2HNIA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, k111a mutation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
230
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
total genus 67
structure length 230
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2hniA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2hniA01
5DY9A 1D3BA 4YYEA 3TEGA 4RCBA 3REUA 4H2SA 1WYDA 1U1TA 2DEQA 3HSBA 1J5WA 1ASZA 2DXTA 4XEOA 2ZR2A 4TQDA 4PJOG 1EQRA 1I5LA 1I8FA 1WPYA 3BY7A 4M7AB 4EMKB 1JRIA 2DZCA 3JCMW 1EFWA 1HK9A 2RM4A 4HWRA 4DPGA 2ZZGA 4UP9A 1B34B 4P73A 3L4GB 1Z7NA 2DU7A 1N9RA 3M4PA 4YP0A 3SB2A 4C92E 3FB9A 4KR3A 3RF1A 2XGTA 1NJ8A 4MMKA 2C8MA 4CH6A 4TVAB 4YRTA 3A32A 1RIQA 3LSSA 3UGQA 2ZNJA 2ZT8A 2DZ9A 3E9IA 4DQ2A 3A7UA 2RA2A 2AMCA 1EVLA 4C92D 3HY1A 1YGBA 4PHCA 1LJOA 3NETA 2PMEA 4YRMA 1WQWA 1ASYA 2RHSB 4RQEA 5GANf 4H2YA 3E9HA 3P8YA 4PG3A 2ZIOA 4P71C 2Q7HA 4XU2A 2ZT7A 2EJ9A 3BDUA 3RERA 2ZGWA 4C8QC 1YFRA 4KQEA 1L0WA 4P75C 4PJOF 4C92B 1B70A 4MMLA 2I4MA 1BIBA 4JLIA 1NYRA 5GANg 1PYSA 1SESA 4YRKA 1KOGA 3HRIA 5LJ5e 2I4LA 5GAN4 3P8TA 3L1AA 3BFMA 1NYQA 5GAMd 1SRYA 3VQXA 3R07A 2K57A 2QTXA 4P75A 3RKWA 4PJOA 1H4QA 2YHTA 3DSQA 4HWTA 3IG2A 1ATIA 4A54A 5GAOl 4XTYA 4K88A 1W66A 3JB9J 3FIFA 3QO5A 3HXVA 1USYC 4H2XB 2YLCA 4F7UA 4CS2A 3PZCA 3QHSA 3HXXA 5GMKj 2XTIA 4M77E 3JCMe 4YCUA 4M7DE 2CJAA 2ODRD 3V7SA 1Z7MA 4EMHA 5C53B 1B7YB 4YRIA 4M78C 4HWPA 4M77A 1I4K1 4C8QE 4M7DD 4H2TA 4M7AC 2CJBA 4Q15A 3WQZA 5F5WA 2FYKA 4YCWA 2AKWB 1JJCA 2HNIA 4J5YA 4E51A 3NENA 2AKWA 3GIBA 3QO7A 2DXUA 3V8LA 5GMKl 2AMCB 2PMFA 1I81A 4C8QD 4F7UF 1ADJA 1LOJA 3V8JA 5GANe 2DQ0A 2Q7EA 1B7YA 1IL2A 2ARSA 1WU7A 3JCMX 4M75D 3A7RA 2C7IA 2QHSA 4P71A 3A5ZA 2Q7GA 4XTVA 3QUIA 4ZTZB 3IKMB 3VBBA 2E10A 2J3LA 4C8QF 1YFTA 5LJ5f 2E65A 3UH0A 2ARUA 2QHUA 2Q5HA 4C92A 1D3BB 1JBMA 1YB3A 1H641 3L2ZA 4YRSA 1TH7A 2VXFA 3KFUA 3LSQA 1HTTA 4XTUA 1LNXA 4PNOA 2DKGA 3CMQA 5I21A 5C52B 2QHVA 3RESA 1X01A 3TEHA 1N9WA 4K87A 3EFSA 4YRNA 4JRIA 3RL6A 5GAMf 2IY5B 2CGHA 3HTZA 1EVKA 3HXZA 4TVWA 4Q6GA 1FYFA 3L4GA 3FJPA 2I2LA 2I4OA 5GAN2 3SWNC 2ZR3A 3PCOB 1BBWA 1EIYA 4PJOC 5LJ3j 3JCMb 4TVAA 1HXDA 1NNHA 4HA8A 3EFRA 4YREA 4EX5A 4CS3A 1B76A 2EJGA 5C51B 5LJ5g 2RHQA 4WF2A 1BIAA 3BW1A 2VXEA 4M78G 3UFGA 3SWNB 4H2WA 4WI1A 4XEMA 3A31A 3JB9I 1Y96A 2J3MA 5LJ3e 4PJOE 1BBUA 4M77D 2QHTA 4BWAA 2E3CA 1WLEA 4UPAA 1H4TA 3UGTA 2DDZA 3VQWA 1M5Q1 5GAN3 4XQ3A 1C0AA 1G5IA 1X2HA 4N0AA 4C8QA 1X2GA 3QO8A 4K86A 4XU0A 5GAOq 1Y96B 2ZZEA 4XTWA 4YDQA 4XTZA 3HFZB 5LJ5j 3M4GA 3JCMg 4ZTUB 4JUVA 4M75A 3HY0A 5LJ5h 1MGQA 4HWOA 2FB7A 2ZT5A 4P73C 4N0AC 3LC0A 3V7CA 4HT9A 4M78B 1X55A 3JCMQ 1NJ6A 4X9CA 3G1ZA 1EOVA 1X56A 1M8VA 1QF6A 5GAN6 3HXWA 2E64A 4YRFA 5GAN5 1EIYB 3JCMf 4M7DC 2ZZFA 4M78D 3JCMV 4YRJA 5GMKm 2ZT6A 5GAMe 1E1TA 2RD1A 5GMKi 1SERA 3HFVA 3HFNA 2EWNA 3QSUA 4UP7A 3ICAA 4M7DG 2DVEA 5GAMj 3RGLA 5GAOr 3JB9D 4F7UE 4XTXA 1ADYA 1E22A 3QNEA 4H2XA 3PGGA 3RKYA 4OLFA 3INZA 5K1XA 3VQYA 5ELOA 3MEYA 3IALA 1KMNA 4NL3A 3HXUA 4P3NA 4M7AF 2EJFA 2E5AA 4YRLA 5GAN7 2EL9A 4LNSA 4V2SA 4M78F 3AHUA 4PJOB 1GGMA 3BJUA 5K1PA 4F7UB 2JN0A 2P5IA 4YRGA 1LYLA 4YRCA 3A74A 4YCVA 5GANd 1KMMA 1NJ1A 2ALYA 1E24A 3JB9H 1JJCB 3HRKA 5GAMh 1PYSB 5GAOn 3HFOA 3HXYA 4RMFA 4M75F 4QVDA 3I7FA 5KNNA 2ZXFA 1WNLA 3JCMP 4M77B 4XU3A 4M75E 4M7AD 1H4SA 4C92F 5GAMg 4X9DA 1YCYA 4CH3A 4H2VA 4X5OA 4YPFA 2ZINA 2I4NA 4YRRA 3W3SA 2ZCEA 1G51A 3JCMc 4J15A 1N9SA 2P0LA 2ALYB 2E41A 4KR2A 1KQ1A 4M78E 3NELA 1H4VB 2Y90A 3VU3C 11ASA 1B70B 3IKLA 1U1SA 5GANh 4EMKC 3RACA 4C92G 4WJ3M 2DJZA 4HVCA 2ODRC 4NOYA 4P3OA 1VQZA 4J6YA 5GMKh 4RQFA 4CH5A 3RUXA 4XU1A 3VQVA 3A5YA 2EAYA 4EMKA 4P74C 4Y91A 4RDXA 5GAN8 2DU5A 4TWAA 1G5HA 1KQ2A 3ERRA 3RIRA 12ASA 3V7RA 4M78A 4NCXA 4M7AG 2ZNIA 3M4QA 4M75B 3A7AA 1B34A 1E1OA 5GAOp 5ELNA 4M77F 2G4CA 2ZTGA 4P72C 4H02A 1YFSA 4J6WA 5GANj 4AH6A 5GMKe 1NJ5A 2RHSA 3TUPA 4TVYA 3V8KA 4RCCA 4P3PA 4J6XA 4EMGA 4A53A 4M75G 4QVCA 4F7UG 1B8AA 4C8QG 4M7DF 4TTVA 3REXA 2E1HA 4M77C 4M75C 1QE0A 4P72A 3OD1A 3JCMh 4HT8A 1NJ2A 1WQ7A 1X54A 3JB9F 4M77G 4H2UA 4PJOD 4YRQA 4UP8A 2DTIA 5LJ3d 4O2DA 2DTOA 4C92C 4TQFA 5LJ3g 5LJ3f 3MF2A 2YLBA 4EO4A 1USYA 5LJ5d 3JB9G 4WJ4A 2ARTA 4P74A 2RHQB 3MF1A 3QO3A 4C8QB 5GAOm 1HC7A 3NEMA 2Q5IA 2DTHA 4BW9A 3RKXA 5LJ3h 4JRKA 4YROA 2RB6A 3P8VA 2CIMA 4CH4A 4L87A 5E3IA 3PCOA 3TEHB 3HFZA 4NL2A 4M7DB 4YRPA 3JCMd 2ZIMA 5HGQA 4M7AA 4HWSA 2DQ3A 3JCMJ 4G84A 5CAIA 4G85A 3SWNA 3QTCA 4M7DA 2CJ9A 4CS4A 1SETA 4OP0A 2VC8A 2IY5A 4ZIBA 4M7AE
chains in the Genus database with same CATH superfamily
1Q81R 1D3BA 1AHJB 3TEGA 4RCBA 3OS1A 1VQ5T 1QVPA 3HSBA 1S72T 3CMAQ 1MMDA 2DXTA 3REAB 3HHTB 2X3XD 1I5LA 1Q86R 3CMEQ 3QZ5B 1FMVA 5CKBA 1EFWA 4E7HA 2ZZGA 4UP9A 1WYXA 1QLYA 2LTOA 4AG1C 3PVLA 2J05A 2RNAA 4FCYA 2DO3A 3MQZA 3G1JA 2CH4W 1NJ8A 2VVKA 2OTJQ 3A32A 1RAFB 2AT1B 1SHGA 2ZT8A 3A7UA 1M2VB 2B8AA 2AMCA 2P0KA 2EQJA 1TG0A 3RBBB 2G3RA 4OMPA 3VS6A 2RHSB 3E9HA 4PG3A 2DAQA 2ZIOA 3PIPA 2Q7HA 5KYXA 3LGFA 2DMOA 2EJ9A 2M0OA 3RERA 2NWMA 3CC7A 1IGUA 1VOMA 4P75C 1OU9A 3G71A 3I5SA 3TVTA 1YJWQ 4JLIA 5FWCA 1ZUYA 2MWPA 1D1AA 1KOGA 4DOVA 5LJ5e 3G4SQ 3M54A 2I4LA 5GAN4 4LUEA 2ZAEA 4BDYA 4FYYB 1XNIA 4J9IA 3THKA 1W70A 2CP5A 4PJOA 3GOXA 2YHTA 3DSQA 1LCKA 3M0SA 1ATIA 3MP1A 1VQ8A 3TSWA 2RPNA 1KG1A 2EPDA 3QO5A 2DL8A 2CKKA 3EGXA 5FU6C 1USYC 4MZTA 5GMKj 2XTIA 4RTYA 4M7DE 3UDCA 4BUGA 2O9VA 2XHCA 3OYHA 1GBRA 3OW2P 2EQMA 2XICA 4J9FA 2KGTA 3NMZC 1K0SA 2RHYA 1JJCA 3URGA 1S1NA 2JVVA 5AYFA 1OI1A 3NENA 4J8OA 2K3YA 3GF5A 3V8LA 5GMKl 1QCFA 1WXTA 3E2UA 3VS1A 3CCQA 1MMNA 2DERA 2ATCB 1WIEA 2LT4A 3PIOA 4C5IA 1FX7A 3JCMX 2DXCA 1NEGA 1G8XA 1TXQA 5DLQE 2QHSA 4P71A 1SPKA 2O31A 1UG1A 5KH6A 3A98A 4XTVA 3RNJA 1NLOC 3VBBA 1QP2A 4C8QF 1TUDA 2QASA 5LJ5f 2E65A 3FLGA 3UH0A 3CXCS 3CCST 4C92A 4MDWA 2A7YA 2DK3A 1B3QA 1H641 2YRCA 1TH7A 2QAZA 2XD0A 1HTTA 3NTKA 1UTIA 4OGCA 4OMLA 1PG5B 1IXDA 1GL5A 1N9WA 1MMGA 3VKIA 1W2BP 4A4FA 2QDYB 4ESRA 1QVGP 2HKQB 2QGFB 5CKEA 1G3YA 1OPLA 2LNHB 3HTZA 1W4SA 1EVKA 2J6KA 4FT4A 4Q6GA 2D0NA 4ZGJB 2EQUA 3L4GA 3OYBA 2I2LA 1UHFA 3CPFA 4AG2C 4P5NA 5FU6B 4A4HA 1SSFA 2XDDA 1KC8R 3PCOB 3D7SB 1PKTA 2DL5A 3VUZA 5IAYA 3CCVT 3G6EA 3JCMb 3WVEB 2DILA 3TREA 3NGPA 1IB8A 3CC4T 2R5MA 4PFZA 5C51B 3M5AA 3HP9A 2FRWA 1H8KA 4WF2A 1BIAA 4LXCA 5FU7B 3H0FA 1ZSZB 4M78G 3UFGA 3CMAT 3A31A 2MIOA 2L0AA 5LJ3e 5IHKA 3EH2A 4M77D 3JAME 2QHTA 1FYNA 1WLEA 3E1SA 1VQ9A 2OTLA 3H41A 2DDZA 3M53A 1WJQA 2WSEE 2EYWA 3SD4A 3G7ZA 3EGUA 3G6ET 1GBQA 3VJPA 1X2GA 3CQTA 3EHRA 3EG1A 4AFSC 5GAOq 1Y96B 1JXMA 3CMET 4ZTJA 4CRIA 1X2KA 3CCSQ 2H3JA 2HBWA 3E19A 4XTZA 3X20B 1SSHA 3JCMg 4FU6A 1YJNQ 3MP6A 4BDZA 3V7CA 4HCCA 4HT9A 3EAEA 2M9UA 1X55A 1N8RR 1YJ9A 4II1A 3HXWA 2E64A 1QP3A 1EIYB 2WACA 4M7DC 1Y71A 4BB7A 1OZ3A 2CUBA 4M78D 2LP5A 5C6SA 3L2RA 1E1TA 2RD1A 4FIBA 2W0ZA 2K6DA 3HFVA 5L8RE 2WSCE 2X4YA 1M1KR 2HL5C 4QQ6A 2E70A 3OYNA 2KT1A 5GAOr 3QNEA 2RHIA 2DD4A 3I55T 3META 1N6AA 5FRNA 1EIFA 4E7LA 1JJ2S 3X25B 3IQLA 2E3HA 1SRLA 2EGEA 3A8HB 4C5HA 2HQXA 4X34A 4IUVA 3OMCA 2EJFA 1MHNA 2YUOA 2E5AA 1OEBA 2CUDA 2MYSA 3E9FA 4PJOB 1RAEB 1UGQB 2L3RA 1TSFA 2JN0A 2ZPIB 3MEWA 1AEYA 4YRCA 2YT6A 2X9HA 4RUGA 5GANd 2K5LA 1KMMA 2K4YA 1NJ1A 1EZZB 1X2QA 1IHWA 1J3TA 5GAMh 5M9OA 1QCNA 4PJNA 2YUPA 4A63B 3JCMP 2P84A 4M7AD 3EFOB 4E6RA 1K0XA 1OU8A 3OBWA 3SHWA 3TEEA 4GY5A 3U23A 2E4HA 1M1KU 2ZCEA 3EG3A 3JCMc 1M1KC 1R8OB 1UJ0A 2E41A 2A36A 1SF9A 3X24B 3NELA 2LNVA 2OTLQ 4LVJA 11ASA 3PMTA 1B70B 4RG8A 3IKLA 4JJDA 1S72Q 5KYNA 3RACA 4C92G 4WJ3M 2DJZA 2XMFA 4HVCA 4CC2A 4ZNXA 4NOYA 1X69A 5CKHA 1KHIA 4RQFA 1VYTA 4CH5A 2GFAA 1N8RU 4BI4A 2EAYA 2F5TX 2DU5A 3CCLQ 2MF2A 2LQ8A 4TWAA 2A08A 4E7IA 3V7RA 12ASA 2HL3A 3PFSA 2C0TA 1YJ9T 3LGLA 1B34A 1PWTA 2F1LA 5GAOp 3CD6Q 5ELNA 1Z9QA 2LQWA 4KRTA 4P72C 4H02A 5GMKe 3O8VA 3CD6T 1KD1R 1YITT 3V8KA 4J6XA 2GGRA 2XDBA 1UGRB 4O6JA 3PVQA 2J6OA 4J83A 4C8QG 3CCUQ 1VQ6A 1NZ9A 3REXA 4F16A 4M77C 2PQWA 4P72A 4HT8A 3UA7A 5A2QE 2GBQA 4M77G 4H2UA 4PJOD 4YRQA 5A0GA 3LW5E 4TQFA 1MNDA 2DL3A 4EO4A 2LDMA 3CCEA 5KE3A 1PSFA 4WJ4A 2F2XA 1VQPT 2CZ6B 1RACB 1JJ2P 3MF1A 1KC8C 2RF0A 1X6BA 5GAOm 2OTLT 2DEUA 4BW9A 4JRKA 1Q82C 2CIMA 4JJNK 5E3IA 3OY9A 1WHMA 2QK0A 5HGQA 2O2OA 1U8RA 1WHGA 2DQ3A 2HEQA 4DBHA 4C0FA 5CAIA 4G85A 1UJYA 2CJ9A 4CS4A 2FPEA 3N5BB 1KD1U 9ATCB 3VS7A 2VC8A 3LX7A 4QKUA 2PTKA 3PNWC 2XKOC 4RTTA 1QVFS 2K5FA 2E6NA 4MZPA 1Q95G 1NG2A 1ASZA 4Z8AA 2KY9A 4XEOA 2ZR2A 4TQDA 1Q7YR 1EQRA 2D9TA 1WPYA 1JRIA 2X35A 2DZCA 3ZEHA 2CP3A 1HK9A 4FYXB 4DPGA 4FT2A 2A37A 3QKJA 3L4GB 1YIJQ 4ATOA 4YP0A 3M4PA 2NUPB 4FW1A 2K9GA 3SB2A 4C92E 3FB9A 2JOYA 2EW3A 3OYGA 4CH6A 4TVAB 2ZNJA 2DZ9A 4DQ2A 2BZXA 2JT4A 2FPFA 2AZSA 4C92D 2ECZA 3VRYA 1LJOA 2R58A 3FC3A 1VQMT 3TU4K 4H2YA 3GNGA 3S3OA 2JTEA 4P71C 1K9MU 2ZT7A 4JZ4A 1OPKA 3UF4A 4C0DC 4IUUA 2HCKA 2CT3A 3ER0A 3EHQA 4L59A 5D6YA 5DLOA 1M90C 1UECA 4C92B 2I4MA 2QA4A 1PYSA 4YRKA 3P8TA 1HYOA 2C06A 2DETA 4B6MA 1SHFA 5GAMd 1SRYA 2QTXA 4A4KA 2CH4A 3CCJT 3RKWA 2SRCA 4BY6C 1OYXA 3OB9A 5IXFA 2MCNA 4A54A 1MV0B 2Z0WA 1V76A 3FIFA 3HXVA 3C0CA 4JRPA 3G6EQ 2YLCA 5HY6A 4F7UA 2K7AA 3PZCA 4CS2A 1W2BS 3QHSA 4LN2A 2OJ2A 4Z88A 1WXUA 1BU1A 1PHTA 2CJAA 2QTVA 3V7SA 5KYWA 1NEBA 2LJ3A 1VIEA 2AKLA 2R5AA 4OMFB 2SEMA 4IURA 1VQLT 4M77A 4ME7A 3QZ9B 3PE0A 4H2TA 4KH1B 4Q15A 2FYKA 2RHZA 4HCBA 2JJ9A 1KHCA 4ANJA 1QVGS 2AKWA 1HD3A 2CZ0B 2K2MA 1VQ8T 1ACMB 1I81A 2QQ9A 4LE9A 2COZA 1KQSS 3V8JA 1ADJA 2DQ0A 2DL7A 2JUFA 4PLIA 1B7YA 3JSCA 4Y28E 1CKAA 2HD0A 2EYZA 2BE7D 1IL2A 1WU7A 2K79A 1NYFA 4OB0B 1M27C 4KGXB 1H3ZA 4E7SA 2YRDA 2Q7GA 2D8HA 3M56A 3TSZA 4ZTZB 4GBQA 2A3LA 3CXCP 3CCEQ 2K3XA 2E10A 2J3LA 2J6FA 2ARUA 2EIFA 1KIKA 2QHUA 2V26A 2Q5HA 2DPPB 3CCMA 2PNIA 3JRZA 2QQSA 1ZHIA 4EPCA 1VIFA 4E7JA 1T3LA 3CPWS 2EFIA 1C0MA 4YRSA 4WCIA 4F14A 5CVIA 4XTUA 3OYFA 4PNOA 2J06A 4J7IA 3S3NA 4DBRA 3AT1B 5C52B 1WJSA 1M2VA 3RESA 3I55Q 2LQNA 2ZPEB 5KYYA 4C0GA 4K87A 4YRNA 3SDZA 4OF1A 1S72A 2E6ZA 4BE0A 3CCJQ 2PZ1A 1ZSZC 1XQHA 1AT1B 1U06A 1Z9ZA 2CP0A 1W6XA 2XU8A 2L5QA 2B86A 1C1AA 4Z02A 2OAUA 3P8BB 1YP5A 2LX9A 5LJ3j 1YIJA 2AHJB 1NM7A 4IIMA 1NNHA 4HA8A 4YREA 4CS3A 1B76A 2QDLA 2EJGA 1UE9A 1WX6A 4EIKA 2DE0X 4K11A 1M8MA 2P4TA 2V8KA 3CCJA 3DB3A 4WI1A 1VQKA 3CCET 3JB9I 2V8JA 1VQOA 1BBUA 4BWAA 1RABB 1FMWA 1PC0A 3G4ST 1VQ6Q 1H4TA 1KD1C 4FL6A 1N8RC 4LDYA 1RAGB 1G5IA 1P92A 4IIOA 4JDSA 1BCOA 1JEGA 4C8QA 3OBYA 4J7FA 4K86A 5FROA 2ZZEA 1YCSB 1AWWA 2RJDA 4JJBA 1Q82U 1GCPA 2CP6A 4DOWA 2FPDA 5LJ5j 3HFZB 3HY0A 5LJ5h 1E6HA 4HWOA 2ZT5A 4P73C 2HKNA 3M9QA 1T0HA 2JTFA 2HSPA 1UGPB 3G1ZA 3VUBA 1QF6A 4N4IA 3OYCA 5GAN5 4LDWA 3MJXA 4Y92A 2DA9A 4E7ZA 5GMKm 5GAMe 4DBFA 3OYLA 3C94A 1AVZC 5GJVB 2LCCA 3CMEA 1NLPC 1PRLC 2EWNA 4OMNA 4UP7A 2KR3A 3ICAA 1EX4A 5GAMj 3JB9D 2JMCA 2RQUA 3M0QA 3J81E 3OYJA 2OTJA 3PGGA 4QQGA 3RKYA 4FSSA 2K3BA 4OLFA 1I5OB 3VQYA 2A0FB 5ELOA 3H9NA 1D0XA 4AT1B 3IALA 1Q86U 3EFOA 3RMSA 2KXDA 4NL3A 2LMJA 4GLKA 4YRLA 2EL9A 1C6VX 3JV3A 2RQTA 3AHUA 4V2SA 1QMCA 3LWHA 5K1PA 4Z89A 2KRSA 2FZGB 4YRGA 4HVUA 2NUTB 4BACA 1XTDA 1XOVA 1YI2T 2EQKA 3QG1A 1LYLA 1WXBA 3A74A 4PK4A 2EYXA 4D6WA 3KXTA 3JB9H 3HXYA 1MMAA 4M75F 2ZXFA 4XK8E 4M77B 2DD5A 4M75E 2KK4A 2L89A 1Q81C 1K8AC 5KYWB 4X5OA 2MAMA 1QKWA 2I4NA 2ENMA 5CCAA 2BIVA 2P0LA 2ALYB 3I56Q 4RG2A 4KR2A 1Q81U 4M78E 2OX7A 2D8JA 3RDVA 3VU3C 4C5EA 1RL2A 4QT7A 4QW2A 4EMKC 2QI2A 4IUTA 3CBOA 2KAFA 2KE9A 2ODRC 2DL4A 4P3OA 3CCMT 5D7UA 3LLRA 2L3QA 3RUXA 3HPWA 3J7AF 3QYHB 4EMKA 1WA7A 3WVDB 3ERRA 1KQ2A 2MMPA 1ZQ1A 2P0QA 3OS5A 4NCXA 3M4QA 3A7AA 1TUCA 2VKNA 1E1OA 2G4CA 2ZTGA 4R55A 1YFSA 4J6WA 5GANj 5C0MA 3TUPA 5I11A 1YN8A 4KUIA 1K8AR 4A53A 5I2SA 4QVCA 1ZSZA 4M7DF 2F69A 2E1HA 2F2VA 3OD1A 5CKFA 1WQ7A 3R6OA 2GTOA 2KI7A 2JZ2A 4AFUC 4LNPA 2YSQA 5LJ3d 2YUNA 5LJ3f 3P8DA 3ME9A 1FMKA 1USYA 5LJ5d 1K1ZA 5HK3A 1YJNT 4J9DA 1ARKA 3QO3A 5FRMA 3VV0A 5HKCA 1HC7A 3NEMA 4DA4A 3RKXA 2ZZDA 2RB6A 2VASA 1FXXA 2X3WD 1PD0A 3I56T 1X6OA 2DF6A 4CH4A 3PCOA 1UUEA 3QDFA 4PJMA 2ZIMA 2DRKA 2ABLA 3J80E 4HVVA 4L6V5 2JNGA 3CCUT 2FZKB 2JS2A 3JCMJ 4G84A 3QTCA 5I22A 1VQ7T 3QPHA 3M4YA 2DBMA 2C0OA 4ZIBA 4M7AE 2QA4T 2KMTA 5DY9A 1ZUUA 4CC4B 2KBTA 4YYEA 4BI8B 3L42A 3EG0A 3VS3A 4BI3A 1WYDA 4H2SA 3OYMA 2IG0A 2GQVA 2EYQA 2X4WA 5KE2A 3OA6A 1ZA2B 4PJOG 2JM8A 2BUDA 3KBGA 3JCMW 1JQQA 2RM4A 3Q1JA 2CSIA 3CCLT 4P73A 4RTUA 5HK0A 4PFOA 2O88A 2J7IA 1JB0E 4KR3A 2XGTA 4FYWB 3VS4A 4B9WA 2C8MA 4YRTA 2RK1A 3LSSA 3UGQA 5EC7A 1O75A 2RA2A 3CXCA 5FU7C 2K5IA 1EVLA 3HY1A 4PHCA 5CO7A 2V1QA 1ASYA 1TU0B 1I1JA 4RQEA 3P8YA 3HRUA 4DBQA 5CK9A 1R0BG 4XU2A 4LVKA 4GLMA 1GFCA 2ZGWA 1RLQC 1YFRA 1DJ7B 1OX8A 1K8AU 1AZGB 4KQEA 1L0WA 1OZ2A 4PJOF 4MMLA 1YBYA 1RADB 1CKBA 1BIBA 3VRZA 1NYRA 5GANg 1SESA 1K76A 3HRIA 3S3MA 4KBMB 2PUKB 3BFMA 1H92A 1NYQA 3MO8A 3SFMA 3VQXA 2K57A 2LZ6B 4CC7A 1M90R 2X4XA 1H4QA 1T3SA 4HWTA 2E5KA 3IG2A 2CZ7B 3GNFB 5GAOl 4A4EA 4JS5A 1VQ4A 5CQYA 2KXCA 4XTYA 2EVRA 3CCQQ 1BI2A 4LUDA 1KQSP 1E7OA 4HT4A 4H2XB 1ABOA 5I2MA 3FJ5A 2ED0A 1G2BA 3JCMe 1NJIC 4YCUA 2KSSA 4EMHA 3CCMQ 2QQRA 4D8DA 1VQ7A 2M51A 3M57A 4ZN1A 2QEXA 1XJWB 2RQWA 1BI3A 4YRIA 2K2VA 2CREA 4M78C 4HWPA 2JMAA 2DYBA 1VQKQ 1K73C 4C8QE 4M7DD 2RJFA 3WQZA 4YCWA 1NPPA 4ELZC 3L2VA 4E47A 5LL6S 2COYA 2HAXA 4E51A 1RLPC 2HQHA 2NLUA 3GIBA 3QO7A 2DXUA 2AMCB 4C8QD 1AWOA 5GANe 2Q7EA 1VQNT 1HJDA 1N5ZA 1PD1A 3PMIA 1YIJT 2EKOA 3A1PA 2MI6A 1OULA 3M0RA 3OYEA 3CCSA 1G3TA 4KGZB 3LWIA 1VA7A 4JJCA 3CC2A 3IKMB 1UEBA 1YI2Q 2F5KA 3MPUB 3L2UA 2XK0A 1YHQA 2DFUA 2DX1A 1D3BB 2AK5A 1X75C 3L2ZA 1YITA 4LVLA 4AMCA 4LVIA 3CPWP 2H8HA 3G71Q 1LNXA 4JZ3A 2JS0A 3H6ZA 3R6NA 3CMQA 2RHUA 5I21A 3DB4A 2QHVA 1X01A 1K9AA 2ZCFB 3EFSA 3QXEB 3RL6A 3ULRB 1T0JA 3CC2Q 5GAMf 4HVWA 1WHHA 2JM9A 1Y0MA 1E6GA 2VGNA 2KDSA 2YRVA 3CC2T 4TVWA 1FYFA 4FM4B 3FJPA 1NE8A 2NYSA 2I4OA 5GAN2 5FW9A 3SWNC 3CC4Q 3KFVA 1BI1A 4LDVA 3H0HA 1EIYA 3CCVQ 1HXDA 3EFRA 4EX5A 3ZFJA 4OMQA 2AIRB 2X4JA 2IVWA 2R57A 5LJ5g 2RHQA 3BW1A 3I9QA 3EGDB 1G5VA 1IO6A 3SWNB 4H2WA 1BBZA 1JJ2A 2CYZB 1Y96A 4PJOE 1F1BB 1WDXA 4OGEA 1QVFA 4UPAA 3OYYA 3OYKA 5GAN3 4XQ3A 3A8LB 3QO8A 2VGMA 1QCOA 3HL8A 1GXIE 4YDQA 4JS4A 1VQMA 4ZTUB 4JUVA 1X6GA 1D1BA 4M75A 1ZLMA 1MGQA 2FB7A 4N0AC 3LC0A 1KC8U 4M78B 2V8IA 3JCMQ 4LDXA 4E7KA 1NJ6A 5J39A 5J26A 1EOVA 1M8VA 5GAN6 4YRFA 1MNEA 4RTXA 3L2WA 3JCMV 4YRJA 2QYZA 2ZT6A 2DRMA 5GMKi 3MEVA 3BDLA 1PNJA 1SERA 1VQ9Q 2HSEB 3C95A 3QSUA 2JTMA 1I07A 1UHCA 2M16A 3HRSA 2DVEA 3EG9B 4XTXA 3GP8A 1E22A 2IPOB 2GTJA 3VYGA 4H2XA 3GLXA 3A8OB 4IUPA 3INZA 5K1XA 1YJWT 5A0DA 1KMNA 4NS5A 4OB2B 3HXUA 1ZA1B 4P3NA 2QQBA 3CCQT 2FEIA 5GAN7 2BTTA 4LNSA 1GGMA 3BJUA 3CC4A 4F7UB 4HCKA 1IGQA 4XAXB 3X26B 1VQPQ 1SG5A 3GBQA 1JJCB 5GAOn 3HFOA 2CS7A 3HKSA 4RMFA 1WNLA 3G4SA 1PRMC 2FZCB 3M59A 4C92F 1YFNA 4X9DA 2V1RA 3EG2A 1OOTA 3TQ7P 1JU5C 1VYUA 4YRRA 3W3SA 4J15A 4N4HA 3F70A 4PL6A 1KQ1A 4PJJA 1RI0A 1JXOA 2Y90A 3QYGB 1PSEA 2AZVA 1YITQ 1M3AA 5GANh 1VQ5Q 2EQIA 2CP7A 5L23A 3M58A 2VUBA 2RH2A 4J6YA 5GMKh 1YHQT 1WLPB 1D0ZA 3EGXB 2VV5A 3ZL7C 2XDPA 4F04B 2EGCA 1IREB 4P74C 4ZGDB 1D09B 5CR2A 1WJRA 1YNZA 2BKDN 3RIRA 2RI2A 4LVMA 1UGVA 1KSWA 4RMOA 1U3OA 1QW1A 2IIMA 4KGVB 1G83A 2VYTA 1YWPA 1Y07A 1PCXA 2DLPA 1X27A 2RHSA 4TVYA 1WHKA 2OAWA 4EMGA 1UDLA 3OSVA 4M75G 4F7UG 4OB3B 4LDUA 4BD3A 1B8AA 3OS0A 4TTVA 2P4RA 3MCAB 1Q7YU 2GQIA 1QE0A 5KYXB 1D1CA 3PTAA 1NJ2A 1H3HA 1SKUB 1OV3A 2FO0A 2ZPGB 2DTIA 1VQ4Q 4VUBA 3UA6A 4O2DA 2VWFA 2RQRA 1R77A 3MF2A 2RN8A 4HCZA 1X43A 2DYIA 4E2FB 4O5VA 1YI2A 4P74A 2CZ1B 5KCHA 4ELYC 1JO8A 3QWXX 1LVKA 4JPBW 2DTHA 1A0NB 2L3PA 2O4XB 1I0CA 4J9GA 3DLLA 3M55A 2HBPA 3CCUA 1TTHB 3TEHB 2XG8D 3HFZA 3JCMd 4J9BA 2ROLA 1GCQA 4LD9K 2GNCA 2FL7A 4MZMA 1SRMA 2ED1A 1QWEA 2D6FA 3CBPA 3SWNA 4M7DA 2QXFA 1SETA 1HSQA 1U5SA 2IY5A 4FSXA 2ZNIA 1B07A 2NUZA 3REUA 1U1TA 2DEQA 1J5WA 2ESWA 2MWOA 1AZEA 1I8FA 3BY7A 4M7AB 4EMKB 1GRIA 1QWFA 2LCLA 4HWRA 1UFFA 1B34B 1Z7NA 2DU7A 1N9RA 2KQWA 5IN1A 1VQOQ 5FWBA 1VQ6T 3RF1A 1K73U 4MMKA 2HQEA 1RIQA 1M9SA 4M4ZA 3E9IA 2BZ8A 3MHXA 3CD6A 2DJQA 1YGBA 4TVRA 3X28B 1MUZA 3NETA 2PMEA 4YRMA 1WQWA 5HCKA 2D0QB 1CSKA 5GANf 2M0YA 2KRMA 2HMAA 3PT9A 3WXMB 1EFNA 3BDUA 3EH1A 2D1XA 4OMMA 5KYUB 2QEXQ 4C8QC 2DVJA 1AWXA 3KUFA 4F17A 3LYIA 1M3CA 1B70A 5KYYB 4IKFA 5DM7R 1BYMA 2FRYA 2ZPHB 3MEAA 4AFQC 5A0LA 1WHJA 3L1AA 1M4ZA 1PKSA 1QVGA 3UATA 1RAIB 3C4SA 1KFZA 2HZYA 3R07A 4P75A 1FWZA 1RAHB 1WI7A 2M1HA 1QQJA 3LH5A 1PM3A 2LC4A 2HDAA 3LH0A 4KULA 2EBPA 1AD5A 4ZGEB 4K88A 3L2QA 1W66A 2RQVA 3JB9J 4X1VA 2XI9A 3QJYA 1K73R 1K9MC 3CCVA 3NFCA 2CT4A 3QWYA 3HXXA 1VUBA 3DKMA 4M77E 2ODRD 3OQ5A 3QJ6A 1Z7MA 3MP8A 1AOJA 3RMQA 4CI0C 2PVGB 3NTIA 5C53B 1KK7A 2RHXA 5ECAA 1B7YB 4ORZA 5IH2A 3VS5A 4BE2A 5J3BA 2RI5A 1K9MR 1OQKA 1I4K1 2DM1A 4M7AC 2CJBA 5F5WA 5D6XA 2AKWB 3CMAA 1VQLQ 3MEUA 2HNIA 4J5YA 2OTJT 2DIQA 3CCRT 3QBYA 2PMFA 1TS9A 4F7UF 2E5QA 1LOJA 1O9SA 1TOVA 1NJIR 3OYIA 3G71T 2YWWA 3OSSC 4DEYA 2BE9B 2YXYA 3C12A 1SEMA 4KUDK 2RO0A 4QQDA 2ARSA 2MPXC 1VQ8Q 2PVDB 4M75D 3A7RA 2C7IA 1M2OA 3A5ZA 4B9XA 2YDLA 4RKUE 2COWA 3QUIA 1V29B 1WHLA 1YFTA 1R0CB 1QKXA 1W1FA 2KNBB 3CBMA 1RI9A 2LRQA 1JBMA 1YB3A 4J9HA 5CKDA 4C0DB 1IRXA 3CC7Q 2VXFA 3HRTA 3KFUA 3T9NA 3LSQA 3BE3A 4KT0E 1ABQA 4LD6A 5EG2A 3VYHB 5IHNA 1VQNQ 4PFPA 4RTWA 2DKGA 1IHVA 2KVQG 2MK5A 1WFWA 3TEHA 4JRIA 2FG0A 4A4GA 2IY5B 4C5GA 2CGHA 3CCLA 4R0KA 3HXZA 1NPRA 2CSQA 2PVOB 2QGGA 2ZR3A 3FDRA 3SEMA 4AFZC 1BBWA 4PJOC 3A8GB 2JW4A 4TVAA 4RTZA 1GFDA 4PLLA 2C0IA 4JLGA 2NUPA 4OVAA 2ROTA 5IT9E 1N27A 2NS6A 2GFUA 4PJLA 2LCSA 5IHIA 2VXEA 5IXBA 2KEAA 1VQMQ 1VQPA 1GCQC 4XEMA 1VQKT 3RR6A 4HKEA 3TCJA 2J3MA 1RAAB 7AT1B 2E3CA 3NTHA 4IUQA 1M3BA 3UGTA 3VQWA 1M5Q1 1C0AA 3CC7T 2KT8A 4JRQA 4UC4A 1X2HA 4N0AA 4Q5WA 2O01E 4XU0A 4MDXA 3VS2A 2FHDA 3E9GA 4XTWA 4CC3A 2L8DA 3M4GA 5CIUA 4C0ZA 4R56A 2QQAA 4X9CA 1X56A 4BY6B 2KRNA 2LVMA 3JCMf 1LPLA 2ZPBB 4BE1A 2ZZFA 1MV3A 2OI3A 2DNUA 1NBEB 3CPWA 1V1CA 1BK2A 1ZSGA 1NYGA 4L5GA 3QDRB 1ZUKA 1Q7YC 3CCRQ 3HFNA 2L3SA 2F2WA 3MKDA 4QVZA 3FEOA 2LT1A 1BKBA 2MOXA 2RJEA 2DBKA 4M7DG 1YWOA 1M30A 1M1FA 8ATCB 3RGLA 4ZN3A 4F7UE 1VQNA 1ADYA 1NJIU 4ZTFA 3S6WA 5KCOA 1VQ7Q 2FVUA 4YTLA 3MEYA 3ASKA 2EGAA 4PKCC 1Q82R 2RI3A 4OMOA 2EYYA 2ZPFB 4M7AF 1OX9A 2QEXT 4M78F 4FW2A 3UPUA 2P5IA 3A5ZB 2PUOB 4YCVA 2Y4XA 1VQ5A 2ALYA 2QA4Q 3OYAA 2G6FX 1E24A 3HRKA 1PYSB 2E12A 2RMOA 4QVDA 2WSFE 3I7FA 5KNNA 1UGSB 3UT1A 5FLXE 4XU3A 2LX7A 2X51A 1Y7XA 1H4SA 5GAMg 1QVFP 4EDUA 3GPLA 1YCYA 1VQOT 1IZ6A 1KQSA 3REBB 4CH3A 4H2VA 1BI0A 3OS2A 4YPFA 2ZINA 1YJWA 4FYVB 1G51A 1N9SA 2KYMA 5AT1B 1YHQQ 3A8MB 3OW2S 4J9CA 2NUTA 3EG9A 1H4VB 1ZX6A 2QG9B 3OW2A 1U1SA 4RTVA 3OYDA 1YJNA 6AT1B 1WGSA 2LJ0A 3H0IA 1K4US 1VQZA 3HTRA 1M1GA 3I55A 2XIDA 2CDTA 3FRNA 4XU1A 2DIGA 2KYBA 3VQVA 1D0YA 5GJWB 3A5YA 2W10A 4Y91A 4RDXA 5GAN8 3OMGA 1G5HA 1ZBXA 2VB6A 3P8HA 4M78A 1Q86C 4DEXA 4M7AG 1B7TA 1KJWA 3NHNA 4M75B 4J9EA 3CEYA 5KYUA 2GCXA 3ZBDA 4M77F 2E3IA 2M02A 8AT1B 4AH6A 3DLMA 4OB1B 1NJ5A 4RCCA 4P3PA 3CCRA 1TUGB 2AKKA 2YUQA 3NPFA 1TWBA 2LJ1A 1ZBJA 2KROA 3UWNA 3EGDA 2RK2A 3M0TA 4M75C 2P0PA 3JCMh 3M0PA 1G3SA 2JXBA 1G3WA 1X54A 1VYVA 3JB9F 1BB9A 2DXBA 3I5RA 1RUWA 2Y4YA 4UP8A 2DTOA 4C92C 1M90U 5LJ3g 1W2BA 1BCMA 3O5ZA 2YLBA 3JB9G 3M0UA 2ARTA 2RHQB 3VS0A 5D6WA 4C8QB 2LQKA 2H3EB 1VQ4T 3QIIA 2A28A 1VQ9T 1YJ9Q 5LJ3h 2Q5IA 4YROA 3P8VA 1AWJA 2PU9B 2A8EA 1WZOA 1Y57A 2EKHA 4L87A 4HXJA 4N4GA 4YRPA 4NL2A 4M7DB 4D8KA 2O9SA 3I35A 4KH0B 5CQXA 2GF7A 2I0NA 4M7AA 2L2PA 3H8ZA 2BZYA 4HWSA 2RJCA 1VQLA 3I56A 4WTOB 1UB4A 4OP0A 2O4XA 2CP2A
chains in the Genus database with same CATH topology
1D3BA 1AHJB 3TEGA 4RCBA 3OS1A 1VQ5T 1QVPA 3HSBA 1S72T 2DXTA 3HHTB 1I5LA 3QZ5B 5CKBA 1EFWA 4E7HA 2ZZGA 4UP9A 2LTOA 2DO3A 3MQZA 1NJ8A 3A32A 2ZT8A 3A7UA 2B8AA 2AMCA 2P0KA 2EQJA 2RHSB 2G3RA 3E9HA 4PG3A 2DAQA 2ZIOA 3PIPA 2Q7HA 3LGFA 2EJ9A 2M0OA 3RERA 3CC7A 4P75C 3G71A 4JLIA 2MWPA 1KOGA 4DOVA 5LJ5e 3M54A 2I4LA 5GAN4 4BDYA 1XNIA 4PJOA 3GOXA 2YHTA 3DSQA 1ATIA 3MP1A 1VQ8A 1KG1A 3QO5A 2CKKA 5FU6C 1USYC 4MZTA 5GMKj 2XTIA 4M7DE 3UDCA 4BUGA 2XHCA 3OYHA 2EQMA 2XICA 2RHYA 1JJCA 3URGA 2JVVA 5AYFA 1OI1A 3NENA 4J8OA 2K3YA 3GF5A 3V8LA 5GMKl 3CCQA 2LT4A 3PIOA 4C5IA 1FX7A 3JCMX 2DXCA 5DLQE 2QHSA 4P71A 5KH6A 4XTVA 3VBBA 1QP2A 4C8QF 5LJ5f 2E65A 3FLGA 3UH0A 3CXCS 3CCST 4C92A 4MDWA 2A7YA 2DK3A 1H641 1TH7A 2XD0A 1HTTA 3NTKA 4OGCA 1N9WA 3VKIA 4A4FA 2QDYB 5CKEA 1G3YA 3HTZA 1W4SA 1EVKA 4FT4A 4Q6GA 4ZGJB 2EQUA 3L4GA 3OYBA 2I2LA 3CPFA 4P5NA 5FU6B 4A4HA 1SSFA 2XDDA 3PCOB 3VUZA 5IAYA 3CCVT 3G6EA 3JCMb 3WVEB 3TREA 3CC4T 2R5MA 5C51B 3M5AA 3HP9A 4WF2A 1BIAA 5FU7B 4M78G 3UFGA 3CMAT 3A31A 5LJ3e 3JAME 4M77D 2QHTA 1WLEA 3E1SA 1VQ9A 2OTLA 2DDZA 3M53A 1WJQA 2WSEE 3SD4A 3G7ZA 3G6ET 3VJPA 1X2GA 5GAOq 1Y96B 3CMET 4ZTJA 4CRIA 2H3JA 3E19A 4XTZA 3X20B 3JCMg 4FU6A 3MP6A 4BDZA 3V7CA 4HCCA 4HT9A 3EAEA 2M9UA 1X55A 1YJ9A 4II1A 3HXWA 2E64A 1QP3A 1EIYB 2WACA 4M7DC 1Y71A 4BB7A 1OZ3A 4M78D 5C6SA 3L2RA 1E1TA 2RD1A 4FIBA 3HFVA 5L8RE 2WSCE 2X4YA 4QQ6A 2E70A 3OYNA 5GAOr 3QNEA 2RHIA 2DD4A 3I55T 3META 1N6AA 5FRNA 1EIFA 4E7LA 1JJ2S 3X25B 3A8HB 4C5HA 2HQXA 4X34A 4IUVA 3OMCA 2EJFA 1MHNA 2E5AA 3E9FA 4PJOB 1UGQB 2L3RA 2JN0A 2ZPIB 3MEWA 4YRCA 5GANd 1NJ1A 2K5LA 2K4YA 1KMMA 5GAMh 5M9OA 3JCMP 4M7AD 3OBWA 3TEEA 4GY5A 1M1KU 2ZCEA 3JCMc 1M1KC 1R8OB 2E41A 3X24B 3NELA 2LNVA 4LVJA 11ASA 3PMTA 1B70B 4RG8A 3IKLA 3RACA 4C92G 4WJ3M 2DJZA 4HVCA 4NOYA 5CKHA 1KHIA 4RQFA 4CH5A 2GFAA 1N8RU 4BI4A 2EAYA 2F5TX 2DU5A 2MF2A 2LQ8A 4TWAA 4E7IA 3V7RA 12ASA 3PFSA 1YJ9T 3LGLA 1B34A 5GAOp 5ELNA 4P72C 4H02A 5GMKe 3O8VA 3CD6T 1YITT 3V8KA 4J6XA 2XDBA 1UGRB 4O6JA 4J83A 4C8QG 1VQ6A 1NZ9A 3REXA 4M77C 2PQWA 4P72A 4HT8A 5A2QE 4M77G 4H2UA 4PJOD 4YRQA 5A0GA 3LW5E 4TQFA 4EO4A 2LDMA 3CCEA 5KE3A 1PSFA 4WJ4A 1VQPT 2CZ6B 3MF1A 1KC8C 5GAOm 2OTLT 4BW9A 4JRKA 1Q82C 2CIMA 4JJNK 5E3IA 3OY9A 5HGQA 1U8RA 2DQ3A 4C0FA 5CAIA 4G85A 2CJ9A 4CS4A 3N5BB 1KD1U 2VC8A 3LX7A 3PNWC 2XKOC 1QVFS 2K5FA 2E6NA 4MZPA 1ASZA 2KY9A 4XEOA 2ZR2A 4TQDA 1EQRA 2D9TA 1WPYA 1JRIA 2X35A 2DZCA 3ZEHA 1HK9A 4DPGA 4FT2A 3QKJA 3L4GB 4ATOA 4YP0A 3M4PA 3SB2A 4C92E 3FB9A 2JOYA 3OYGA 4CH6A 4TVAB 2ZNJA 2DZ9A 4DQ2A 4C92D 1LJOA 2R58A 3FC3A 1VQMT 3TU4K 4H2YA 3GNGA 3S3OA 4P71C 1K9MU 2ZT7A 4C0DC 4IUUA 3ER0A 4L59A 5D6YA 5DLOA 1M90C 4C92B 2I4MA 2QA4A 1PYSA 4YRKA 3P8TA 2C06A 5GAMd 1SRYA 2QTXA 4A4KA 3CCJT 3RKWA 4BY6C 1OYXA 3OB9A 4A54A 3FIFA 3HXVA 4JRPA 2YLCA 5HY6A 4F7UA 4CS2A 3PZCA 1W2BS 3QHSA 2CJAA 3V7SA 1VIEA 2R5AA 4OMFB 4IURA 1VQLT 4M77A 4ME7A 3QZ9B 4H2TA 4Q15A 2FYKA 2RHZA 4HCBA 1KHCA 1QVGS 2AKWA 2CZ0B 1VQ8T 1I81A 2QQ9A 1ADJA 1KQSS 3V8JA 2DQ0A 2JUFA 4PLIA 1B7YA 3JSCA 4Y28E 2HD0A 1IL2A 1WU7A 4OB0B 1H3ZA 2Q7GA 3M56A 4ZTZB 2A3LA 2K3XA 2E10A 2J3LA 2ARUA 2EIFA 2QHUA 2Q5HA 2DPPB 3CCMA 3JRZA 2QQSA 1ZHIA 4EPCA 1VIFA 4E7JA 3CPWS 2EFIA 4YRSA 5CVIA 4XTUA 3OYFA 4PNOA 4J7IA 3S3NA 5C52B 1WJSA 3RESA 2ZPEB 4C0GA 4K87A 4YRNA 3SDZA 4OF1A 1S72A 2E6ZA 4BE0A 1XQHA 2XU8A 2L5QA 4Z02A 2OAUA 3P8BB 2LX9A 5LJ3j 1YIJA 2AHJB 1NNHA 4HA8A 4YREA 4CS3A 1B76A 2EJGA 2P4TA 2V8KA 3CCJA 3DB3A 4WI1A 1VQKA 3CCET 3JB9I 2V8JA 1VQOA 1BBUA 4BWAA 3G4ST 1H4TA 1KD1C 4FL6A 1N8RC 4LDYA 1G5IA 1P92A 4JDSA 4C8QA 3OBYA 4J7FA 4K86A 5FROA 2ZZEA 2RJDA 1Q82U 4DOWA 5LJ5j 3HFZB 3HY0A 5LJ5h 4P73C 4HWOA 2ZT5A 3M9QA 2JTFA 3G1ZA 1UGPB 3VUBA 1QF6A 4N4IA 3OYCA 5GAN5 4LDWA 5GMKm 5GAMe 3OYLA 3C94A 2LCCA 3CMEA 2EWNA 4UP7A 3ICAA 5GAMj 3JB9D 3J81E 3OYJA 2OTJA 3PGGA 4QQGA 3RKYA 4OLFA 3VQYA 5ELOA 3IALA 1Q86U 3RMSA 4NL3A 4GLKA 4YRLA 2EL9A 4V2SA 3AHUA 3LWHA 5K1PA 4YRGA 4BACA 1XTDA 1XOVA 1YI2T 2EQKA 3QG1A 1LYLA 3A74A 4D6WA 3KXTA 3JB9H 3HXYA 4M75F 2ZXFA 4XK8E 4M77B 2DD5A 4M75E 2KK4A 2L89A 1Q81C 1K8AC 4X5OA 2MAMA 2I4NA 5CCAA 2BIVA 2P0LA 2ALYB 4RG2A 4KR2A 1Q81U 4M78E 3VU3C 4C5EA 1RL2A 4QW2A 4EMKC 2QI2A 4IUTA 3CBOA 2KAFA 2ODRC 4P3OA 3CCMT 3LLRA 3RUXA 3HPWA 3J7AF 3QYHB 4EMKA 3WVDB 3ERRA 1KQ2A 2MMPA 1ZQ1A 2P0QA 3OS5A 4NCXA 3M4QA 3A7AA 1E1OA 2G4CA 2ZTGA 4R55A 1YFSA 4J6WA 5GANj 5C0MA 3TUPA 4KUIA 4A53A 5I2SA 4QVCA 4M7DF 2F69A 2E1HA 3OD1A 5CKFA 1WQ7A 3R6OA 2JZ2A 5LJ3d 5LJ3f 3P8DA 3ME9A 1USYA 5LJ5d 5HK3A 1YJNT 3QO3A 5FRMA 3VV0A 5HKCA 1HC7A 3NEMA 4DA4A 3RKXA 2ZZDA 2RB6A 1FXXA 3I56T 1X6OA 4CH4A 3PCOA 2ZIMA 3J80E 4L6V5 2JNGA 3CCUT 3JCMJ 4G84A 3QTCA 1VQ7T 3QPHA 3M4YA 4ZIBA 4M7AE 2QA4T 2KMTA 5DY9A 4YYEA 4BI8B 3L42A 4H2SA 4BI3A 1WYDA 3OYMA 2IG0A 2GQVA 2EYQA 2X4WA 5KE2A 3OA6A 4PJOG 2BUDA 3KBGA 3JCMW 2RM4A 3Q1JA 3CCLT 4P73A 5HK0A 1JB0E 4KR3A 2XGTA 4B9WA 2C8MA 4YRTA 2RK1A 3LSSA 3UGQA 1O75A 2RA2A 3CXCA 5FU7C 2K5IA 1EVLA 3HY1A 4PHCA 5CO7A 1ASYA 4RQEA 3P8YA 3HRUA 5CK9A 4XU2A 4LVKA 2ZGWA 1YFRA 1DJ7B 1K8AU 4KQEA 1L0WA 1OZ2A 4PJOF 4MMLA 1YBYA 1BIBA 1NYRA 5GANg 1SESA 3HRIA 3S3MA 4KBMB 2PUKB 3BFMA 1NYQA 3MO8A 3SFMA 3VQXA 2K57A 2X4XA 1H4QA 4HWTA 3IG2A 2CZ7B 3GNFB 5GAOl 4A4EA 4JS5A 1VQ4A 5CQYA 4XTYA 1BI2A 4HT4A 4H2XB 5I2MA 3JCMe 1NJIC 4YCUA 2KSSA 4EMHA 2QQRA 1VQ7A 3M57A 4ZN1A 2QEXA 1BI3A 4YRIA 2K2VA 4M78C 4HWPA 1K73C 4C8QE 4M7DD 2RJFA 3WQZA 4YCWA 1NPPA 4ELZC 3L2VA 4E47A 5LL6S 2HAXA 4E51A 2NLUA 3QO7A 3GIBA 2DXUA 2AMCB 4C8QD 5GANe 2Q7EA 1VQNT 3PMIA 1YIJT 2EKOA 2MI6A 3OYEA 3CCSA 1G3TA 3LWIA 3CC2A 3IKMB 1UEBA 2F5KA 3L2UA 2XK0A 1YHQA 1D3BB 1X75C 3L2ZA 1YITA 4LVLA 4LVIA 1LNXA 3H6ZA 3CMQA 2RHUA 5I21A 3DB4A 2QHVA 1X01A 2ZCFB 3EFSA 3QXEB 3RL6A 5GAMf 2VGNA 2KDSA 2YRVA 3CC2T 4TVWA 1FYFA 4FM4B 3FJPA 1NE8A 2I4OA 5GAN2 3SWNC 1BI1A 4LDVA 1EIYA 1HXDA 3EFRA 4EX5A 3ZFJA 2X4JA 2IVWA 2R57A 5LJ5g 2RHQA 3BW1A 1G5VA 3SWNB 4H2WA 1JJ2A 2CYZB 1Y96A 4PJOE 4OGEA 1QVFA 4UPAA 3OYYA 3OYKA 5GAN3 4XQ3A 3A8LB 3QO8A 2VGMA 3HL8A 1GXIE 4YDQA 4JS4A 1VQMA 4ZTUB 4JUVA 4M75A 1MGQA 2FB7A 3LC0A 4N0AC 1KC8U 4M78B 2V8IA 3JCMQ 4LDXA 4E7KA 1NJ6A 5J39A 5J26A 1EOVA 1M8VA 5GAN6 4YRFA 3L2WA 3JCMV 4YRJA 2ZT6A 5GMKi 3MEVA 3BDLA 1SERA 3C95A 3QSUA 2JTMA 2M16A 3HRSA 2DVEA 4XTXA 3GP8A 1E22A 3VYGA 4H2XA 3GLXA 3A8OB 4IUPA 3INZA 5K1XA 1YJWT 5A0DA 1KMNA 4NS5A 4OB2B 3HXUA 4P3NA 2QQBA 3CCQT 5GAN7 4LNSA 1GGMA 3BJUA 3CC4A 4F7UB 4XAXB 3X26B 1JJCB 5GAOn 3HFOA 2CS7A 3HKSA 4RMFA 1WNLA 3G4SA 3M59A 4C92F 4X9DA 4YRRA 3W3SA 4J15A 4N4HA 3F70A 4PL6A 1KQ1A 1RI0A 2Y90A 3QYGB 1PSEA 5GANh 3M58A 2VUBA 2RH2A 4J6YA 5GMKh 1YHQT 2VV5A 2XDPA 1IREB 4P74C 4ZGDB 5CR2A 1WJRA 2BKDN 3RIRA 2RI2A 4LVMA 4RMOA 1QW1A 2VYTA 1Y07A 2RHSA 4TVYA 4EMGA 3OSVA 4M75G 4F7UG 4OB3B 4LDUA 4BD3A 1B8AA 3OS0A 4TTVA 3MCAB 1Q7YU 1QE0A 3PTAA 1NJ2A 2ZPGB 2DTIA 4VUBA 4O2DA 3MF2A 4HCZA 4P74A 4O5VA 1YI2A 2CZ1B 5KCHA 4ELYC 2DTHA 2O4XB 3DLLA 3M55A 2HBPA 3CCUA 3TEHB 2XG8D 3HFZA 3JCMd 4LD9K 2FL7A 4MZMA 2D6FA 3CBPA 3SWNA 4M7DA 2QXFA 1SETA 2IY5A 4FSXA 2ZNIA 3REUA 1U1TA 2DEQA 1J5WA 2MWOA 1I8FA 3BY7A 4M7AB 4EMKB 2LCLA 4HWRA 1B34B 1Z7NA 2DU7A 1N9RA 2KQWA 5IN1A 1VQ6T 3RF1A 1K73U 4MMKA 2HQEA 1RIQA 1M9SA 3E9IA 3CD6A 3MHXA 1YGBA 4TVRA 3X28B 3NETA 2PMEA 4YRMA 1WQWA 2D0QB 5GANf 3PT9A 3WXMB 3BDUA 4C8QC 3KUFA 3LYIA 1B70A 4IKFA 5DM7R 1BYMA 2ZPHB 3MEAA 5A0LA 3L1AA 1M4ZA 1QVGA 3C4SA 3R07A 4P75A 1FWZA 2M1HA 2LC4A 3LH0A 4KULA 4ZGEB 4K88A 3L2QA 1W66A 3JB9J 2XI9A 3QJYA 1K9MC 3CCVA 3NFCA 3HXXA 1VUBA 3DKMA 4M77E 2ODRD 3OQ5A 3QJ6A 1Z7MA 3MP8A 3RMQA 4CI0C 2PVGB 3NTIA 5C53B 2RHXA 1B7YB 4BE2A 5J3BA 2RI5A 1I4K1 4M7AC 2CJBA 5F5WA 5D6XA 2AKWB 3CMAA 3MEUA 2HNIA 4J5YA 2OTJT 2DIQA 3CCRT 3QBYA 2PMFA 4F7UF 2E5QA 1LOJA 1O9SA 3OYIA 3G71T 3OSSC 3C12A 4KUDK 2RO0A 4QQDA 2ARSA 2PVDB 4M75D 3A7RA 2C7IA 3A5ZA 4B9XA 4RKUE 3QUIA 1V29B 1YFTA 3CBMA 2LRQA 1JBMA 1YB3A 5CKDA 4C0DB 2VXFA 3HRTA 3KFUA 3T9NA 3LSQA 4LD6A 4KT0E 5EG2A 3VYHB 2DKGA 2KVQG 3TEHA 4JRIA 4A4GA 2IY5B 4C5GA 2CGHA 3CCLA 3HXZA 1NPRA 2PVOB 2ZR3A 3FDRA 1BBWA 4PJOC 3A8GB 4TVAA 4PLLA 4JLGA 4OVAA 5IT9E 1N27A 2NS6A 2GFUA 2VXEA 1VQPA 4XEMA 1VQKT 4HKEA 3TCJA 2J3MA 2E3CA 3NTHA 4IUQA 3UGTA 3VQWA 1M5Q1 1C0AA 3CC7T 4JRQA 4UC4A 1X2HA 4N0AA 4Q5WA 2O01E 4XU0A 4MDXA 2FHDA 3E9GA 4XTWA 2L8DA 3M4GA 5CIUA 4C0ZA 4R56A 2QQAA 4X9CA 1X56A 4BY6B 2LVMA 3JCMf 2ZPBB 4BE1A 2ZZFA 3CPWA 4L5GA 3QDRB 1Q7YC 3HFNA 4QVZA 3FEOA 2LT1A 1BKBA 2RJEA 4M7DG 1M1FA 3RGLA 4ZN3A 4F7UE 1VQNA 1ADYA 1NJIU 4ZTFA 3S6WA 5KCOA 2FVUA 4YTLA 3MEYA 3ASKA 4PKCC 2RI3A 2ZPFB 4M7AF 2QEXT 4M78F 3UPUA 2P5IA 3A5ZB 2PUOB 4YCVA 2Y4XA 2ALYA 1VQ5A 3OYAA 1E24A 3HRKA 1PYSB 2E12A 4QVDA 2WSFE 3I7FA 5KNNA 1UGSB 3UT1A 5FLXE 4XU3A 1Y7XA 1H4SA 5GAMg 4EDUA 3GPLA 1YCYA 1VQOT 1IZ6A 1KQSA 4CH3A 4H2VA 1BI0A 3OS2A 4YPFA 2ZINA 1YJWA 1G51A 1N9SA 3A8MB 3OW2S 1H4VB 3OW2A 1U1SA 3OYDA 1YJNA 1WGSA 1VQZA 1M1GA 3I55A 2XIDA 3FRNA 4XU1A 2DIGA 3VQVA 3A5YA 4Y91A 4RDXA 5GAN8 3OMGA 1G5HA 1ZBXA 3P8HA 4M78A 1Q86C 4M7AG 4M75B 3CEYA 2GCXA 3ZBDA 4M77F 4AH6A 3DLMA 4OB1B 1NJ5A 4RCCA 4P3PA 3CCRA 3UWNA 2RK2A 4M75C 2P0PA 3JCMh 1G3SA 1G3WA 1X54A 3JB9F 2DXBA 2Y4YA 4UP8A 2DTOA 4C92C 1M90U 5LJ3g 1W2BA 2YLBA 3JB9G 2ARTA 2RHQB 5D6WA 4C8QB 2LQKA 1VQ4T 3QIIA 2Q5IA 1VQ9T 5LJ3h 4YROA 3P8VA 2PU9B 2A8EA 4L87A 4N4GA 4YRPA 4NL2A 4M7DB 5CQXA 2GF7A 4M7AA 3H8ZA 4HWSA 2RJCA 1VQLA 3I56A 1UB4A 4OP0A 2O4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DY9 A;  1D3B A;  4YYE A;  3TEG A;  4RCB A;  3REU A;  4H2S A;  1WYD A;  1U1T A;  2DEQ A;  3HSB A;  1J5W A;  1ASZ A;  2DXT A;  4XEO A;  2ZR2 A;  4TQD A;  4PJO G;  1EQR A;  1I5L A;  1I8F A;  1WPY A;  3BY7 A;  4M7A B;  4EMK B;  1JRI A;  2DZC A;  3JCM W;  1EFW A;  1HK9 A;  2RM4 A;  4HWR A;  4DPG A;  2ZZG A;  4UP9 A;  1B34 B;  4P73 A;  3L4G B;  1Z7N A;  2DU7 A;  1N9R A;  3M4P A;  4YP0 A;  3SB2 A;  4C92 E;  3FB9 A;  4KR3 A;  3RF1 A;  2XGT A;  1NJ8 A;  4MMK A;  2C8M A;  4CH6 A;  4TVA B;  4YRT A;  3A32 A;  1RIQ A;  3LSS A;  3UGQ A;  2ZNJ A;  2ZT8 A;  2DZ9 A;  3E9I A;  4DQ2 A;  3A7U A;  2RA2 A;  2AMC A;  1EVL A;  4C92 D;  3HY1 A;  1YGB A;  4PHC A;  1LJO A;  3NET A;  2PME A;  4YRM A;  1WQW A;  1ASY A;  2RHS B;  4RQE A;  5GAN f;  4H2Y A;  3E9H A;  3P8Y A;  4PG3 A;  2ZIO A;  4P71 C;  2Q7H A;  4XU2 A;  2ZT7 A;  2EJ9 A;  3BDU A;  3RER A;  2ZGW A;  4C8Q C;  1YFR A;  4KQE A;  1L0W A;  4P75 C;  4PJO F;  4C92 B;  1B70 A;  4MML A;  2I4M A;  1BIB A;  4JLI A;  1NYR A;  5GAN g;  1PYS A;  1SES A;  4YRK A;  1KOG A;  3HRI A;  5LJ5 e;  2I4L A;  5GAN 4;  3P8T A;  3L1A A;  3BFM A;  1NYQ A;  5GAM d;  1SRY A;  3VQX A;  3R07 A;  2K57 A;  2QTX A;  4P75 A;  3RKW A;  4PJO A;  1H4Q A;  2YHT A;  3DSQ A;  4HWT A;  3IG2 A;  1ATI A;  4A54 A;  5GAO l;  4XTY A;  4K88 A;  1W66 A;  3JB9 J;  3FIF A;  3QO5 A;  3HXV A;  1USY C;  4H2X B;  2YLC A;  4F7U A;  4CS2 A;  3PZC A;  3QHS A;  3HXX A;  5GMK j;  2XTI A;  4M77 E;  3JCM e;  4YCU A;  4M7D E;  2CJA A;  2ODR D;  3V7S A;  1Z7M A;  4EMH A;  5C53 B;  1B7Y B;  4YRI A;  4M78 C;  4HWP A;  4M77 A;  1I4K 1;  4C8Q E;  4M7D D;  4H2T A;  4M7A C;  2CJB A;  4Q15 A;  3WQZ A;  5F5W A;  2FYK A;  4YCW A;  2AKW B;  1JJC A;  2HNI A;  4J5Y A;  4E51 A;  3NEN A;  2AKW A;  3GIB A;  3QO7 A;  2DXU A;  3V8L A;  5GMK l;  2AMC B;  2PMF A;  1I81 A;  4C8Q D;  4F7U F;  1ADJ A;  1LOJ A;  3V8J A;  5GAN e;  2DQ0 A;  2Q7E A;  1B7Y A;  1IL2 A;  2ARS A;  1WU7 A;  3JCM X;  4M75 D;  3A7R A;  2C7I A;  2QHS A;  4P71 A;  3A5Z A;  2Q7G A;  4XTV A;  3QUI A;  4ZTZ B;  3IKM B;  3VBB A;  2E10 A;  2J3L A;  4C8Q F;  1YFT A;  5LJ5 f;  2E65 A;  3UH0 A;  2ARU A;  2QHU A;  2Q5H A;  4C92 A;  1D3B B;  1JBM A;  1YB3 A;  1H64 1;  3L2Z A;  4YRS A;  1TH7 A;  2VXF A;  3KFU A;  3LSQ A;  1HTT A;  4XTU A;  1LNX A;  4PNO A;  2DKG A;  3CMQ A;  5I21 A;  5C52 B;  2QHV A;  3RES A;  1X01 A;  3TEH A;  1N9W A;  4K87 A;  3EFS A;  4YRN A;  4JRI A;  3RL6 A;  5GAM f;  2IY5 B;  2CGH A;  3HTZ A;  1EVK A;  3HXZ A;  4TVW A;  4Q6G A;  1FYF A;  3L4G A;  3FJP A;  2I2L A;  2I4O A;  5GAN 2;  3SWN C;  2ZR3 A;  3PCO B;  1BBW A;  1EIY A;  4PJO C;  5LJ3 j;  3JCM b;  4TVA A;  1HXD A;  1NNH A;  4HA8 A;  3EFR A;  4YRE A;  4EX5 A;  4CS3 A;  1B76 A;  2EJG A;  5C51 B;  5LJ5 g;  2RHQ A;  4WF2 A;  1BIA A;  3BW1 A;  2VXE A;  4M78 G;  3UFG A;  3SWN B;  4H2W A;  4WI1 A;  4XEM A;  3A31 A;  3JB9 I;  1Y96 A;  2J3M A;  5LJ3 e;  4PJO E;  1BBU A;  4M77 D;  2QHT A;  4BWA A;  2E3C A;  1WLE A;  4UPA A;  1H4T A;  3UGT A;  2DDZ A;  3VQW A;  1M5Q 1;  5GAN 3;  4XQ3 A;  1C0A A;  1G5I A;  1X2H A;  4N0A A;  4C8Q A;  1X2G A;  3QO8 A;  4K86 A;  4XU0 A;  5GAO q;  1Y96 B;  2ZZE A;  4XTW A;  4YDQ A;  4XTZ A;  3HFZ B;  5LJ5 j;  3M4G A;  3JCM g;  4ZTU B;  4JUV A;  4M75 A;  3HY0 A;  5LJ5 h;  1MGQ A;  4HWO A;  2FB7 A;  2ZT5 A;  4P73 C;  4N0A C;  3LC0 A;  3V7C A;  4HT9 A;  4M78 B;  1X55 A;  3JCM Q;  1NJ6 A;  4X9C A;  3G1Z A;  1EOV A;  1X56 A;  1M8V A;  1QF6 A;  5GAN 6;  3HXW A;  2E64 A;  4YRF A;  5GAN 5;  1EIY B;  3JCM f;  4M7D C;  2ZZF A;  4M78 D;  3JCM V;  4YRJ A;  5GMK m;  2ZT6 A;  5GAM e;  1E1T A;  2RD1 A;  5GMK i;  1SER A;  3HFV A;  3HFN A;  2EWN A;  3QSU A;  4UP7 A;  3ICA A;  4M7D G;  2DVE A;  5GAM j;  3RGL A;  5GAO r;  3JB9 D;  4F7U E;  4XTX A;  1ADY A;  1E22 A;  3QNE A;  4H2X A;  3PGG A;  3RKY A;  4OLF A;  3INZ A;  5K1X A;  3VQY A;  5ELO A;  3MEY A;  3IAL A;  1KMN A;  4NL3 A;  3HXU A;  4P3N A;  4M7A F;  2EJF A;  2E5A A;  4YRL A;  5GAN 7;  2EL9 A;  4LNS A;  4V2S A;  4M78 F;  3AHU A;  4PJO B;  1GGM A;  3BJU A;  5K1P A;  4F7U B;  2JN0 A;  2P5I A;  4YRG A;  1LYL A;  4YRC A;  3A74 A;  4YCV A;  5GAN d;  1KMM A;  1NJ1 A;  2ALY A;  1E24 A;  3JB9 H;  1JJC B;  3HRK A;  5GAM h;  1PYS B;  5GAO n;  3HFO A;  3HXY A;  4RMF A;  4M75 F;  4QVD A;  3I7F A;  5KNN A;  2ZXF A;  1WNL A;  3JCM P;  4M77 B;  4XU3 A;  4M75 E;  4M7A D;  1H4S A;  4C92 F;  5GAM g;  4X9D A;  1YCY A;  4CH3 A;  4H2V A;  4X5O A;  4YPF A;  2ZIN A;  2I4N A;  4YRR A;  3W3S A;  2ZCE A;  1G51 A;  3JCM c;  4J15 A;  1N9S A;  2P0L A;  2ALY B;  2E41 A;  4KR2 A;  1KQ1 A;  4M78 E;  3NEL A;  1H4V B;  2Y90 A;  3VU3 C;  11AS A;  1B70 B;  3IKL A;  1U1S A;  5GAN h;  4EMK C;  3RAC A;  4C92 G;  4WJ3 M;  2DJZ A;  4HVC A;  2ODR C;  4NOY A;  4P3O A;  1VQZ A;  4J6Y A;  5GMK h;  4RQF A;  4CH5 A;  3RUX A;  4XU1 A;  3VQV A;  3A5Y A;  2EAY A;  4EMK A;  4P74 C;  4Y91 A;  4RDX A;  5GAN 8;  2DU5 A;  4TWA A;  1G5H A;  1KQ2 A;  3ERR A;  3RIR A;  12AS A;  3V7R A;  4M78 A;  4NCX A;  4M7A G;  2ZNI A;  3M4Q A;  4M75 B;  3A7A A;  1B34 A;  1E1O A;  5GAO p;  5ELN A;  4M77 F;  2G4C A;  2ZTG A;  4P72 C;  4H02 A;  1YFS A;  4J6W A;  5GAN j;  4AH6 A;  5GMK e;  1NJ5 A;  2RHS A;  3TUP A;  4TVY A;  3V8K A;  4RCC A;  4P3P A;  4J6X A;  4EMG A;  4A53 A;  4M75 G;  4QVC A;  4F7U G;  1B8A A;  4C8Q G;  4M7D F;  4TTV A;  3REX A;  2E1H A;  4M77 C;  4M75 C;  1QE0 A;  4P72 A;  3OD1 A;  3JCM h;  4HT8 A;  1NJ2 A;  1WQ7 A;  1X54 A;  3JB9 F;  4M77 G;  4H2U A;  4PJO D;  4YRQ A;  4UP8 A;  2DTI A;  5LJ3 d;  4O2D A;  2DTO A;  4C92 C;  4TQF A;  5LJ3 g;  5LJ3 f;  3MF2 A;  2YLB A;  4EO4 A;  1USY A;  5LJ5 d;  3JB9 G;  4WJ4 A;  2ART A;  4P74 A;  2RHQ B;  3MF1 A;  3QO3 A;  4C8Q B;  5GAO m;  1HC7 A;  3NEM A;  2Q5I A;  2DTH A;  4BW9 A;  3RKX A;  5LJ3 h;  4JRK A;  4YRO A;  2RB6 A;  3P8V A;  2CIM A;  4CH4 A;  4L87 A;  5E3I A;  3PCO A;  3TEH B;  3HFZ A;  4NL2 A;  4M7D B;  4YRP A;  3JCM d;  2ZIM A;  5HGQ A;  4M7A A;  4HWS A;  2DQ3 A;  3JCM J;  4G84 A;  5CAI A;  4G85 A;  3SWN A;  3QTC A;  4M7D A;  2CJ9 A;  4CS4 A;  1SET A;  4OP0 A;  2VC8 A;  2IY5 A;  4ZIB A;  4M7A E; 
#chains in the Genus database with same CATH topology
 1Q81 R;  1D3B A;  1AHJ B;  3TEG A;  4RCB A;  3OS1 A;  1VQ5 T;  1QVP A;  3HSB A;  1S72 T;  3CMA Q;  1MMD A;  2DXT A;  3REA B;  3HHT B;  2X3X D;  1I5L A;  1Q86 R;  3CME Q;  3QZ5 B;  1FMV A;  5CKB A;  1EFW A;  4E7H A;  2ZZG A;  4UP9 A;  1WYX A;  1QLY A;  2LTO A;  4AG1 C;  3PVL A;  2J05 A;  2RNA A;  4FCY A;  2DO3 A;  3MQZ A;  3G1J A;  2CH4 W;  1NJ8 A;  2VVK A;  2OTJ Q;  3A32 A;  1RAF B;  2AT1 B;  1SHG A;  2ZT8 A;  3A7U A;  1M2V B;  2B8A A;  2AMC A;  2P0K A;  2EQJ A;  1TG0 A;  3RBB B;  2G3R A;  4OMP A;  3VS6 A;  2RHS B;  3E9H A;  4PG3 A;  2DAQ A;  2ZIO A;  3PIP A;  2Q7H A;  5KYX A;  3LGF A;  2DMO A;  2EJ9 A;  2M0O A;  3RER A;  2NWM A;  3CC7 A;  1IGU A;  1VOM A;  4P75 C;  1OU9 A;  3G71 A;  3I5S A;  3TVT A;  1YJW Q;  4JLI A;  5FWC A;  1ZUY A;  2MWP A;  1D1A A;  1KOG A;  4DOV A;  5LJ5 e;  3G4S Q;  3M54 A;  2I4L A;  5GAN 4;  4LUE A;  2ZAE A;  4BDY A;  4FYY B;  1XNI A;  4J9I A;  3THK A;  1W70 A;  2CP5 A;  4PJO A;  3GOX A;  2YHT A;  3DSQ A;  1LCK A;  3M0S A;  1ATI A;  3MP1 A;  1VQ8 A;  3TSW A;  2RPN A;  1KG1 A;  2EPD A;  3QO5 A;  2DL8 A;  2CKK A;  3EGX A;  5FU6 C;  1USY C;  4MZT A;  5GMK j;  2XTI A;  4RTY A;  4M7D E;  3UDC A;  4BUG A;  2O9V A;  2XHC A;  3OYH A;  1GBR A;  3OW2 P;  2EQM A;  2XIC A;  4J9F A;  2KGT A;  3NMZ C;  1K0S A;  2RHY A;  1JJC A;  3URG A;  1S1N A;  2JVV A;  5AYF A;  1OI1 A;  3NEN A;  4J8O A;  2K3Y A;  3GF5 A;  3V8L A;  5GMK l;  1QCF A;  1WXT A;  3E2U A;  3VS1 A;  3CCQ A;  1MMN A;  2DER A;  2ATC B;  1WIE A;  2LT4 A;  3PIO A;  4C5I A;  1FX7 A;  3JCM X;  2DXC A;  1NEG A;  1G8X A;  1TXQ A;  5DLQ E;  2QHS A;  4P71 A;  1SPK A;  2O31 A;  1UG1 A;  5KH6 A;  3A98 A;  4XTV A;  3RNJ A;  1NLO C;  3VBB A;  1QP2 A;  4C8Q F;  1TUD A;  2QAS A;  5LJ5 f;  2E65 A;  3FLG A;  3UH0 A;  3CXC S;  3CCS T;  4C92 A;  4MDW A;  2A7Y A;  2DK3 A;  1B3Q A;  1H64 1;  2YRC A;  1TH7 A;  2QAZ A;  2XD0 A;  1HTT A;  3NTK A;  1UTI A;  4OGC A;  4OML A;  1PG5 B;  1IXD A;  1GL5 A;  1N9W A;  1MMG A;  3VKI A;  1W2B P;  4A4F A;  2QDY B;  4ESR A;  1QVG P;  2HKQ B;  2QGF B;  5CKE A;  1G3Y A;  1OPL A;  2LNH B;  3HTZ A;  1W4S A;  1EVK A;  2J6K A;  4FT4 A;  4Q6G A;  2D0N A;  4ZGJ B;  2EQU A;  3L4G A;  3OYB A;  2I2L A;  1UHF A;  3CPF A;  4AG2 C;  4P5N A;  5FU6 B;  4A4H A;  1SSF A;  2XDD A;  1KC8 R;  3PCO B;  3D7S B;  1PKT A;  2DL5 A;  3VUZ A;  5IAY A;  3CCV T;  3G6E A;  3JCM b;  3WVE B;  2DIL A;  3TRE A;  3NGP A;  1IB8 A;  3CC4 T;  2R5M A;  4PFZ A;  5C51 B;  3M5A A;  3HP9 A;  2FRW A;  1H8K A;  4WF2 A;  1BIA A;  4LXC A;  5FU7 B;  3H0F A;  1ZSZ B;  4M78 G;  3UFG A;  3CMA T;  3A31 A;  2MIO A;  2L0A A;  5LJ3 e;  5IHK A;  3EH2 A;  4M77 D;  3JAM E;  2QHT A;  1FYN A;  1WLE A;  3E1S A;  1VQ9 A;  2OTL A;  3H41 A;  2DDZ A;  3M53 A;  1WJQ A;  2WSE E;  2EYW A;  3SD4 A;  3G7Z A;  3EGU A;  3G6E T;  1GBQ A;  3VJP A;  1X2G A;  3CQT A;  3EHR A;  3EG1 A;  4AFS C;  5GAO q;  1Y96 B;  1JXM A;  3CME T;  4ZTJ A;  4CRI A;  1X2K A;  3CCS Q;  2H3J A;  2HBW A;  3E19 A;  4XTZ A;  3X20 B;  1SSH A;  3JCM g;  4FU6 A;  1YJN Q;  3MP6 A;  4BDZ A;  3V7C A;  4HCC A;  4HT9 A;  3EAE A;  2M9U A;  1X55 A;  1N8R R;  1YJ9 A;  4II1 A;  3HXW A;  2E64 A;  1QP3 A;  1EIY B;  2WAC A;  4M7D C;  1Y71 A;  4BB7 A;  1OZ3 A;  2CUB A;  4M78 D;  2LP5 A;  5C6S A;  3L2R A;  1E1T A;  2RD1 A;  4FIB A;  2W0Z A;  2K6D A;  3HFV A;  5L8R E;  2WSC E;  2X4Y A;  1M1K R;  2HL5 C;  4QQ6 A;  2E70 A;  3OYN A;  2KT1 A;  5GAO r;  3QNE A;  2RHI A;  2DD4 A;  3I55 T;  3MET A;  1N6A A;  5FRN A;  1EIF A;  4E7L A;  1JJ2 S;  3X25 B;  3IQL A;  2E3H A;  1SRL A;  2EGE A;  3A8H B;  4C5H A;  2HQX A;  4X34 A;  4IUV A;  3OMC A;  2EJF A;  1MHN A;  2YUO A;  2E5A A;  1OEB A;  2CUD A;  2MYS A;  3E9F A;  4PJO B;  1RAE B;  1UGQ B;  2L3R A;  1TSF A;  2JN0 A;  2ZPI B;  3MEW A;  1AEY A;  4YRC A;  2YT6 A;  2X9H A;  4RUG A;  5GAN d;  2K5L A;  1KMM A;  2K4Y A;  1NJ1 A;  1EZZ B;  1X2Q A;  1IHW A;  1J3T A;  5GAM h;  5M9O A;  1QCN A;  4PJN A;  2YUP A;  4A63 B;  3JCM P;  2P84 A;  4M7A D;  3EFO B;  4E6R A;  1K0X A;  1OU8 A;  3OBW A;  3SHW A;  3TEE A;  4GY5 A;  3U23 A;  2E4H A;  1M1K U;  2ZCE A;  3EG3 A;  3JCM c;  1M1K C;  1R8O B;  1UJ0 A;  2E41 A;  2A36 A;  1SF9 A;  3X24 B;  3NEL A;  2LNV A;  2OTL Q;  4LVJ A;  11AS A;  3PMT A;  1B70 B;  4RG8 A;  3IKL A;  4JJD A;  1S72 Q;  5KYN A;  3RAC A;  4C92 G;  4WJ3 M;  2DJZ A;  2XMF A;  4HVC A;  4CC2 A;  4ZNX A;  4NOY A;  1X69 A;  5CKH A;  1KHI A;  4RQF A;  1VYT A;  4CH5 A;  2GFA A;  1N8R U;  4BI4 A;  2EAY A;  2F5T X;  2DU5 A;  3CCL Q;  2MF2 A;  2LQ8 A;  4TWA A;  2A08 A;  4E7I A;  3V7R A;  12AS A;  2HL3 A;  3PFS A;  2C0T A;  1YJ9 T;  3LGL A;  1B34 A;  1PWT A;  2F1L A;  5GAO p;  3CD6 Q;  5ELN A;  1Z9Q A;  2LQW A;  4KRT A;  4P72 C;  4H02 A;  5GMK e;  3O8V A;  3CD6 T;  1KD1 R;  1YIT T;  3V8K A;  4J6X A;  2GGR A;  2XDB A;  1UGR B;  4O6J A;  3PVQ A;  2J6O A;  4J83 A;  4C8Q G;  3CCU Q;  1VQ6 A;  1NZ9 A;  3REX A;  4F16 A;  4M77 C;  2PQW A;  4P72 A;  4HT8 A;  3UA7 A;  5A2Q E;  2GBQ A;  4M77 G;  4H2U A;  4PJO D;  4YRQ A;  5A0G A;  3LW5 E;  4TQF A;  1MND A;  2DL3 A;  4EO4 A;  2LDM A;  3CCE A;  5KE3 A;  1PSF A;  4WJ4 A;  2F2X A;  1VQP T;  2CZ6 B;  1RAC B;  1JJ2 P;  3MF1 A;  1KC8 C;  2RF0 A;  1X6B A;  5GAO m;  2OTL T;  2DEU A;  4BW9 A;  4JRK A;  1Q82 C;  2CIM A;  4JJN K;  5E3I A;  3OY9 A;  1WHM A;  2QK0 A;  5HGQ A;  2O2O A;  1U8R A;  1WHG A;  2DQ3 A;  2HEQ A;  4DBH A;  4C0F A;  5CAI A;  4G85 A;  1UJY A;  2CJ9 A;  4CS4 A;  2FPE A;  3N5B B;  1KD1 U;  9ATC B;  3VS7 A;  2VC8 A;  3LX7 A;  4QKU A;  2PTK A;  3PNW C;  2XKO C;  4RTT A;  1QVF S;  2K5F A;  2E6N A;  4MZP A;  1Q95 G;  1NG2 A;  1ASZ A;  4Z8A A;  2KY9 A;  4XEO A;  2ZR2 A;  4TQD A;  1Q7Y R;  1EQR A;  2D9T A;  1WPY A;  1JRI A;  2X35 A;  2DZC A;  3ZEH A;  2CP3 A;  1HK9 A;  4FYX B;  4DPG A;  4FT2 A;  2A37 A;  3QKJ A;  3L4G B;  1YIJ Q;  4ATO A;  4YP0 A;  3M4P A;  2NUP B;  4FW1 A;  2K9G A;  3SB2 A;  4C92 E;  3FB9 A;  2JOY A;  2EW3 A;  3OYG A;  4CH6 A;  4TVA B;  2ZNJ A;  2DZ9 A;  4DQ2 A;  2BZX A;  2JT4 A;  2FPF A;  2AZS A;  4C92 D;  2ECZ A;  3VRY A;  1LJO A;  2R58 A;  3FC3 A;  1VQM T;  3TU4 K;  4H2Y A;  3GNG A;  3S3O A;  2JTE A;  4P71 C;  1K9M U;  2ZT7 A;  4JZ4 A;  1OPK A;  3UF4 A;  4C0D C;  4IUU A;  2HCK A;  2CT3 A;  3ER0 A;  3EHQ A;  4L59 A;  5D6Y A;  5DLO A;  1M90 C;  1UEC A;  4C92 B;  2I4M A;  2QA4 A;  1PYS A;  4YRK A;  3P8T A;  1HYO A;  2C06 A;  2DET A;  4B6M A;  1SHF A;  5GAM d;  1SRY A;  2QTX A;  4A4K A;  2CH4 A;  3CCJ T;  3RKW A;  2SRC A;  4BY6 C;  1OYX A;  3OB9 A;  5IXF A;  2MCN A;  4A54 A;  1MV0 B;  2Z0W A;  1V76 A;  3FIF A;  3HXV A;  3C0C A;  4JRP A;  3G6E Q;  2YLC A;  5HY6 A;  4F7U A;  2K7A A;  3PZC A;  4CS2 A;  1W2B S;  3QHS A;  4LN2 A;  2OJ2 A;  4Z88 A;  1WXU A;  1BU1 A;  1PHT A;  2CJA A;  2QTV A;  3V7S A;  5KYW A;  1NEB A;  2LJ3 A;  1VIE A;  2AKL A;  2R5A A;  4OMF B;  2SEM A;  4IUR A;  1VQL T;  4M77 A;  4ME7 A;  3QZ9 B;  3PE0 A;  4H2T A;  4KH1 B;  4Q15 A;  2FYK A;  2RHZ A;  4HCB A;  2JJ9 A;  1KHC A;  4ANJ A;  1QVG S;  2AKW A;  1HD3 A;  2CZ0 B;  2K2M A;  1VQ8 T;  1ACM B;  1I81 A;  2QQ9 A;  4LE9 A;  2COZ A;  1KQS S;  3V8J A;  1ADJ A;  2DQ0 A;  2DL7 A;  2JUF A;  4PLI A;  1B7Y A;  3JSC A;  4Y28 E;  1CKA A;  2HD0 A;  2EYZ A;  2BE7 D;  1IL2 A;  1WU7 A;  2K79 A;  1NYF A;  4OB0 B;  1M27 C;  4KGX B;  1H3Z A;  4E7S A;  2YRD A;  2Q7G A;  2D8H A;  3M56 A;  3TSZ A;  4ZTZ B;  4GBQ A;  2A3L A;  3CXC P;  3CCE Q;  2K3X A;  2E10 A;  2J3L A;  2J6F A;  2ARU A;  2EIF A;  1KIK A;  2QHU A;  2V26 A;  2Q5H A;  2DPP B;  3CCM A;  2PNI A;  3JRZ A;  2QQS A;  1ZHI A;  4EPC A;  1VIF A;  4E7J A;  1T3L A;  3CPW S;  2EFI A;  1C0M A;  4YRS A;  4WCI A;  4F14 A;  5CVI A;  4XTU A;  3OYF A;  4PNO A;  2J06 A;  4J7I A;  3S3N A;  4DBR A;  3AT1 B;  5C52 B;  1WJS A;  1M2V A;  3RES A;  3I55 Q;  2LQN A;  2ZPE B;  5KYY A;  4C0G A;  4K87 A;  4YRN A;  3SDZ A;  4OF1 A;  1S72 A;  2E6Z A;  4BE0 A;  3CCJ Q;  2PZ1 A;  1ZSZ C;  1XQH A;  1AT1 B;  1U06 A;  1Z9Z A;  2CP0 A;  1W6X A;  2XU8 A;  2L5Q A;  2B86 A;  1C1A A;  4Z02 A;  2OAU A;  3P8B B;  1YP5 A;  2LX9 A;  5LJ3 j;  1YIJ A;  2AHJ B;  1NM7 A;  4IIM A;  1NNH A;  4HA8 A;  4YRE A;  4CS3 A;  1B76 A;  2QDL A;  2EJG A;  1UE9 A;  1WX6 A;  4EIK A;  2DE0 X;  4K11 A;  1M8M A;  2P4T A;  2V8K A;  3CCJ A;  3DB3 A;  4WI1 A;  1VQK A;  3CCE T;  3JB9 I;  2V8J A;  1VQO A;  1BBU A;  4BWA A;  1RAB B;  1FMW A;  1PC0 A;  3G4S T;  1VQ6 Q;  1H4T A;  1KD1 C;  4FL6 A;  1N8R C;  4LDY A;  1RAG B;  1G5I A;  1P92 A;  4IIO A;  4JDS A;  1BCO A;  1JEG A;  4C8Q A;  3OBY A;  4J7F A;  4K86 A;  5FRO A;  2ZZE A;  1YCS B;  1AWW A;  2RJD A;  4JJB A;  1Q82 U;  1GCP A;  2CP6 A;  4DOW A;  2FPD A;  5LJ5 j;  3HFZ B;  3HY0 A;  5LJ5 h;  1E6H A;  4HWO A;  2ZT5 A;  4P73 C;  2HKN A;  3M9Q A;  1T0H A;  2JTF A;  2HSP A;  1UGP B;  3G1Z A;  3VUB A;  1QF6 A;  4N4I A;  3OYC A;  5GAN 5;  4LDW A;  3MJX A;  4Y92 A;  2DA9 A;  4E7Z A;  5GMK m;  5GAM e;  4DBF A;  3OYL A;  3C94 A;  1AVZ C;  5GJV B;  2LCC A;  3CME A;  1NLP C;  1PRL C;  2EWN A;  4OMN A;  4UP7 A;  2KR3 A;  3ICA A;  1EX4 A;  5GAM j;  3JB9 D;  2JMC A;  2RQU A;  3M0Q A;  3J81 E;  3OYJ A;  2OTJ A;  3PGG A;  4QQG A;  3RKY A;  4FSS A;  2K3B A;  4OLF A;  1I5O B;  3VQY A;  2A0F B;  5ELO A;  3H9N A;  1D0X A;  4AT1 B;  3IAL A;  1Q86 U;  3EFO A;  3RMS A;  2KXD A;  4NL3 A;  2LMJ A;  4GLK A;  4YRL A;  2EL9 A;  1C6V X;  3JV3 A;  2RQT A;  3AHU A;  4V2S A;  1QMC A;  3LWH A;  5K1P A;  4Z89 A;  2KRS A;  2FZG B;  4YRG A;  4HVU A;  2NUT B;  4BAC A;  1XTD A;  1XOV A;  1YI2 T;  2EQK A;  3QG1 A;  1LYL A;  1WXB A;  3A74 A;  4PK4 A;  2EYX A;  4D6W A;  3KXT A;  3JB9 H;  3HXY A;  1MMA A;  4M75 F;  2ZXF A;  4XK8 E;  4M77 B;  2DD5 A;  4M75 E;  2KK4 A;  2L89 A;  1Q81 C;  1K8A C;  5KYW B;  4X5O A;  2MAM A;  1QKW A;  2I4N A;  2ENM A;  5CCA A;  2BIV A;  2P0L A;  2ALY B;  3I56 Q;  4RG2 A;  4KR2 A;  1Q81 U;  4M78 E;  2OX7 A;  2D8J A;  3RDV A;  3VU3 C;  4C5E A;  1RL2 A;  4QT7 A;  4QW2 A;  4EMK C;  2QI2 A;  4IUT A;  3CBO A;  2KAF A;  2KE9 A;  2ODR C;  2DL4 A;  4P3O A;  3CCM T;  5D7U A;  3LLR A;  2L3Q A;  3RUX A;  3HPW A;  3J7A F;  3QYH B;  4EMK A;  1WA7 A;  3WVD B;  3ERR A;  1KQ2 A;  2MMP A;  1ZQ1 A;  2P0Q A;  3OS5 A;  4NCX A;  3M4Q A;  3A7A A;  1TUC A;  2VKN A;  1E1O A;  2G4C A;  2ZTG A;  4R55 A;  1YFS A;  4J6W A;  5GAN j;  5C0M A;  3TUP A;  5I11 A;  1YN8 A;  4KUI A;  1K8A R;  4A53 A;  5I2S A;  4QVC A;  1ZSZ A;  4M7D F;  2F69 A;  2E1H A;  2F2V A;  3OD1 A;  5CKF A;  1WQ7 A;  3R6O A;  2GTO A;  2KI7 A;  2JZ2 A;  4AFU C;  4LNP A;  2YSQ A;  5LJ3 d;  2YUN A;  5LJ3 f;  3P8D A;  3ME9 A;  1FMK A;  1USY A;  5LJ5 d;  1K1Z A;  5HK3 A;  1YJN T;  4J9D A;  1ARK A;  3QO3 A;  5FRM A;  3VV0 A;  5HKC A;  1HC7 A;  3NEM A;  4DA4 A;  3RKX A;  2ZZD A;  2RB6 A;  2VAS A;  1FXX A;  2X3W D;  1PD0 A;  3I56 T;  1X6O A;  2DF6 A;  4CH4 A;  3PCO A;  1UUE A;  3QDF A;  4PJM A;  2ZIM A;  2DRK A;  2ABL A;  3J80 E;  4HVV A;  4L6V 5;  2JNG A;  3CCU T;  2FZK B;  2JS2 A;  3JCM J;  4G84 A;  3QTC A;  5I22 A;  1VQ7 T;  3QPH A;  3M4Y A;  2DBM A;  2C0O A;  4ZIB A;  4M7A E;  2QA4 T;  2KMT A;  5DY9 A;  1ZUU A;  4CC4 B;  2KBT A;  4YYE A;  4BI8 B;  3L42 A;  3EG0 A;  3VS3 A;  4BI3 A;  1WYD A;  4H2S A;  3OYM A;  2IG0 A;  2GQV A;  2EYQ A;  2X4W A;  5KE2 A;  3OA6 A;  1ZA2 B;  4PJO G;  2JM8 A;  2BUD A;  3KBG A;  3JCM W;  1JQQ A;  2RM4 A;  3Q1J A;  2CSI A;  3CCL T;  4P73 A;  4RTU A;  5HK0 A;  4PFO A;  2O88 A;  2J7I A;  1JB0 E;  4KR3 A;  2XGT A;  4FYW B;  3VS4 A;  4B9W A;  2C8M A;  4YRT A;  2RK1 A;  3LSS A;  3UGQ A;  5EC7 A;  1O75 A;  2RA2 A;  3CXC A;  5FU7 C;  2K5I A;  1EVL A;  3HY1 A;  4PHC A;  5CO7 A;  2V1Q A;  1ASY A;  1TU0 B;  1I1J A;  4RQE A;  3P8Y A;  3HRU A;  4DBQ A;  5CK9 A;  1R0B G;  4XU2 A;  4LVK A;  4GLM A;  1GFC A;  2ZGW A;  1RLQ C;  1YFR A;  1DJ7 B;  1OX8 A;  1K8A U;  1AZG B;  4KQE A;  1L0W A;  1OZ2 A;  4PJO F;  4MML A;  1YBY A;  1RAD B;  1CKB A;  1BIB A;  3VRZ A;  1NYR A;  5GAN g;  1SES A;  1K76 A;  3HRI A;  3S3M A;  4KBM B;  2PUK B;  3BFM A;  1H92 A;  1NYQ A;  3MO8 A;  3SFM A;  3VQX A;  2K57 A;  2LZ6 B;  4CC7 A;  1M90 R;  2X4X A;  1H4Q A;  1T3S A;  4HWT A;  2E5K A;  3IG2 A;  2CZ7 B;  3GNF B;  5GAO l;  4A4E A;  4JS5 A;  1VQ4 A;  5CQY A;  2KXC A;  4XTY A;  2EVR A;  3CCQ Q;  1BI2 A;  4LUD A;  1KQS P;  1E7O A;  4HT4 A;  4H2X B;  1ABO A;  5I2M A;  3FJ5 A;  2ED0 A;  1G2B A;  3JCM e;  1NJI C;  4YCU A;  2KSS A;  4EMH A;  3CCM Q;  2QQR A;  4D8D A;  1VQ7 A;  2M51 A;  3M57 A;  4ZN1 A;  2QEX A;  1XJW B;  2RQW A;  1BI3 A;  4YRI A;  2K2V A;  2CRE A;  4M78 C;  4HWP A;  2JMA A;  2DYB A;  1VQK Q;  1K73 C;  4C8Q E;  4M7D D;  2RJF A;  3WQZ A;  4YCW A;  1NPP A;  4ELZ C;  3L2V A;  4E47 A;  5LL6 S;  2COY A;  2HAX A;  4E51 A;  1RLP C;  2HQH A;  2NLU A;  3GIB A;  3QO7 A;  2DXU A;  2AMC B;  4C8Q D;  1AWO A;  5GAN e;  2Q7E A;  1VQN T;  1HJD A;  1N5Z A;  1PD1 A;  3PMI A;  1YIJ T;  2EKO A;  3A1P A;  2MI6 A;  1OUL A;  3M0R A;  3OYE A;  3CCS A;  1G3T A;  4KGZ B;  3LWI A;  1VA7 A;  4JJC A;  3CC2 A;  3IKM B;  1UEB A;  1YI2 Q;  2F5K A;  3MPU B;  3L2U A;  2XK0 A;  1YHQ A;  2DFU A;  2DX1 A;  1D3B B;  2AK5 A;  1X75 C;  3L2Z A;  1YIT A;  4LVL A;  4AMC A;  4LVI A;  3CPW P;  2H8H A;  3G71 Q;  1LNX A;  4JZ3 A;  2JS0 A;  3H6Z A;  3R6N A;  3CMQ A;  2RHU A;  5I21 A;  3DB4 A;  2QHV A;  1X01 A;  1K9A A;  2ZCF B;  3EFS A;  3QXE B;  3RL6 A;  3ULR B;  1T0J A;  3CC2 Q;  5GAM f;  4HVW A;  1WHH A;  2JM9 A;  1Y0M A;  1E6G A;  2VGN A;  2KDS A;  2YRV A;  3CC2 T;  4TVW A;  1FYF A;  4FM4 B;  3FJP A;  1NE8 A;  2NYS A;  2I4O A;  5GAN 2;  5FW9 A;  3SWN C;  3CC4 Q;  3KFV A;  1BI1 A;  4LDV A;  3H0H A;  1EIY A;  3CCV Q;  1HXD A;  3EFR A;  4EX5 A;  3ZFJ A;  4OMQ A;  2AIR B;  2X4J A;  2IVW A;  2R57 A;  5LJ5 g;  2RHQ A;  3BW1 A;  3I9Q A;  3EGD B;  1G5V A;  1IO6 A;  3SWN B;  4H2W A;  1BBZ A;  1JJ2 A;  2CYZ B;  1Y96 A;  4PJO E;  1F1B B;  1WDX A;  4OGE A;  1QVF A;  4UPA A;  3OYY A;  3OYK A;  5GAN 3;  4XQ3 A;  3A8L B;  3QO8 A;  2VGM A;  1QCO A;  3HL8 A;  1GXI E;  4YDQ A;  4JS4 A;  1VQM A;  4ZTU B;  4JUV A;  1X6G A;  1D1B A;  4M75 A;  1ZLM A;  1MGQ A;  2FB7 A;  4N0A C;  3LC0 A;  1KC8 U;  4M78 B;  2V8I A;  3JCM Q;  4LDX A;  4E7K A;  1NJ6 A;  5J39 A;  5J26 A;  1EOV A;  1M8V A;  5GAN 6;  4YRF A;  1MNE A;  4RTX A;  3L2W A;  3JCM V;  4YRJ A;  2QYZ A;  2ZT6 A;  2DRM A;  5GMK i;  3MEV A;  3BDL A;  1PNJ A;  1SER A;  1VQ9 Q;  2HSE B;  3C95 A;  3QSU A;  2JTM A;  1I07 A;  1UHC A;  2M16 A;  3HRS A;  2DVE A;  3EG9 B;  4XTX A;  3GP8 A;  1E22 A;  2IPO B;  2GTJ A;  3VYG A;  4H2X A;  3GLX A;  3A8O B;  4IUP A;  3INZ A;  5K1X A;  1YJW T;  5A0D A;  1KMN A;  4NS5 A;  4OB2 B;  3HXU A;  1ZA1 B;  4P3N A;  2QQB A;  3CCQ T;  2FEI A;  5GAN 7;  2BTT A;  4LNS A;  1GGM A;  3BJU A;  3CC4 A;  4F7U B;  4HCK A;  1IGQ A;  4XAX B;  3X26 B;  1VQP Q;  1SG5 A;  3GBQ A;  1JJC B;  5GAO n;  3HFO A;  2CS7 A;  3HKS A;  4RMF A;  1WNL A;  3G4S A;  1PRM C;  2FZC B;  3M59 A;  4C92 F;  1YFN A;  4X9D A;  2V1R A;  3EG2 A;  1OOT A;  3TQ7 P;  1JU5 C;  1VYU A;  4YRR A;  3W3S A;  4J15 A;  4N4H A;  3F70 A;  4PL6 A;  1KQ1 A;  4PJJ A;  1RI0 A;  1JXO A;  2Y90 A;  3QYG B;  1PSE A;  2AZV A;  1YIT Q;  1M3A A;  5GAN h;  1VQ5 Q;  2EQI A;  2CP7 A;  5L23 A;  3M58 A;  2VUB A;  2RH2 A;  4J6Y A;  5GMK h;  1YHQ T;  1WLP B;  1D0Z A;  3EGX B;  2VV5 A;  3ZL7 C;  2XDP A;  4F04 B;  2EGC A;  1IRE B;  4P74 C;  4ZGD B;  1D09 B;  5CR2 A;  1WJR A;  1YNZ A;  2BKD N;  3RIR A;  2RI2 A;  4LVM A;  1UGV A;  1KSW A;  4RMO A;  1U3O A;  1QW1 A;  2IIM A;  4KGV B;  1G83 A;  2VYT A;  1YWP A;  1Y07 A;  1PCX A;  2DLP A;  1X27 A;  2RHS A;  4TVY A;  1WHK A;  2OAW A;  4EMG A;  1UDL A;  3OSV A;  4M75 G;  4F7U G;  4OB3 B;  4LDU A;  4BD3 A;  1B8A A;  3OS0 A;  4TTV A;  2P4R A;  3MCA B;  1Q7Y U;  2GQI A;  1QE0 A;  5KYX B;  1D1C A;  3PTA A;  1NJ2 A;  1H3H A;  1SKU B;  1OV3 A;  2FO0 A;  2ZPG B;  2DTI A;  1VQ4 Q;  4VUB A;  3UA6 A;  4O2D A;  2VWF A;  2RQR A;  1R77 A;  3MF2 A;  2RN8 A;  4HCZ A;  1X43 A;  2DYI A;  4E2F B;  4O5V A;  1YI2 A;  4P74 A;  2CZ1 B;  5KCH A;  4ELY C;  1JO8 A;  3QWX X;  1LVK A;  4JPB W;  2DTH A;  1A0N B;  2L3P A;  2O4X B;  1I0C A;  4J9G A;  3DLL A;  3M55 A;  2HBP A;  3CCU A;  1TTH B;  3TEH B;  2XG8 D;  3HFZ A;  3JCM d;  4J9B A;  2ROL A;  1GCQ A;  4LD9 K;  2GNC A;  2FL7 A;  4MZM A;  1SRM A;  2ED1 A;  1QWE A;  2D6F A;  3CBP A;  3SWN A;  4M7D A;  2QXF A;  1SET A;  1HSQ A;  1U5S A;  2IY5 A;  4FSX A;  2ZNI A;  1B07 A;  2NUZ A;  3REU A;  1U1T A;  2DEQ A;  1J5W A;  2ESW A;  2MWO A;  1AZE A;  1I8F A;  3BY7 A;  4M7A B;  4EMK B;  1GRI A;  1QWF A;  2LCL A;  4HWR A;  1UFF A;  1B34 B;  1Z7N A;  2DU7 A;  1N9R A;  2KQW A;  5IN1 A;  1VQO Q;  5FWB A;  1VQ6 T;  3RF1 A;  1K73 U;  4MMK A;  2HQE A;  1RIQ A;  1M9S A;  4M4Z A;  3E9I A;  2BZ8 A;  3MHX A;  3CD6 A;  2DJQ A;  1YGB A;  4TVR A;  3X28 B;  1MUZ A;  3NET A;  2PME A;  4YRM A;  1WQW A;  5HCK A;  2D0Q B;  1CSK A;  5GAN f;  2M0Y A;  2KRM A;  2HMA A;  3PT9 A;  3WXM B;  1EFN A;  3BDU A;  3EH1 A;  2D1X A;  4OMM A;  5KYU B;  2QEX Q;  4C8Q C;  2DVJ A;  1AWX A;  3KUF A;  4F17 A;  3LYI A;  1M3C A;  1B70 A;  5KYY B;  4IKF A;  5DM7 R;  1BYM A;  2FRY A;  2ZPH B;  3MEA A;  4AFQ C;  5A0L A;  1WHJ A;  3L1A A;  1M4Z A;  1PKS A;  1QVG A;  3UAT A;  1RAI B;  3C4S A;  1KFZ A;  2HZY A;  3R07 A;  4P75 A;  1FWZ A;  1RAH B;  1WI7 A;  2M1H A;  1QQJ A;  3LH5 A;  1PM3 A;  2LC4 A;  2HDA A;  3LH0 A;  4KUL A;  2EBP A;  1AD5 A;  4ZGE B;  4K88 A;  3L2Q A;  1W66 A;  2RQV A;  3JB9 J;  4X1V A;  2XI9 A;  3QJY A;  1K73 R;  1K9M C;  3CCV A;  3NFC A;  2CT4 A;  3QWY A;  3HXX A;  1VUB A;  3DKM A;  4M77 E;  2ODR D;  3OQ5 A;  3QJ6 A;  1Z7M A;  3MP8 A;  1AOJ A;  3RMQ A;  4CI0 C;  2PVG B;  3NTI A;  5C53 B;  1KK7 A;  2RHX A;  5ECA A;  1B7Y B;  4ORZ A;  5IH2 A;  3VS5 A;  4BE2 A;  5J3B A;  2RI5 A;  1K9M R;  1OQK A;  1I4K 1;  2DM1 A;  4M7A C;  2CJB A;  5F5W A;  5D6X A;  2AKW B;  3CMA A;  1VQL Q;  3MEU A;  2HNI A;  4J5Y A;  2OTJ T;  2DIQ A;  3CCR T;  3QBY A;  2PMF A;  1TS9 A;  4F7U F;  2E5Q A;  1LOJ A;  1O9S A;  1TOV A;  1NJI R;  3OYI A;  3G71 T;  2YWW A;  3OSS C;  4DEY A;  2BE9 B;  2YXY A;  3C12 A;  1SEM A;  4KUD K;  2RO0 A;  4QQD A;  2ARS A;  2MPX C;  1VQ8 Q;  2PVD B;  4M75 D;  3A7R A;  2C7I A;  1M2O A;  3A5Z A;  4B9X A;  2YDL A;  4RKU E;  2COW A;  3QUI A;  1V29 B;  1WHL A;  1YFT A;  1R0C B;  1QKX A;  1W1F A;  2KNB B;  3CBM A;  1RI9 A;  2LRQ A;  1JBM A;  1YB3 A;  4J9H A;  5CKD A;  4C0D B;  1IRX A;  3CC7 Q;  2VXF A;  3HRT A;  3KFU A;  3T9N A;  3LSQ A;  3BE3 A;  4KT0 E;  1ABQ A;  4LD6 A;  5EG2 A;  3VYH B;  5IHN A;  1VQN Q;  4PFP A;  4RTW A;  2DKG A;  1IHV A;  2KVQ G;  2MK5 A;  1WFW A;  3TEH A;  4JRI A;  2FG0 A;  4A4G A;  2IY5 B;  4C5G A;  2CGH A;  3CCL A;  4R0K A;  3HXZ A;  1NPR A;  2CSQ A;  2PVO B;  2QGG A;  2ZR3 A;  3FDR A;  3SEM A;  4AFZ C;  1BBW A;  4PJO C;  3A8G B;  2JW4 A;  4TVA A;  4RTZ A;  1GFD A;  4PLL A;  2C0I A;  4JLG A;  2NUP A;  4OVA A;  2ROT A;  5IT9 E;  1N27 A;  2NS6 A;  2GFU A;  4PJL A;  2LCS A;  5IHI A;  2VXE A;  5IXB A;  2KEA A;  1VQM Q;  1VQP A;  1GCQ C;  4XEM A;  1VQK T;  3RR6 A;  4HKE A;  3TCJ A;  2J3M A;  1RAA B;  7AT1 B;  2E3C A;  3NTH A;  4IUQ A;  1M3B A;  3UGT A;  3VQW A;  1M5Q 1;  1C0A A;  3CC7 T;  2KT8 A;  4JRQ A;  4UC4 A;  1X2H A;  4N0A A;  4Q5W A;  2O01 E;  4XU0 A;  4MDX A;  3VS2 A;  2FHD A;  3E9G A;  4XTW A;  4CC3 A;  2L8D A;  3M4G A;  5CIU A;  4C0Z A;  4R56 A;  2QQA A;  4X9C A;  1X56 A;  4BY6 B;  2KRN A;  2LVM A;  3JCM f;  1LPL A;  2ZPB B;  4BE1 A;  2ZZF A;  1MV3 A;  2OI3 A;  2DNU A;  1NBE B;  3CPW A;  1V1C A;  1BK2 A;  1ZSG A;  1NYG A;  4L5G A;  3QDR B;  1ZUK A;  1Q7Y C;  3CCR Q;  3HFN A;  2L3S A;  2F2W A;  3MKD A;  4QVZ A;  3FEO A;  2LT1 A;  1BKB A;  2MOX A;  2RJE A;  2DBK A;  4M7D G;  1YWO A;  1M30 A;  1M1F A;  8ATC B;  3RGL A;  4ZN3 A;  4F7U E;  1VQN A;  1ADY A;  1NJI U;  4ZTF A;  3S6W A;  5KCO A;  1VQ7 Q;  2FVU A;  4YTL A;  3MEY A;  3ASK A;  2EGA A;  4PKC C;  1Q82 R;  2RI3 A;  4OMO A;  2EYY A;  2ZPF B;  4M7A F;  1OX9 A;  2QEX T;  4M78 F;  4FW2 A;  3UPU A;  2P5I A;  3A5Z B;  2PUO B;  4YCV A;  2Y4X A;  1VQ5 A;  2ALY A;  2QA4 Q;  3OYA A;  2G6F X;  1E24 A;  3HRK A;  1PYS B;  2E12 A;  2RMO A;  4QVD A;  2WSF E;  3I7F A;  5KNN A;  1UGS B;  3UT1 A;  5FLX E;  4XU3 A;  2LX7 A;  2X51 A;  1Y7X A;  1H4S A;  5GAM g;  1QVF P;  4EDU A;  3GPL A;  1YCY A;  1VQO T;  1IZ6 A;  1KQS A;  3REB B;  4CH3 A;  4H2V A;  1BI0 A;  3OS2 A;  4YPF A;  2ZIN A;  1YJW A;  4FYV B;  1G51 A;  1N9S A;  2KYM A;  5AT1 B;  1YHQ Q;  3A8M B;  3OW2 S;  4J9C A;  2NUT A;  3EG9 A;  1H4V B;  1ZX6 A;  2QG9 B;  3OW2 A;  1U1S A;  4RTV A;  3OYD A;  1YJN A;  6AT1 B;  1WGS A;  2LJ0 A;  3H0I A;  1K4U S;  1VQZ A;  3HTR A;  1M1G A;  3I55 A;  2XID A;  2CDT A;  3FRN A;  4XU1 A;  2DIG A;  2KYB A;  3VQV A;  1D0Y A;  5GJW B;  3A5Y A;  2W10 A;  4Y91 A;  4RDX A;  5GAN 8;  3OMG A;  1G5H A;  1ZBX A;  2VB6 A;  3P8H A;  4M78 A;  1Q86 C;  4DEX A;  4M7A G;  1B7T A;  1KJW A;  3NHN A;  4M75 B;  4J9E A;  3CEY A;  5KYU A;  2GCX A;  3ZBD A;  4M77 F;  2E3I A;  2M02 A;  8AT1 B;  4AH6 A;  3DLM A;  4OB1 B;  1NJ5 A;  4RCC A;  4P3P A;  3CCR A;  1TUG B;  2AKK A;  2YUQ A;  3NPF A;  1TWB A;  2LJ1 A;  1ZBJ A;  2KRO A;  3UWN A;  3EGD A;  2RK2 A;  3M0T A;  4M75 C;  2P0P A;  3JCM h;  3M0P A;  1G3S A;  2JXB A;  1G3W A;  1X54 A;  1VYV A;  3JB9 F;  1BB9 A;  2DXB A;  3I5R A;  1RUW A;  2Y4Y A;  4UP8 A;  2DTO A;  4C92 C;  1M90 U;  5LJ3 g;  1W2B A;  1BCM A;  3O5Z A;  2YLB A;  3JB9 G;  3M0U A;  2ART A;  2RHQ B;  3VS0 A;  5D6W A;  4C8Q B;  2LQK A;  2H3E B;  1VQ4 T;  3QII A;  2A28 A;  1VQ9 T;  1YJ9 Q;  5LJ3 h;  2Q5I A;  4YRO A;  3P8V A;  1AWJ A;  2PU9 B;  2A8E A;  1WZO A;  1Y57 A;  2EKH A;  4L87 A;  4HXJ A;  4N4G A;  4YRP A;  4NL2 A;  4M7D B;  4D8K A;  2O9S A;  3I35 A;  4KH0 B;  5CQX A;  2GF7 A;  2I0N A;  4M7A A;  2L2P A;  3H8Z A;  2BZY A;  4HWS A;  2RJC A;  1VQL A;  3I56 A;  4WTO B;  1UB4 A;  4OP0 A;  2O4X A;  2CP2 A; 
#chains in the Genus database with same CATH homology
 1D3B A;  1AHJ B;  3TEG A;  4RCB A;  3OS1 A;  1VQ5 T;  1QVP A;  3HSB A;  1S72 T;  2DXT A;  3HHT B;  1I5L A;  3QZ5 B;  5CKB A;  1EFW A;  4E7H A;  2ZZG A;  4UP9 A;  2LTO A;  2DO3 A;  3MQZ A;  1NJ8 A;  3A32 A;  2ZT8 A;  3A7U A;  2B8A A;  2AMC A;  2P0K A;  2EQJ A;  2RHS B;  2G3R A;  3E9H A;  4PG3 A;  2DAQ A;  2ZIO A;  3PIP A;  2Q7H A;  3LGF A;  2EJ9 A;  2M0O A;  3RER A;  3CC7 A;  4P75 C;  3G71 A;  4JLI A;  2MWP A;  1KOG A;  4DOV A;  5LJ5 e;  3M54 A;  2I4L A;  5GAN 4;  4BDY A;  1XNI A;  4PJO A;  3GOX A;  2YHT A;  3DSQ A;  1ATI A;  3MP1 A;  1VQ8 A;  1KG1 A;  3QO5 A;  2CKK A;  5FU6 C;  1USY C;  4MZT A;  5GMK j;  2XTI A;  4M7D E;  3UDC A;  4BUG A;  2XHC A;  3OYH A;  2EQM A;  2XIC A;  2RHY A;  1JJC A;  3URG A;  2JVV A;  5AYF A;  1OI1 A;  3NEN A;  4J8O A;  2K3Y A;  3GF5 A;  3V8L A;  5GMK l;  3CCQ A;  2LT4 A;  3PIO A;  4C5I A;  1FX7 A;  3JCM X;  2DXC A;  5DLQ E;  2QHS A;  4P71 A;  5KH6 A;  4XTV A;  3VBB A;  1QP2 A;  4C8Q F;  5LJ5 f;  2E65 A;  3FLG A;  3UH0 A;  3CXC S;  3CCS T;  4C92 A;  4MDW A;  2A7Y A;  2DK3 A;  1H64 1;  1TH7 A;  2XD0 A;  1HTT A;  3NTK A;  4OGC A;  1N9W A;  3VKI A;  4A4F A;  2QDY B;  5CKE A;  1G3Y A;  3HTZ A;  1W4S A;  1EVK A;  4FT4 A;  4Q6G A;  4ZGJ B;  2EQU A;  3L4G A;  3OYB A;  2I2L A;  3CPF A;  4P5N A;  5FU6 B;  4A4H A;  1SSF A;  2XDD A;  3PCO B;  3VUZ A;  5IAY A;  3CCV T;  3G6E A;  3JCM b;  3WVE B;  3TRE A;  3CC4 T;  2R5M A;  5C51 B;  3M5A A;  3HP9 A;  4WF2 A;  1BIA A;  5FU7 B;  4M78 G;  3UFG A;  3CMA T;  3A31 A;  5LJ3 e;  3JAM E;  4M77 D;  2QHT A;  1WLE A;  3E1S A;  1VQ9 A;  2OTL A;  2DDZ A;  3M53 A;  1WJQ A;  2WSE E;  3SD4 A;  3G7Z A;  3G6E T;  3VJP A;  1X2G A;  5GAO q;  1Y96 B;  3CME T;  4ZTJ A;  4CRI A;  2H3J A;  3E19 A;  4XTZ A;  3X20 B;  3JCM g;  4FU6 A;  3MP6 A;  4BDZ A;  3V7C A;  4HCC A;  4HT9 A;  3EAE A;  2M9U A;  1X55 A;  1YJ9 A;  4II1 A;  3HXW A;  2E64 A;  1QP3 A;  1EIY B;  2WAC A;  4M7D C;  1Y71 A;  4BB7 A;  1OZ3 A;  4M78 D;  5C6S A;  3L2R A;  1E1T A;  2RD1 A;  4FIB A;  3HFV A;  5L8R E;  2WSC E;  2X4Y A;  4QQ6 A;  2E70 A;  3OYN A;  5GAO r;  3QNE A;  2RHI A;  2DD4 A;  3I55 T;  3MET A;  1N6A A;  5FRN A;  1EIF A;  4E7L A;  1JJ2 S;  3X25 B;  3A8H B;  4C5H A;  2HQX A;  4X34 A;  4IUV A;  3OMC A;  2EJF A;  1MHN A;  2E5A A;  3E9F A;  4PJO B;  1UGQ B;  2L3R A;  2JN0 A;  2ZPI B;  3MEW A;  4YRC A;  5GAN d;  1NJ1 A;  2K5L A;  2K4Y A;  1KMM A;  5GAM h;  5M9O A;  3JCM P;  4M7A D;  3OBW A;  3TEE A;  4GY5 A;  1M1K U;  2ZCE A;  3JCM c;  1M1K C;  1R8O B;  2E41 A;  3X24 B;  3NEL A;  2LNV A;  4LVJ A;  11AS A;  3PMT A;  1B70 B;  4RG8 A;  3IKL A;  3RAC A;  4C92 G;  4WJ3 M;  2DJZ A;  4HVC A;  4NOY A;  5CKH A;  1KHI A;  4RQF A;  4CH5 A;  2GFA A;  1N8R U;  4BI4 A;  2EAY A;  2F5T X;  2DU5 A;  2MF2 A;  2LQ8 A;  4TWA A;  4E7I A;  3V7R A;  12AS A;  3PFS A;  1YJ9 T;  3LGL A;  1B34 A;  5GAO p;  5ELN A;  4P72 C;  4H02 A;  5GMK e;  3O8V A;  3CD6 T;  1YIT T;  3V8K A;  4J6X A;  2XDB A;  1UGR B;  4O6J A;  4J83 A;  4C8Q G;  1VQ6 A;  1NZ9 A;  3REX A;  4M77 C;  2PQW A;  4P72 A;  4HT8 A;  5A2Q E;  4M77 G;  4H2U A;  4PJO D;  4YRQ A;  5A0G A;  3LW5 E;  4TQF A;  4EO4 A;  2LDM A;  3CCE A;  5KE3 A;  1PSF A;  4WJ4 A;  1VQP T;  2CZ6 B;  3MF1 A;  1KC8 C;  5GAO m;  2OTL T;  4BW9 A;  4JRK A;  1Q82 C;  2CIM A;  4JJN K;  5E3I A;  3OY9 A;  5HGQ A;  1U8R A;  2DQ3 A;  4C0F A;  5CAI A;  4G85 A;  2CJ9 A;  4CS4 A;  3N5B B;  1KD1 U;  2VC8 A;  3LX7 A;  3PNW C;  2XKO C;  1QVF S;  2K5F A;  2E6N A;  4MZP A;  1ASZ A;  2KY9 A;  4XEO A;  2ZR2 A;  4TQD A;  1EQR A;  2D9T A;  1WPY A;  1JRI A;  2X35 A;  2DZC A;  3ZEH A;  1HK9 A;  4DPG A;  4FT2 A;  3QKJ A;  3L4G B;  4ATO A;  4YP0 A;  3M4P A;  3SB2 A;  4C92 E;  3FB9 A;  2JOY A;  3OYG A;  4CH6 A;  4TVA B;  2ZNJ A;  2DZ9 A;  4DQ2 A;  4C92 D;  1LJO A;  2R58 A;  3FC3 A;  1VQM T;  3TU4 K;  4H2Y A;  3GNG A;  3S3O A;  4P71 C;  1K9M U;  2ZT7 A;  4C0D C;  4IUU A;  3ER0 A;  4L59 A;  5D6Y A;  5DLO A;  1M90 C;  4C92 B;  2I4M A;  2QA4 A;  1PYS A;  4YRK A;  3P8T A;  2C06 A;  5GAM d;  1SRY A;  2QTX A;  4A4K A;  3CCJ T;  3RKW A;  4BY6 C;  1OYX A;  3OB9 A;  4A54 A;  3FIF A;  3HXV A;  4JRP A;  2YLC A;  5HY6 A;  4F7U A;  4CS2 A;  3PZC A;  1W2B S;  3QHS A;  2CJA A;  3V7S A;  1VIE A;  2R5A A;  4OMF B;  4IUR A;  1VQL T;  4M77 A;  4ME7 A;  3QZ9 B;  4H2T A;  4Q15 A;  2FYK A;  2RHZ A;  4HCB A;  1KHC A;  1QVG S;  2AKW A;  2CZ0 B;  1VQ8 T;  1I81 A;  2QQ9 A;  1ADJ A;  1KQS S;  3V8J A;  2DQ0 A;  2JUF A;  4PLI A;  1B7Y A;  3JSC A;  4Y28 E;  2HD0 A;  1IL2 A;  1WU7 A;  4OB0 B;  1H3Z A;  2Q7G A;  3M56 A;  4ZTZ B;  2A3L A;  2K3X A;  2E10 A;  2J3L A;  2ARU A;  2EIF A;  2QHU A;  2Q5H A;  2DPP B;  3CCM A;  3JRZ A;  2QQS A;  1ZHI A;  4EPC A;  1VIF A;  4E7J A;  3CPW S;  2EFI A;  4YRS A;  5CVI A;  4XTU A;  3OYF A;  4PNO A;  4J7I A;  3S3N A;  5C52 B;  1WJS A;  3RES A;  2ZPE B;  4C0G A;  4K87 A;  4YRN A;  3SDZ A;  4OF1 A;  1S72 A;  2E6Z A;  4BE0 A;  1XQH A;  2XU8 A;  2L5Q A;  4Z02 A;  2OAU A;  3P8B B;  2LX9 A;  5LJ3 j;  1YIJ A;  2AHJ B;  1NNH A;  4HA8 A;  4YRE A;  4CS3 A;  1B76 A;  2EJG A;  2P4T A;  2V8K A;  3CCJ A;  3DB3 A;  4WI1 A;  1VQK A;  3CCE T;  3JB9 I;  2V8J A;  1VQO A;  1BBU A;  4BWA A;  3G4S T;  1H4T A;  1KD1 C;  4FL6 A;  1N8R C;  4LDY A;  1G5I A;  1P92 A;  4JDS A;  4C8Q A;  3OBY A;  4J7F A;  4K86 A;  5FRO A;  2ZZE A;  2RJD A;  1Q82 U;  4DOW A;  5LJ5 j;  3HFZ B;  3HY0 A;  5LJ5 h;  4P73 C;  4HWO A;  2ZT5 A;  3M9Q A;  2JTF A;  3G1Z A;  1UGP B;  3VUB A;  1QF6 A;  4N4I A;  3OYC A;  5GAN 5;  4LDW A;  5GMK m;  5GAM e;  3OYL A;  3C94 A;  2LCC A;  3CME A;  2EWN A;  4UP7 A;  3ICA A;  5GAM j;  3JB9 D;  3J81 E;  3OYJ A;  2OTJ A;  3PGG A;  4QQG A;  3RKY A;  4OLF A;  3VQY A;  5ELO A;  3IAL A;  1Q86 U;  3RMS A;  4NL3 A;  4GLK A;  4YRL A;  2EL9 A;  4V2S A;  3AHU A;  3LWH A;  5K1P A;  4YRG A;  4BAC A;  1XTD A;  1XOV A;  1YI2 T;  2EQK A;  3QG1 A;  1LYL A;  3A74 A;  4D6W A;  3KXT A;  3JB9 H;  3HXY A;  4M75 F;  2ZXF A;  4XK8 E;  4M77 B;  2DD5 A;  4M75 E;  2KK4 A;  2L89 A;  1Q81 C;  1K8A C;  4X5O A;  2MAM A;  2I4N A;  5CCA A;  2BIV A;  2P0L A;  2ALY B;  4RG2 A;  4KR2 A;  1Q81 U;  4M78 E;  3VU3 C;  4C5E A;  1RL2 A;  4QW2 A;  4EMK C;  2QI2 A;  4IUT A;  3CBO A;  2KAF A;  2ODR C;  4P3O A;  3CCM T;  3LLR A;  3RUX A;  3HPW A;  3J7A F;  3QYH B;  4EMK A;  3WVD B;  3ERR A;  1KQ2 A;  2MMP A;  1ZQ1 A;  2P0Q A;  3OS5 A;  4NCX A;  3M4Q A;  3A7A A;  1E1O A;  2G4C A;  2ZTG A;  4R55 A;  1YFS A;  4J6W A;  5GAN j;  5C0M A;  3TUP A;  4KUI A;  4A53 A;  5I2S A;  4QVC A;  4M7D F;  2F69 A;  2E1H A;  3OD1 A;  5CKF A;  1WQ7 A;  3R6O A;  2JZ2 A;  5LJ3 d;  5LJ3 f;  3P8D A;  3ME9 A;  1USY A;  5LJ5 d;  5HK3 A;  1YJN T;  3QO3 A;  5FRM A;  3VV0 A;  5HKC A;  1HC7 A;  3NEM A;  4DA4 A;  3RKX A;  2ZZD A;  2RB6 A;  1FXX A;  3I56 T;  1X6O A;  4CH4 A;  3PCO A;  2ZIM A;  3J80 E;  4L6V 5;  2JNG A;  3CCU T;  3JCM J;  4G84 A;  3QTC A;  1VQ7 T;  3QPH A;  3M4Y A;  4ZIB A;  4M7A E;  2QA4 T;  2KMT A;  5DY9 A;  4YYE A;  4BI8 B;  3L42 A;  4H2S A;  4BI3 A;  1WYD A;  3OYM A;  2IG0 A;  2GQV A;  2EYQ A;  2X4W A;  5KE2 A;  3OA6 A;  4PJO G;  2BUD A;  3KBG A;  3JCM W;  2RM4 A;  3Q1J A;  3CCL T;  4P73 A;  5HK0 A;  1JB0 E;  4KR3 A;  2XGT A;  4B9W A;  2C8M A;  4YRT A;  2RK1 A;  3LSS A;  3UGQ A;  1O75 A;  2RA2 A;  3CXC A;  5FU7 C;  2K5I A;  1EVL A;  3HY1 A;  4PHC A;  5CO7 A;  1ASY A;  4RQE A;  3P8Y A;  3HRU A;  5CK9 A;  4XU2 A;  4LVK A;  2ZGW A;  1YFR A;  1DJ7 B;  1K8A U;  4KQE A;  1L0W A;  1OZ2 A;  4PJO F;  4MML A;  1YBY A;  1BIB A;  1NYR A;  5GAN g;  1SES A;  3HRI A;  3S3M A;  4KBM B;  2PUK B;  3BFM A;  1NYQ A;  3MO8 A;  3SFM A;  3VQX A;  2K57 A;  2X4X A;  1H4Q A;  4HWT A;  3IG2 A;  2CZ7 B;  3GNF B;  5GAO l;  4A4E A;  4JS5 A;  1VQ4 A;  5CQY A;  4XTY A;  1BI2 A;  4HT4 A;  4H2X B;  5I2M A;  3JCM e;  1NJI C;  4YCU A;  2KSS A;  4EMH A;  2QQR A;  1VQ7 A;  3M57 A;  4ZN1 A;  2QEX A;  1BI3 A;  4YRI A;  2K2V A;  4M78 C;  4HWP A;  1K73 C;  4C8Q E;  4M7D D;  2RJF A;  3WQZ A;  4YCW A;  1NPP A;  4ELZ C;  3L2V A;  4E47 A;  5LL6 S;  2HAX A;  4E51 A;  2NLU A;  3QO7 A;  3GIB A;  2DXU A;  2AMC B;  4C8Q D;  5GAN e;  2Q7E A;  1VQN T;  3PMI A;  1YIJ T;  2EKO A;  2MI6 A;  3OYE A;  3CCS A;  1G3T A;  3LWI A;  3CC2 A;  3IKM B;  1UEB A;  2F5K A;  3L2U A;  2XK0 A;  1YHQ A;  1D3B B;  1X75 C;  3L2Z A;  1YIT A;  4LVL A;  4LVI A;  1LNX A;  3H6Z A;  3CMQ A;  2RHU A;  5I21 A;  3DB4 A;  2QHV A;  1X01 A;  2ZCF B;  3EFS A;  3QXE B;  3RL6 A;  5GAM f;  2VGN A;  2KDS A;  2YRV A;  3CC2 T;  4TVW A;  1FYF A;  4FM4 B;  3FJP A;  1NE8 A;  2I4O A;  5GAN 2;  3SWN C;  1BI1 A;  4LDV A;  1EIY A;  1HXD A;  3EFR A;  4EX5 A;  3ZFJ A;  2X4J A;  2IVW A;  2R57 A;  5LJ5 g;  2RHQ A;  3BW1 A;  1G5V A;  3SWN B;  4H2W A;  1JJ2 A;  2CYZ B;  1Y96 A;  4PJO E;  4OGE A;  1QVF A;  4UPA A;  3OYY A;  3OYK A;  5GAN 3;  4XQ3 A;  3A8L B;  3QO8 A;  2VGM A;  3HL8 A;  1GXI E;  4YDQ A;  4JS4 A;  1VQM A;  4ZTU B;  4JUV A;  4M75 A;  1MGQ A;  2FB7 A;  3LC0 A;  4N0A C;  1KC8 U;  4M78 B;  2V8I A;  3JCM Q;  4LDX A;  4E7K A;  1NJ6 A;  5J39 A;  5J26 A;  1EOV A;  1M8V A;  5GAN 6;  4YRF A;  3L2W A;  3JCM V;  4YRJ A;  2ZT6 A;  5GMK i;  3MEV A;  3BDL A;  1SER A;  3C95 A;  3QSU A;  2JTM A;  2M16 A;  3HRS A;  2DVE A;  4XTX A;  3GP8 A;  1E22 A;  3VYG A;  4H2X A;  3GLX A;  3A8O B;  4IUP A;  3INZ A;  5K1X A;  1YJW T;  5A0D A;  1KMN A;  4NS5 A;  4OB2 B;  3HXU A;  4P3N A;  2QQB A;  3CCQ T;  5GAN 7;  4LNS A;  1GGM A;  3BJU A;  3CC4 A;  4F7U B;  4XAX B;  3X26 B;  1JJC B;  5GAO n;  3HFO A;  2CS7 A;  3HKS A;  4RMF A;  1WNL A;  3G4S A;  3M59 A;  4C92 F;  4X9D A;  4YRR A;  3W3S A;  4J15 A;  4N4H A;  3F70 A;  4PL6 A;  1KQ1 A;  1RI0 A;  2Y90 A;  3QYG B;  1PSE A;  5GAN h;  3M58 A;  2VUB A;  2RH2 A;  4J6Y A;  5GMK h;  1YHQ T;  2VV5 A;  2XDP A;  1IRE B;  4P74 C;  4ZGD B;  5CR2 A;  1WJR A;  2BKD N;  3RIR A;  2RI2 A;  4LVM A;  4RMO A;  1QW1 A;  2VYT A;  1Y07 A;  2RHS A;  4TVY A;  4EMG A;  3OSV A;  4M75 G;  4F7U G;  4OB3 B;  4LDU A;  4BD3 A;  1B8A A;  3OS0 A;  4TTV A;  3MCA B;  1Q7Y U;  1QE0 A;  3PTA A;  1NJ2 A;  2ZPG B;  2DTI A;  4VUB A;  4O2D A;  3MF2 A;  4HCZ A;  4P74 A;  4O5V A;  1YI2 A;  2CZ1 B;  5KCH A;  4ELY C;  2DTH A;  2O4X B;  3DLL A;  3M55 A;  2HBP A;  3CCU A;  3TEH B;  2XG8 D;  3HFZ A;  3JCM d;  4LD9 K;  2FL7 A;  4MZM A;  2D6F A;  3CBP A;  3SWN A;  4M7D A;  2QXF A;  1SET A;  2IY5 A;  4FSX A;  2ZNI A;  3REU A;  1U1T A;  2DEQ A;  1J5W A;  2MWO A;  1I8F A;  3BY7 A;  4M7A B;  4EMK B;  2LCL A;  4HWR A;  1B34 B;  1Z7N A;  2DU7 A;  1N9R A;  2KQW A;  5IN1 A;  1VQ6 T;  3RF1 A;  1K73 U;  4MMK A;  2HQE A;  1RIQ A;  1M9S A;  3E9I A;  3CD6 A;  3MHX A;  1YGB A;  4TVR A;  3X28 B;  3NET A;  2PME A;  4YRM A;  1WQW A;  2D0Q B;  5GAN f;  3PT9 A;  3WXM B;  3BDU A;  4C8Q C;  3KUF A;  3LYI A;  1B70 A;  4IKF A;  5DM7 R;  1BYM A;  2ZPH B;  3MEA A;  5A0L A;  3L1A A;  1M4Z A;  1QVG A;  3C4S A;  3R07 A;  4P75 A;  1FWZ A;  2M1H A;  2LC4 A;  3LH0 A;  4KUL A;  4ZGE B;  4K88 A;  3L2Q A;  1W66 A;  3JB9 J;  2XI9 A;  3QJY A;  1K9M C;  3CCV A;  3NFC A;  3HXX A;  1VUB A;  3DKM A;  4M77 E;  2ODR D;  3OQ5 A;  3QJ6 A;  1Z7M A;  3MP8 A;  3RMQ A;  4CI0 C;  2PVG B;  3NTI A;  5C53 B;  2RHX A;  1B7Y B;  4BE2 A;  5J3B A;  2RI5 A;  1I4K 1;  4M7A C;  2CJB A;  5F5W A;  5D6X A;  2AKW B;  3CMA A;  3MEU A;  2HNI A;  4J5Y A;  2OTJ T;  2DIQ A;  3CCR T;  3QBY A;  2PMF A;  4F7U F;  2E5Q A;  1LOJ A;  1O9S A;  3OYI A;  3G71 T;  3OSS C;  3C12 A;  4KUD K;  2RO0 A;  4QQD A;  2ARS A;  2PVD B;  4M75 D;  3A7R A;  2C7I A;  3A5Z A;  4B9X A;  4RKU E;  3QUI A;  1V29 B;  1YFT A;  3CBM A;  2LRQ A;  1JBM A;  1YB3 A;  5CKD A;  4C0D B;  2VXF A;  3HRT A;  3KFU A;  3T9N A;  3LSQ A;  4LD6 A;  4KT0 E;  5EG2 A;  3VYH B;  2DKG A;  2KVQ G;  3TEH A;  4JRI A;  4A4G A;  2IY5 B;  4C5G A;  2CGH A;  3CCL A;  3HXZ A;  1NPR A;  2PVO B;  2ZR3 A;  3FDR A;  1BBW A;  4PJO C;  3A8G B;  4TVA A;  4PLL A;  4JLG A;  4OVA A;  5IT9 E;  1N27 A;  2NS6 A;  2GFU A;  2VXE A;  1VQP A;  4XEM A;  1VQK T;  4HKE A;  3TCJ A;  2J3M A;  2E3C A;  3NTH A;  4IUQ A;  3UGT A;  3VQW A;  1M5Q 1;  1C0A A;  3CC7 T;  4JRQ A;  4UC4 A;  1X2H A;  4N0A A;  4Q5W A;  2O01 E;  4XU0 A;  4MDX A;  2FHD A;  3E9G A;  4XTW A;  2L8D A;  3M4G A;  5CIU A;  4C0Z A;  4R56 A;  2QQA A;  4X9C A;  1X56 A;  4BY6 B;  2LVM A;  3JCM f;  2ZPB B;  4BE1 A;  2ZZF A;  3CPW A;  4L5G A;  3QDR B;  1Q7Y C;  3HFN A;  4QVZ A;  3FEO A;  2LT1 A;  1BKB A;  2RJE A;  4M7D G;  1M1F A;  3RGL A;  4ZN3 A;  4F7U E;  1VQN A;  1ADY A;  1NJI U;  4ZTF A;  3S6W A;  5KCO A;  2FVU A;  4YTL A;  3MEY A;  3ASK A;  4PKC C;  2RI3 A;  2ZPF B;  4M7A F;  2QEX T;  4M78 F;  3UPU A;  2P5I A;  3A5Z B;  2PUO B;  4YCV A;  2Y4X A;  2ALY A;  1VQ5 A;  3OYA A;  1E24 A;  3HRK A;  1PYS B;  2E12 A;  4QVD A;  2WSF E;  3I7F A;  5KNN A;  1UGS B;  3UT1 A;  5FLX E;  4XU3 A;  1Y7X A;  1H4S A;  5GAM g;  4EDU A;  3GPL A;  1YCY A;  1VQO T;  1IZ6 A;  1KQS A;  4CH3 A;  4H2V A;  1BI0 A;  3OS2 A;  4YPF A;  2ZIN A;  1YJW A;  1G51 A;  1N9S A;  3A8M B;  3OW2 S;  1H4V B;  3OW2 A;  1U1S A;  3OYD A;  1YJN A;  1WGS A;  1VQZ A;  1M1G A;  3I55 A;  2XID A;  3FRN A;  4XU1 A;  2DIG A;  3VQV A;  3A5Y A;  4Y91 A;  4RDX A;  5GAN 8;  3OMG A;  1G5H A;  1ZBX A;  3P8H A;  4M78 A;  1Q86 C;  4M7A G;  4M75 B;  3CEY A;  2GCX A;  3ZBD A;  4M77 F;  4AH6 A;  3DLM A;  4OB1 B;  1NJ5 A;  4RCC A;  4P3P A;  3CCR A;  3UWN A;  2RK2 A;  4M75 C;  2P0P A;  3JCM h;  1G3S A;  1G3W A;  1X54 A;  3JB9 F;  2DXB A;  2Y4Y A;  4UP8 A;  2DTO A;  4C92 C;  1M90 U;  5LJ3 g;  1W2B A;  2YLB A;  3JB9 G;  2ART A;  2RHQ B;  5D6W A;  4C8Q B;  2LQK A;  1VQ4 T;  3QII A;  2Q5I A;  1VQ9 T;  5LJ3 h;  4YRO A;  3P8V A;  2PU9 B;  2A8E A;  4L87 A;  4N4G A;  4YRP A;  4NL2 A;  4M7D B;  5CQX A;  2GF7 A;  4M7A A;  3H8Z A;  4HWS A;  2RJC A;  1VQL A;  3I56 A;  1UB4 A;  4OP0 A;  2O4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...