2HMQA

The structures of met and azidomet hemerythrin at 1.66 angstroms resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
113
structure length
113
Chain Sequence
b'GFPIPDPYCWDISFRTFYTIIDDEHKTLFNGILLLSQADNADHLNELRRCTGKHFLNEQQLMQASQYAGYAEHKKAHDDFIHKLDTWDGDVTYAKNWLVNHIKTIDFKYRGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMERYTHRIN
publication title Structures of met and azidomet hemerythrin at 1.66 A resolution.
pubmed doi rcsb
source organism Themiste dyscritum
molecule tags Oxygen transport
total genus 47
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1990-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2hmqA00
2AWCA 4XQ1A 3AGTA 3AGUA 1A7DA 1I4ZA 1A7EA 4XPWA 2AVKA 2HMQA 1I4YA 3WAQA 1HMDA 3WHNA 4XPXA 1HMOA 2HMZA 4XPYA 2MHRA 2AWYA
chains in the Genus database with same CATH superfamily
1G4US 4MW8A 4C3BA 1D0YA 1H6GA 3AQCA 2EIMC 3HKKA 1ST6A 3O6XA 3FHDA 4JCHA 4NTBA 4AE4A 4PK4A 2ZPAA 3GM3A 3RW0A 1MMAA 5KYWA 4BJ5C 3I4UA 2Y3HA 3S27A 5E33A 2OJED 5EK0A 1TWHA 2H7BA 3KKBA 4B6IA 5KYNA 4DJ9A 3Q7LA 2L6FA 1KTMA 2C04A 2J9BA 4CS8A 4LLCA 4EHPA 1QZXA 4IARA 1H9TA 1HY5A 4HE8D 2Y3BA 2ZXPA 2XXAA 4N4WA 3LEOA 1BR1A 1HW2A 1RKEA 2IXPA 2LD6A 4KI2A 4QI0A 5KYYB 1NBBA 2VCAA 1VLTA 2IM8A 5BQGA 2YQYA 2XL4A 4I3MA 4CJOA 2MHRA 3C8GA 3IQTA 3SXKA 2EINC 1Z63A 4OIRF 1D1BA 1OR2A 2B0JA 4N6CA 4PJMA 3N0TA 1A7EA 2YRFA 1RKEB 3AJMA 5B3IA 5DS6A 2YL7A 4CX9A 2P7VA 1OCOC 3EH2A 1J8MF 3TJ6A 2KNHA 3LS0A 4YT5A 3VRCA 4CS9C 2M4EA 4KC9A 1PD1A 3RKOF 3S9OA 1MMGA 3RQEA 3S84A 2Q7RA 5E2QA 3KH2A 4EBKA 3W4YA 2WZFA 3J06A 1PV3A 1APCA 4LERA 2HKVA 1OKKD 3L0IA 1OXBA 3N2ZB 1GM5A 1LIHA 2NPUA 3VAYA 1T01A 2HMZA 3PMRA 4E0IA 3O55A 5JVEA 1NZEA 4JE9A 2HV6A 2W4MA 4U5GA 2DI3A 3GEEA 4Q4ZF 1ZW3A 2PF4E 2Y3GA 2VC9A 3NKDA 3L8JA 4Z9JA 1A7DA 1DOWA 3TQOA 3K66A 2OJQA 3IEEA 3U2LA 3QZCA 2HZ8A 3QVYA 5A6AA 1CGME 1L3PA 2B0HA 1EI7A 3I5QA 4CS8C 3JT1A 3UNGC 2I15A 1JR8A 2YLIA 5B1BC 2XS1A 3C63A 4JKVA 2YWAA 2EPLX 3EG9A 1T6UA 2KC3A 3ZVRA 2WB7A 3M1CB 2A0UA 2L6GA 1FFHA 1QPUA 2XSEA 3K1IA 3LNRA 4P9FA 3RH3A 1Y4CA 3ZTZA 3PDMP 3E70C 3VM6A 5BQHA 3B0PA 4XPYA 3TOMA 3QMKA 3EH1A 3TULA 1TKNA 3EGXA 4LLEA 1A7VA 2J7PA 4EBBA 5A6JA 4WJ0A 4YJWA 3ZIBA 4BPMA 5B3SC 4OD5A 4BEMJ 3EQLF 1TFKB 2GAQA 2IXOA 4UDVA 2R7XA 3UR3C 2CNWD 5KYXB 4MW3A 3V7OA 1ZHYA 1R5ID 3OWTA 1WOLA 3GEIA 3EGXB 3LAYA 2FAPB 2W45A 1Z6AA 4DXWA 1MQVA 1M2VA 2LK4A 2OKUA 4ULVA 1UG7A 3DKAA 2ZXOA 3L34A 3NMJA 3RVYA 4XEKA 4DBRA 1YA9A 3JZ0A 5AC4A 5JRAA 1YA7O 2NUTA 3LLIA 3RQGA 4PJNA 4DBQA 5L3QA 3M4CA 5JP7A 2R7OA 2DYRC 2Z15A 4BJ1A 5F5FA 4ZLDA 1I5NA 3LUTB 4LDRA 3H2UA 1C03A 4NQFA 2J45A 3AGUA 4DRHB 2DB4A 3DXJF 2VCBA 2EPOA 3K7DA 2L9JA 2WL8A 4FESA 3CQZA 3W8HA 4MVRA 2XM0A 2NUTB 1JPJA 1NFNA 2R02A 1DOVA 3EZHA 1Q0FA 3NG1A 5CIVA 1E85A 2QE9A 4YL0A 5DS5A 2HSQA 1HW1A 2DYSC 4N6HA 3HNKA 3ZQYA 3C8GD 3ASOC 3Q6NA 4LDQA 5FCLA 1EKYA 4WGYA 4CS9A 2Y69C 4BG0A 1D1CA 1AUEA 2Q9CA 2XLMA 2XL6A 4OD4A 2YEVA 1NU9C 3B29A 4N06A 3SXZA 3U0CA 1LS4A 2MWQA 3G4ZA 4PFOA 3UMKA 2J8WA 3KL4A 1GGQA 4Z9HA 1K04A 3FVYA 4JTCB 4O6YA 4O6NA 5JT4A 1B68A 4C7OB 3IQ5A 1QLEC 2WVOA 2OEVA 1OW8A 2XLVA 4F4BA 3CSKA 4ZLCA 4XLPF 4EBJA 2G3VA 3A9CA 4AX2A 1V4AA 3UGOA 5KYYA 3ZTMA 3DJUB 5A6BA 2A0BA 3SP1A 3HLZA 5EHHA 1BDJB 3OEOA 4H4KC 3B0VC 1WASA 3T9OA 2PX3A 2W4BA 3WAQA 3HNIA 4JZAA 1V74B 4NTFA 4IWBA 3RF3A 4YT2A 1QQ3A 3GANA 1PCXA 2BE5F 2ICWG 3L8IA 4MQ9F 4U9EA 1K05A 3U5SA 4A4AA 2HSBA 4D4XA 5L0DA 4W8PA 3IQCA 1TWGA 4JEBA 4CS7A 2GDCA 4MTOA 4JW1A 4Q5SF 4LDKA 3ZWIA 3NDBB 4RBNA 1RXQA 2A69F 4PACA 2QUPA 3CEXA 3W2VA 2Q4FA 2VH3A 4M63A 4JJFA 4XTKA 1LPEA 3U2MA 1CGNA 1OR3A 3FAPB 4CBEA 4GEHA 1OXKA 4E0HA 2R7SA 3G50A 1MMDA 5JSLA 1LI7A 2KQ9A 3VYWA 5DLJA 2Q3TA 4YT8A 2OEXA 3F46A 2KYHA 4WABA 3C62A 4HFKB 2NSGA 3AG1C 1YAUO 3EGDB 1YVIA 2PX0A 2J7PD 3ZDLA 1M56C 4KNVA 5L0IA 1VB5A 1LE4A 1U89A 1U6HA 1WN0A 2OOCA 3DM9B 3MLGA 3Q7GA 4XPXA 1HMOA 1ZYRF 2RD9A 1IZMA 4U5EE 4XEVA 3B71A 1G8XA 1BR4A 4YL1A 1OCZC 4CSAC 3K6BA 1MNEA 3GODA 4QDLA 3B0UX 4OIOF 3T6JA 3EFOB 5CI8A 1E84A 2NUPB 2ASRA 1A0BA 2A6HF 3CZ6A 3PCVA 3GEHA 2CDQA 3U8VA 2J9VA 2PFDA 4PR9A 3MYIA 1RKCA 4GQHA 2HS5A 4H54A 3KMIA 2XLEA 3E9VA 1VYIA 3T4RA 4IAOA 2R7UA 2UUIA 4JJGA 1FMVA 4J7TA 3WG7C 2YVKA 2VB6A 4I1MA 1YARO 3L1MA 1L7CA 4XEFA 2X0CA 3K1HA 4BJTA 2EPMX 1YJGA 3BEHA 2EILC 1ZZPA 1FMWA 1CPRA 2LFDA 3EJNA 2R7QA 3DJNB 4NC3A 3GORA 4EWCA 1EQ1A 2ZXRA 2TMVP 2Y3DA 1H7IA 2GA0A 2L81A 4JVSA 3DWWA 4L6RA 4MVSA 4WGZA 4U5BE 4MVMA 5KYXA 1V55C 4MVZA 1TWAA 1V54C 3HTKC 5L3VA 4G7ZF 1A41A 1U0BB 1D1AA 3IHUA 5L0HA 2D5RB 5FZTA 1EA8A 2XS8A 3NMKA 4FWVA 4AK9A 3M4BA 2IXMA 3RYLA 1TFOB 3AQBA 1SF8A 3R2PA 4R32A 1Z23A 3K33A 4C7OA 4BJ6C 4U5CE 2XL8A 1T6QA 4IGGA 5JS5A 3DZAA 3FOPA 5L0JA 1SR2A 2L7AA 3OA1A 2HMQA 2P6VA 4ULWA 2NG1A 2Q00A 5K0IA 4ANJA 1QKRA 2NSFA 2P1AA 4J32B 3EZIA 2WZGA 1VK5A 4KNWA 1PD0A 3FAJA 5D91A 1VYKA 2A1DD 3ABKC 1ORSC 3EHNA 3GWNA 5F28E 4QI2A 1JAFA 1S05A 4CDAA 1BBHA 1K40A 2EPKX 2R7WA 2KK1A 1LI5A 3JRTA 3LS1A 3QTHA 4ONSA 5HSWA 3AG2C 2V26A 4IAQA 3T6GB 5A69A 1C02A 5A6BD 4K1OA 3UMIA 4CJGA 4EIYA 1T6IA 1ZHWA 2R03A 2HJMA 3ECSA 4JRZA 3RFYA 4DVZA 1IW7F 1GS9A 4Q7CA 4PJLA 4KBLA 5COMA 4YK5A 2VASA 4IB4A 4ER9A 2VCCA 3GM2A 1VLSA 3AOUA 3KYIA 2MYSA 1ZU4A 1ZW2A 3JYHA 2LSEA 2R7TA 1D0XA 3F47A 3MBGA 3US6A 1YDIA 2R05A 1HMDA 1E86A 3WHNA 1O3UA 1T9KA 1WWPA 3SXMA 2ZD9A 3N24A 1YYXA 3UMHA 5IY5C 4MTGA 4MVOA 1E83A 1Z3IX 2R9RB 2BC5A 3MFNA 3SZRA 1G4WR 2Q9BA 1W2WA 2R25A 3NRHA 4C3EA 1CGOA 3LJBA 4E17A 2H7VC 3M79A 2J0WA 3TOLA 2R7RA 3QW0A 3KPHA 4XQ1A 1H9GA 5KYUB 4CSAA 3O39A 5T3TA 1ORJA 4O79A 3BRJA 2LP4A 2PNOA 1FNTc 1LE2A 4GYTA 4G78A 3SYNA 3DD7A 3W8IA 4DRIB 4DVYP 1RJ9A 2Y39A 2A68F 2YKZA 2J46A 1QSPA 4I1OB 4J7YA 1LS1A 2CGEA 1NG1A 1OQCA 4A2NB 1OCCC 2C03A 3S29A 4CIHA 3G4XA 4YN0B 2G3KA 4U5HA 1M57C 1VMAA 2P61A 3AG4C 4HEAJ 4I44A 4NY3A 1WATA 5DVWA 4YWQA 2G62A 1BZ4A 1YYJA 2IBFA 2OG2A 2XLDA 3NYLA 4K0DA 4Z9IA 4NCQA 3DMDA 3V5ZA 3ITFA 1TQGA 5DS4A 2ZXWC 4C3DA 4DOZA 2UUHA 3PHF2 1RJ9B 3RVZA 1ZHXA 2JD3A 3NYJA 4JTAB 2IOQA 2XLHA 1Q0DA 1FTSA 1XZQA 2AWCA 1Q0KA 1AVOB 3FOOA 2QTVA 1Z5ZA 1SMYF 1JOGA 3EGDA 2EPNA 3ABMC 4BEJA 3IQ6A 4XPWA 1D0ZA 1HE1A 2H7OA 5F5HA 5DQZA 1GQAA 4MVUA 1OCRC 3B9QA 5COFA 3SXYA 4IJJA 2EIKC 2WZLA 3EHMA 3QW1A 3KYJA 4IRUA 4U5DE 2JX0A 4AL0A 2V3CC 2HV7A 3JTLO 2X51A 4BJ6A 1Y6DA 1AEPA 2IXNA 2QY9A 3EFOA 2J9UA 3LEVA 2NUPA 2CW0F 4G0HA 3V5YA 4FAPB 5BQIA 2HUJA 2OU6A 1MNDA 1E2XA 2KSFA 3NKEA 4P9TA 3TK0A 4AE4B 3CAXA 1M2OA 3HJCA 5KYWB 4RD9A 1LM3B 3EPVA 1YZAA 1ORYA 1RCPA 2D4UA 5D92A 3POVA 3JYYA 3JSEO 2Q9AA 3SNHA 3FDQA 3C8ZA 4MS2A 3ZQVA 4JURI 1WTYA 1KNYA 3AGTA 1NU7D 4D4NA 2XXAB 1T5OA 1HE9A 2J9WA 2OCCC 2DGJA 1VTMP 2GWWA 3DAGA 2YLGA 4U5FE 1VOMA 1G5ZA 3LESA 4MVQA 1LVKA 5GPGB 4E7ZA 1JRAA 2LIGA 1OW6A 1QVXA 1ZU5A 2YL3A 3LLKA 5L0CA 3U3BA 3C8GB 1I4YA 2AP3A 3C18A 3DM5A 4JEAA 4E18A 4W8KA 3C7JA 2I8BA 3H2VA 2AU5A 2RSEB 5AGFA 5T3WA 3ZC4A 3S0XA 4CDVA 5COGA 3NYMA 2H8AA 3X2QC 2J0XA 3TJ5A 2XRHA 1FFTC 4EKWA 2GFHA 2XLOA 3RQFA 4K7BA 1Q0GA 3RIPA 4JIOA 4CDYA 1RMVA 4OINF 1ZHZA 1S7ZA 4JTDB 2W9YA 4YT4A 1O87A 1I4ZA 1WGWA 3MX3A 4LACB 5L0FA 4JC7A 2M64A 5AC5A 3NMIA 3X1OA 4PFPA 1TWCA 3DE8A 4XLNF 3I5PA 3WODF 4CIPA 1BR2A 1R4TA 2BL2A 2OQMA 2P0NA 3ATPA 3JCUQ 3ZG1A 5EGYA 5L0GA 4G7HF 1TR2A 3UGPA 4X0RA 2ETSA 3MYFA 4U9DA 3T6BA 2E87A 2WVNA 3R7CA 4EUKB 256BA 3U3FA 2FFHA 3Q6MA 2A6EF 1SZIA 2XM4A 2CCYA 3HNLA 3ABLC 1F1MA 2CYDA 3JSZA 5CI9A 2AWYA 2HJ3A 4JCZA 2EIJC 3EG9B 3ASNC 3W2WA 4FX5A 5TJ5E 1OKKA 2O9XA 4O6MA 1FR0A 3SEOA 5JUAA 4MTFA 2QNLA 1C17M 3ZSUA 1XWJA 3A11A 3GWLA 4G7OF 1N1CA 3H65A 4BJ5A 1JPNA 2KJGA 1NLXA 2KW3C 2LCHA 1ZHTA 1Q0MA 3DE9A 3U9MA 3M15A 2YHSA 4O7GA 4XWJA 5KYUA 3GM1A 4DRJB 3S90A 4E7SA 4PJJA 5T1DB 3S28A 1YLMA 4OIQF 1UFBA 1YZCA 3U8PA 5E3AA 2R7VA 2WVQA 1SYQA 3DAFA 4AL1A 3U9JA 1LKXA 5A6KA 2HFIA 2YZSA 3QVZA 4J30B 4P6IC 4RDAA 3V5XA 5DQTA 1M6TA 2PP4A 1XZPA 2KGOA 4MNDA 1M2VB 2YLDA 5HV9A 1KU2A 4OIPF 3IPMO 5E3CA 3FXHA 2PBEA 2F22A 1FAPB 1OW7A 5B1AC 2XLWA 2AVKA 1CPQA 2L6HA 3O10A 1NSGB 1MMNA 2JPUA 2LQGA 1NFOA 2IYLD 3K1IC 4NTAA 3LNMB 3HNJA 3FMSA 5BUOA 1Z7Qc 2YL0A 4YL3A 2CNWA 5JLIA 2QLAA 2YL1A 3JRMO 1ZVZA 3VF0A 3TD7A 2FGYA 3DI5A 1J8YF 4HFFB 3AG3C 2LFFA 1O5HA 1JMWA
chains in the Genus database with same CATH topology
2AWCA 4XQ1A 3AGTA 3AGUA 1A7DA 1I4ZA 1A7EA 4XPWA 2AVKA 2HMQA 1I4YA 3WAQA 1HMDA 3WHNA 4XPXA 1HMOA 2HMZA 4XPYA 2MHRA 2AWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWC A;  4XQ1 A;  3AGT A;  3AGU A;  1A7D A;  1I4Z A;  1A7E A;  4XPW A;  2AVK A;  2HMQ A;  1I4Y A;  3WAQ A;  1HMD A;  3WHN A;  4XPX A;  1HMO A;  2HMZ A;  4XPY A;  2MHR A;  2AWY A; 
#chains in the Genus database with same CATH topology
 1G4U S;  4MW8 A;  4C3B A;  1D0Y A;  1H6G A;  3AQC A;  2EIM C;  3HKK A;  1ST6 A;  3O6X A;  3FHD A;  4JCH A;  4NTB A;  4AE4 A;  4PK4 A;  2ZPA A;  3GM3 A;  3RW0 A;  1MMA A;  5KYW A;  4BJ5 C;  3I4U A;  2Y3H A;  3S27 A;  5E33 A;  2OJE D;  5EK0 A;  1TWH A;  2H7B A;  3KKB A;  4B6I A;  5KYN A;  4DJ9 A;  3Q7L A;  2L6F A;  1KTM A;  2C04 A;  2J9B A;  4CS8 A;  4LLC A;  4EHP A;  1QZX A;  4IAR A;  1H9T A;  1HY5 A;  4HE8 D;  2Y3B A;  2ZXP A;  2XXA A;  4N4W A;  3LEO A;  1BR1 A;  1HW2 A;  1RKE A;  2IXP A;  2LD6 A;  4KI2 A;  4QI0 A;  5KYY B;  1NBB A;  2VCA A;  1VLT A;  2IM8 A;  5BQG A;  2YQY A;  2XL4 A;  4I3M A;  4CJO A;  2MHR A;  3C8G A;  3IQT A;  3SXK A;  2EIN C;  1Z63 A;  4OIR F;  1D1B A;  1OR2 A;  2B0J A;  4N6C A;  4PJM A;  3N0T A;  1A7E A;  2YRF A;  1RKE B;  3AJM A;  5B3I A;  5DS6 A;  2YL7 A;  4CX9 A;  2P7V A;  1OCO C;  3EH2 A;  1J8M F;  3TJ6 A;  2KNH A;  3LS0 A;  4YT5 A;  3VRC A;  4CS9 C;  2M4E A;  4KC9 A;  1PD1 A;  3RKO F;  3S9O A;  1MMG A;  3RQE A;  3S84 A;  2Q7R A;  5E2Q A;  3KH2 A;  4EBK A;  3W4Y A;  2WZF A;  3J06 A;  1PV3 A;  1APC A;  4LER A;  2HKV A;  1OKK D;  3L0I A;  1OXB A;  3N2Z B;  1GM5 A;  1LIH A;  2NPU A;  3VAY A;  1T01 A;  2HMZ A;  3PMR A;  4E0I A;  3O55 A;  5JVE A;  1NZE A;  4JE9 A;  2HV6 A;  2W4M A;  4U5G A;  2DI3 A;  3GEE A;  4Q4Z F;  1ZW3 A;  2PF4 E;  2Y3G A;  2VC9 A;  3NKD A;  3L8J A;  4Z9J A;  1A7D A;  1DOW A;  3TQO A;  3K66 A;  2OJQ A;  3IEE A;  3U2L A;  3QZC A;  2HZ8 A;  3QVY A;  5A6A A;  1CGM E;  1L3P A;  2B0H A;  1EI7 A;  3I5Q A;  4CS8 C;  3JT1 A;  3UNG C;  2I15 A;  1JR8 A;  2YLI A;  5B1B C;  2XS1 A;  3C63 A;  4JKV A;  2YWA A;  2EPL X;  3EG9 A;  1T6U A;  2KC3 A;  3ZVR A;  2WB7 A;  3M1C B;  2A0U A;  2L6G A;  1FFH A;  1QPU A;  2XSE A;  3K1I A;  3LNR A;  4P9F A;  3RH3 A;  1Y4C A;  3ZTZ A;  3PDM P;  3E70 C;  3VM6 A;  5BQH A;  3B0P A;  4XPY A;  3TOM A;  3QMK A;  3EH1 A;  3TUL A;  1TKN A;  3EGX A;  4LLE A;  1A7V A;  2J7P A;  4EBB A;  5A6J A;  4WJ0 A;  4YJW A;  3ZIB A;  4BPM A;  5B3S C;  4OD5 A;  4BEM J;  3EQL F;  1TFK B;  2GAQ A;  2IXO A;  4UDV A;  2R7X A;  3UR3 C;  2CNW D;  5KYX B;  4MW3 A;  3V7O A;  1ZHY A;  1R5I D;  3OWT A;  1WOL A;  3GEI A;  3EGX B;  3LAY A;  2FAP B;  2W45 A;  1Z6A A;  4DXW A;  1MQV A;  1M2V A;  2LK4 A;  2OKU A;  4ULV A;  1UG7 A;  3DKA A;  2ZXO A;  3L34 A;  3NMJ A;  3RVY A;  4XEK A;  4DBR A;  1YA9 A;  3JZ0 A;  5AC4 A;  5JRA A;  1YA7 O;  2NUT A;  3LLI A;  3RQG A;  4PJN A;  4DBQ A;  5L3Q A;  3M4C A;  5JP7 A;  2R7O A;  2DYR C;  2Z15 A;  4BJ1 A;  5F5F A;  4ZLD A;  1I5N A;  3LUT B;  4LDR A;  3H2U A;  1C03 A;  4NQF A;  2J45 A;  3AGU A;  4DRH B;  2DB4 A;  3DXJ F;  2VCB A;  2EPO A;  3K7D A;  2L9J A;  2WL8 A;  4FES A;  3CQZ A;  3W8H A;  4MVR A;  2XM0 A;  2NUT B;  1JPJ A;  1NFN A;  2R02 A;  1DOV A;  3EZH A;  1Q0F A;  3NG1 A;  5CIV A;  1E85 A;  2QE9 A;  4YL0 A;  5DS5 A;  2HSQ A;  1HW1 A;  2DYS C;  4N6H A;  3HNK A;  3ZQY A;  3C8G D;  3ASO C;  3Q6N A;  4LDQ A;  5FCL A;  1EKY A;  4WGY A;  4CS9 A;  2Y69 C;  4BG0 A;  1D1C A;  1AUE A;  2Q9C A;  2XLM A;  2XL6 A;  4OD4 A;  2YEV A;  1NU9 C;  3B29 A;  4N06 A;  3SXZ A;  3U0C A;  1LS4 A;  2MWQ A;  3G4Z A;  4PFO A;  3UMK A;  2J8W A;  3KL4 A;  1GGQ A;  4Z9H A;  1K04 A;  3FVY A;  4JTC B;  4O6Y A;  4O6N A;  5JT4 A;  1B68 A;  4C7O B;  3IQ5 A;  1QLE C;  2WVO A;  2OEV A;  1OW8 A;  2XLV A;  4F4B A;  3CSK A;  4ZLC A;  4XLP F;  4EBJ A;  2G3V A;  3A9C A;  4AX2 A;  1V4A A;  3UGO A;  5KYY A;  3ZTM A;  3DJU B;  5A6B A;  2A0B A;  3SP1 A;  3HLZ A;  5EHH A;  1BDJ B;  3OEO A;  4H4K C;  3B0V C;  1WAS A;  3T9O A;  2PX3 A;  2W4B A;  3WAQ A;  3HNI A;  4JZA A;  1V74 B;  4NTF A;  4IWB A;  3RF3 A;  4YT2 A;  1QQ3 A;  3GAN A;  1PCX A;  2BE5 F;  2ICW G;  3L8I A;  4MQ9 F;  4U9E A;  1K05 A;  3U5S A;  4A4A A;  2HSB A;  4D4X A;  5L0D A;  4W8P A;  3IQC A;  1TWG A;  4JEB A;  4CS7 A;  2GDC A;  4MTO A;  4JW1 A;  4Q5S F;  4LDK A;  3ZWI A;  3NDB B;  4RBN A;  1RXQ A;  2A69 F;  4PAC A;  2QUP A;  3CEX A;  3W2V A;  2Q4F A;  2VH3 A;  4M63 A;  4JJF A;  4XTK A;  1LPE A;  3U2M A;  1CGN A;  1OR3 A;  3FAP B;  4CBE A;  4GEH A;  1OXK A;  4E0H A;  2R7S A;  3G50 A;  1MMD A;  5JSL A;  1LI7 A;  2KQ9 A;  3VYW A;  5DLJ A;  2Q3T A;  4YT8 A;  2OEX A;  3F46 A;  2KYH A;  4WAB A;  3C62 A;  4HFK B;  2NSG A;  3AG1 C;  1YAU O;  3EGD B;  1YVI A;  2PX0 A;  2J7P D;  3ZDL A;  1M56 C;  4KNV A;  5L0I A;  1VB5 A;  1LE4 A;  1U89 A;  1U6H A;  1WN0 A;  2OOC A;  3DM9 B;  3MLG A;  3Q7G A;  4XPX A;  1HMO A;  1ZYR F;  2RD9 A;  1IZM A;  4U5E E;  4XEV A;  3B71 A;  1G8X A;  1BR4 A;  4YL1 A;  1OCZ C;  4CSA C;  3K6B A;  1MNE A;  3GOD A;  4QDL A;  3B0U X;  4OIO F;  3T6J A;  3EFO B;  5CI8 A;  1E84 A;  2NUP B;  2ASR A;  1A0B A;  2A6H F;  3CZ6 A;  3PCV A;  3GEH A;  2CDQ A;  3U8V A;  2J9V A;  2PFD A;  4PR9 A;  3MYI A;  1RKC A;  4GQH A;  2HS5 A;  4H54 A;  3KMI A;  2XLE A;  3E9V A;  1VYI A;  3T4R A;  4IAO A;  2R7U A;  2UUI A;  4JJG A;  1FMV A;  4J7T A;  3WG7 C;  2YVK A;  2VB6 A;  4I1M A;  1YAR O;  3L1M A;  1L7C A;  4XEF A;  2X0C A;  3K1H A;  4BJT A;  2EPM X;  1YJG A;  3BEH A;  2EIL C;  1ZZP A;  1FMW A;  1CPR A;  2LFD A;  3EJN A;  2R7Q A;  3DJN B;  4NC3 A;  3GOR A;  4EWC A;  1EQ1 A;  2ZXR A;  2TMV P;  2Y3D A;  1H7I A;  2GA0 A;  2L81 A;  4JVS A;  3DWW A;  4L6R A;  4MVS A;  4WGZ A;  4U5B E;  4MVM A;  5KYX A;  1V55 C;  4MVZ A;  1TWA A;  1V54 C;  3HTK C;  5L3V A;  4G7Z F;  1A41 A;  1U0B B;  1D1A A;  3IHU A;  5L0H A;  2D5R B;  5FZT A;  1EA8 A;  2XS8 A;  3NMK A;  4FWV A;  4AK9 A;  3M4B A;  2IXM A;  3RYL A;  1TFO B;  3AQB A;  1SF8 A;  3R2P A;  4R32 A;  1Z23 A;  3K33 A;  4C7O A;  4BJ6 C;  4U5C E;  2XL8 A;  1T6Q A;  4IGG A;  5JS5 A;  3DZA A;  3FOP A;  5L0J A;  1SR2 A;  2L7A A;  3OA1 A;  2HMQ A;  2P6V A;  4ULW A;  2NG1 A;  2Q00 A;  5K0I A;  4ANJ A;  1QKR A;  2NSF A;  2P1A A;  4J32 B;  3EZI A;  2WZG A;  1VK5 A;  4KNW A;  1PD0 A;  3FAJ A;  5D91 A;  1VYK A;  2A1D D;  3ABK C;  1ORS C;  3EHN A;  3GWN A;  5F28 E;  4QI2 A;  1JAF A;  1S05 A;  4CDA A;  1BBH A;  1K40 A;  2EPK X;  2R7W A;  2KK1 A;  1LI5 A;  3JRT A;  3LS1 A;  3QTH A;  4ONS A;  5HSW A;  3AG2 C;  2V26 A;  4IAQ A;  3T6G B;  5A69 A;  1C02 A;  5A6B D;  4K1O A;  3UMI A;  4CJG A;  4EIY A;  1T6I A;  1ZHW A;  2R03 A;  2HJM A;  3ECS A;  4JRZ A;  3RFY A;  4DVZ A;  1IW7 F;  1GS9 A;  4Q7C A;  4PJL A;  4KBL A;  5COM A;  4YK5 A;  2VAS A;  4IB4 A;  4ER9 A;  2VCC A;  3GM2 A;  1VLS A;  3AOU A;  3KYI A;  2MYS A;  1ZU4 A;  1ZW2 A;  3JYH A;  2LSE A;  2R7T A;  1D0X A;  3F47 A;  3MBG A;  3US6 A;  1YDI A;  2R05 A;  1HMD A;  1E86 A;  3WHN A;  1O3U A;  1T9K A;  1WWP A;  3SXM A;  2ZD9 A;  3N24 A;  1YYX A;  3UMH A;  5IY5 C;  4MTG A;  4MVO A;  1E83 A;  1Z3I X;  2R9R B;  2BC5 A;  3MFN A;  3SZR A;  1G4W R;  2Q9B A;  1W2W A;  2R25 A;  3NRH A;  4C3E A;  1CGO A;  3LJB A;  4E17 A;  2H7V C;  3M79 A;  2J0W A;  3TOL A;  2R7R A;  3QW0 A;  3KPH A;  4XQ1 A;  1H9G A;  5KYU B;  4CSA A;  3O39 A;  5T3T A;  1ORJ A;  4O79 A;  3BRJ A;  2LP4 A;  2PNO A;  1FNT c;  1LE2 A;  4GYT A;  4G78 A;  3SYN A;  3DD7 A;  3W8I A;  4DRI B;  4DVY P;  1RJ9 A;  2Y39 A;  2A68 F;  2YKZ A;  2J46 A;  1QSP A;  4I1O B;  4J7Y A;  1LS1 A;  2CGE A;  1NG1 A;  1OQC A;  4A2N B;  1OCC C;  2C03 A;  3S29 A;  4CIH A;  3G4X A;  4YN0 B;  2G3K A;  4U5H A;  1M57 C;  1VMA A;  2P61 A;  3AG4 C;  4HEA J;  4I44 A;  4NY3 A;  1WAT A;  5DVW A;  4YWQ A;  2G62 A;  1BZ4 A;  1YYJ A;  2IBF A;  2OG2 A;  2XLD A;  3NYL A;  4K0D A;  4Z9I A;  4NCQ A;  3DMD A;  3V5Z A;  3ITF A;  1TQG A;  5DS4 A;  2ZXW C;  4C3D A;  4DOZ A;  2UUH A;  3PHF 2;  1RJ9 B;  3RVZ A;  1ZHX A;  2JD3 A;  3NYJ A;  4JTA B;  2IOQ A;  2XLH A;  1Q0D A;  1FTS A;  1XZQ A;  2AWC A;  1Q0K A;  1AVO B;  3FOO A;  2QTV A;  1Z5Z A;  1SMY F;  1JOG A;  3EGD A;  2EPN A;  3ABM C;  4BEJ A;  3IQ6 A;  4XPW A;  1D0Z A;  1HE1 A;  2H7O A;  5F5H A;  5DQZ A;  1GQA A;  4MVU A;  1OCR C;  3B9Q A;  5COF A;  3SXY A;  4IJJ A;  2EIK C;  2WZL A;  3EHM A;  3QW1 A;  3KYJ A;  4IRU A;  4U5D E;  2JX0 A;  4AL0 A;  2V3C C;  2HV7 A;  3JTL O;  2X51 A;  4BJ6 A;  1Y6D A;  1AEP A;  2IXN A;  2QY9 A;  3EFO A;  2J9U A;  3LEV A;  2NUP A;  2CW0 F;  4G0H A;  3V5Y A;  4FAP B;  5BQI A;  2HUJ A;  2OU6 A;  1MND A;  1E2X A;  2KSF A;  3NKE A;  4P9T A;  3TK0 A;  4AE4 B;  3CAX A;  1M2O A;  3HJC A;  5KYW B;  4RD9 A;  1LM3 B;  3EPV A;  1YZA A;  1ORY A;  1RCP A;  2D4U A;  5D92 A;  3POV A;  3JYY A;  3JSE O;  2Q9A A;  3SNH A;  3FDQ A;  3C8Z A;  4MS2 A;  3ZQV A;  4JUR I;  1WTY A;  1KNY A;  3AGT A;  1NU7 D;  4D4N A;  2XXA B;  1T5O A;  1HE9 A;  2J9W A;  2OCC C;  2DGJ A;  1VTM P;  2GWW A;  3DAG A;  2YLG A;  4U5F E;  1VOM A;  1G5Z A;  3LES A;  4MVQ A;  1LVK A;  5GPG B;  4E7Z A;  1JRA A;  2LIG A;  1OW6 A;  1QVX A;  1ZU5 A;  2YL3 A;  3LLK A;  5L0C A;  3U3B A;  3C8G B;  1I4Y A;  2AP3 A;  3C18 A;  3DM5 A;  4JEA A;  4E18 A;  4W8K A;  3C7J A;  2I8B A;  3H2V A;  2AU5 A;  2RSE B;  5AGF A;  5T3W A;  3ZC4 A;  3S0X A;  4CDV A;  5COG A;  3NYM A;  2H8A A;  3X2Q C;  2J0X A;  3TJ5 A;  2XRH A;  1FFT C;  4EKW A;  2GFH A;  2XLO A;  3RQF A;  4K7B A;  1Q0G A;  3RIP A;  4JIO A;  4CDY A;  1RMV A;  4OIN F;  1ZHZ A;  1S7Z A;  4JTD B;  2W9Y A;  4YT4 A;  1O87 A;  1I4Z A;  1WGW A;  3MX3 A;  4LAC B;  5L0F A;  4JC7 A;  2M64 A;  5AC5 A;  3NMI A;  3X1O A;  4PFP A;  1TWC A;  3DE8 A;  4XLN F;  3I5P A;  3WOD F;  4CIP A;  1BR2 A;  1R4T A;  2BL2 A;  2OQM A;  2P0N A;  3ATP A;  3JCU Q;  3ZG1 A;  5EGY A;  5L0G A;  4G7H F;  1TR2 A;  3UGP A;  4X0R A;  2ETS A;  3MYF A;  4U9D A;  3T6B A;  2E87 A;  2WVN A;  3R7C A;  4EUK B;  256B A;  3U3F A;  2FFH A;  3Q6M A;  2A6E F;  1SZI A;  2XM4 A;  2CCY A;  3HNL A;  3ABL C;  1F1M A;  2CYD A;  3JSZ A;  5CI9 A;  2AWY A;  2HJ3 A;  4JCZ A;  2EIJ C;  3EG9 B;  3ASN C;  3W2W A;  4FX5 A;  5TJ5 E;  1OKK A;  2O9X A;  4O6M A;  1FR0 A;  3SEO A;  5JUA A;  4MTF A;  2QNL A;  1C17 M;  3ZSU A;  1XWJ A;  3A11 A;  3GWL A;  4G7O F;  1N1C A;  3H65 A;  4BJ5 A;  1JPN A;  2KJG A;  1NLX A;  2KW3 C;  2LCH A;  1ZHT A;  1Q0M A;  3DE9 A;  3U9M A;  3M15 A;  2YHS A;  4O7G A;  4XWJ A;  5KYU A;  3GM1 A;  4DRJ B;  3S90 A;  4E7S A;  4PJJ A;  5T1D B;  3S28 A;  1YLM A;  4OIQ F;  1UFB A;  1YZC A;  3U8P A;  5E3A A;  2R7V A;  2WVQ A;  1SYQ A;  3DAF A;  4AL1 A;  3U9J A;  1LKX A;  5A6K A;  2HFI A;  2YZS A;  3QVZ A;  4J30 B;  4P6I C;  4RDA A;  3V5X A;  5DQT A;  1M6T A;  2PP4 A;  1XZP A;  2KGO A;  4MND A;  1M2V B;  2YLD A;  5HV9 A;  1KU2 A;  4OIP F;  3IPM O;  5E3C A;  3FXH A;  2PBE A;  2F22 A;  1FAP B;  1OW7 A;  5B1A C;  2XLW A;  2AVK A;  1CPQ A;  2L6H A;  3O10 A;  1NSG B;  1MMN A;  2JPU A;  2LQG A;  1NFO A;  2IYL D;  3K1I C;  4NTA A;  3LNM B;  3HNJ A;  3FMS A;  5BUO A;  1Z7Q c;  2YL0 A;  4YL3 A;  2CNW A;  5JLI A;  2QLA A;  2YL1 A;  3JRM O;  1ZVZ A;  3VF0 A;  3TD7 A;  2FGY A;  3DI5 A;  1J8Y F;  4HFF B;  3AG3 C;  2LFF A;  1O5H A;  1JMW A; 
#chains in the Genus database with same CATH homology
 2AWC A;  4XQ1 A;  3AGT A;  3AGU A;  1A7D A;  1I4Z A;  1A7E A;  4XPW A;  2AVK A;  2HMQ A;  1I4Y A;  3WAQ A;  1HMD A;  3WHN A;  4XPX A;  1HMO A;  2HMZ A;  4XPY A;  2MHR A;  2AWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...