2HNFA

Structure of a hyper-cleavable monomeric fragment of phage lambda repressor containing the cleavage site region
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
133
structure length
130
Chain Sequence
b'GSHMYEYPVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTTPKTSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFAKLIRDSGQVFLQPLNPQYPMIPCNESCSVVGKVIASQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repressor protein cI101-229DM-K192A
molecule tags Viral protein
source organism Escherichia coli
publication title Structure of a Hyper-cleavable Monomeric Fragment of Phage lambda Repressor Containing the Cleavage Site Region.
pubmed doi rcsb
total genus 21
structure length 130
sequence length 133
ec nomenclature
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 2hnfA00
3JSOA 4N31A 3S04A 3JSPA 1AY9A 1JHHA 2FKDA 2HNFA 1KCAA 1JHFA 4ME8A 2FJRA 2HO0A 3K2ZA 3BDNA 1JHEA 1F39A 1B12A 1JHCA 4NV4A 1T7DA 4K8WA 1UMUA 3IIQA 1I4VA 1KN9A
chains in the Genus database with same CATH superfamily
3JSOA 4N31A 3S04A 3JSPA 1AY9A 1JHHA 2FKDA 2HNFA 1KCAA 1JHFA 4ME8A 2FJRA 2HO0A 3K2ZA 3BDNA 1JHEA 1F39A 1B12A 1JHCA 4NV4A 1T7DA 4K8WA 1UMUA 3IIQA 1I4VA 1KN9A
chains in the Genus database with same CATH topology
3JSOA 4N31A 3S04A 3JSPA 1AY9A 1JHHA 2FKDA 2HNFA 1KCAA 1JHFA 4ME8A 2FJRA 2HO0A 3K2ZA 3BDNA 1JHEA 1F39A 1B12A 1JHCA 4NV4A 1T7DA 4K8WA 1UMUA 3IIQA 1I4VA 1KN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSO A;  4N31 A;  3S04 A;  3JSP A;  1AY9 A;  1JHH A;  2FKD A;  2HNF A;  1KCA A;  1JHF A;  4ME8 A;  2FJR A;  2HO0 A;  3K2Z A;  3BDN A;  1JHE A;  1F39 A;  1B12 A;  1JHC A;  4NV4 A;  1T7D A;  4K8W A;  1UMU A;  3IIQ A;  1I4V A;  1KN9 A; 
#chains in the Genus database with same CATH topology
 3JSO A;  4N31 A;  3S04 A;  3JSP A;  1AY9 A;  1JHH A;  2FKD A;  2HNF A;  1KCA A;  1JHF A;  4ME8 A;  2FJR A;  2HO0 A;  3K2Z A;  3BDN A;  1JHE A;  1F39 A;  1B12 A;  1JHC A;  4NV4 A;  1T7D A;  4K8W A;  1UMU A;  3IIQ A;  1I4V A;  1KN9 A; 
#chains in the Genus database with same CATH homology
 3JSO A;  4N31 A;  3S04 A;  3JSP A;  1AY9 A;  1JHH A;  2FKD A;  2HNF A;  1KCA A;  1JHF A;  4ME8 A;  2FJR A;  2HO0 A;  3K2Z A;  3BDN A;  1JHE A;  1F39 A;  1B12 A;  1JHC A;  4NV4 A;  1T7D A;  4K8W A;  1UMU A;  3IIQ A;  1I4V A;  1KN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...