2HMQA

The structures of met and azidomet hemerythrin at 1.66 angstroms resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
113
structure length
113
Chain Sequence
GFPIPDPYCWDISFRTFYTIIDDEHKTLFNGILLLSQADNADHLNELRRCTGKHFLNEQQLMQASQYAGYAEHKKAHDDFIHKLDTWDGDVTYAKNWLVNHIKTIDFKYRGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMERYTHRIN
publication title Structures of met and azidomet hemerythrin at 1.66 A resolution.
pubmed doi rcsb
source organism Themiste dyscritum
molecule tags Oxygen transport
total genus 47
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1990-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2hmqA00
4XPYA 2AWCA 1A7EA 1HMOA 1I4ZA 4XPWA 3WAQA 4XQ1A 2AVKA 1I4YA 1HMDA 2MHRA 3WHNA 2AWYA 1A7DA 2HMZA 3AGUA 4XPXA 2HMQA 3AGTA
chains in the Genus database with same CATH superfamily
1T9KA 1OQCA 1JAFA 2EPOA 3OWTA 4BJ5A 1JPJA 1RCPA 2QY9A 4I1OB 3C8GD 2QNLA 3VF0A 1M56C 3PHF2 1M6TA 4AL0A 1T01A 3VRCA 3U3BA 4D4XA 5CI8A 4O6YA 1K05A 5BUOA 1SR2A 1BZ4A 3U0CA 1M2VA 1SYQA 2MYSA 2HUJA 3EHNA 4JKVA 2CW0F 4JTAB 1Q0FA 2CNWD 3SP1A 3X2QC 3HNJA 5B1BC 5DS4A 2YL1A 2IBFA 1NSGB 2AU5A 2D5RB 1LVKA 1QPUA 4PK4A 4U5BE 2TMVP 2P1AA 2QTVA 4LLEA 5L0DA 3WHNA 256BA 2RSEB 1OXBA 3CQZA 3MYIA 1ZU5A 4GEHA 3T9OA 2YKZA 4CS8A 1OCCC 4JJGA 4DXWA 4YN0B 5JVEA 1ZW2A 2A68F 3ZWIA 4AK9A 1DOVA 2CDQA 2DB4A 2XLEA 3JCUQ 4Q7CA 3UMHA 3C63A 3ZQVA 4JJFA 2XS1A 4DJ9A 4U5HA 3DJUB 3GORA 3AG3C 3NMJA 2C03A 2L9JA 4CDAA 4EWCA 3ABLC 1E86A 5D91A 4P9TA 4BJ5C 1ZW3A 3FDQA 2H8AA 4U5CE 1QVXA 3LJBA 1Y4CA 5EHHA 1UG7A 1I5NA 4J7YA 4G7HF 1FR0A 4CDVA 2VC9A 3BEHA 5DVWA 1KTMA 3HKKA 1NG1A 4CX9A 4DBQA 1WGWA 5F28E 3UGOA 4UDVA 2OKUA 1T5OA 1RXQA 4E0HA 3LNMB 4X0RA 2R7VA 2GFHA 1VLSA 1H6GA 4E7SA 4OIPF 1YA7O 2VCBA 3K1HA 5L3VA 1E2XA 4MTOA 5CIVA 3KH2A 3M4BA 3PDMP 4BJ1A 4L6RA 1O87A 5JSLA 3SXYA 3EHMA 4CS8C 3GODA 1QQ3A 3WODF 2J7PA 3LLKA 2D4UA 3JTLO 1YAUO 2XLOA 3GM3A 3L8IA 3ATPA 4PFPA 3US6A 1V55C 2Q00A 3B0UX 4O79A 2XLWA 3LAYA 3SNHA 1CGNA 3IQTA 1V4AA 2Q7RA 5B3SC 5A6KA 1T6QA 2ZXWC 2XRHA 4RD9A 3LS0A 3U2LA 1MMDA 2LQGA 1YYJA 4EBBA 5KYUB 1MMNA 2PX3A 2XL6A 2J7PD 3QVYA 1A0BA 2J9BA 2OU6A 3ZVRA 3H2VA 2P0NA 2Z15A 1IZMA 1YARO 2MHRA 3FOPA 1WOLA 1OCOC 1LE4A 2L6HA 2W4MA 4C7OB 1WTYA 3WG7C 5HSWA 2Y69C 4MVOA 2GWWA 4AX2A 3LLIA 4G7ZF 2J0WA 4N06A 1BDJB 4I1MA 4PJJA 4D4NA 4U5FE 5AC4A 2ZXRA 1J8MF 1OXKA 3OA1A 4N6HA 2EPKX 3ASNC 4XPYA 2R7WA 4XLPF 2A69F 4ANJA 2AP3A 3AJMA 1AVOB 3NYLA 1LI7A 1KU2A 4OINF 2A6HF 5T3TA 2J9WA 4NC3A 4DVYP 4J30B 3UR3C 5L0FA 3MFNA 2YVKA 4NTAA 2AVKA 1R5ID 3CSKA 4OD5A 3Q7GA 2WZGA 3CAXA 1V54C 5COFA 1CPQA 1G4WR 1D0XA 1ZYRF 2R7RA 3TD7A 1NLXA 3LEOA 2KNHA 3ZTMA 5DQTA 1B68A 4WJ0A 3DXJF 3W4YA 3QZCA 5A6AA 2Y39A 2EPLX 2NUPB 4C3BA 2HFIA 1E84A 1NZEA 3SXMA 1MMAA 1VYIA 3G4XA 1PV3A 4MVSA 3UMKA 2G3KA 4CS9A 1A7EA 3Q7LA 2HS5A 4K0DA 4PJMA 1OR3A 4YL1A 1IW7F 1Y6DA 4JCZA 3GWNA 2IM8A 2OEXA 3Q6MA 4IRUA 5L0CA 4G7OF 2R7XA 2L7AA 4GYTA 2IXMA 5JUAA 1LPEA 3U5SA 2C04A 2VCCA 3AG2C 5L0JA 1HW2A 1TWCA 3AOUA 1C02A 3S9OA 3IHUA 1FFHA 4PFOA 3RQEA 1HW1A 2I15A 3FVYA 1FMVA 2NPUA 3K1IA 4H4KC 4PR9A 3NKDA 2R7OA 4JRZA 2Y3HA 4DVZA 1TWAA 4CSAA 3AG4C 2GAQA 4B6IA 2HSQA 5DS6A 2R7UA 3U9MA 4QI2A 3X1OA 2G62A 2PBEA 4XEVA 4CDYA 2OJQA 3CZ6A 1Z6AA 4FAPB 4RBNA 4Q5SF 3M15A 1OR2A 2IOQA 2Q4FA 4M63A 4J32B 4YJWA 2UUIA 1DOWA 5B1AC 1HMOA 1EKYA 2R03A 2YZSA 4DRHB 2JX0A 2KK1A 3EH2A 1D0YA 4NQFA 4XPWA 5KYUA 4CS9C 1R4TA 1OKKD 1F1MA 4G78A 4KC9A 1LKXA 1BR2A 4JTCB 3ZC4A 1AEPA 3CEXA 3B9QA 1GS9A 3C62A 2ICWG 3B0PA 1KNYA 2IYLD 4H54A 3TULA 4C7OA 4HFFB 3UGPA 3LEVA 1U6HA 4JIOA 3K1IC 4XWJA 1OCRC 1CGME 2HJMA 1ZHWA 4AE4B 2V3CC 4CSAC 2R7QA 1JMWA 2WVNA 5A6BA 2A1DD 2YLIA 3E70C 4MW8A 4CIHA 3DI5A 1D1CA 3O6XA 4W8KA 3U2MA 3UMIA 4DBRA 3EJNA 3LS1A 1YZCA 3S27A 2XLMA 3DKAA 3RVYA 2VH3A 1LS1A 4I3MA 2KW3C 4GQHA 1VK5A 4IAQA 4AL1A 2MWQA 5BQHA 4XQ1A 2R7TA 3LUTB 2Y3GA 4MTGA 2CCYA 2V26A 3KYIA 1EQ1A 4BPMA 3DM9B 4E18A 4MQ9F 1JPNA 1XZPA 3NYMA 2LK4A 3DD7A 3QTHA 3TOMA 4JEBA 3N0TA 4BJTA 1A7DA 1TFOB 2J9VA 1YVIA 1T6IA 2WB7A 2YQYA 2EPMX 3DWWA 3HNLA 3JSZA 3JYYA 3KPHA 2XM0A 4E0IA 3EGXB 3GEEA 3T6JA 3AG1C 1UFBA 3FXHA 2R05A 3DAFA 4XLNF 5COGA 2FFHA 1H9GA 2NUPA 4JEAA 2I8BA 4IB4A 3PCVA 3I5QA 3PMRA 4U5GA 3RFYA 3GANA 3ZIBA 2Q3TA 4EHPA 3U8PA 1GM5A 5HV9A 2CGEA 4YT4A 2JPUA 4NY3A 1G8XA 1CPRA 3M79A 3GWLA 2YL7A 1JR8A 3C8ZA 5FZTA 2YLDA 1I4YA 3DJNB 4CBEA 3L34A 1VB5A 2P61A 3FAPB 4LLCA 1V74B 1Z5ZA 1QZXA 3O10A 4BG0A 5DLJA 3MX3A 4A4AA 1LM3B 4FESA 3L0IA 1HE1A 3B71A 2X51A 1WASA 1ORSC 3N24A 2EPNA 4LDRA 4C3DA 2YEVA 2XLDA 2ZXPA 1ZVZA 3DMDA 5F5FA 1S7ZA 2H7VC 3M1CB 1NU7D 3R7CA 2LP4A 4YWQA 3H2UA 4HFKB 2EIMC 2IXPA 4CS7A 1TQGA 1OW7A 2L6FA 1NFNA 3EG9A 3FHDA 2JD3A 4EIYA 3G50A 4FWVA 1FFTC 3HNKA 5EGYA 2NUTB 2PFDA 2XM4A 3BRJA 2KJGA 3F46A 1MNEA 2LIGA 1WWPA 1HY5A 1PD0A 2L6GA 3ZSUA 4EBJA 4ULVA 2GA0A 1ST6A 3R2PA 2XSEA 3NMKA 2E87A 2DGJA 4N4WA 3RYLA 1FAPB 4E17A 3B0VC 5KYNA 3KL4A 3ECSA 4JTDB 1WN0A 2VCAA 3S29A 3U8VA 5DQZA 4NTFA 2WL8A 2FGYA 2RD9A 3KKBA 2XLVA 2LFFA 2J45A 1VOMA 4XEKA 4AE4A 1FTSA 2KYHA 2ETSA 1BR4A 3EGDB 5B3IA 3JYHA 4MS2A 2OQMA 1NU9C 3EFOB 1K04A 4WGZA 3GM1A 3IEEA 3ZDLA 2BC5A 2DI3A 1MMGA 2WZLA 2QLAA 4YT5A 3IQCA 3W2VA 1Z63A 4OIOF 3EPVA 4FX5A 4BEMJ 2NSFA 2HJ3A 3ZTZA 2HZ8A 2XXAA 4JVSA 2GDCA 2VASA 4JE9A 5JLIA 2B0HA 2YWAA 4ER9A 4MVRA 3VM6A 2HSBA 4K7BA 4MVQA 1Z23A 3B29A 1CGOA 3POVA 2J8WA 1H7IA 2YRFA 1Z3IX 4HE8D 3O55A 3DZAA 4K1OA 4MVUA 4MVMA 4BJ6C 4CJGA 4CIPA 5KYYB 3EQLF 3FOOA 1C17M 3GEHA 2PNOA 4MNDA 1K40A 2KGOA 2M4EA 1APCA 4PJLA 3V5ZA 3AGUA 1OW8A 2G3VA 3EGXA 5A6JA 4KI2A 2ASRA 1VYKA 4I44A 2OG2A 3KYJA 5JS5A 2X0CA 4CJOA 1MQVA 4YT2A 3GM2A 2O9XA 3SXZA 3V7OA 3IQ5A 2A0BA 1NBBA 1BBHA 3T6GB 1LI5A 4DRJB 1JOGA 3EG9B 5BQIA 2KSFA 4IARA 1M2OA 3RQFA 1FNTc 4JCHA 1G5ZA 1O5HA 5E3AA 2QUPA 2BE5F 4O6MA 1Q0MA 3TOLA 1QLEC 4MW3A 4ZLCA 4YK5A 4N6CA 1GQAA 4EKWA 4OIQF 1O3UA 1BR1A 2PF4E 3RKOF 3NKEA 4WGYA 2A0UA 2EILC 1AUEA 1PD1A 4E7ZA 2EIJC 1RKCA 3ASOC 1ZU4A 1RJ9B 2BL2A 2CNWA 2HMQA 1VTMP 4RDAA 2HV7A 1M57C 1NFOA 3IPMO 2J46A 4R32A 5L3QA 4U9EA 1TR2A 2AWCA 3JRMO 4JZAA 4G0HA 2WZFA 3O39A 2OCCC 3T6BA 3DE8A 3A11A 3H65A 1ZHXA 3L1MA 2Q9BA 3A9CA 3N2ZB 4NTBA 1TKNA 2NUTA 5L0IA 3TJ5A 3J06A 3SZRA 3QMKA 4EUKB 3K66A 2M64A 2YLGA 5AGFA 1W2WA 5E2QA 3VAYA 2XXAB 1L3PA 2Q9AA 3NG1A 3NYJA 3S84A 5DS5A 3EZIA 4KNVA 3RW0A 5A6BD 3RIPA 4DOZA 1ORYA 2UUHA 3DE9A 1JRAA 1FMWA 5BQGA 1H9TA 2P6VA 2AWYA 4WABA 3S28A 3EH1A 3SEOA 2W4BA 3EGDA 3ZG1A 5KYWB 4O6NA 4Z9JA 3U9JA 3JRTA 3EFOA 3DM5A 2NSGA 2WVQA 3K33A 5JRAA 3E9VA 2PX0A 3IQ6A 1EA8A 2QE9A 3LNRA 3ITFA 1ZHTA 1YLMA 2A6EF 2ZXOA 1Q0GA 2XL8A 1Q0DA 3HTKC 1ORJA 2ZPAA 5EK0A 1Z7Qc 3QW0A 1VLTA 1RKEA 3K6BA 4HEAJ 3UNGC 1N1CA 3NDBB 4PJNA 4C3EA 3C18A 1TWHA 3C7JA 1TWGA 3VYWA 5KYXA 1G4US 2IXNA 5KYYA 3C8GB 1U89A 4F4BA 1ZZPA 1D0ZA 2LFDA 2VB6A 4A2NB 3TJ6A 1MNDA 3JZ0A 4JC7A 4KBLA 4QI0A 1RMVA 4XPXA 2YHSA 1D1AA 1YYXA 2YL0A 3SYNA 3W8IA 4NCQA 2KQ9A 1XZQA 1PCXA 3MYFA 3QW1A 3W2WA 3TQOA 3W8HA 2B0JA 5F5HA 4J7TA 2EIKC 2HV6A 4O7GA 5IY5C 2W9YA 3RF3A 4DRIB 4ULWA 1I4ZA 1S05A 4U5DE 2HKVA 3ABKC 1E83A 2XS8A 2YL3A 3JSEO 1E85A 1M2VB 1OW6A 2P7VA 4OIRF 2FAPB 4BJ6A 3M4CA 4QDLA 3V5XA 1HMDA 1L7CA 4XEFA 4YL3A 2R25A 1GGQA 3DAGA 4KNWA 4LERA 2DYRC 4ONSA 1YDIA 4LDKA 1HE9A 1WATA 3JT1A 4JURI 3RH3A 3U3FA 5FCLA 2H7OA 1YZAA 3Q6NA 4BEJA 1LIHA 2LCHA 1RJ9A 2Q9CA 4YT8A 2R9RB 3S90A 4W8PA 1XWJA 5TJ5E 2W45A 4IAOA 1ZHZA 3K7DA 2OOCA 1QKRA 5L0HA 3I4UA 3RVZA 4YL0A 5L0GA 3RQGA 3NMIA 2IXOA 5D92A 4IGGA 1D1BA 4IJJA 4Z9HA 3HNIA 4Z9IA 3V5YA 4EBKA 4MVZA 5JP7A 5JT4A 1U0BB 3G4ZA 4JW1A 4P6IC 4OD4A 3WAQA 1EI7A 1RKEB 2EINC 1LE2A 3L8JA 2H7BA 4IWBA 4XTKA 1C03A 2WVOA 5COMA 1T6UA 4P9FA 2ZD9A 3ABMC 2XL4A 1QSPA 1YJGA 5KYXB 3NRHA 3I5PA 2L81A 2KC3A 5K0IA 1ZHYA 1LS4A 2J9UA 2HMZA 3T4RA 1J8YF 2Y3BA 5KYWA 2XLHA 2LD6A 3EZHA 2R02A 4U5EE 5E33A 3ZQYA 3LESA 3AGTA 3AQCA 2DYSC 5GPGB 2F22A 1SZIA 4LDQA 5T3WA 1A7VA 5T1DB 3TK0A 2PP4A 2CYDA 3QVZA 4MTFA 4Q4ZF 3FMSA 3SXKA 2LSEA 3AQBA 1SF8A 1A41A 2J0XA 3OEOA 2NG1A 3FAJA 5CI9A 3GEIA 1Q0KA 3HLZA 3MBGA 3MLGA 1OCZC 2Y3DA 3C8GA 3F47A 2OEVA 1VMAA 2R7SA 4ZLDA 3HJCA 4U9DA 1TFKB 1YA9A 2OJED 5AC5A 1SMYF 5A69A 4LACB 1OKKA 3KMIA 5E3CA 3S0XA 4PACA
chains in the Genus database with same CATH topology
4XPYA 2AWCA 1A7EA 1HMOA 1I4ZA 4XPWA 3WAQA 4XQ1A 2AVKA 1I4YA 1HMDA 2MHRA 3WHNA 2AWYA 1A7DA 2HMZA 3AGUA 4XPXA 2HMQA 3AGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPY A;  2AWC A;  1A7E A;  1HMO A;  1I4Z A;  4XPW A;  3WAQ A;  4XQ1 A;  2AVK A;  1I4Y A;  1HMD A;  2MHR A;  3WHN A;  2AWY A;  1A7D A;  2HMZ A;  3AGU A;  4XPX A;  2HMQ A;  3AGT A; 
#chains in the Genus database with same CATH topology
 1T9K A;  1OQC A;  1JAF A;  2EPO A;  3OWT A;  4BJ5 A;  1JPJ A;  1RCP A;  2QY9 A;  4I1O B;  3C8G D;  2QNL A;  3VF0 A;  1M56 C;  3PHF 2;  1M6T A;  4AL0 A;  1T01 A;  3VRC A;  3U3B A;  4D4X A;  5CI8 A;  4O6Y A;  1K05 A;  5BUO A;  1SR2 A;  1BZ4 A;  3U0C A;  1M2V A;  1SYQ A;  2MYS A;  2HUJ A;  3EHN A;  4JKV A;  2CW0 F;  4JTA B;  1Q0F A;  2CNW D;  3SP1 A;  3X2Q C;  3HNJ A;  5B1B C;  5DS4 A;  2YL1 A;  2IBF A;  1NSG B;  2AU5 A;  2D5R B;  1LVK A;  1QPU A;  4PK4 A;  4U5B E;  2TMV P;  2P1A A;  2QTV A;  4LLE A;  5L0D A;  3WHN A;  256B A;  2RSE B;  1OXB A;  3CQZ A;  3MYI A;  1ZU5 A;  4GEH A;  3T9O A;  2YKZ A;  4CS8 A;  1OCC C;  4JJG A;  4DXW A;  4YN0 B;  5JVE A;  1ZW2 A;  2A68 F;  3ZWI A;  4AK9 A;  1DOV A;  2CDQ A;  2DB4 A;  2XLE A;  3JCU Q;  4Q7C A;  3UMH A;  3C63 A;  3ZQV A;  4JJF A;  2XS1 A;  4DJ9 A;  4U5H A;  3DJU B;  3GOR A;  3AG3 C;  3NMJ A;  2C03 A;  2L9J A;  4CDA A;  4EWC A;  3ABL C;  1E86 A;  5D91 A;  4P9T A;  4BJ5 C;  1ZW3 A;  3FDQ A;  2H8A A;  4U5C E;  1QVX A;  3LJB A;  1Y4C A;  5EHH A;  1UG7 A;  1I5N A;  4J7Y A;  4G7H F;  1FR0 A;  4CDV A;  2VC9 A;  3BEH A;  5DVW A;  1KTM A;  3HKK A;  1NG1 A;  4CX9 A;  4DBQ A;  1WGW A;  5F28 E;  3UGO A;  4UDV A;  2OKU A;  1T5O A;  1RXQ A;  4E0H A;  3LNM B;  4X0R A;  2R7V A;  2GFH A;  1VLS A;  1H6G A;  4E7S A;  4OIP F;  1YA7 O;  2VCB A;  3K1H A;  5L3V A;  1E2X A;  4MTO A;  5CIV A;  3KH2 A;  3M4B A;  3PDM P;  4BJ1 A;  4L6R A;  1O87 A;  5JSL A;  3SXY A;  3EHM A;  4CS8 C;  3GOD A;  1QQ3 A;  3WOD F;  2J7P A;  3LLK A;  2D4U A;  3JTL O;  1YAU O;  2XLO A;  3GM3 A;  3L8I A;  3ATP A;  4PFP A;  3US6 A;  1V55 C;  2Q00 A;  3B0U X;  4O79 A;  2XLW A;  3LAY A;  3SNH A;  1CGN A;  3IQT A;  1V4A A;  2Q7R A;  5B3S C;  5A6K A;  1T6Q A;  2ZXW C;  2XRH A;  4RD9 A;  3LS0 A;  3U2L A;  1MMD A;  2LQG A;  1YYJ A;  4EBB A;  5KYU B;  1MMN A;  2PX3 A;  2XL6 A;  2J7P D;  3QVY A;  1A0B A;  2J9B A;  2OU6 A;  3ZVR A;  3H2V A;  2P0N A;  2Z15 A;  1IZM A;  1YAR O;  2MHR A;  3FOP A;  1WOL A;  1OCO C;  1LE4 A;  2L6H A;  2W4M A;  4C7O B;  1WTY A;  3WG7 C;  5HSW A;  2Y69 C;  4MVO A;  2GWW A;  4AX2 A;  3LLI A;  4G7Z F;  2J0W A;  4N06 A;  1BDJ B;  4I1M A;  4PJJ A;  4D4N A;  4U5F E;  5AC4 A;  2ZXR A;  1J8M F;  1OXK A;  3OA1 A;  4N6H A;  2EPK X;  3ASN C;  4XPY A;  2R7W A;  4XLP F;  2A69 F;  4ANJ A;  2AP3 A;  3AJM A;  1AVO B;  3NYL A;  1LI7 A;  1KU2 A;  4OIN F;  2A6H F;  5T3T A;  2J9W A;  4NC3 A;  4DVY P;  4J30 B;  3UR3 C;  5L0F A;  3MFN A;  2YVK A;  4NTA A;  2AVK A;  1R5I D;  3CSK A;  4OD5 A;  3Q7G A;  2WZG A;  3CAX A;  1V54 C;  5COF A;  1CPQ A;  1G4W R;  1D0X A;  1ZYR F;  2R7R A;  3TD7 A;  1NLX A;  3LEO A;  2KNH A;  3ZTM A;  5DQT A;  1B68 A;  4WJ0 A;  3DXJ F;  3W4Y A;  3QZC A;  5A6A A;  2Y39 A;  2EPL X;  2NUP B;  4C3B A;  2HFI A;  1E84 A;  1NZE A;  3SXM A;  1MMA A;  1VYI A;  3G4X A;  1PV3 A;  4MVS A;  3UMK A;  2G3K A;  4CS9 A;  1A7E A;  3Q7L A;  2HS5 A;  4K0D A;  4PJM A;  1OR3 A;  4YL1 A;  1IW7 F;  1Y6D A;  4JCZ A;  3GWN A;  2IM8 A;  2OEX A;  3Q6M A;  4IRU A;  5L0C A;  4G7O F;  2R7X A;  2L7A A;  4GYT A;  2IXM A;  5JUA A;  1LPE A;  3U5S A;  2C04 A;  2VCC A;  3AG2 C;  5L0J A;  1HW2 A;  1TWC A;  3AOU A;  1C02 A;  3S9O A;  3IHU A;  1FFH A;  4PFO A;  3RQE A;  1HW1 A;  2I15 A;  3FVY A;  1FMV A;  2NPU A;  3K1I A;  4H4K C;  4PR9 A;  3NKD A;  2R7O A;  4JRZ A;  2Y3H A;  4DVZ A;  1TWA A;  4CSA A;  3AG4 C;  2GAQ A;  4B6I A;  2HSQ A;  5DS6 A;  2R7U A;  3U9M A;  4QI2 A;  3X1O A;  2G62 A;  2PBE A;  4XEV A;  4CDY A;  2OJQ A;  3CZ6 A;  1Z6A A;  4FAP B;  4RBN A;  4Q5S F;  3M15 A;  1OR2 A;  2IOQ A;  2Q4F A;  4M63 A;  4J32 B;  4YJW A;  2UUI A;  1DOW A;  5B1A C;  1HMO A;  1EKY A;  2R03 A;  2YZS A;  4DRH B;  2JX0 A;  2KK1 A;  3EH2 A;  1D0Y A;  4NQF A;  4XPW A;  5KYU A;  4CS9 C;  1R4T A;  1OKK D;  1F1M A;  4G78 A;  4KC9 A;  1LKX A;  1BR2 A;  4JTC B;  3ZC4 A;  1AEP A;  3CEX A;  3B9Q A;  1GS9 A;  3C62 A;  2ICW G;  3B0P A;  1KNY A;  2IYL D;  4H54 A;  3TUL A;  4C7O A;  4HFF B;  3UGP A;  3LEV A;  1U6H A;  4JIO A;  3K1I C;  4XWJ A;  1OCR C;  1CGM E;  2HJM A;  1ZHW A;  4AE4 B;  2V3C C;  4CSA C;  2R7Q A;  1JMW A;  2WVN A;  5A6B A;  2A1D D;  2YLI A;  3E70 C;  4MW8 A;  4CIH A;  3DI5 A;  1D1C A;  3O6X A;  4W8K A;  3U2M A;  3UMI A;  4DBR A;  3EJN A;  3LS1 A;  1YZC A;  3S27 A;  2XLM A;  3DKA A;  3RVY A;  2VH3 A;  1LS1 A;  4I3M A;  2KW3 C;  4GQH A;  1VK5 A;  4IAQ A;  4AL1 A;  2MWQ A;  5BQH A;  4XQ1 A;  2R7T A;  3LUT B;  2Y3G A;  4MTG A;  2CCY A;  2V26 A;  3KYI A;  1EQ1 A;  4BPM A;  3DM9 B;  4E18 A;  4MQ9 F;  1JPN A;  1XZP A;  3NYM A;  2LK4 A;  3DD7 A;  3QTH A;  3TOM A;  4JEB A;  3N0T A;  4BJT A;  1A7D A;  1TFO B;  2J9V A;  1YVI A;  1T6I A;  2WB7 A;  2YQY A;  2EPM X;  3DWW A;  3HNL A;  3JSZ A;  3JYY A;  3KPH A;  2XM0 A;  4E0I A;  3EGX B;  3GEE A;  3T6J A;  3AG1 C;  1UFB A;  3FXH A;  2R05 A;  3DAF A;  4XLN F;  5COG A;  2FFH A;  1H9G A;  2NUP A;  4JEA A;  2I8B A;  4IB4 A;  3PCV A;  3I5Q A;  3PMR A;  4U5G A;  3RFY A;  3GAN A;  3ZIB A;  2Q3T A;  4EHP A;  3U8P A;  1GM5 A;  5HV9 A;  2CGE A;  4YT4 A;  2JPU A;  4NY3 A;  1G8X A;  1CPR A;  3M79 A;  3GWL A;  2YL7 A;  1JR8 A;  3C8Z A;  5FZT A;  2YLD A;  1I4Y A;  3DJN B;  4CBE A;  3L34 A;  1VB5 A;  2P61 A;  3FAP B;  4LLC A;  1V74 B;  1Z5Z A;  1QZX A;  3O10 A;  4BG0 A;  5DLJ A;  3MX3 A;  4A4A A;  1LM3 B;  4FES A;  3L0I A;  1HE1 A;  3B71 A;  2X51 A;  1WAS A;  1ORS C;  3N24 A;  2EPN A;  4LDR A;  4C3D A;  2YEV A;  2XLD A;  2ZXP A;  1ZVZ A;  3DMD A;  5F5F A;  1S7Z A;  2H7V C;  3M1C B;  1NU7 D;  3R7C A;  2LP4 A;  4YWQ A;  3H2U A;  4HFK B;  2EIM C;  2IXP A;  4CS7 A;  1TQG A;  1OW7 A;  2L6F A;  1NFN A;  3EG9 A;  3FHD A;  2JD3 A;  4EIY A;  3G50 A;  4FWV A;  1FFT C;  3HNK A;  5EGY A;  2NUT B;  2PFD A;  2XM4 A;  3BRJ A;  2KJG A;  3F46 A;  1MNE A;  2LIG A;  1WWP A;  1HY5 A;  1PD0 A;  2L6G A;  3ZSU A;  4EBJ A;  4ULV A;  2GA0 A;  1ST6 A;  3R2P A;  2XSE A;  3NMK A;  2E87 A;  2DGJ A;  4N4W A;  3RYL A;  1FAP B;  4E17 A;  3B0V C;  5KYN A;  3KL4 A;  3ECS A;  4JTD B;  1WN0 A;  2VCA A;  3S29 A;  3U8V A;  5DQZ A;  4NTF A;  2WL8 A;  2FGY A;  2RD9 A;  3KKB A;  2XLV A;  2LFF A;  2J45 A;  1VOM A;  4XEK A;  4AE4 A;  1FTS A;  2KYH A;  2ETS A;  1BR4 A;  3EGD B;  5B3I A;  3JYH A;  4MS2 A;  2OQM A;  1NU9 C;  3EFO B;  1K04 A;  4WGZ A;  3GM1 A;  3IEE A;  3ZDL A;  2BC5 A;  2DI3 A;  1MMG A;  2WZL A;  2QLA A;  4YT5 A;  3IQC A;  3W2V A;  1Z63 A;  4OIO F;  3EPV A;  4FX5 A;  4BEM J;  2NSF A;  2HJ3 A;  3ZTZ A;  2HZ8 A;  2XXA A;  4JVS A;  2GDC A;  2VAS A;  4JE9 A;  5JLI A;  2B0H A;  2YWA A;  4ER9 A;  4MVR A;  3VM6 A;  2HSB A;  4K7B A;  4MVQ A;  1Z23 A;  3B29 A;  1CGO A;  3POV A;  2J8W A;  1H7I A;  2YRF A;  1Z3I X;  4HE8 D;  3O55 A;  3DZA A;  4K1O A;  4MVU A;  4MVM A;  4BJ6 C;  4CJG A;  4CIP A;  5KYY B;  3EQL F;  3FOO A;  1C17 M;  3GEH A;  2PNO A;  4MND A;  1K40 A;  2KGO A;  2M4E A;  1APC A;  4PJL A;  3V5Z A;  3AGU A;  1OW8 A;  2G3V A;  3EGX A;  5A6J A;  4KI2 A;  2ASR A;  1VYK A;  4I44 A;  2OG2 A;  3KYJ A;  5JS5 A;  2X0C A;  4CJO A;  1MQV A;  4YT2 A;  3GM2 A;  2O9X A;  3SXZ A;  3V7O A;  3IQ5 A;  2A0B A;  1NBB A;  1BBH A;  3T6G B;  1LI5 A;  4DRJ B;  1JOG A;  3EG9 B;  5BQI A;  2KSF A;  4IAR A;  1M2O A;  3RQF A;  1FNT c;  4JCH A;  1G5Z A;  1O5H A;  5E3A A;  2QUP A;  2BE5 F;  4O6M A;  1Q0M A;  3TOL A;  1QLE C;  4MW3 A;  4ZLC A;  4YK5 A;  4N6C A;  1GQA A;  4EKW A;  4OIQ F;  1O3U A;  1BR1 A;  2PF4 E;  3RKO F;  3NKE A;  4WGY A;  2A0U A;  2EIL C;  1AUE A;  1PD1 A;  4E7Z A;  2EIJ C;  1RKC A;  3ASO C;  1ZU4 A;  1RJ9 B;  2BL2 A;  2CNW A;  2HMQ A;  1VTM P;  4RDA A;  2HV7 A;  1M57 C;  1NFO A;  3IPM O;  2J46 A;  4R32 A;  5L3Q A;  4U9E A;  1TR2 A;  2AWC A;  3JRM O;  4JZA A;  4G0H A;  2WZF A;  3O39 A;  2OCC C;  3T6B A;  3DE8 A;  3A11 A;  3H65 A;  1ZHX A;  3L1M A;  2Q9B A;  3A9C A;  3N2Z B;  4NTB A;  1TKN A;  2NUT A;  5L0I A;  3TJ5 A;  3J06 A;  3SZR A;  3QMK A;  4EUK B;  3K66 A;  2M64 A;  2YLG A;  5AGF A;  1W2W A;  5E2Q A;  3VAY A;  2XXA B;  1L3P A;  2Q9A A;  3NG1 A;  3NYJ A;  3S84 A;  5DS5 A;  3EZI A;  4KNV A;  3RW0 A;  5A6B D;  3RIP A;  4DOZ A;  1ORY A;  2UUH A;  3DE9 A;  1JRA A;  1FMW A;  5BQG A;  1H9T A;  2P6V A;  2AWY A;  4WAB A;  3S28 A;  3EH1 A;  3SEO A;  2W4B A;  3EGD A;  3ZG1 A;  5KYW B;  4O6N A;  4Z9J A;  3U9J A;  3JRT A;  3EFO A;  3DM5 A;  2NSG A;  2WVQ A;  3K33 A;  5JRA A;  3E9V A;  2PX0 A;  3IQ6 A;  1EA8 A;  2QE9 A;  3LNR A;  3ITF A;  1ZHT A;  1YLM A;  2A6E F;  2ZXO A;  1Q0G A;  2XL8 A;  1Q0D A;  3HTK C;  1ORJ A;  2ZPA A;  5EK0 A;  1Z7Q c;  3QW0 A;  1VLT A;  1RKE A;  3K6B A;  4HEA J;  3UNG C;  1N1C A;  3NDB B;  4PJN A;  4C3E A;  3C18 A;  1TWH A;  3C7J A;  1TWG A;  3VYW A;  5KYX A;  1G4U S;  2IXN A;  5KYY A;  3C8G B;  1U89 A;  4F4B A;  1ZZP A;  1D0Z A;  2LFD A;  2VB6 A;  4A2N B;  3TJ6 A;  1MND A;  3JZ0 A;  4JC7 A;  4KBL A;  4QI0 A;  1RMV A;  4XPX A;  2YHS A;  1D1A A;  1YYX A;  2YL0 A;  3SYN A;  3W8I A;  4NCQ A;  2KQ9 A;  1XZQ A;  1PCX A;  3MYF A;  3QW1 A;  3W2W A;  3TQO A;  3W8H A;  2B0J A;  5F5H A;  4J7T A;  2EIK C;  2HV6 A;  4O7G A;  5IY5 C;  2W9Y A;  3RF3 A;  4DRI B;  4ULW A;  1I4Z A;  1S05 A;  4U5D E;  2HKV A;  3ABK C;  1E83 A;  2XS8 A;  2YL3 A;  3JSE O;  1E85 A;  1M2V B;  1OW6 A;  2P7V A;  4OIR F;  2FAP B;  4BJ6 A;  3M4C A;  4QDL A;  3V5X A;  1HMD A;  1L7C A;  4XEF A;  4YL3 A;  2R25 A;  1GGQ A;  3DAG A;  4KNW A;  4LER A;  2DYR C;  4ONS A;  1YDI A;  4LDK A;  1HE9 A;  1WAT A;  3JT1 A;  4JUR I;  3RH3 A;  3U3F A;  5FCL A;  2H7O A;  1YZA A;  3Q6N A;  4BEJ A;  1LIH A;  2LCH A;  1RJ9 A;  2Q9C A;  4YT8 A;  2R9R B;  3S90 A;  4W8P A;  1XWJ A;  5TJ5 E;  2W45 A;  4IAO A;  1ZHZ A;  3K7D A;  2OOC A;  1QKR A;  5L0H A;  3I4U A;  3RVZ A;  4YL0 A;  5L0G A;  3RQG A;  3NMI A;  2IXO A;  5D92 A;  4IGG A;  1D1B A;  4IJJ A;  4Z9H A;  3HNI A;  4Z9I A;  3V5Y A;  4EBK A;  4MVZ A;  5JP7 A;  5JT4 A;  1U0B B;  3G4Z A;  4JW1 A;  4P6I C;  4OD4 A;  3WAQ A;  1EI7 A;  1RKE B;  2EIN C;  1LE2 A;  3L8J A;  2H7B A;  4IWB A;  4XTK A;  1C03 A;  2WVO A;  5COM A;  1T6U A;  4P9F A;  2ZD9 A;  3ABM C;  2XL4 A;  1QSP A;  1YJG A;  5KYX B;  3NRH A;  3I5P A;  2L81 A;  2KC3 A;  5K0I A;  1ZHY A;  1LS4 A;  2J9U A;  2HMZ A;  3T4R A;  1J8Y F;  2Y3B A;  5KYW A;  2XLH A;  2LD6 A;  3EZH A;  2R02 A;  4U5E E;  5E33 A;  3ZQY A;  3LES A;  3AGT A;  3AQC A;  2DYS C;  5GPG B;  2F22 A;  1SZI A;  4LDQ A;  5T3W A;  1A7V A;  5T1D B;  3TK0 A;  2PP4 A;  2CYD A;  3QVZ A;  4MTF A;  4Q4Z F;  3FMS A;  3SXK A;  2LSE A;  3AQB A;  1SF8 A;  1A41 A;  2J0X A;  3OEO A;  2NG1 A;  3FAJ A;  5CI9 A;  3GEI A;  1Q0K A;  3HLZ A;  3MBG A;  3MLG A;  1OCZ C;  2Y3D A;  3C8G A;  3F47 A;  2OEV A;  1VMA A;  2R7S A;  4ZLD A;  3HJC A;  4U9D A;  1TFK B;  1YA9 A;  2OJE D;  5AC5 A;  1SMY F;  5A69 A;  4LAC B;  1OKK A;  3KMI A;  5E3C A;  3S0X A;  4PAC A; 
#chains in the Genus database with same CATH homology
 4XPY A;  2AWC A;  1A7E A;  1HMO A;  1I4Z A;  4XPW A;  3WAQ A;  4XQ1 A;  2AVK A;  1I4Y A;  1HMD A;  2MHR A;  3WHN A;  2AWY A;  1A7D A;  2HMZ A;  3AGU A;  4XPX A;  2HMQ A;  3AGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...