2HNIA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, k111a mutation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
230
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
total genus 67
structure length 230
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2hniA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2hniA01
3E9IA 1YFSA 2VXFA 5GAMh 3HXVA 4XQ3A 4V2SA 4H2XA 4YCUA 1WPYA 1SESA 1LJOA 2EJFA 4RCCA 4YROA 4RQFA 5GAMj 1WLEA 3G1ZA 1NJ8A 4C8QB 2EJGA 2G4CA 2DXUA 2AMCA 5LJ3j 1U1SA 2ZIOA 5GAOm 2C8MA 2ZT7A 1U1TA 3JCMV 4F7UF 3A7RA 5I21A 5GAN4 4EMGA 1N9WA 3SWNB 4NOYA 2DKGA 4WF2A 4C8QC 4HT9A 4H2YA 4CS2A 1LNXA 3RKYA 2DZCA 4J5YA 2RB6A 1JRIA 2ZCEA 2ZT8A 2I4MA 4M7DC 4XU3A 3VU3C 3IKLA 3QTCA 4M7DD 4JRKA 1I81A 3L1AA 4XTYA 1EOVA 4Q6GA 4KR3A 4UP9A 1D3BB 3NENA 4K87A 4YCWA 2AMCB 2FYKA 2DDZA 2QHVA 3QO5A 4H02A 5CAIA 4YCVA 4TVAB 4ZTZB 4F7UB 2DVEA 4M77F 5GANg 2HNIA 4UP7A 1EIYB 4HT8A 5GANf 4M78B 3GIBA 1Z7NA 3JCMW 5LJ5e 1EVLA 3TEHA 1EFWA 2RHSA 5K1XA 4YREA 4C8QD 3PCOA 1IL2A 1USYA 3QO3A 4PNOA 3QUIA 2YLCA 5LJ3g 1X2GA 2DZ9A 4P73C 3LSQA 2RM4A 5HGQA 4PHCA 1QF6A 2DJZA 1B34A 2DTOA 4CS3A 4DQ2A 4P74C 4H2UA 4M7AA 4A54A 3HFVA 3RL6A 4XEMA 3VQYA 1EIYA 5GAMf 2DEQA 3UGTA 3V8KA 4PJOB 2ZNIA 2E65A 3P8YA 1H641 4PJOA 1W66A 1YB3A 4YRIA 3JCMc 5DY9A 3HRIA 4YRGA 2QHUA 1WYDA 4NCXA 2ZR3A 1H4TA 2E3CA 5LJ3f 3A5ZA 4M7DB 5KNNA 2ODRD 1HK9A 4YPFA 4KQEA 1KOGA 1H4SA 4OP0A 4H2SA 4HWTA 4HWOA 3RACA 2E41A 1WQWA 5GANj 1Z7MA 3A32A 4YRSA 4X9DA 2DQ3A 4M77G 2Y90A 2QHSA 4MMKA 3FIFA 1HXDA 4M7AD 2DQ0A 2QTXA 4M78A 3RGLA 4RDXA 1X01A 3HRKA 1B76A 2VXEA 2I4LA 2ZIMA 2DTHA 2C7IA 1ATIA 1YCYA 4A53A 4M78F 1VQZA 3INZA 5GAN2 4EMKA 1GGMA 4H2XB 2E1HA 4J6XA 4C92D 5GMKe 1NJ6A 4XTUA 2ZINA 4C92C 4YP0A 4WJ3M 4RCBA 1B7YB 4O2DA 1WNLA 5GMKh 4XU0A 4EMHA 3JCMe 3HXZA 5GAMd 5GAN3 1J5WA 3JCMJ 1YFTA 5GAN5 2CIMA 2ZNJA 4YRMA 2XTIA 5GMKj 1H4QA 4EX5A 4X9CA 1E1TA 3VBBA 1PYSA 2IY5B 3HSBA 4YDQA 2I4NA 3HXUA 4TVAA 1X56A 5GMKi 3SB2A 3L4GB 3MEYA 4NL3A 4C8QF 3EFSA 1JJCA 3VQWA 4YRFA 3JB9F 3CMQA 4P71A 5C53B 4K88A 3JCMX 3QSUA 12ASA 2EJ9A 3OD1A 3ERRA 3HFZA 4C92E 1KQ2A 5C52B 5ELOA 2I2LA 1EVKA 3BW1A 1I8FA 5LJ5g 3JB9J 2ZTGA 2ARSA 4M77E 2P0LA 3RERA 1ADJA 3NEMA 1B70A 3NETA 2ALYA 3JB9H 1E22A 4C92G 4YRKA 4M75B 5LJ3d 4M7DG 4YRRA 3KFUA 4WJ4A 3L2ZA 2FB7A 4EMKC 3P8VA 3JCMQ 4TVYA 1C0AA 1I5LA 3HFOA 4C92A 2DU7A 3A7UA 2Q7EA 5LJ5j 2YHTA 3JCMd 3UH0A 2AKWB 1MGQA 4P72C 5GAOn 4TQFA 1USYC 4M77D 3TEGA 5LJ5h 3BY7A 1LOJA 2Q7GA 5LJ3h 3LC0A 1TH7A 4NL2A 1NJ1A 2E10A 3DSQA 1KMNA 4HVCA 3TUPA 4P73A 3UFGA 4P3NA 3AHUA 2ZXFA 4J6YA 3BDUA 2ZZGA 5GAN8 3SWNA 3JCMf 1X54A 3I7FA 1LYLA 1RIQA 4C8QG 4LNSA 3BJUA 2K57A 3RKXA 1N9RA 3V7SA 5GANd 4PJOE 4XU1A 4PJOF 5GMKl 4C8QA 2Q5IA 4MMLA 1Y96A 2DU5A 2DXTA 3HXXA 3RF1A 4C92F 3QHSA 2Q7HA 3R07A 3M4QA 3M4PA 4Q15A 3PCOB 2E64A 2ZT6A 4HWSA 4P75A 2ZGWA 4CH4A 2RHQB 3JB9I 4CH5A 1M5Q1 1X55A 3HXWA 1ASZA 3A74A 3RUXA 5C51B 3QNEA 2CJBA 4CH6A 2I4OA 3FB9A 1N9SA 1B7YA 4BWAA 4XTXA 4G84A 5GAOl 3HY0A 4G85A 4J6WA 4YRPA 3MF1A 4CS4A 4PJOC 1NYRA 3REXA 5F5WA 2ZT5A 4EMKB 4XTWA 4DPGA 1G51A 3JCMP 3V7RA 1BBWA 4ZTUB 3V8JA 3HY1A 4C92B 3V7CA 3EFRA 3HTZA 4BW9A 4M77B 5GAMe 4M7AF 2DTIA 4M7AE 4X5OA 2ALYB 4M7AC 4M75D 4P74A 4M75E 11ASA 5GAMg 3HFNA 4C8QE 4M75F 3JCMb 4EO4A 1NJ5A 1WQ7A 4M78D 4KR2A 4PJOG 4UP8A 4N0AA 4M78C 4M77C 4H2TA 5K1PA 4M7AG 3RKWA 4TTVA 4WI1A 2JN0A 2AKWA 3M4GA 4E51A 3PZCA 4HWPA 4TQDA 4YRQA 3P8TA 4YRTA 3A5YA 4P75C 2IY5A 4HA8A 4F7UG 4HWRA 1NYQA 2RA2A 5GAOr 3UGQA 4JUVA 4P72A 1ASYA 4F7UA 3MF2A 3JB9G 2RHQA 2CGHA 1B70B 2QHTA 2YLBA 1WU7A 1QE0A 4TWAA 4CH3A 4M78E 5LJ3e 4AH6A 3JB9D 3HXYA 3RESA 1NJ2A 2J3MA 2ARTA 3HFZB 3IKMB 5GANh 3L4GA 2Q5HA 2E5AA 3E9HA 4QVCA 1BIAA 1PYSB 2ZZEA 1JJCB 3ICAA 4XEOA 3PGGA 2EAYA 4L87A 3FJPA 4YRJA 1SRYA 2VC8A 4P3PA 4OLFA 3RIRA 1JBMA 2P5IA 4H2WA 4M7DF 1KMMA 5LJ5f 5LJ5d 5GANe 1B8AA 4JLIA 4M75G 1E1OA 3LSSA 4YRCA 4P3OA 2EL9A 3WQZA 5GMKm 4ZIBA 1FYFA 4QVDA 1X2HA 2ODRC 3REUA 3QO7A 3VQVA 4H2VA 1D3BA 3JCMh 4M75C 3A7AA 1HC7A 4RQEA 4JRIA 2PMFA 1SERA 1G5IA 4XTVA 4J15A 2J3LA 5GAN7 1BBUA 4F7UE 1SETA 1YGBA 5ELNA 2CJ9A 4XTZA 3JCMg 1L0WA 4Y91A 1H4VB 1ADYA 1HTTA 2ZR2A 1G5HA 4P71C 3IG2A 3IALA 1E24A 4YYEA 4M77A 2PMEA 4M7AB 1I4K1 2CJAA 5GAN6 5E3IA 1B34B 4K86A 5GAOq 4PJOD 4M78G 4M7DA 3SWNC 1Y96B 1BIBA 3BFMA 4TVWA 3QO8A 4RMFA 3W3SA 4YRNA 4N0AC 5GAOp 2ZZFA 3TEHB 3VQXA 2ARUA 4YRLA 2EWNA 3V8LA 4XU2A 1YFRA 3A31A 3NELA 4PG3A 4UPAA 2RD1A 1KQ1A 4M75A 1M8VA 2RHSB 2XGTA 4M7DE 1EQRA 1NNHA
chains in the Genus database with same CATH superfamily
1VQPT 1QKWA 1X6GA 2D9TA 4V2SA 4DEXA 2VB6A 2EIFA 1VQ6Q 1BCOA 1LJOA 2EJFA 4RCCA 4RQFA 2EYYA 1WLEA 4C8QB 1ZSGA 2EJGA 2GTOA 2G4CA 2AMCA 2DF6A 1QVGS 2ZT7A 5FU7B 5FW9A 1R77A 3VS3A 2YRDA 4M4ZA 4EMGA 2CS7A 2LNHB 4PKCC 3OYIA 1B07A 4X1VA 1WJQA 2DZCA 3RKYA 4J5YA 3PIOA 4XU3A 2ECZA 3QTCA 1VQ6T 2X51A 1EOVA 2DL5A 4IUVA 3PFSA 7AT1B 2AMCB 3T9NA 2DDZA 2QHVA 1WI7A 3CCSQ 3H6ZA 1JEGA 3C94A 2O2OA 4YCVA 4C5EA 4FYXB 1EFNA 2O9SA 3OY9A 4UP7A 1EIYB 4OB1B 1XOVA 2G6FX 5GANf 2NUTA 3CCUQ 3GIBA 1Z7NA 1EVLA 1EFWA 2L3RA 1M3CA 3A8HB 4BUGA 3C12A 2LDMA 1IREB 2JUFA 3ZFJA 3E9GA 2CT4A 2M02A 3QG1A 2KR3A 2DRKA 1WGSA 2EGCA 2HL5C 1N8RC 2GQVA 2RM4A 4EPCA 3M56A 1AWOA 2QYZA 1AZGB 1WXTA 4DQ2A 1MMDA 4H2UA 3I56A 3RL6A 4FW1A 3G4SA 2LRQA 5CQXA 1QWFA 2O01E 1UTIA 2K6DA 3CCJQ 1GL5A 2OTLQ 2VV5A 3P8YA 4PJOA 2OJ2A 1YB3A 2DPPB 5DY9A 5HKCA 2OTJQ 2KMTA 1AHJB 3I55T 2RNAA 1WYDA 4NCXA 3NMZC 4BI4A 2ZR3A 2E3CA 2EQMA 1KOGA 2RQTA 3OW2P 4OP0A 3G71A 1MUZA 5GANj 4YRSA 4HVUA 2K5LA 1KQSS 1R0CB 4QW2A 1XQHA 3VJPA 1G3TA 2DQ0A 4M78A 2B8AA 3EFOA 4DA4A 2HEQA 3HRKA 3G6ET 1VQ7A 2I4LA 1E7OA 1OI1A 2BE9B 2L3PA 2DTHA 2C7IA 4KGZB 1R0BG 4A53A 1OU9A 3GNFB 4JJDA 3I9QA 2E4HA 3E19A 5J39A 5A0DA 5GMKe 1VOMA 2ZINA 2XMFA 4X34A 4DEYA 4RCBA 1K8AC 4XU0A 5C6SA 4EMHA 1NLPC 1UFFA 2DX1A 5KE3A 5GJWB 5GAN3 5IN1A 2XTIA 1K73R 1QW1A 3VBBA 3L2RA 1QVFP 3HXUA 2A0FB 3L4GB 3MEYA 2Y4YA 2MI6A 1IB8A 2HBWA 1FMWA 1JJCA 2QTVA 4OMPA 4ELZC 3JB9F 3CMQA 2O31A 1VQOQ 1HYOA 2EJ9A 3ERRA 5AYFA 2ZZDA 5FWBA 2RJEA 1EVKA 2ZTGA 1TOVA 2ARSA 1VYUA 1TS9A 3CMET 3JSCA 4K11A 4AG2C 1MV3A 3KFVA 5CKEA 4M7DG 2DL7A 3HHTB 3L2ZA 3CC4T 4EIKA 3CD6T 1AVZC 2EGEA 3OW2S 1I5LA 3HFOA 2A36A 1K73U 1NG2A 4Q5WA 1VQ5Q 1QCFA 2Q7EA 2YHTA 1K9MU 3JCMd 1KC8R 1KC8C 3FDRA 3O8VA 2E6ZA 4A4HA 4TQFA 3CCRQ 2A28A 3S3MA 1LOJA 3LYIA 3CCUT 3DSQA 1S1NA 2P84A 3X24B 4J6YA 2ZZGA 5GAN8 1X54A 4C8QG 1N9RA 4RMOA 4IKFA 3C0CA 2D0NA 4QQGA 2KBTA 4MMLA 1H3HA 5FU7C 3CBPA 2DXTA 2KE9A 4Z89A 1RI9A 2CSQA 3R07A 3U23A 1PSFA 2ZT6A 4P75A 4CH4A 1K73C 1HD3A 2LQ8A 3JB9I 4A4EA 1N6AA 4ME7A 4HCZA 4OB0B 1Q81U 4BACA 3HXWA 4F14A 3RMQA 3A74A 3R6NA 3VS6A 4JS5A 4CH6A 1CKBA 1D1CA 1Y7XA 2JS0A 5KYUA 4AFQC 1VIFA 3E1SA 4G85A 1UGSB 2EVRA 1OQKA 2P0KA 2F2WA 3V7RA 1PD1A 4ZTUB 3MEAA 1XJWB 1X2QA 4E7ZA 5IXFA 2F2XA 2JTEA 4J9DA 4J9CA 3HTZA 3QDFA 2COYA 3QDRB 4LD6A 5GAMe 3UPUA 2D1XA 1NYGA 3I56Q 2CP0A 2GF7A 1IZ6A 1RADB 4M75D 1BB9A 4M75E 2YUOA 4KUDK 4GY5A 1NJ5A 2K7AA 4H2TA 1RAAB 1SF9A 4M7AG 2E5KA 3M4GA 4YRQA 5IXBA 4F7UG 4RTWA 4C5GA 2ROLA 2ZPBB 1NYQA 2PZ1A 3OQ5A 2PVGB 1U3OA 3JB9G 2QDYB 4JRPA 1VQLQ 3MHXA 4CH3A 2K4YA 3PVLA 5CQYA 2DBKA 1VQOT 2A8EA 3HXYA 2ED1A 3HFZB 3CXCS 4C0GA 2JMCA 1YJWA 4YTLA 1C0MA 3TSWA 3LH5A 2QQAA 3ICAA 1Q95G 4PFOA 3MEUA 3EGXB 1NYFA 3MJXA 3VUBA 2QA4T 4P3PA 4J9IA 2QGGA 1F1BB 1VIEA 1B8AA 1E1OA 1AT1B 2EL9A 2ED0A 4QVDA 2DEUA 3REUA 4B9XA 1M90U 3PIPA 4E7IA 1K8AU 1TWBA 3A7AA 2C0OA 2RK1A 1RAIB 4PFZA 4JS4A 4LDUA 4XTVA 3F70A 2KQWA 3EGDB 4F7UE 1SETA 4QVZA 1D1BA 2CJ9A 4KH1B 2A08A 2F2VA 1UE9A 1S72T 2ZR2A 3IALA 2DXBA 1WHHA 1VA7A 1WHKA 2ZPIB 5KH6A 2O88A 2DO3A 5CKDA 2RI2A 3NHNA 2QEXT 3OS5A 4PJOD 1KSWA 3SWNC 4TVRA 2YUQA 3BFMA 3EHQA 4IIMA 1WXBA 4J7FA 1YWOA 4RMFA 2RQVA 1OV3A 4ORZA 1VQNA 5KYUB 3PT9A 1NM7A 3GF5A 3VQXA 2EWNA 3V8LA 4MDWA 3A31A 1WHMA 5D6XA 3FC3A 2RD1A 1KQ1A 1M8VA 2AKLA 3E9IA 1ZSZC 3HXVA 2HKNA 1M27C 4YCUA 1WPYA 1SESA 1VQPA 2AKKA 4JJNK 1VQ9A 5HY6A 2LX7A 3X28B 2ATCB 5GAMj 2FPDA 3OB9A 2DXUA 1RLPC 3CCEA 1U1SA 3EGUA 1NZ9A 2DL8A 3JCMV 4F7UF 2EQUA 2KY9A 1ZSZA 4P5NA 1JJ2A 3A7RA 2VASA 4DOWA 1N9WA 3SWNB 2X35A 2DKGA 1TUDA 4C8QC 4CS2A 4OB2B 1M2VA 2RB6A 2ZCEA 1H3ZA 2I4MA 1YHQT 1YJNT 2KI7A 2RI3A 3L1AA 2YT6A 3A98A 4Q6GA 2QA4A 4UP9A 1T3SA 4K87A 3HL8A 4YCWA 2FYKA 1NJIR 2LCLA 1VQMT 4RTYA 4C5IA 3QO5A 2DL3A 2H3JA 1UGVA 4PJMA 4TVAB 3HRUA 5FWCA 4ZTZB 4F7UB 2F1LA 3UDCA 4M77F 5GANg 2E12A 2J6OA 2BUDA 2CH4W 4KGXB 1K9MR 3TEHA 1OX8A 5K1XA 1VYVA 4C0FA 4C8QD 4VUBA 3M0RA 4YREA 2QQSA 2RHYA 4HCBA 1WHLA 2B86A 3TVTA 2RI5A 3OYEA 4E7LA 1KD1C 4A4FA 4DBHA 1UB4A 1C1AA 1QKXA 1ZLMA 3UA7A 4JZ3A 1VQ7Q 2YLCA 5LJ3g 4PJNA 2DK3A 2HQXA 5HGQA 1O9SA 2DJZA 1AD5A 1B34A 2PVOB 4CI0C 3CCLT 5D6WA 2EYWA 4N4HA 4AFZC 1OX9A 4A54A 4XEMA 1ZBXA 2DEQA 3CBOA 2M0YA 1M90R 2NUPB 4JJBA 3TCJA 1QVFA 3CCQT 1VQ5T 1H641 1V76A 4YRIA 3CC7Q 3HRIA 2BIVA 4YRGA 2QHUA 4F17A 2SEMA 1H4TA 2OAWA 5KNNA 3IQLA 2YXYA 2YDLA 1YJ9T 2V8KA 3EH2A 4HWTA 4HWOA 1WQWA 2DJQA 3CCJT 1Z7MA 3VRZA 4X9DA 1G2BA 2Y90A 4PJJA 2QHSA 2ZPHB 1YJWT 2X3XD 4MMKA 1H8KA 1EX4A 4ESRA 5CCAA 1BI1A 3FIFA 1HXDA 1O75A 1VQKT 2DERA 1W2BP 3RGLA 1RACB 2YRVA 5HK3A 1ZSZB 3CPFA 1ATIA 3CC2T 4M78F 4LE9A 3INZA 1GGMA 2F5KA 4J9GA 2J6FA 1NJ6A 4E7KA 3QYGB 1JB0E 4O2DA 4KH0B 4E7SA 2COZA 5IHIA 2RHIA 1YP5A 2RJFA 2RHXA 4RUGA 1M4ZA 5KCOA 1YFTA 2CIMA 2ZNJA 4YRMA 3OYNA 5GMKj 1C6VX 2BKDN 3EHRA 4XK8E 3CCSA 1ACMB 2AT1B 3HSBA 1CSKA 1ZA2B 1V1CA 1D0XA 3DB3A 3SB2A 5GMKi 4NL3A 1GCQC 2BZXA 3L42A 1WLPB 3VQWA 4YRFA 2E3IA 4RG8A 3DKMA 4K88A 2R57A 1JJ2S 2MK5A 4C92E 2V8IA 2CZ1B 1KQ2A 1KFZA 5ELOA 4MZPA 5LJ5g 3H9NA 1M8MA 2P0LA 1PKSA 2DE0X 1WJSA 3RERA 2DYBA 1ADJA 1B70A 3JB9H 3A8GB 2CDTA 2EFIA 4M75B 5LJ3d 2MAMA 1RAFB 1VQ4Q 1IGUA 3P8VA 4GBQA 3CCQQ 4E47A 1OOTA 2RQRA 4OGCA 1XTDA 3E9FA 5LJ5j 1BI3A 3VYHB 1AOJA 1AWWA 3NGPA 3UH0A 4ZTJA 3CXCP 2FZGB 3BY7A 3RBBB 1IRXA 1WDXA 2JXBA 9ATCB 4PK4A 4NL2A 1YFNA 4ATOA 1K0SA 4AMCA 4P73A 3QJ6A 1BK2A 3KBGA 3I7FA 1RUWA 1X69A 3BJUA 2K57A 2AIRB 2LT1A 1VQKQ 2K2MA 1Y96A 4L59A 2DU5A 2A37A 5D6YA 4C92F 2Q7HA 1UGPB 3CCEQ 3M5AA 5CKHA 1MNDA 4Q15A 1SG5A 3CEYA 3R6OA 1VQMA 1YNZA 2KDSA 3PMTA 1UG1A 4ANJA 1X55A 4FW2A 5C51B 2C0TA 4IURA 4DBFA 1QCOA 2I4OA 4E7HA 2DD4A 1BKBA 2E5QA 3QYHB 3EG1A 4XTXA 4YRPA 4J6WA 4CS4A 4PJOC 4RG2A 2FPEA 2JT4A 5F5WA 4BDZA 4EMKB 1VQ8T 2K5IA 2EKHA 4LDWA 3OYAA 4LVLA 2HCKA 3ZEHA 1BBWA 2KSSA 3V8JA 3OYGA 3HY1A 4C92B 1LPLA 1G3YA 3EFRA 3CC7T 2NUPA 2LQKA 4M7AF 1XNIA 4X5OA 4HCKA 5IAYA 1OYXA 3MKDA 4M7AC 2CSIA 1G3SA 3OYDA 1GFCA 3THKA 1T0JA 4KR2A 4PJLA 1VYTA 2L8DA 1I1JA 4KBMB 4WI1A 2OX7A 3PZCA 4TQDA 4YRTA 3P8TA 4J9HA 4QKUA 4L5GA 2QGFB 4AT1B 2GTJA 2WSEE 2YWWA 4LXCA 5GAOr 3UGQA 4JUVA 4P72A 1RAGB 3CBMA 3TREA 1TU0B 2RJDA 2PNIA 3MF2A 3M59A 4AFUC 4IUPA 2HD0A 2DYIA 3NTKA 1B70B 2YLBA 2QHTA 1QE0A 2KGTA 2JM8A 1WIEA 1KHCA 4M78E 1WA7A 3OYCA 5LJ3e 5HK0A 4HCCA 3JB9D 5I11A 3JAME 2GQIA 3RESA 1SRMA 1MMAA 2EQJA 1E6HA 1WFWA 1N8RU 2LC4A 4LUDA 3P8HA 2ZZEA 3UT1A 4XEOA 3MEVA 3FJPA 3GNGA 3S3NA 1SRYA 4OLFA 4KT0E 3META 1JQQA 1JBMA 2P5IA 1ABOA 1S72Q 4H2WA 2LVMA 1E6GA 1I5OB 5DLOA 2GGRA 5GANe 4M75G 4YRCA 2RJCA 2K5FA 3WQZA 2OTLA 3CCST 4FM4B 2DMOA 3X25B 1D09B 3VQVA 1D3BA 2AZSA 3A8MB 2HAXA 4RQEA 4JRIA 3FEOA 2EQIA 2D8JA 3GPLA 1G5IA 2PMFA 2J3LA 4HKEA 1GCPA 4IUUA 3WVDB 4J9BA 2O4XB 3KXTA 3JCMg 4Y91A 3QJYA 2CP7A 2K9GA 2VUBA 2XDBA 1HTTA 1E24A 1YJWQ 4YYEA 3LW5E 3OW2A 2RQUA 2CJAA 3FJ5A 4OGEA 3TU4K 2XKOC 2I0NA 5GAOq 2IVWA 3OSSC 5C0MA 5A0GA 3CCLQ 4LVIA 3URGA 4FSXA 1HJDA 2X3WD 1ZX6A 2X4XA 1X6OA 3QO8A 3W3SA 4YRNA 1K9MC 4CC4B 1KD1R 2KVQG 2ZZFA 1JXMA 5EG2A 2ARUA 5CKBA 4XU2A 1TG0A 5L23A 1BI0A 1PRLC 3NELA 4UPAA 4C0DB 3M0PA 1NJIC 3QZ5B 2YRCA 1YFSA 2VXFA 3DLLA 2GCXA 4XQ3A 1VQ6A 4GLMA 2FPFA 1U8RA 4OMMA 3GP8A 1NJIU 4J9EA 2KEAA 4YROA 1PKTA 2PUOB 4QQ6A 3G1ZA 1M1KR 1OPLA 4F04B 1PNJA 2XI9A 1D0YA 5LJ3j 3GOXA 4LVMA 1W6XA 3G71T 2GNCA 2KK4A 2JNGA 3MP8A 4HVVA 2E6NA 5GAN4 1M30A 1R8OB 1QVPA 1VQ8A 4OMOA 1LNXA 2ZT8A 3M55A 1JRIA 1PWTA 2DD5A 1VUBA 3OYYA 3QBYA 1K9AA 2AK5A 1K1ZA 4M7DD 4OMFB 4JRKA 2F69A 4XTYA 3FRNA 3CD6Q 3CC7A 4LNPA 2FG0A 4B9WA 2QAZA 4NS5A 3C4SA 2VWFA 1A0NB 3A1PA 1NE8A 1X2KA 3VRYA 3M0SA 1Q7YC 4H02A 3VS0A 2RF0A 5I2MA 2CT3A 2DVEA 2CZ7B 1SKUB 1TUCA 3I35A 1VQLT 3UATA 4HT8A 4M78B 3WXMB 3JCMW 5LJ5e 1M9SA 2DAQA 1GCQA 2RHSA 2ENMA 4FSSA 2XICA 4JZ4A 4BE0A 3GLXA 5D7UA 4PNOA 2EBPA 2HZYA 4OB3B 3QUIA 4OMQA 1X2GA 2DZ9A 3LSQA 1I07A 4PHCA 1QF6A 1WHJA 1DJ7B 1QCNA 2CYZB 4LD9K 2RHZA 1VQ8Q 1IXDA 2XU8A 2YUNA 3UGTA 3CCET 2LT4A 3V8KA 4ELYC 2DNUA 2CP3A 5KYXB 4R56A 1FMKA 3OS2A 3BDLA 3M57A 1W66A 2OI3A 2CZ6B 4ZN1A 1ZHIA 3JCMc 4F16A 3QIIA 3KUFA 5KYWB 1VQ5A 3VS4A 1M90C 2CH4A 3HTRA 1AEYA 1KD1U 4M7DB 2ODRD 1HK9A 3ASKA 1YI2T 2X4JA 3LLRA 1PHTA 2DIGA 3CMAA 3UF4A 2VGMA 3VYGA 1LVKA 4FT2A 3OYLA 1G3WA 1YJ9A 3A32A 2DQ3A 3PVQA 1FXXA 3JRZA 1VQNQ 3EGXA 3P8DA 1PSEA 2KT8A 2KT1A 2L2PA 5J3BA 2D8HA 3RNJA 1KG1A 1WX6A 4RDXA 3EG0A 1B76A 2ZIMA 1VQKA 3VUZA 3D7SB 3I55A 2CP2A 1YCYA 2D0QB 1TSFA 5GAN2 4EMKA 4BE1A 1G83A 4H2XB 2D6FA 4J6XA 4C92C 4YP0A 3SFMA 2J05A 1B7YB 2A7YA 2RQWA 3JCMe 1BI2A 3HXZA 3M58A 5GAMd 5AT1B 1W4SA 1J5WA 5GAN5 1Q82R 2L89A 1FYNA 4X9CA 2KRSA 1E1TA 2IY5B 4OMNA 4YDQA 2W10A 3CC4A 3OYKA 1X56A 3TEEA 3CD6A 4ZGJB 3OMCA 3CCQA 1YBYA 4C8QF 3EFSA 4BI8B 4P71A 3WVEB 2WSFE 3G71Q 5I2SA 12ASA 3OD1A 1Q86U 4BY6B 2RN8A 1FX7A 3I56T 2M0OA 5I22A 1MHNA 3BW1A 2ROTA 3JB9J 3CQTA 3HRTA 4PLIA 2GFUA 1MNEA 4QQDA 3PTAA 1Q81R 1ABQA 2GBQA 4YRKA 2ZPGB 4YRRA 1M3BA 4ZGEB 2FB7A 4EMKC 1YIJQ 3JCMQ 2LCSA 4TVYA 1C0AA 4MZMA 4C92A 2XIDA 3A7UA 3C95A 1RI0A 1ZQ1A 4AG1C 5DLQE 1V29B 2NWMA 2JOYA 2DBMA 2ZAEA 2AKWB 2ZPEB 1X75C 1MGQA 1GBQA 5GAOn 2X4WA 4P72C 1M1KU 1USYC 2RO0A 2LP5A 3M54A 1NPRA 4N4IA 2Q7GA 5LJ3h 1NJ1A 2E10A 1WZOA 4ZGDB 4EDUA 3CCLA 3TUPA 2CUBA 4P3NA 3AHUA 2ZXFA 2MMPA 3H0FA 2XDDA 1U5SA 3SWNA 3JCMf 1LYLA 1RIQA 2YSQA 2L3QA 4LNSA 3PMIA 3G6EA 5GANd 3V7SA 1VQ7T 2LJ3A 1ZUKA 1D1AA 2FRWA 1GFDA 2ABLA 5GMKl 1VQLA 1IHVA 2Q5IA 3RR6A 2L3SA 3A5ZB 1YITA 3QHSA 3M0UA 3M4QA 1Y57A 3PCOB 2E64A 4LDVA 1WXUA 3OYMA 2MYSA 2ZGWA 4LN2A 4CH5A 2HL3A 3OYBA 2X9HA 2OTJT 1P92A 2MWOA 1N9SA 1B7YA 4MZTA 1Y71A 5L8RE 3MQZA 1VQPQ 3MF1A 1NYRA 3REXA 2KROA 1QP3A 3NTIA 1M1GA 3HKSA 3MPUB 4XTWA 4DPGA 1YCSB 2KRMA 4KGVB 1SHGA 1JU5C 4KUIA 2AHJB 4HVWA 2J7IA 3VS2A 8ATCB 5CIUA 2KYBA 1YIJA 2LJ1A 2DTIA 4M7AE 2MPXC 1WHGA 2ALYB 4RTUA 3N5BB 2WSCE 2BTTA 1N5ZA 1LCKA 11ASA 3A8OB 1Q86R 4M75F 2R58A 4EO4A 1WQ7A 2RH2A 4Z02A 4PJOG 4UP8A 4E2FB 1IGQA 2KAFA 3L2QA 4M78C 2FL7A 3X26B 2FZKB 4C5HA 1SHFA 2EYXA 3DB4A 1VQ4A 1JXOA 4FIBA 3OS1A 1AWXA 2XHCA 4RTVA 4HWRA 4OF1A 5KYNA 4PL6A 3VV0A 2RA2A 3PE0A 4CRIA 3EG3A 1ZA1B 1ASYA 3S3OA 2V26A 2P4TA 2QQRA 1D0ZA 2RHQA 1OEBA 4TWAA 2K3XA 1ZBJA 5FU6B 1OPKA 2IPOB 2P0PA 3OBYA 2JTMA 4FCYA 2QK0A 5IHKA 2EKOA 2M9UA 5CK9A 3CCRA 3MP1A 2E5AA 1GXIE 4CC2A 3E9HA 4UC4A 4RTZA 2VGNA 1PYSB 2DIQA 2FO0A 2PTKA 2VKNA 3UWNA 3O5ZA 2EAYA 5J26A 2LQWA 2LTOA 2LQNA 3HPWA 1TTHB 3NPFA 4FT4A 3GBQA 3CCVT 5LJ5d 5GJVB 1BYMA 2QEXA 1Q7YR 4P3OA 4LUEA 1FYFA 1VQMQ 4JLGA 1X2HA 4WCIA 3ME9A 4H2VA 3JCMh 3EG9A 4CC3A 1QP2A 2IG0A 5KCHA 1BBUA 5ELNA 1YGBA 4XTZA 3REAB 1JO8A 4L6V5 5KYXA 4HT4A 5A2QE 2DLPA 1ADYA 1SSFA 3G7ZA 3L2UA 3M9QA 4P71C 3CCMA 4M77A 4O6JA 2PMEA 4M7AB 1I4K1 2J06A 5GAN6 1B34B 5ECAA 2QG9B 4M7DA 1OULA 5A0LA 1WYXA 1BIBA 1N8RR 1Q7YU 2BZ8A 3OBWA 2KRNA 5GAOp 2DXCA 1B7TA 1G5VA 1YFRA 3VS1A 3SHWA 2G3RA 2JJ9A 1SRLA 2GFAA 2JVVA 4PLLA 3QWXX 2XK0A 4FU6A 2XGTA 3VS5A 3G1JA 2MF2A 2QQBA 5GAMh 1YJNA 2JM9A 4MDXA 4LVJA 1KC8U 2KXCA 4H2XA 2FRYA 1I0CA 3OA6A 4FL6A 3MEWA 1NJ8A 3LH0A 2ZIOA 5GAOm 2C8MA 1X43A 1VQNT 1EIFA 4ZTFA 1U1TA 2COWA 2CUDA 3CCJA 3J7AF 1KJWA 1MMGA 5I21A 4Z88A 4LDXA 1ARKA 4A4GA 4NOYA 2E3HA 4WF2A 3CCRT 4BE2A 4HT9A 4H2YA 3TQ7P 2RHUA 1TXQA 2H3EB 4M7DC 1W1FA 3IKLA 3VU3C 4BI3A 5CR2A 3CC2A 1I81A 4KR3A 3SD4A 3LWIA 1YIJT 1D3BB 3A8LB 2MOXA 3NENA 1KHIA 2RK2A 1M1FA 2DILA 1TUGB 2HSEB 2LZ6B 3HRSA 2E70A 2NS6A 3ZL7C 3J80E 4KULA 4D8KA 2EYZA 2DFUA 3NTHA 4FYYB 3OS0A 5CAIA 3JV3A 3G4SQ 3NFCA 5IH2A 4AFSC 2EPDA 1K4US 2O9VA 2HNIA 3UA6A 4RTTA 2VYTA 3RMSA 5FRMA 3PCOA 1IL2A 4XAXB 1YHQA 1QWEA 1USYA 3QO3A 1M2OA 2VVKA 1X6BA 2SRCA 3MP6A 3QWYA 4P73C 4PFPA 3CCUA 2DTOA 3CPWS 2CP6A 3CMEQ 3G4ST 4CS3A 3OSVA 4P74C 4M7AA 1J3TA 3HFVA 4BY6C 4Y28E 3VQYA 1EIYA 5GAMf 2K3BA 2C0IA 2K2VA 1VQ4T 2W0ZA 4PJOB 2ZNIA 2FHDA 2NUZA 2E65A 4ZNXA 3CMAQ 2HQHA 3M4YA 3EGDA 4J83A 3H0IA 3H41A 1UJYA 2F5TX 4CC7A 4RKUE 2EW3A 3OYJA 3A5ZA 5LJ3f 3QKJA 4YPFA 4KQEA 4R0KA 2M51A 4D6WA 1RAEB 3X20B 4DBRA 1H4SA 1G8XA 2JMAA 4H2SA 1K76A 1FWZA 1RL2A 1QVFS 3RACA 2E41A 2XD0A 4M77G 1WJRA 4J7IA 4JRQA 1W2BS 2EGAA 4M7AD 4HXJA 2QTXA 1T0HA 1NEBA 1X01A 5CO7A 3OYFA 1PCXA 2HQEA 2K3YA 2VXEA 1NLOC 2MWPA 4LDYA 2O4XA 1VQZA 2E1HA 4C92D 3CCMT 4XTUA 3J81E 1OZ3A 4WJ3M 1WNLA 5GMKh 4IIOA 3CXCA 1M3AA 1AWJA 5FROA 3H0HA 3JCMJ 1H4QA 4EX5A 4RTXA 3BE3A 1PYSA 2I4NA 4TVAA 2QA4Q 2L0AA 1N27A 4ZN3A 2H8HA 1OU8A 2LJ0A 4C0ZA 1JJ2P 2HKQB 2DA9A 4JDSA 2PQWA 5FRNA 5C53B 8AT1B 3ER0A 3OMGA 1BBZA 1PRMC 3M53A 3JCMX 3QSUA 3HFZA 1M1KC 2EYQA 3CMEA 1Q81C 5C52B 2I2LA 2QDLA 4N4GA 1I8FA 1YI2A 1W70A 2PUKB 4M77E 1RABB 3M0TA 3NEMA 3NETA 1QMCA 2ALYA 3ZBDA 2PU9B 3AT1B 1YHQQ 4Z8AA 4BD3A 2DL4A 4C92G 1VQOA 1E22A 1YITQ 3KFUA 4WJ4A 2AZVA 1QVGP 3P8BB 2M1HA 4QT7A 3CCVQ 3Q1JA 2EQKA 2LX9A 5FLXE 2DU7A 1UGRB 1BCMA 2P4RA 4Y92A 1NPPA 1KK7A 2V1RA 2V1QA 3VS7A 1RAHB 1Q86C 4M77D 3TEGA 5LJ5h 2Z0WA 1EZZB 3LC0A 3LGLA 1TH7A 3QXEB 1ZUYA 1KMNA 4HVCA 1RLQC 3UFGA 1SEMA 4BB7A 3BDUA 1GRIA 4II1A 1MMNA 2KNBB 1K8AR 2JS2A 2JTFA 2XG8D 1BU1A 3TSZA 3FLGA 2ESWA 3RKXA 4PJOE 3REBB 4XU1A 4PJOF 3OYHA 3CPWA 4C8QA 1Y07A 2HSPA 3HXXA 3RF1A 4DOVA 1FMVA 2NLUA 1U06A 4JJCA 1S72A 3I5RA 5M9OA 3M4PA 1QQJA 1IO6A 2Y4XA 1CKAA 2P0QA 4HWSA 1GBRA 5CVIA 2DETA 3SDZA 3CMAT 2R5MA 2RHQB 2ZCFB 1M5Q1 5EC7A 4J8OA 1NEGA 1ASZA 3RUXA 3QNEA 2KXDA 2CJBA 2R5AA 2DM1A 3RDVA 1Z9QA 3FB9A 2FEIA 4BWAA 4G84A 2OTJA 5GAOl 2K79A 3HY0A 3LGFA 3EG9B 2ZT5A 2QASA 2BZYA 1PM3A 3I5SA 2HDAA 1G51A 3JCMP 1K0XA 3H8ZA 1W2BA 1T3LA 1Q82U 2CP5A 5HCKA 4OVAA 4FYVB 1SPKA 4J9FA 1MV0B 5DM7R 1PD0A 3V7CA 1X27A 4BW9A 1UGQB 4M77B 4R55A 2QQ9A 3I55Q 2KYMA 2PVDB 3VKIA 2IIMA 4A4KA 3HP9A 4P74A 1M2VB 2HBPA 3HFNA 2HMAA 5GAMg 4C8QE 3JCMb 3MCAB 3L2WA 5FU6C 4M78D 3PNWC 3CPWP 3CCMQ 3EH1A 4N0AA 4M77C 1YJNQ 5K1PA 2LNVA 2RMOA 4O5VA 3RKWA 4C0DC 2ZPFB 3CC4Q 4TTVA 2JN0A 2AKWA 3EG2A 5KYYA 2XDPA 3MO8A 4HWPA 4E51A 2MIOA 3S6WA 4WTOB 3A5YA 4P75C 2IY5A 2BE7D 4HA8A 2DVJA 1UDLA 2X4YA 3G6EQ 2A3LA 3EAEA 4F7UA 2QXFA 1SSHA 2CGHA 3LX7A 1WU7A 2LMJA 4JPBW 2OTLT 2V8JA 1VQ9Q 4AH6A 2MCNA 4IUQA 3M0QA 4D8DA 1QVGA 1NJ2A 2J3MA 2ARTA 4FYWB 3QZ9B 3IKMB 5GANh 1IHWA 4E6RA 3L4GA 4E7JA 2Q5HA 4BDYA 4QVCA 1BIAA 1OZ2A 1JJCB 3PGGA 2JZ2A 1YI2Q 4L87A 1Y0MA 1YJ9Q 4YRJA 2VC8A 3RIRA 3EFOB 1HSQA 2QI2A 2FVUA 1UJ0A 4M7DF 1KMMA 5LJ5f 1QLYA 1VQ9T 1Z9ZA 4JLIA 3LSSA 1PC0A 2CREA 1PG5B 5GMKm 4ZIBA 3CCVA 2ODRC 2QEXQ 3QO7A 3QPHA 5KYYB 4M75C 4IUTA 2DRMA 1HC7A 5IT9E 1UUEA 1SERA 4J15A 4OMLA 4B6MA 2WACA 4LVKA 5CKFA 4A63B 5GAN7 1B3QA 3L2VA 1KIKA 2RPNA 1L0WA 1YITT 1KQSP 2L5QA 1YWPA 1H4VB 2JW4A 4GLKA 1G5HA 3IG2A 1UHFA 5LL6S 2NYSA 5IHNA 3DLMA 1UEBA 1UHCA 1KQSA 5E3IA 5KE2A 4K86A 2FZCB 6AT1B 4M78G 1NBEB 1YN8A 1AZEA 1ZUUA 1Y96B 3CC2Q 4TVWA 4N0AC 3SEMA 1UECA 2M16A 2YUPA 2C06A 3E2UA 3TEHB 4YRLA 2CZ0B 5KYWA 4PG3A 4DBQA 2CKKA 2OAUA 2J6KA 4M75A 3LWHA 1Q82C 4KRTA 2RHSB 3ULRB 4M7DE 1EQRA 1H92A 2LCCA 2NUTB 1NNHA
chains in the Genus database with same CATH topology
1VQPT 2D9TA 4V2SA 2EIFA 1LJOA 2EJFA 4RCCA 4RQFA 1WLEA 4C8QB 2EJGA 2G4CA 2AMCA 2ZT7A 1QVGS 5FU7B 4EMGA 2CS7A 4PKCC 3OYIA 3RKYA 1WJQA 2DZCA 4J5YA 3PIOA 4XU3A 3QTCA 1VQ6T 1EOVA 4IUVA 3PFSA 2AMCB 3T9NA 2DDZA 2QHVA 3H6ZA 3C94A 4YCVA 4C5EA 3OY9A 4UP7A 1EIYB 4OB1B 1XOVA 5GANf 3GIBA 1Z7NA 1EVLA 1EFWA 2L3RA 3A8HB 4BUGA 3C12A 2LDMA 1IREB 2JUFA 3ZFJA 3E9GA 3QG1A 1WGSA 1N8RC 2GQVA 2RM4A 4EPCA 3M56A 4DQ2A 4H2UA 3I56A 3RL6A 3G4SA 2LRQA 5CQXA 2O01E 2VV5A 3P8YA 4PJOA 1YB3A 2DPPB 5DY9A 5HKCA 2KMTA 1AHJB 3I55T 1WYDA 4NCXA 4BI4A 2ZR3A 2E3CA 2EQMA 1KOGA 4OP0A 3G71A 5GANj 4YRSA 2K5LA 1KQSS 4QW2A 1XQHA 3VJPA 1G3TA 2DQ0A 2B8AA 4M78A 4DA4A 3HRKA 3G6ET 1VQ7A 2I4LA 1OI1A 2DTHA 2C7IA 4A53A 3GNFB 3E19A 5J39A 5A0DA 5GMKe 2ZINA 4X34A 4RCBA 1K8AC 4XU0A 5C6SA 4EMHA 5KE3A 5GAN3 5IN1A 2XTIA 1QW1A 3VBBA 3L2RA 3HXUA 3L4GB 3MEYA 2Y4YA 2MI6A 1JJCA 4ELZC 3JB9F 3CMQA 2EJ9A 3ERRA 5AYFA 2ZZDA 2RJEA 1EVKA 2ZTGA 2ARSA 3CMET 3JSCA 5CKEA 4M7DG 3HHTB 3L2ZA 3CC4T 3CD6T 3OW2S 1I5LA 3HFOA 1K73U 4Q5WA 2Q7EA 2YHTA 1K9MU 3JCMd 1KC8C 3FDRA 3O8VA 2E6ZA 4A4HA 4TQFA 3S3MA 1LOJA 3LYIA 3CCUT 3DSQA 3X24B 4J6YA 2ZZGA 5GAN8 1X54A 4C8QG 1N9RA 4RMOA 4IKFA 4QQGA 4MMLA 5FU7C 3CBPA 2DXTA 3R07A 4P75A 1PSFA 2ZT6A 4CH4A 1K73C 2LQ8A 3JB9I 4A4EA 1N6AA 4ME7A 4HCZA 4OB0B 1Q81U 4BACA 3HXWA 3A74A 3RMQA 4JS5A 4CH6A 1Y7XA 1VIFA 3E1SA 4G85A 1UGSB 2P0KA 3V7RA 4ZTUB 3MEAA 3HTZA 3QDRB 5GAMe 4LD6A 3UPUA 2GF7A 1IZ6A 4M75D 4M75E 4KUDK 4GY5A 1NJ5A 4H2TA 4M7AG 3M4GA 4YRQA 4F7UG 4C5GA 2ZPBB 1NYQA 3OQ5A 2PVGB 3JB9G 2QDYB 4JRPA 3MHXA 4CH3A 2K4YA 5CQYA 1VQOT 2A8EA 3HXYA 3HFZB 3CXCS 4C0GA 1YJWA 4YTLA 2QQAA 3ICAA 3MEUA 3VUBA 2QA4T 4P3PA 1VIEA 1B8AA 1E1OA 2EL9A 4QVDA 3REUA 4B9XA 1M90U 3PIPA 4E7IA 1K8AU 3A7AA 2RK1A 4JS4A 4LDUA 4XTVA 3F70A 2KQWA 4F7UE 1SETA 4QVZA 2CJ9A 1S72T 2ZR2A 3IALA 2DXBA 2ZPIB 5KH6A 2DO3A 5CKDA 2RI2A 2QEXT 3OS5A 4PJOD 3SWNC 4TVRA 3BFMA 4J7FA 4RMFA 1VQNA 3PT9A 3GF5A 3VQXA 2EWNA 3V8LA 4MDWA 3A31A 5D6XA 3FC3A 2RD1A 1KQ1A 1M8VA 3E9IA 3HXVA 4YCUA 1WPYA 1SESA 1VQPA 4JJNK 1VQ9A 5HY6A 3X28B 5GAMj 3OB9A 2DXUA 3CCEA 1U1SA 1NZ9A 3JCMV 4F7UF 2EQUA 2KY9A 4P5NA 1JJ2A 3A7RA 4DOWA 1N9WA 3SWNB 2X35A 2DKGA 4C8QC 4CS2A 4OB2B 2RB6A 2ZCEA 1H3ZA 2I4MA 1YHQT 1YJNT 2RI3A 3L1AA 4Q6GA 2QA4A 4UP9A 4K87A 3HL8A 4YCWA 2FYKA 2LCLA 1VQMT 4C5IA 3QO5A 2H3JA 4TVAB 3HRUA 4ZTZB 4F7UB 3UDCA 4M77F 5GANg 2E12A 2BUDA 3TEHA 5K1XA 4C0FA 4C8QD 4YREA 4VUBA 2QQSA 2RHYA 4HCBA 2RI5A 3OYEA 4E7LA 1KD1C 4A4FA 1UB4A 2YLCA 5LJ3g 2DK3A 2HQXA 5HGQA 1O9SA 2DJZA 1B34A 2PVOB 4CI0C 3CCLT 5D6WA 4N4HA 4A54A 4XEMA 1ZBXA 2DEQA 3CBOA 3TCJA 1QVFA 3CCQT 1VQ5T 1H641 4YRIA 3HRIA 2BIVA 4YRGA 2QHUA 1H4TA 5KNNA 1YJ9T 2V8KA 4HWTA 4HWOA 1WQWA 3CCJT 1Z7MA 4X9DA 2Y90A 2QHSA 2ZPHB 1YJWT 4MMKA 5CCAA 1BI1A 3FIFA 1HXDA 1O75A 1VQKT 3RGLA 2YRVA 5HK3A 3CPFA 1ATIA 3CC2T 4M78F 3INZA 1GGMA 2F5KA 1NJ6A 4E7KA 3QYGB 1JB0E 4O2DA 2RHIA 2RJFA 2RHXA 1M4ZA 5KCOA 1YFTA 2CIMA 2ZNJA 4YRMA 3OYNA 5GMKj 4XK8E 2BKDN 3CCSA 3HSBA 3DB3A 3SB2A 5GMKi 4NL3A 3L42A 3VQWA 4YRFA 4RG8A 3DKMA 4K88A 2R57A 1JJ2S 4C92E 2V8IA 2CZ1B 1KQ2A 5ELOA 4MZPA 5LJ5g 2P0LA 1WJSA 3RERA 1ADJA 1B70A 3JB9H 3A8GB 2EFIA 4M75B 5LJ3d 2MAMA 3P8VA 4E47A 4OGCA 1XTDA 3E9FA 5LJ5j 1BI3A 3VYHB 3UH0A 4ZTJA 3BY7A 4NL2A 4ATOA 4P73A 3QJ6A 3KBGA 3I7FA 3BJUA 2K57A 2LT1A 1Y96A 4L59A 2DU5A 5D6YA 4C92F 2Q7HA 1UGPB 3M5AA 5CKHA 4Q15A 3CEYA 3R6OA 1VQMA 2KDSA 3PMTA 1X55A 5C51B 4IURA 2I4OA 4E7HA 2DD4A 1BKBA 2E5QA 3QYHB 4XTXA 4YRPA 4J6WA 4CS4A 4PJOC 4RG2A 5F5WA 4BDZA 4EMKB 1VQ8T 2K5IA 4LDWA 3OYAA 4LVLA 3ZEHA 1BBWA 2KSSA 3V8JA 3OYGA 3HY1A 4C92B 1G3YA 3EFRA 3CC7T 2LQKA 4M7AF 1XNIA 4X5OA 5IAYA 1OYXA 4M7AC 1G3SA 3OYDA 4KR2A 2L8DA 4KBMB 4WI1A 3PZCA 4TQDA 4YRTA 3P8TA 4L5GA 2WSEE 5GAOr 3UGQA 4JUVA 4P72A 3CBMA 3TREA 2RJDA 3MF2A 3M59A 4IUPA 2HD0A 3NTKA 1B70B 2YLBA 2QHTA 1QE0A 1KHCA 4M78E 3OYCA 5LJ3e 5HK0A 4HCCA 3JB9D 3JAME 3RESA 2EQJA 1N8RU 2LC4A 3P8HA 2ZZEA 3UT1A 4XEOA 3MEVA 3FJPA 3GNGA 3S3NA 1SRYA 4OLFA 4KT0E 3META 1JBMA 2P5IA 4H2WA 2LVMA 5DLOA 5GANe 4M75G 4YRCA 2RJCA 2K5FA 3WQZA 2OTLA 3CCST 4FM4B 3X25B 3VQVA 1D3BA 3A8MB 2HAXA 4RQEA 4JRIA 3FEOA 2PMFA 3GPLA 1G5IA 2J3LA 4HKEA 4IUUA 3WVDB 2O4XB 3KXTA 3JCMg 4Y91A 3QJYA 2VUBA 2XDBA 1HTTA 1E24A 4YYEA 3LW5E 3OW2A 2CJAA 4OGEA 3TU4K 2XKOC 5GAOq 2IVWA 3OSSC 5C0MA 5A0GA 4LVIA 3URGA 4FSXA 2X4XA 1X6OA 3QO8A 3W3SA 4YRNA 1K9MC 2ZZFA 2KVQG 5EG2A 2ARUA 5CKBA 4XU2A 1BI0A 3NELA 4UPAA 4C0DB 1NJIC 3QZ5B 1YFSA 2VXFA 3DLLA 2GCXA 4XQ3A 1VQ6A 1U8RA 3GP8A 1NJIU 4YROA 2PUOB 4QQ6A 3G1ZA 2XI9A 3GOXA 5LJ3j 4LVMA 3G71T 2KK4A 2JNGA 3MP8A 2E6NA 5GAN4 1R8OB 1QVPA 1VQ8A 1LNXA 2ZT8A 3M55A 1JRIA 2DD5A 3OYYA 1VUBA 3QBYA 4M7DD 4OMFB 4JRKA 2F69A 4XTYA 3FRNA 3CC7A 4B9WA 4NS5A 3C4SA 1NE8A 4H02A 1Q7YC 5I2MA 2DVEA 2CZ7B 1VQLT 4HT8A 4M78B 3WXMB 3JCMW 5LJ5e 1M9SA 2DAQA 2RHSA 2XICA 4BE0A 3GLXA 4PNOA 4OB3B 3QUIA 1X2GA 2DZ9A 3LSQA 4PHCA 1QF6A 1DJ7B 2CYZB 4LD9K 2RHZA 2XU8A 3UGTA 3CCET 2LT4A 3V8KA 4ELYC 4R56A 3OS2A 3BDLA 3M57A 1W66A 2CZ6B 4ZN1A 1ZHIA 3JCMc 3QIIA 3KUFA 1VQ5A 1M90C 1KD1U 4M7DB 2ODRD 1HK9A 3ASKA 1YI2T 2X4JA 3LLRA 3CMAA 2DIGA 2VGMA 3VYGA 4FT2A 3OYLA 1G3WA 1YJ9A 3A32A 2DQ3A 1FXXA 3JRZA 3P8DA 1PSEA 5J3BA 1KG1A 4RDXA 1B76A 2ZIMA 1VQKA 3VUZA 3I55A 1YCYA 2D0QB 5GAN2 4EMKA 4BE1A 4H2XB 2D6FA 4J6XA 4C92C 4YP0A 3SFMA 1B7YB 2A7YA 3JCMe 1BI2A 3HXZA 3M58A 5GAMd 1W4SA 1J5WA 5GAN5 2L89A 4X9CA 1E1TA 2IY5B 4YDQA 3CC4A 3OYKA 1X56A 3TEEA 3CD6A 4ZGJB 3OMCA 3CCQA 1YBYA 4C8QF 3EFSA 4BI8B 4P71A 3WVEB 2WSFE 5I2SA 12ASA 3OD1A 1Q86U 4BY6B 1FX7A 3I56T 2M0OA 1MHNA 3BW1A 3JB9J 3HRTA 4PLIA 2GFUA 4QQDA 3PTAA 4YRKA 2ZPGB 4YRRA 4ZGEB 2FB7A 4EMKC 3JCMQ 4TVYA 1C0AA 4MZMA 4C92A 2XIDA 3A7UA 3C95A 1RI0A 1ZQ1A 5DLQE 1V29B 2JOYA 2AKWB 2ZPEB 1X75C 1MGQA 4P72C 5GAOn 2X4WA 1M1KU 1USYC 2RO0A 3M54A 1NPRA 4N4IA 2Q7GA 5LJ3h 1NJ1A 2E10A 4ZGDB 4EDUA 3CCLA 3TUPA 4P3NA 3AHUA 2ZXFA 2MMPA 2XDDA 3SWNA 3JCMf 1LYLA 1RIQA 4LNSA 3PMIA 3G6EA 5GANd 3V7SA 1VQ7T 5GMKl 1VQLA 2Q5IA 3A5ZB 1YITA 3QHSA 3M4QA 3PCOB 2E64A 4LDVA 3OYMA 2ZGWA 4CH5A 3OYBA 2OTJT 1P92A 2MWOA 1N9SA 1B7YA 4MZTA 1Y71A 5L8RE 3MQZA 3MF1A 1NYRA 3REXA 1QP3A 3NTIA 1M1GA 3HKSA 4XTWA 4DPGA 4KUIA 2AHJB 5CIUA 1YIJA 2DTIA 4M7AE 2ALYB 3N5BB 2WSCE 11ASA 3A8OB 4M75F 2R58A 4EO4A 1WQ7A 2RH2A 4Z02A 4PJOG 4UP8A 2KAFA 3L2QA 4M78C 2FL7A 3X26B 4C5HA 3DB4A 1VQ4A 4FIBA 3OS1A 2XHCA 4HWRA 4OF1A 4PL6A 3VV0A 2RA2A 4CRIA 1ASYA 3S3OA 2P4TA 2QQRA 2RHQA 4TWAA 2K3XA 5FU6B 2P0PA 3OBYA 2JTMA 2EKOA 2M9UA 5CK9A 3CCRA 3MP1A 2E5AA 1GXIE 3E9HA 4UC4A 2VGNA 1PYSB 2DIQA 3UWNA 2EAYA 5J26A 2LTOA 3HPWA 4FT4A 3CCVT 5LJ5d 1BYMA 2QEXA 4P3OA 1FYFA 4JLGA 1X2HA 3ME9A 4H2VA 3JCMh 1QP2A 2IG0A 1BBUA 5KCHA 5ELNA 1YGBA 4XTZA 4L6V5 4HT4A 5A2QE 1ADYA 1SSFA 3G7ZA 3L2UA 3M9QA 4P71C 3CCMA 4M77A 4O6JA 2PMEA 4M7AB 1I4K1 5GAN6 1B34B 4M7DA 5A0LA 1BIBA 1Q7YU 3OBWA 5GAOp 2DXCA 1G5VA 1YFRA 2G3RA 2GFAA 2JVVA 4PLLA 2XK0A 4FU6A 2XGTA 2MF2A 2QQBA 5GAMh 1YJNA 4MDXA 4LVJA 1KC8U 4H2XA 3OA6A 4FL6A 3MEWA 1NJ8A 3LH0A 2ZIOA 5GAOm 2C8MA 1VQNT 1EIFA 4ZTFA 1U1TA 3J7AF 3CCJA 5I21A 4LDXA 4A4GA 4NOYA 4WF2A 4H2YA 3CCRT 4BE2A 4HT9A 2RHUA 4M7DC 3IKLA 3VU3C 4BI3A 5CR2A 3CC2A 1I81A 4KR3A 3SD4A 3LWIA 1YIJT 1D3BB 3A8LB 3NENA 1KHIA 2RK2A 1M1FA 3HRSA 2E70A 2NS6A 3J80E 4KULA 3NTHA 3OS0A 5CAIA 3NFCA 2HNIA 2VYTA 3RMSA 5FRMA 3PCOA 1IL2A 4XAXB 1YHQA 1USYA 3QO3A 3MP6A 4P73C 3CCUA 2DTOA 3CPWS 4CS3A 3G4ST 3OSVA 4P74C 4M7AA 3HFVA 4BY6C 4Y28E 3VQYA 1EIYA 5GAMf 2K2VA 1VQ4T 4PJOB 2ZNIA 2FHDA 2E65A 3M4YA 4J83A 2F5TX 4RKUE 3OYJA 3A5ZA 5LJ3f 3QKJA 4YPFA 4KQEA 4D6WA 3X20B 1H4SA 4H2SA 1FWZA 1RL2A 1QVFS 3RACA 2E41A 2XD0A 4M77G 1WJRA 4J7IA 4JRQA 1W2BS 4M7AD 2QTXA 1X01A 5CO7A 3OYFA 2HQEA 2K3YA 2VXEA 2MWPA 4LDYA 2O4XA 1VQZA 2E1HA 4C92D 3CCMT 4XTUA 3J81E 1OZ3A 4WJ3M 1WNLA 5GMKh 3CXCA 5FROA 3JCMJ 1H4QA 4EX5A 1PYSA 2I4NA 4TVAA 1N27A 4ZN3A 4C0ZA 4JDSA 2PQWA 5FRNA 5C53B 3ER0A 3OMGA 3M53A 3JCMX 3QSUA 3HFZA 1M1KC 2EYQA 3CMEA 1Q81C 5C52B 2I2LA 4N4GA 1I8FA 1YI2A 2PUKB 4M77E 3NEMA 3NETA 2ALYA 3ZBDA 2PU9B 4BD3A 1E22A 4C92G 1VQOA 3KFUA 4WJ4A 3P8BB 2M1HA 3Q1JA 2EQKA 2LX9A 5FLXE 2DU7A 1UGRB 1NPPA 1Q86C 4M77D 3TEGA 5LJ5h 3LC0A 3LGLA 1TH7A 3QXEB 1KMNA 4HVCA 3UFGA 4BB7A 3BDUA 4II1A 2JTFA 2XG8D 3FLGA 3RKXA 4PJOE 4XU1A 4PJOF 3OYHA 3CPWA 4C8QA 1Y07A 3HXXA 3RF1A 4DOVA 2NLUA 1S72A 5M9OA 3M4PA 2Y4XA 2P0QA 4HWSA 5CVIA 3CMAT 3SDZA 2R5MA 2RHQB 2ZCFB 1M5Q1 4J8OA 1ASZA 3RUXA 3QNEA 2CJBA 2R5AA 3FB9A 4BWAA 4G84A 2OTJA 5GAOl 3HY0A 3LGFA 2ZT5A 1G51A 3JCMP 3H8ZA 1W2BA 1Q82U 4OVAA 5DM7R 3V7CA 4BW9A 1UGQB 4M77B 4R55A 2QQ9A 3VKIA 2PVDB 4A4KA 3HP9A 4P74A 2HBPA 3HFNA 5GAMg 4C8QE 3JCMb 3MCAB 3L2WA 5FU6C 4M78D 3PNWC 4N0AA 4M77C 5K1PA 2LNVA 4O5VA 3RKWA 4C0DC 2ZPFB 4TTVA 2JN0A 2AKWA 2XDPA 3MO8A 4HWPA 4E51A 3S6WA 3A5YA 4P75C 2IY5A 4HA8A 2X4YA 2A3LA 3EAEA 4F7UA 2QXFA 2CGHA 3LX7A 1WU7A 2OTLT 2V8JA 4AH6A 4IUQA 1QVGA 2J3MA 1NJ2A 2ARTA 3QZ9B 3IKMB 5GANh 3L4GA 4E7JA 2Q5HA 4BDYA 4QVCA 1BIAA 1OZ2A 1JJCB 3PGGA 2JZ2A 4L87A 4YRJA 2VC8A 3RIRA 2QI2A 2FVUA 4M7DF 1KMMA 5LJ5f 1VQ9T 4JLIA 3LSSA 5GMKm 4ZIBA 3CCVA 2ODRC 3QO7A 3QPHA 4M75C 4IUTA 1HC7A 5IT9E 1SERA 4J15A 4LVKA 2WACA 5CKFA 5GAN7 3L2VA 1L0WA 1YITT 2L5QA 1H4VB 4GLKA 1G5HA 3IG2A 5LL6S 3DLMA 1UEBA 1KQSA 5E3IA 5KE2A 4K86A 4M78G 1Y96B 4TVWA 4N0AC 2M16A 2C06A 3TEHB 4YRLA 2CZ0B 4PG3A 2CKKA 2OAUA 4M75A 3LWHA 1Q82C 2RHSB 4M7DE 1EQRA 2LCCA 1NNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9I A;  1YFS A;  2VXF A;  5GAM h;  3HXV A;  4XQ3 A;  4V2S A;  4H2X A;  4YCU A;  1WPY A;  1SES A;  1LJO A;  2EJF A;  4RCC A;  4YRO A;  4RQF A;  5GAM j;  1WLE A;  3G1Z A;  1NJ8 A;  4C8Q B;  2EJG A;  2G4C A;  2DXU A;  2AMC A;  5LJ3 j;  1U1S A;  2ZIO A;  5GAO m;  2C8M A;  2ZT7 A;  1U1T A;  3JCM V;  4F7U F;  3A7R A;  5I21 A;  5GAN 4;  4EMG A;  1N9W A;  3SWN B;  4NOY A;  2DKG A;  4WF2 A;  4C8Q C;  4HT9 A;  4H2Y A;  4CS2 A;  1LNX A;  3RKY A;  2DZC A;  4J5Y A;  2RB6 A;  1JRI A;  2ZCE A;  2ZT8 A;  2I4M A;  4M7D C;  4XU3 A;  3VU3 C;  3IKL A;  3QTC A;  4M7D D;  4JRK A;  1I81 A;  3L1A A;  4XTY A;  1EOV A;  4Q6G A;  4KR3 A;  4UP9 A;  1D3B B;  3NEN A;  4K87 A;  4YCW A;  2AMC B;  2FYK A;  2DDZ A;  2QHV A;  3QO5 A;  4H02 A;  5CAI A;  4YCV A;  4TVA B;  4ZTZ B;  4F7U B;  2DVE A;  4M77 F;  5GAN g;  2HNI A;  4UP7 A;  1EIY B;  4HT8 A;  5GAN f;  4M78 B;  3GIB A;  1Z7N A;  3JCM W;  5LJ5 e;  1EVL A;  3TEH A;  1EFW A;  2RHS A;  5K1X A;  4YRE A;  4C8Q D;  3PCO A;  1IL2 A;  1USY A;  3QO3 A;  4PNO A;  3QUI A;  2YLC A;  5LJ3 g;  1X2G A;  2DZ9 A;  4P73 C;  3LSQ A;  2RM4 A;  5HGQ A;  4PHC A;  1QF6 A;  2DJZ A;  1B34 A;  2DTO A;  4CS3 A;  4DQ2 A;  4P74 C;  4H2U A;  4M7A A;  4A54 A;  3HFV A;  3RL6 A;  4XEM A;  3VQY A;  1EIY A;  5GAM f;  2DEQ A;  3UGT A;  3V8K A;  4PJO B;  2ZNI A;  2E65 A;  3P8Y A;  1H64 1;  4PJO A;  1W66 A;  1YB3 A;  4YRI A;  3JCM c;  5DY9 A;  3HRI A;  4YRG A;  2QHU A;  1WYD A;  4NCX A;  2ZR3 A;  1H4T A;  2E3C A;  5LJ3 f;  3A5Z A;  4M7D B;  5KNN A;  2ODR D;  1HK9 A;  4YPF A;  4KQE A;  1KOG A;  1H4S A;  4OP0 A;  4H2S A;  4HWT A;  4HWO A;  3RAC A;  2E41 A;  1WQW A;  5GAN j;  1Z7M A;  3A32 A;  4YRS A;  4X9D A;  2DQ3 A;  4M77 G;  2Y90 A;  2QHS A;  4MMK A;  3FIF A;  1HXD A;  4M7A D;  2DQ0 A;  2QTX A;  4M78 A;  3RGL A;  4RDX A;  1X01 A;  3HRK A;  1B76 A;  2VXE A;  2I4L A;  2ZIM A;  2DTH A;  2C7I A;  1ATI A;  1YCY A;  4A53 A;  4M78 F;  1VQZ A;  3INZ A;  5GAN 2;  4EMK A;  1GGM A;  4H2X B;  2E1H A;  4J6X A;  4C92 D;  5GMK e;  1NJ6 A;  4XTU A;  2ZIN A;  4C92 C;  4YP0 A;  4WJ3 M;  4RCB A;  1B7Y B;  4O2D A;  1WNL A;  5GMK h;  4XU0 A;  4EMH A;  3JCM e;  3HXZ A;  5GAM d;  5GAN 3;  1J5W A;  3JCM J;  1YFT A;  5GAN 5;  2CIM A;  2ZNJ A;  4YRM A;  2XTI A;  5GMK j;  1H4Q A;  4EX5 A;  4X9C A;  1E1T A;  3VBB A;  1PYS A;  2IY5 B;  3HSB A;  4YDQ A;  2I4N A;  3HXU A;  4TVA A;  1X56 A;  5GMK i;  3SB2 A;  3L4G B;  3MEY A;  4NL3 A;  4C8Q F;  3EFS A;  1JJC A;  3VQW A;  4YRF A;  3JB9 F;  3CMQ A;  4P71 A;  5C53 B;  4K88 A;  3JCM X;  3QSU A;  12AS A;  2EJ9 A;  3OD1 A;  3ERR A;  3HFZ A;  4C92 E;  1KQ2 A;  5C52 B;  5ELO A;  2I2L A;  1EVK A;  3BW1 A;  1I8F A;  5LJ5 g;  3JB9 J;  2ZTG A;  2ARS A;  4M77 E;  2P0L A;  3RER A;  1ADJ A;  3NEM A;  1B70 A;  3NET A;  2ALY A;  3JB9 H;  1E22 A;  4C92 G;  4YRK A;  4M75 B;  5LJ3 d;  4M7D G;  4YRR A;  3KFU A;  4WJ4 A;  3L2Z A;  2FB7 A;  4EMK C;  3P8V A;  3JCM Q;  4TVY A;  1C0A A;  1I5L A;  3HFO A;  4C92 A;  2DU7 A;  3A7U A;  2Q7E A;  5LJ5 j;  2YHT A;  3JCM d;  3UH0 A;  2AKW B;  1MGQ A;  4P72 C;  5GAO n;  4TQF A;  1USY C;  4M77 D;  3TEG A;  5LJ5 h;  3BY7 A;  1LOJ A;  2Q7G A;  5LJ3 h;  3LC0 A;  1TH7 A;  4NL2 A;  1NJ1 A;  2E10 A;  3DSQ A;  1KMN A;  4HVC A;  3TUP A;  4P73 A;  3UFG A;  4P3N A;  3AHU A;  2ZXF A;  4J6Y A;  3BDU A;  2ZZG A;  5GAN 8;  3SWN A;  3JCM f;  1X54 A;  3I7F A;  1LYL A;  1RIQ A;  4C8Q G;  4LNS A;  3BJU A;  2K57 A;  3RKX A;  1N9R A;  3V7S A;  5GAN d;  4PJO E;  4XU1 A;  4PJO F;  5GMK l;  4C8Q A;  2Q5I A;  4MML A;  1Y96 A;  2DU5 A;  2DXT A;  3HXX A;  3RF1 A;  4C92 F;  3QHS A;  2Q7H A;  3R07 A;  3M4Q A;  3M4P A;  4Q15 A;  3PCO B;  2E64 A;  2ZT6 A;  4HWS A;  4P75 A;  2ZGW A;  4CH4 A;  2RHQ B;  3JB9 I;  4CH5 A;  1M5Q 1;  1X55 A;  3HXW A;  1ASZ A;  3A74 A;  3RUX A;  5C51 B;  3QNE A;  2CJB A;  4CH6 A;  2I4O A;  3FB9 A;  1N9S A;  1B7Y A;  4BWA A;  4XTX A;  4G84 A;  5GAO l;  3HY0 A;  4G85 A;  4J6W A;  4YRP A;  3MF1 A;  4CS4 A;  4PJO C;  1NYR A;  3REX A;  5F5W A;  2ZT5 A;  4EMK B;  4XTW A;  4DPG A;  1G51 A;  3JCM P;  3V7R A;  1BBW A;  4ZTU B;  3V8J A;  3HY1 A;  4C92 B;  3V7C A;  3EFR A;  3HTZ A;  4BW9 A;  4M77 B;  5GAM e;  4M7A F;  2DTI A;  4M7A E;  4X5O A;  2ALY B;  4M7A C;  4M75 D;  4P74 A;  4M75 E;  11AS A;  5GAM g;  3HFN A;  4C8Q E;  4M75 F;  3JCM b;  4EO4 A;  1NJ5 A;  1WQ7 A;  4M78 D;  4KR2 A;  4PJO G;  4UP8 A;  4N0A A;  4M78 C;  4M77 C;  4H2T A;  5K1P A;  4M7A G;  3RKW A;  4TTV A;  4WI1 A;  2JN0 A;  2AKW A;  3M4G A;  4E51 A;  3PZC A;  4HWP A;  4TQD A;  4YRQ A;  3P8T A;  4YRT A;  3A5Y A;  4P75 C;  2IY5 A;  4HA8 A;  4F7U G;  4HWR A;  1NYQ A;  2RA2 A;  5GAO r;  3UGQ A;  4JUV A;  4P72 A;  1ASY A;  4F7U A;  3MF2 A;  3JB9 G;  2RHQ A;  2CGH A;  1B70 B;  2QHT A;  2YLB A;  1WU7 A;  1QE0 A;  4TWA A;  4CH3 A;  4M78 E;  5LJ3 e;  4AH6 A;  3JB9 D;  3HXY A;  3RES A;  1NJ2 A;  2J3M A;  2ART A;  3HFZ B;  3IKM B;  5GAN h;  3L4G A;  2Q5H A;  2E5A A;  3E9H A;  4QVC A;  1BIA A;  1PYS B;  2ZZE A;  1JJC B;  3ICA A;  4XEO A;  3PGG A;  2EAY A;  4L87 A;  3FJP A;  4YRJ A;  1SRY A;  2VC8 A;  4P3P A;  4OLF A;  3RIR A;  1JBM A;  2P5I A;  4H2W A;  4M7D F;  1KMM A;  5LJ5 f;  5LJ5 d;  5GAN e;  1B8A A;  4JLI A;  4M75 G;  1E1O A;  3LSS A;  4YRC A;  4P3O A;  2EL9 A;  3WQZ A;  5GMK m;  4ZIB A;  1FYF A;  4QVD A;  1X2H A;  2ODR C;  3REU A;  3QO7 A;  3VQV A;  4H2V A;  1D3B A;  3JCM h;  4M75 C;  3A7A A;  1HC7 A;  4RQE A;  4JRI A;  2PMF A;  1SER A;  1G5I A;  4XTV A;  4J15 A;  2J3L A;  5GAN 7;  1BBU A;  4F7U E;  1SET A;  1YGB A;  5ELN A;  2CJ9 A;  4XTZ A;  3JCM g;  1L0W A;  4Y91 A;  1H4V B;  1ADY A;  1HTT A;  2ZR2 A;  1G5H A;  4P71 C;  3IG2 A;  3IAL A;  1E24 A;  4YYE A;  4M77 A;  2PME A;  4M7A B;  1I4K 1;  2CJA A;  5GAN 6;  5E3I A;  1B34 B;  4K86 A;  5GAO q;  4PJO D;  4M78 G;  4M7D A;  3SWN C;  1Y96 B;  1BIB A;  3BFM A;  4TVW A;  3QO8 A;  4RMF A;  3W3S A;  4YRN A;  4N0A C;  5GAO p;  2ZZF A;  3TEH B;  3VQX A;  2ARU A;  4YRL A;  2EWN A;  3V8L A;  4XU2 A;  1YFR A;  3A31 A;  3NEL A;  4PG3 A;  4UPA A;  2RD1 A;  1KQ1 A;  4M75 A;  1M8V A;  2RHS B;  2XGT A;  4M7D E;  1EQR A;  1NNH A; 
#chains in the Genus database with same CATH topology
 1VQP T;  1QKW A;  1X6G A;  2D9T A;  4V2S A;  4DEX A;  2VB6 A;  2EIF A;  1VQ6 Q;  1BCO A;  1LJO A;  2EJF A;  4RCC A;  4RQF A;  2EYY A;  1WLE A;  4C8Q B;  1ZSG A;  2EJG A;  2GTO A;  2G4C A;  2AMC A;  2DF6 A;  1QVG S;  2ZT7 A;  5FU7 B;  5FW9 A;  1R77 A;  3VS3 A;  2YRD A;  4M4Z A;  4EMG A;  2CS7 A;  2LNH B;  4PKC C;  3OYI A;  1B07 A;  4X1V A;  1WJQ A;  2DZC A;  3RKY A;  4J5Y A;  3PIO A;  4XU3 A;  2ECZ A;  3QTC A;  1VQ6 T;  2X51 A;  1EOV A;  2DL5 A;  4IUV A;  3PFS A;  7AT1 B;  2AMC B;  3T9N A;  2DDZ A;  2QHV A;  1WI7 A;  3CCS Q;  3H6Z A;  1JEG A;  3C94 A;  2O2O A;  4YCV A;  4C5E A;  4FYX B;  1EFN A;  2O9S A;  3OY9 A;  4UP7 A;  1EIY B;  4OB1 B;  1XOV A;  2G6F X;  5GAN f;  2NUT A;  3CCU Q;  3GIB A;  1Z7N A;  1EVL A;  1EFW A;  2L3R A;  1M3C A;  3A8H B;  4BUG A;  3C12 A;  2LDM A;  1IRE B;  2JUF A;  3ZFJ A;  3E9G A;  2CT4 A;  2M02 A;  3QG1 A;  2KR3 A;  2DRK A;  1WGS A;  2EGC A;  2HL5 C;  1N8R C;  2GQV A;  2RM4 A;  4EPC A;  3M56 A;  1AWO A;  2QYZ A;  1AZG B;  1WXT A;  4DQ2 A;  1MMD A;  4H2U A;  3I56 A;  3RL6 A;  4FW1 A;  3G4S A;  2LRQ A;  5CQX A;  1QWF A;  2O01 E;  1UTI A;  2K6D A;  3CCJ Q;  1GL5 A;  2OTL Q;  2VV5 A;  3P8Y A;  4PJO A;  2OJ2 A;  1YB3 A;  2DPP B;  5DY9 A;  5HKC A;  2OTJ Q;  2KMT A;  1AHJ B;  3I55 T;  2RNA A;  1WYD A;  4NCX A;  3NMZ C;  4BI4 A;  2ZR3 A;  2E3C A;  2EQM A;  1KOG A;  2RQT A;  3OW2 P;  4OP0 A;  3G71 A;  1MUZ A;  5GAN j;  4YRS A;  4HVU A;  2K5L A;  1KQS S;  1R0C B;  4QW2 A;  1XQH A;  3VJP A;  1G3T A;  2DQ0 A;  4M78 A;  2B8A A;  3EFO A;  4DA4 A;  2HEQ A;  3HRK A;  3G6E T;  1VQ7 A;  2I4L A;  1E7O A;  1OI1 A;  2BE9 B;  2L3P A;  2DTH A;  2C7I A;  4KGZ B;  1R0B G;  4A53 A;  1OU9 A;  3GNF B;  4JJD A;  3I9Q A;  2E4H A;  3E19 A;  5J39 A;  5A0D A;  5GMK e;  1VOM A;  2ZIN A;  2XMF A;  4X34 A;  4DEY A;  4RCB A;  1K8A C;  4XU0 A;  5C6S A;  4EMH A;  1NLP C;  1UFF A;  2DX1 A;  5KE3 A;  5GJW B;  5GAN 3;  5IN1 A;  2XTI A;  1K73 R;  1QW1 A;  3VBB A;  3L2R A;  1QVF P;  3HXU A;  2A0F B;  3L4G B;  3MEY A;  2Y4Y A;  2MI6 A;  1IB8 A;  2HBW A;  1FMW A;  1JJC A;  2QTV A;  4OMP A;  4ELZ C;  3JB9 F;  3CMQ A;  2O31 A;  1VQO Q;  1HYO A;  2EJ9 A;  3ERR A;  5AYF A;  2ZZD A;  5FWB A;  2RJE A;  1EVK A;  2ZTG A;  1TOV A;  2ARS A;  1VYU A;  1TS9 A;  3CME T;  3JSC A;  4K11 A;  4AG2 C;  1MV3 A;  3KFV A;  5CKE A;  4M7D G;  2DL7 A;  3HHT B;  3L2Z A;  3CC4 T;  4EIK A;  3CD6 T;  1AVZ C;  2EGE A;  3OW2 S;  1I5L A;  3HFO A;  2A36 A;  1K73 U;  1NG2 A;  4Q5W A;  1VQ5 Q;  1QCF A;  2Q7E A;  2YHT A;  1K9M U;  3JCM d;  1KC8 R;  1KC8 C;  3FDR A;  3O8V A;  2E6Z A;  4A4H A;  4TQF A;  3CCR Q;  2A28 A;  3S3M A;  1LOJ A;  3LYI A;  3CCU T;  3DSQ A;  1S1N A;  2P84 A;  3X24 B;  4J6Y A;  2ZZG A;  5GAN 8;  1X54 A;  4C8Q G;  1N9R A;  4RMO A;  4IKF A;  3C0C A;  2D0N A;  4QQG A;  2KBT A;  4MML A;  1H3H A;  5FU7 C;  3CBP A;  2DXT A;  2KE9 A;  4Z89 A;  1RI9 A;  2CSQ A;  3R07 A;  3U23 A;  1PSF A;  2ZT6 A;  4P75 A;  4CH4 A;  1K73 C;  1HD3 A;  2LQ8 A;  3JB9 I;  4A4E A;  1N6A A;  4ME7 A;  4HCZ A;  4OB0 B;  1Q81 U;  4BAC A;  3HXW A;  4F14 A;  3RMQ A;  3A74 A;  3R6N A;  3VS6 A;  4JS5 A;  4CH6 A;  1CKB A;  1D1C A;  1Y7X A;  2JS0 A;  5KYU A;  4AFQ C;  1VIF A;  3E1S A;  4G85 A;  1UGS B;  2EVR A;  1OQK A;  2P0K A;  2F2W A;  3V7R A;  1PD1 A;  4ZTU B;  3MEA A;  1XJW B;  1X2Q A;  4E7Z A;  5IXF A;  2F2X A;  2JTE A;  4J9D A;  4J9C A;  3HTZ A;  3QDF A;  2COY A;  3QDR B;  4LD6 A;  5GAM e;  3UPU A;  2D1X A;  1NYG A;  3I56 Q;  2CP0 A;  2GF7 A;  1IZ6 A;  1RAD B;  4M75 D;  1BB9 A;  4M75 E;  2YUO A;  4KUD K;  4GY5 A;  1NJ5 A;  2K7A A;  4H2T A;  1RAA B;  1SF9 A;  4M7A G;  2E5K A;  3M4G A;  4YRQ A;  5IXB A;  4F7U G;  4RTW A;  4C5G A;  2ROL A;  2ZPB B;  1NYQ A;  2PZ1 A;  3OQ5 A;  2PVG B;  1U3O A;  3JB9 G;  2QDY B;  4JRP A;  1VQL Q;  3MHX A;  4CH3 A;  2K4Y A;  3PVL A;  5CQY A;  2DBK A;  1VQO T;  2A8E A;  3HXY A;  2ED1 A;  3HFZ B;  3CXC S;  4C0G A;  2JMC A;  1YJW A;  4YTL A;  1C0M A;  3TSW A;  3LH5 A;  2QQA A;  3ICA A;  1Q95 G;  4PFO A;  3MEU A;  3EGX B;  1NYF A;  3MJX A;  3VUB A;  2QA4 T;  4P3P A;  4J9I A;  2QGG A;  1F1B B;  1VIE A;  1B8A A;  1E1O A;  1AT1 B;  2EL9 A;  2ED0 A;  4QVD A;  2DEU A;  3REU A;  4B9X A;  1M90 U;  3PIP A;  4E7I A;  1K8A U;  1TWB A;  3A7A A;  2C0O A;  2RK1 A;  1RAI B;  4PFZ A;  4JS4 A;  4LDU A;  4XTV A;  3F70 A;  2KQW A;  3EGD B;  4F7U E;  1SET A;  4QVZ A;  1D1B A;  2CJ9 A;  4KH1 B;  2A08 A;  2F2V A;  1UE9 A;  1S72 T;  2ZR2 A;  3IAL A;  2DXB A;  1WHH A;  1VA7 A;  1WHK A;  2ZPI B;  5KH6 A;  2O88 A;  2DO3 A;  5CKD A;  2RI2 A;  3NHN A;  2QEX T;  3OS5 A;  4PJO D;  1KSW A;  3SWN C;  4TVR A;  2YUQ A;  3BFM A;  3EHQ A;  4IIM A;  1WXB A;  4J7F A;  1YWO A;  4RMF A;  2RQV A;  1OV3 A;  4ORZ A;  1VQN A;  5KYU B;  3PT9 A;  1NM7 A;  3GF5 A;  3VQX A;  2EWN A;  3V8L A;  4MDW A;  3A31 A;  1WHM A;  5D6X A;  3FC3 A;  2RD1 A;  1KQ1 A;  1M8V A;  2AKL A;  3E9I A;  1ZSZ C;  3HXV A;  2HKN A;  1M27 C;  4YCU A;  1WPY A;  1SES A;  1VQP A;  2AKK A;  4JJN K;  1VQ9 A;  5HY6 A;  2LX7 A;  3X28 B;  2ATC B;  5GAM j;  2FPD A;  3OB9 A;  2DXU A;  1RLP C;  3CCE A;  1U1S A;  3EGU A;  1NZ9 A;  2DL8 A;  3JCM V;  4F7U F;  2EQU A;  2KY9 A;  1ZSZ A;  4P5N A;  1JJ2 A;  3A7R A;  2VAS A;  4DOW A;  1N9W A;  3SWN B;  2X35 A;  2DKG A;  1TUD A;  4C8Q C;  4CS2 A;  4OB2 B;  1M2V A;  2RB6 A;  2ZCE A;  1H3Z A;  2I4M A;  1YHQ T;  1YJN T;  2KI7 A;  2RI3 A;  3L1A A;  2YT6 A;  3A98 A;  4Q6G A;  2QA4 A;  4UP9 A;  1T3S A;  4K87 A;  3HL8 A;  4YCW A;  2FYK A;  1NJI R;  2LCL A;  1VQM T;  4RTY A;  4C5I A;  3QO5 A;  2DL3 A;  2H3J A;  1UGV A;  4PJM A;  4TVA B;  3HRU A;  5FWC A;  4ZTZ B;  4F7U B;  2F1L A;  3UDC A;  4M77 F;  5GAN g;  2E12 A;  2J6O A;  2BUD A;  2CH4 W;  4KGX B;  1K9M R;  3TEH A;  1OX8 A;  5K1X A;  1VYV A;  4C0F A;  4C8Q D;  4VUB A;  3M0R A;  4YRE A;  2QQS A;  2RHY A;  4HCB A;  1WHL A;  2B86 A;  3TVT A;  2RI5 A;  3OYE A;  4E7L A;  1KD1 C;  4A4F A;  4DBH A;  1UB4 A;  1C1A A;  1QKX A;  1ZLM A;  3UA7 A;  4JZ3 A;  1VQ7 Q;  2YLC A;  5LJ3 g;  4PJN A;  2DK3 A;  2HQX A;  5HGQ A;  1O9S A;  2DJZ A;  1AD5 A;  1B34 A;  2PVO B;  4CI0 C;  3CCL T;  5D6W A;  2EYW A;  4N4H A;  4AFZ C;  1OX9 A;  4A54 A;  4XEM A;  1ZBX A;  2DEQ A;  3CBO A;  2M0Y A;  1M90 R;  2NUP B;  4JJB A;  3TCJ A;  1QVF A;  3CCQ T;  1VQ5 T;  1H64 1;  1V76 A;  4YRI A;  3CC7 Q;  3HRI A;  2BIV A;  4YRG A;  2QHU A;  4F17 A;  2SEM A;  1H4T A;  2OAW A;  5KNN A;  3IQL A;  2YXY A;  2YDL A;  1YJ9 T;  2V8K A;  3EH2 A;  4HWT A;  4HWO A;  1WQW A;  2DJQ A;  3CCJ T;  1Z7M A;  3VRZ A;  4X9D A;  1G2B A;  2Y90 A;  4PJJ A;  2QHS A;  2ZPH B;  1YJW T;  2X3X D;  4MMK A;  1H8K A;  1EX4 A;  4ESR A;  5CCA A;  1BI1 A;  3FIF A;  1HXD A;  1O75 A;  1VQK T;  2DER A;  1W2B P;  3RGL A;  1RAC B;  2YRV A;  5HK3 A;  1ZSZ B;  3CPF A;  1ATI A;  3CC2 T;  4M78 F;  4LE9 A;  3INZ A;  1GGM A;  2F5K A;  4J9G A;  2J6F A;  1NJ6 A;  4E7K A;  3QYG B;  1JB0 E;  4O2D A;  4KH0 B;  4E7S A;  2COZ A;  5IHI A;  2RHI A;  1YP5 A;  2RJF A;  2RHX A;  4RUG A;  1M4Z A;  5KCO A;  1YFT A;  2CIM A;  2ZNJ A;  4YRM A;  3OYN A;  5GMK j;  1C6V X;  2BKD N;  3EHR A;  4XK8 E;  3CCS A;  1ACM B;  2AT1 B;  3HSB A;  1CSK A;  1ZA2 B;  1V1C A;  1D0X A;  3DB3 A;  3SB2 A;  5GMK i;  4NL3 A;  1GCQ C;  2BZX A;  3L42 A;  1WLP B;  3VQW A;  4YRF A;  2E3I A;  4RG8 A;  3DKM A;  4K88 A;  2R57 A;  1JJ2 S;  2MK5 A;  4C92 E;  2V8I A;  2CZ1 B;  1KQ2 A;  1KFZ A;  5ELO A;  4MZP A;  5LJ5 g;  3H9N A;  1M8M A;  2P0L A;  1PKS A;  2DE0 X;  1WJS A;  3RER A;  2DYB A;  1ADJ A;  1B70 A;  3JB9 H;  3A8G B;  2CDT A;  2EFI A;  4M75 B;  5LJ3 d;  2MAM A;  1RAF B;  1VQ4 Q;  1IGU A;  3P8V A;  4GBQ A;  3CCQ Q;  4E47 A;  1OOT A;  2RQR A;  4OGC A;  1XTD A;  3E9F A;  5LJ5 j;  1BI3 A;  3VYH B;  1AOJ A;  1AWW A;  3NGP A;  3UH0 A;  4ZTJ A;  3CXC P;  2FZG B;  3BY7 A;  3RBB B;  1IRX A;  1WDX A;  2JXB A;  9ATC B;  4PK4 A;  4NL2 A;  1YFN A;  4ATO A;  1K0S A;  4AMC A;  4P73 A;  3QJ6 A;  1BK2 A;  3KBG A;  3I7F A;  1RUW A;  1X69 A;  3BJU A;  2K57 A;  2AIR B;  2LT1 A;  1VQK Q;  2K2M A;  1Y96 A;  4L59 A;  2DU5 A;  2A37 A;  5D6Y A;  4C92 F;  2Q7H A;  1UGP B;  3CCE Q;  3M5A A;  5CKH A;  1MND A;  4Q15 A;  1SG5 A;  3CEY A;  3R6O A;  1VQM A;  1YNZ A;  2KDS A;  3PMT A;  1UG1 A;  4ANJ A;  1X55 A;  4FW2 A;  5C51 B;  2C0T A;  4IUR A;  4DBF A;  1QCO A;  2I4O A;  4E7H A;  2DD4 A;  1BKB A;  2E5Q A;  3QYH B;  3EG1 A;  4XTX A;  4YRP A;  4J6W A;  4CS4 A;  4PJO C;  4RG2 A;  2FPE A;  2JT4 A;  5F5W A;  4BDZ A;  4EMK B;  1VQ8 T;  2K5I A;  2EKH A;  4LDW A;  3OYA A;  4LVL A;  2HCK A;  3ZEH A;  1BBW A;  2KSS A;  3V8J A;  3OYG A;  3HY1 A;  4C92 B;  1LPL A;  1G3Y A;  3EFR A;  3CC7 T;  2NUP A;  2LQK A;  4M7A F;  1XNI A;  4X5O A;  4HCK A;  5IAY A;  1OYX A;  3MKD A;  4M7A C;  2CSI A;  1G3S A;  3OYD A;  1GFC A;  3THK A;  1T0J A;  4KR2 A;  4PJL A;  1VYT A;  2L8D A;  1I1J A;  4KBM B;  4WI1 A;  2OX7 A;  3PZC A;  4TQD A;  4YRT A;  3P8T A;  4J9H A;  4QKU A;  4L5G A;  2QGF B;  4AT1 B;  2GTJ A;  2WSE E;  2YWW A;  4LXC A;  5GAO r;  3UGQ A;  4JUV A;  4P72 A;  1RAG B;  3CBM A;  3TRE A;  1TU0 B;  2RJD A;  2PNI A;  3MF2 A;  3M59 A;  4AFU C;  4IUP A;  2HD0 A;  2DYI A;  3NTK A;  1B70 B;  2YLB A;  2QHT A;  1QE0 A;  2KGT A;  2JM8 A;  1WIE A;  1KHC A;  4M78 E;  1WA7 A;  3OYC A;  5LJ3 e;  5HK0 A;  4HCC A;  3JB9 D;  5I11 A;  3JAM E;  2GQI A;  3RES A;  1SRM A;  1MMA A;  2EQJ A;  1E6H A;  1WFW A;  1N8R U;  2LC4 A;  4LUD A;  3P8H A;  2ZZE A;  3UT1 A;  4XEO A;  3MEV A;  3FJP A;  3GNG A;  3S3N A;  1SRY A;  4OLF A;  4KT0 E;  3MET A;  1JQQ A;  1JBM A;  2P5I A;  1ABO A;  1S72 Q;  4H2W A;  2LVM A;  1E6G A;  1I5O B;  5DLO A;  2GGR A;  5GAN e;  4M75 G;  4YRC A;  2RJC A;  2K5F A;  3WQZ A;  2OTL A;  3CCS T;  4FM4 B;  2DMO A;  3X25 B;  1D09 B;  3VQV A;  1D3B A;  2AZS A;  3A8M B;  2HAX A;  4RQE A;  4JRI A;  3FEO A;  2EQI A;  2D8J A;  3GPL A;  1G5I A;  2PMF A;  2J3L A;  4HKE A;  1GCP A;  4IUU A;  3WVD B;  4J9B A;  2O4X B;  3KXT A;  3JCM g;  4Y91 A;  3QJY A;  2CP7 A;  2K9G A;  2VUB A;  2XDB A;  1HTT A;  1E24 A;  1YJW Q;  4YYE A;  3LW5 E;  3OW2 A;  2RQU A;  2CJA A;  3FJ5 A;  4OGE A;  3TU4 K;  2XKO C;  2I0N A;  5GAO q;  2IVW A;  3OSS C;  5C0M A;  5A0G A;  3CCL Q;  4LVI A;  3URG A;  4FSX A;  1HJD A;  2X3W D;  1ZX6 A;  2X4X A;  1X6O A;  3QO8 A;  3W3S A;  4YRN A;  1K9M C;  4CC4 B;  1KD1 R;  2KVQ G;  2ZZF A;  1JXM A;  5EG2 A;  2ARU A;  5CKB A;  4XU2 A;  1TG0 A;  5L23 A;  1BI0 A;  1PRL C;  3NEL A;  4UPA A;  4C0D B;  3M0P A;  1NJI C;  3QZ5 B;  2YRC A;  1YFS A;  2VXF A;  3DLL A;  2GCX A;  4XQ3 A;  1VQ6 A;  4GLM A;  2FPF A;  1U8R A;  4OMM A;  3GP8 A;  1NJI U;  4J9E A;  2KEA A;  4YRO A;  1PKT A;  2PUO B;  4QQ6 A;  3G1Z A;  1M1K R;  1OPL A;  4F04 B;  1PNJ A;  2XI9 A;  1D0Y A;  5LJ3 j;  3GOX A;  4LVM A;  1W6X A;  3G71 T;  2GNC A;  2KK4 A;  2JNG A;  3MP8 A;  4HVV A;  2E6N A;  5GAN 4;  1M30 A;  1R8O B;  1QVP A;  1VQ8 A;  4OMO A;  1LNX A;  2ZT8 A;  3M55 A;  1JRI A;  1PWT A;  2DD5 A;  1VUB A;  3OYY A;  3QBY A;  1K9A A;  2AK5 A;  1K1Z A;  4M7D D;  4OMF B;  4JRK A;  2F69 A;  4XTY A;  3FRN A;  3CD6 Q;  3CC7 A;  4LNP A;  2FG0 A;  4B9W A;  2QAZ A;  4NS5 A;  3C4S A;  2VWF A;  1A0N B;  3A1P A;  1NE8 A;  1X2K A;  3VRY A;  3M0S A;  1Q7Y C;  4H02 A;  3VS0 A;  2RF0 A;  5I2M A;  2CT3 A;  2DVE A;  2CZ7 B;  1SKU B;  1TUC A;  3I35 A;  1VQL T;  3UAT A;  4HT8 A;  4M78 B;  3WXM B;  3JCM W;  5LJ5 e;  1M9S A;  2DAQ A;  1GCQ A;  2RHS A;  2ENM A;  4FSS A;  2XIC A;  4JZ4 A;  4BE0 A;  3GLX A;  5D7U A;  4PNO A;  2EBP A;  2HZY A;  4OB3 B;  3QUI A;  4OMQ A;  1X2G A;  2DZ9 A;  3LSQ A;  1I07 A;  4PHC A;  1QF6 A;  1WHJ A;  1DJ7 B;  1QCN A;  2CYZ B;  4LD9 K;  2RHZ A;  1VQ8 Q;  1IXD A;  2XU8 A;  2YUN A;  3UGT A;  3CCE T;  2LT4 A;  3V8K A;  4ELY C;  2DNU A;  2CP3 A;  5KYX B;  4R56 A;  1FMK A;  3OS2 A;  3BDL A;  3M57 A;  1W66 A;  2OI3 A;  2CZ6 B;  4ZN1 A;  1ZHI A;  3JCM c;  4F16 A;  3QII A;  3KUF A;  5KYW B;  1VQ5 A;  3VS4 A;  1M90 C;  2CH4 A;  3HTR A;  1AEY A;  1KD1 U;  4M7D B;  2ODR D;  1HK9 A;  3ASK A;  1YI2 T;  2X4J A;  3LLR A;  1PHT A;  2DIG A;  3CMA A;  3UF4 A;  2VGM A;  3VYG A;  1LVK A;  4FT2 A;  3OYL A;  1G3W A;  1YJ9 A;  3A32 A;  2DQ3 A;  3PVQ A;  1FXX A;  3JRZ A;  1VQN Q;  3EGX A;  3P8D A;  1PSE A;  2KT8 A;  2KT1 A;  2L2P A;  5J3B A;  2D8H A;  3RNJ A;  1KG1 A;  1WX6 A;  4RDX A;  3EG0 A;  1B76 A;  2ZIM A;  1VQK A;  3VUZ A;  3D7S B;  3I55 A;  2CP2 A;  1YCY A;  2D0Q B;  1TSF A;  5GAN 2;  4EMK A;  4BE1 A;  1G83 A;  4H2X B;  2D6F A;  4J6X A;  4C92 C;  4YP0 A;  3SFM A;  2J05 A;  1B7Y B;  2A7Y A;  2RQW A;  3JCM e;  1BI2 A;  3HXZ A;  3M58 A;  5GAM d;  5AT1 B;  1W4S A;  1J5W A;  5GAN 5;  1Q82 R;  2L89 A;  1FYN A;  4X9C A;  2KRS A;  1E1T A;  2IY5 B;  4OMN A;  4YDQ A;  2W10 A;  3CC4 A;  3OYK A;  1X56 A;  3TEE A;  3CD6 A;  4ZGJ B;  3OMC A;  3CCQ A;  1YBY A;  4C8Q F;  3EFS A;  4BI8 B;  4P71 A;  3WVE B;  2WSF E;  3G71 Q;  5I2S A;  12AS A;  3OD1 A;  1Q86 U;  4BY6 B;  2RN8 A;  1FX7 A;  3I56 T;  2M0O A;  5I22 A;  1MHN A;  3BW1 A;  2ROT A;  3JB9 J;  3CQT A;  3HRT A;  4PLI A;  2GFU A;  1MNE A;  4QQD A;  3PTA A;  1Q81 R;  1ABQ A;  2GBQ A;  4YRK A;  2ZPG B;  4YRR A;  1M3B A;  4ZGE B;  2FB7 A;  4EMK C;  1YIJ Q;  3JCM Q;  2LCS A;  4TVY A;  1C0A A;  4MZM A;  4C92 A;  2XID A;  3A7U A;  3C95 A;  1RI0 A;  1ZQ1 A;  4AG1 C;  5DLQ E;  1V29 B;  2NWM A;  2JOY A;  2DBM A;  2ZAE A;  2AKW B;  2ZPE B;  1X75 C;  1MGQ A;  1GBQ A;  5GAO n;  2X4W A;  4P72 C;  1M1K U;  1USY C;  2RO0 A;  2LP5 A;  3M54 A;  1NPR A;  4N4I A;  2Q7G A;  5LJ3 h;  1NJ1 A;  2E10 A;  1WZO A;  4ZGD B;  4EDU A;  3CCL A;  3TUP A;  2CUB A;  4P3N A;  3AHU A;  2ZXF A;  2MMP A;  3H0F A;  2XDD A;  1U5S A;  3SWN A;  3JCM f;  1LYL A;  1RIQ A;  2YSQ A;  2L3Q A;  4LNS A;  3PMI A;  3G6E A;  5GAN d;  3V7S A;  1VQ7 T;  2LJ3 A;  1ZUK A;  1D1A A;  2FRW A;  1GFD A;  2ABL A;  5GMK l;  1VQL A;  1IHV A;  2Q5I A;  3RR6 A;  2L3S A;  3A5Z B;  1YIT A;  3QHS A;  3M0U A;  3M4Q A;  1Y57 A;  3PCO B;  2E64 A;  4LDV A;  1WXU A;  3OYM A;  2MYS A;  2ZGW A;  4LN2 A;  4CH5 A;  2HL3 A;  3OYB A;  2X9H A;  2OTJ T;  1P92 A;  2MWO A;  1N9S A;  1B7Y A;  4MZT A;  1Y71 A;  5L8R E;  3MQZ A;  1VQP Q;  3MF1 A;  1NYR A;  3REX A;  2KRO A;  1QP3 A;  3NTI A;  1M1G A;  3HKS A;  3MPU B;  4XTW A;  4DPG A;  1YCS B;  2KRM A;  4KGV B;  1SHG A;  1JU5 C;  4KUI A;  2AHJ B;  4HVW A;  2J7I A;  3VS2 A;  8ATC B;  5CIU A;  2KYB A;  1YIJ A;  2LJ1 A;  2DTI A;  4M7A E;  2MPX C;  1WHG A;  2ALY B;  4RTU A;  3N5B B;  2WSC E;  2BTT A;  1N5Z A;  1LCK A;  11AS A;  3A8O B;  1Q86 R;  4M75 F;  2R58 A;  4EO4 A;  1WQ7 A;  2RH2 A;  4Z02 A;  4PJO G;  4UP8 A;  4E2F B;  1IGQ A;  2KAF A;  3L2Q A;  4M78 C;  2FL7 A;  3X26 B;  2FZK B;  4C5H A;  1SHF A;  2EYX A;  3DB4 A;  1VQ4 A;  1JXO A;  4FIB A;  3OS1 A;  1AWX A;  2XHC A;  4RTV A;  4HWR A;  4OF1 A;  5KYN A;  4PL6 A;  3VV0 A;  2RA2 A;  3PE0 A;  4CRI A;  3EG3 A;  1ZA1 B;  1ASY A;  3S3O A;  2V26 A;  2P4T A;  2QQR A;  1D0Z A;  2RHQ A;  1OEB A;  4TWA A;  2K3X A;  1ZBJ A;  5FU6 B;  1OPK A;  2IPO B;  2P0P A;  3OBY A;  2JTM A;  4FCY A;  2QK0 A;  5IHK A;  2EKO A;  2M9U A;  5CK9 A;  3CCR A;  3MP1 A;  2E5A A;  1GXI E;  4CC2 A;  3E9H A;  4UC4 A;  4RTZ A;  2VGN A;  1PYS B;  2DIQ A;  2FO0 A;  2PTK A;  2VKN A;  3UWN A;  3O5Z A;  2EAY A;  5J26 A;  2LQW A;  2LTO A;  2LQN A;  3HPW A;  1TTH B;  3NPF A;  4FT4 A;  3GBQ A;  3CCV T;  5LJ5 d;  5GJV B;  1BYM A;  2QEX A;  1Q7Y R;  4P3O A;  4LUE A;  1FYF A;  1VQM Q;  4JLG A;  1X2H A;  4WCI A;  3ME9 A;  4H2V A;  3JCM h;  3EG9 A;  4CC3 A;  1QP2 A;  2IG0 A;  5KCH A;  1BBU A;  5ELN A;  1YGB A;  4XTZ A;  3REA B;  1JO8 A;  4L6V 5;  5KYX A;  4HT4 A;  5A2Q E;  2DLP A;  1ADY A;  1SSF A;  3G7Z A;  3L2U A;  3M9Q A;  4P71 C;  3CCM A;  4M77 A;  4O6J A;  2PME A;  4M7A B;  1I4K 1;  2J06 A;  5GAN 6;  1B34 B;  5ECA A;  2QG9 B;  4M7D A;  1OUL A;  5A0L A;  1WYX A;  1BIB A;  1N8R R;  1Q7Y U;  2BZ8 A;  3OBW A;  2KRN A;  5GAO p;  2DXC A;  1B7T A;  1G5V A;  1YFR A;  3VS1 A;  3SHW A;  2G3R A;  2JJ9 A;  1SRL A;  2GFA A;  2JVV A;  4PLL A;  3QWX X;  2XK0 A;  4FU6 A;  2XGT A;  3VS5 A;  3G1J A;  2MF2 A;  2QQB A;  5GAM h;  1YJN A;  2JM9 A;  4MDX A;  4LVJ A;  1KC8 U;  2KXC A;  4H2X A;  2FRY A;  1I0C A;  3OA6 A;  4FL6 A;  3MEW A;  1NJ8 A;  3LH0 A;  2ZIO A;  5GAO m;  2C8M A;  1X43 A;  1VQN T;  1EIF A;  4ZTF A;  1U1T A;  2COW A;  2CUD A;  3CCJ A;  3J7A F;  1KJW A;  1MMG A;  5I21 A;  4Z88 A;  4LDX A;  1ARK A;  4A4G A;  4NOY A;  2E3H A;  4WF2 A;  3CCR T;  4BE2 A;  4HT9 A;  4H2Y A;  3TQ7 P;  2RHU A;  1TXQ A;  2H3E B;  4M7D C;  1W1F A;  3IKL A;  3VU3 C;  4BI3 A;  5CR2 A;  3CC2 A;  1I81 A;  4KR3 A;  3SD4 A;  3LWI A;  1YIJ T;  1D3B B;  3A8L B;  2MOX A;  3NEN A;  1KHI A;  2RK2 A;  1M1F A;  2DIL A;  1TUG B;  2HSE B;  2LZ6 B;  3HRS A;  2E70 A;  2NS6 A;  3ZL7 C;  3J80 E;  4KUL A;  4D8K A;  2EYZ A;  2DFU A;  3NTH A;  4FYY B;  3OS0 A;  5CAI A;  3JV3 A;  3G4S Q;  3NFC A;  5IH2 A;  4AFS C;  2EPD A;  1K4U S;  2O9V A;  2HNI A;  3UA6 A;  4RTT A;  2VYT A;  3RMS A;  5FRM A;  3PCO A;  1IL2 A;  4XAX B;  1YHQ A;  1QWE A;  1USY A;  3QO3 A;  1M2O A;  2VVK A;  1X6B A;  2SRC A;  3MP6 A;  3QWY A;  4P73 C;  4PFP A;  3CCU A;  2DTO A;  3CPW S;  2CP6 A;  3CME Q;  3G4S T;  4CS3 A;  3OSV A;  4P74 C;  4M7A A;  1J3T A;  3HFV A;  4BY6 C;  4Y28 E;  3VQY A;  1EIY A;  5GAM f;  2K3B A;  2C0I A;  2K2V A;  1VQ4 T;  2W0Z A;  4PJO B;  2ZNI A;  2FHD A;  2NUZ A;  2E65 A;  4ZNX A;  3CMA Q;  2HQH A;  3M4Y A;  3EGD A;  4J83 A;  3H0I A;  3H41 A;  1UJY A;  2F5T X;  4CC7 A;  4RKU E;  2EW3 A;  3OYJ A;  3A5Z A;  5LJ3 f;  3QKJ A;  4YPF A;  4KQE A;  4R0K A;  2M51 A;  4D6W A;  1RAE B;  3X20 B;  4DBR A;  1H4S A;  1G8X A;  2JMA A;  4H2S A;  1K76 A;  1FWZ A;  1RL2 A;  1QVF S;  3RAC A;  2E41 A;  2XD0 A;  4M77 G;  1WJR A;  4J7I A;  4JRQ A;  1W2B S;  2EGA A;  4M7A D;  4HXJ A;  2QTX A;  1T0H A;  1NEB A;  1X01 A;  5CO7 A;  3OYF A;  1PCX A;  2HQE A;  2K3Y A;  2VXE A;  1NLO C;  2MWP A;  4LDY A;  2O4X A;  1VQZ A;  2E1H A;  4C92 D;  3CCM T;  4XTU A;  3J81 E;  1OZ3 A;  4WJ3 M;  1WNL A;  5GMK h;  4IIO A;  3CXC A;  1M3A A;  1AWJ A;  5FRO A;  3H0H A;  3JCM J;  1H4Q A;  4EX5 A;  4RTX A;  3BE3 A;  1PYS A;  2I4N A;  4TVA A;  2QA4 Q;  2L0A A;  1N27 A;  4ZN3 A;  2H8H A;  1OU8 A;  2LJ0 A;  4C0Z A;  1JJ2 P;  2HKQ B;  2DA9 A;  4JDS A;  2PQW A;  5FRN A;  5C53 B;  8AT1 B;  3ER0 A;  3OMG A;  1BBZ A;  1PRM C;  3M53 A;  3JCM X;  3QSU A;  3HFZ A;  1M1K C;  2EYQ A;  3CME A;  1Q81 C;  5C52 B;  2I2L A;  2QDL A;  4N4G A;  1I8F A;  1YI2 A;  1W70 A;  2PUK B;  4M77 E;  1RAB B;  3M0T A;  3NEM A;  3NET A;  1QMC A;  2ALY A;  3ZBD A;  2PU9 B;  3AT1 B;  1YHQ Q;  4Z8A A;  4BD3 A;  2DL4 A;  4C92 G;  1VQO A;  1E22 A;  1YIT Q;  3KFU A;  4WJ4 A;  2AZV A;  1QVG P;  3P8B B;  2M1H A;  4QT7 A;  3CCV Q;  3Q1J A;  2EQK A;  2LX9 A;  5FLX E;  2DU7 A;  1UGR B;  1BCM A;  2P4R A;  4Y92 A;  1NPP A;  1KK7 A;  2V1R A;  2V1Q A;  3VS7 A;  1RAH B;  1Q86 C;  4M77 D;  3TEG A;  5LJ5 h;  2Z0W A;  1EZZ B;  3LC0 A;  3LGL A;  1TH7 A;  3QXE B;  1ZUY A;  1KMN A;  4HVC A;  1RLQ C;  3UFG A;  1SEM A;  4BB7 A;  3BDU A;  1GRI A;  4II1 A;  1MMN A;  2KNB B;  1K8A R;  2JS2 A;  2JTF A;  2XG8 D;  1BU1 A;  3TSZ A;  3FLG A;  2ESW A;  3RKX A;  4PJO E;  3REB B;  4XU1 A;  4PJO F;  3OYH A;  3CPW A;  4C8Q A;  1Y07 A;  2HSP A;  3HXX A;  3RF1 A;  4DOV A;  1FMV A;  2NLU A;  1U06 A;  4JJC A;  1S72 A;  3I5R A;  5M9O A;  3M4P A;  1QQJ A;  1IO6 A;  2Y4X A;  1CKA A;  2P0Q A;  4HWS A;  1GBR A;  5CVI A;  2DET A;  3SDZ A;  3CMA T;  2R5M A;  2RHQ B;  2ZCF B;  1M5Q 1;  5EC7 A;  4J8O A;  1NEG A;  1ASZ A;  3RUX A;  3QNE A;  2KXD A;  2CJB A;  2R5A A;  2DM1 A;  3RDV A;  1Z9Q A;  3FB9 A;  2FEI A;  4BWA A;  4G84 A;  2OTJ A;  5GAO l;  2K79 A;  3HY0 A;  3LGF A;  3EG9 B;  2ZT5 A;  2QAS A;  2BZY A;  1PM3 A;  3I5S A;  2HDA A;  1G51 A;  3JCM P;  1K0X A;  3H8Z A;  1W2B A;  1T3L A;  1Q82 U;  2CP5 A;  5HCK A;  4OVA A;  4FYV B;  1SPK A;  4J9F A;  1MV0 B;  5DM7 R;  1PD0 A;  3V7C A;  1X27 A;  4BW9 A;  1UGQ B;  4M77 B;  4R55 A;  2QQ9 A;  3I55 Q;  2KYM A;  2PVD B;  3VKI A;  2IIM A;  4A4K A;  3HP9 A;  4P74 A;  1M2V B;  2HBP A;  3HFN A;  2HMA A;  5GAM g;  4C8Q E;  3JCM b;  3MCA B;  3L2W A;  5FU6 C;  4M78 D;  3PNW C;  3CPW P;  3CCM Q;  3EH1 A;  4N0A A;  4M77 C;  1YJN Q;  5K1P A;  2LNV A;  2RMO A;  4O5V A;  3RKW A;  4C0D C;  2ZPF B;  3CC4 Q;  4TTV A;  2JN0 A;  2AKW A;  3EG2 A;  5KYY A;  2XDP A;  3MO8 A;  4HWP A;  4E51 A;  2MIO A;  3S6W A;  4WTO B;  3A5Y A;  4P75 C;  2IY5 A;  2BE7 D;  4HA8 A;  2DVJ A;  1UDL A;  2X4Y A;  3G6E Q;  2A3L A;  3EAE A;  4F7U A;  2QXF A;  1SSH A;  2CGH A;  3LX7 A;  1WU7 A;  2LMJ A;  4JPB W;  2OTL T;  2V8J A;  1VQ9 Q;  4AH6 A;  2MCN A;  4IUQ A;  3M0Q A;  4D8D A;  1QVG A;  1NJ2 A;  2J3M A;  2ART A;  4FYW B;  3QZ9 B;  3IKM B;  5GAN h;  1IHW A;  4E6R A;  3L4G A;  4E7J A;  2Q5H A;  4BDY A;  4QVC A;  1BIA A;  1OZ2 A;  1JJC B;  3PGG A;  2JZ2 A;  1YI2 Q;  4L87 A;  1Y0M A;  1YJ9 Q;  4YRJ A;  2VC8 A;  3RIR A;  3EFO B;  1HSQ A;  2QI2 A;  2FVU A;  1UJ0 A;  4M7D F;  1KMM A;  5LJ5 f;  1QLY A;  1VQ9 T;  1Z9Z A;  4JLI A;  3LSS A;  1PC0 A;  2CRE A;  1PG5 B;  5GMK m;  4ZIB A;  3CCV A;  2ODR C;  2QEX Q;  3QO7 A;  3QPH A;  5KYY B;  4M75 C;  4IUT A;  2DRM A;  1HC7 A;  5IT9 E;  1UUE A;  1SER A;  4J15 A;  4OML A;  4B6M A;  2WAC A;  4LVK A;  5CKF A;  4A63 B;  5GAN 7;  1B3Q A;  3L2V A;  1KIK A;  2RPN A;  1L0W A;  1YIT T;  1KQS P;  2L5Q A;  1YWP A;  1H4V B;  2JW4 A;  4GLK A;  1G5H A;  3IG2 A;  1UHF A;  5LL6 S;  2NYS A;  5IHN A;  3DLM A;  1UEB A;  1UHC A;  1KQS A;  5E3I A;  5KE2 A;  4K86 A;  2FZC B;  6AT1 B;  4M78 G;  1NBE B;  1YN8 A;  1AZE A;  1ZUU A;  1Y96 B;  3CC2 Q;  4TVW A;  4N0A C;  3SEM A;  1UEC A;  2M16 A;  2YUP A;  2C06 A;  3E2U A;  3TEH B;  4YRL A;  2CZ0 B;  5KYW A;  4PG3 A;  4DBQ A;  2CKK A;  2OAU A;  2J6K A;  4M75 A;  3LWH A;  1Q82 C;  4KRT A;  2RHS B;  3ULR B;  4M7D E;  1EQR A;  1H92 A;  2LCC A;  2NUT B;  1NNH A; 
#chains in the Genus database with same CATH homology
 1VQP T;  2D9T A;  4V2S A;  2EIF A;  1LJO A;  2EJF A;  4RCC A;  4RQF A;  1WLE A;  4C8Q B;  2EJG A;  2G4C A;  2AMC A;  2ZT7 A;  1QVG S;  5FU7 B;  4EMG A;  2CS7 A;  4PKC C;  3OYI A;  3RKY A;  1WJQ A;  2DZC A;  4J5Y A;  3PIO A;  4XU3 A;  3QTC A;  1VQ6 T;  1EOV A;  4IUV A;  3PFS A;  2AMC B;  3T9N A;  2DDZ A;  2QHV A;  3H6Z A;  3C94 A;  4YCV A;  4C5E A;  3OY9 A;  4UP7 A;  1EIY B;  4OB1 B;  1XOV A;  5GAN f;  3GIB A;  1Z7N A;  1EVL A;  1EFW A;  2L3R A;  3A8H B;  4BUG A;  3C12 A;  2LDM A;  1IRE B;  2JUF A;  3ZFJ A;  3E9G A;  3QG1 A;  1WGS A;  1N8R C;  2GQV A;  2RM4 A;  4EPC A;  3M56 A;  4DQ2 A;  4H2U A;  3I56 A;  3RL6 A;  3G4S A;  2LRQ A;  5CQX A;  2O01 E;  2VV5 A;  3P8Y A;  4PJO A;  1YB3 A;  2DPP B;  5DY9 A;  5HKC A;  2KMT A;  1AHJ B;  3I55 T;  1WYD A;  4NCX A;  4BI4 A;  2ZR3 A;  2E3C A;  2EQM A;  1KOG A;  4OP0 A;  3G71 A;  5GAN j;  4YRS A;  2K5L A;  1KQS S;  4QW2 A;  1XQH A;  3VJP A;  1G3T A;  2DQ0 A;  2B8A A;  4M78 A;  4DA4 A;  3HRK A;  3G6E T;  1VQ7 A;  2I4L A;  1OI1 A;  2DTH A;  2C7I A;  4A53 A;  3GNF B;  3E19 A;  5J39 A;  5A0D A;  5GMK e;  2ZIN A;  4X34 A;  4RCB A;  1K8A C;  4XU0 A;  5C6S A;  4EMH A;  5KE3 A;  5GAN 3;  5IN1 A;  2XTI A;  1QW1 A;  3VBB A;  3L2R A;  3HXU A;  3L4G B;  3MEY A;  2Y4Y A;  2MI6 A;  1JJC A;  4ELZ C;  3JB9 F;  3CMQ A;  2EJ9 A;  3ERR A;  5AYF A;  2ZZD A;  2RJE A;  1EVK A;  2ZTG A;  2ARS A;  3CME T;  3JSC A;  5CKE A;  4M7D G;  3HHT B;  3L2Z A;  3CC4 T;  3CD6 T;  3OW2 S;  1I5L A;  3HFO A;  1K73 U;  4Q5W A;  2Q7E A;  2YHT A;  1K9M U;  3JCM d;  1KC8 C;  3FDR A;  3O8V A;  2E6Z A;  4A4H A;  4TQF A;  3S3M A;  1LOJ A;  3LYI A;  3CCU T;  3DSQ A;  3X24 B;  4J6Y A;  2ZZG A;  5GAN 8;  1X54 A;  4C8Q G;  1N9R A;  4RMO A;  4IKF A;  4QQG A;  4MML A;  5FU7 C;  3CBP A;  2DXT A;  3R07 A;  4P75 A;  1PSF A;  2ZT6 A;  4CH4 A;  1K73 C;  2LQ8 A;  3JB9 I;  4A4E A;  1N6A A;  4ME7 A;  4HCZ A;  4OB0 B;  1Q81 U;  4BAC A;  3HXW A;  3A74 A;  3RMQ A;  4JS5 A;  4CH6 A;  1Y7X A;  1VIF A;  3E1S A;  4G85 A;  1UGS B;  2P0K A;  3V7R A;  4ZTU B;  3MEA A;  3HTZ A;  3QDR B;  5GAM e;  4LD6 A;  3UPU A;  2GF7 A;  1IZ6 A;  4M75 D;  4M75 E;  4KUD K;  4GY5 A;  1NJ5 A;  4H2T A;  4M7A G;  3M4G A;  4YRQ A;  4F7U G;  4C5G A;  2ZPB B;  1NYQ A;  3OQ5 A;  2PVG B;  3JB9 G;  2QDY B;  4JRP A;  3MHX A;  4CH3 A;  2K4Y A;  5CQY A;  1VQO T;  2A8E A;  3HXY A;  3HFZ B;  3CXC S;  4C0G A;  1YJW A;  4YTL A;  2QQA A;  3ICA A;  3MEU A;  3VUB A;  2QA4 T;  4P3P A;  1VIE A;  1B8A A;  1E1O A;  2EL9 A;  4QVD A;  3REU A;  4B9X A;  1M90 U;  3PIP A;  4E7I A;  1K8A U;  3A7A A;  2RK1 A;  4JS4 A;  4LDU A;  4XTV A;  3F70 A;  2KQW A;  4F7U E;  1SET A;  4QVZ A;  2CJ9 A;  1S72 T;  2ZR2 A;  3IAL A;  2DXB A;  2ZPI B;  5KH6 A;  2DO3 A;  5CKD A;  2RI2 A;  2QEX T;  3OS5 A;  4PJO D;  3SWN C;  4TVR A;  3BFM A;  4J7F A;  4RMF A;  1VQN A;  3PT9 A;  3GF5 A;  3VQX A;  2EWN A;  3V8L A;  4MDW A;  3A31 A;  5D6X A;  3FC3 A;  2RD1 A;  1KQ1 A;  1M8V A;  3E9I A;  3HXV A;  4YCU A;  1WPY A;  1SES A;  1VQP A;  4JJN K;  1VQ9 A;  5HY6 A;  3X28 B;  5GAM j;  3OB9 A;  2DXU A;  3CCE A;  1U1S A;  1NZ9 A;  3JCM V;  4F7U F;  2EQU A;  2KY9 A;  4P5N A;  1JJ2 A;  3A7R A;  4DOW A;  1N9W A;  3SWN B;  2X35 A;  2DKG A;  4C8Q C;  4CS2 A;  4OB2 B;  2RB6 A;  2ZCE A;  1H3Z A;  2I4M A;  1YHQ T;  1YJN T;  2RI3 A;  3L1A A;  4Q6G A;  2QA4 A;  4UP9 A;  4K87 A;  3HL8 A;  4YCW A;  2FYK A;  2LCL A;  1VQM T;  4C5I A;  3QO5 A;  2H3J A;  4TVA B;  3HRU A;  4ZTZ B;  4F7U B;  3UDC A;  4M77 F;  5GAN g;  2E12 A;  2BUD A;  3TEH A;  5K1X A;  4C0F A;  4C8Q D;  4YRE A;  4VUB A;  2QQS A;  2RHY A;  4HCB A;  2RI5 A;  3OYE A;  4E7L A;  1KD1 C;  4A4F A;  1UB4 A;  2YLC A;  5LJ3 g;  2DK3 A;  2HQX A;  5HGQ A;  1O9S A;  2DJZ A;  1B34 A;  2PVO B;  4CI0 C;  3CCL T;  5D6W A;  4N4H A;  4A54 A;  4XEM A;  1ZBX A;  2DEQ A;  3CBO A;  3TCJ A;  1QVF A;  3CCQ T;  1VQ5 T;  1H64 1;  4YRI A;  3HRI A;  2BIV A;  4YRG A;  2QHU A;  1H4T A;  5KNN A;  1YJ9 T;  2V8K A;  4HWT A;  4HWO A;  1WQW A;  3CCJ T;  1Z7M A;  4X9D A;  2Y90 A;  2QHS A;  2ZPH B;  1YJW T;  4MMK A;  5CCA A;  1BI1 A;  3FIF A;  1HXD A;  1O75 A;  1VQK T;  3RGL A;  2YRV A;  5HK3 A;  3CPF A;  1ATI A;  3CC2 T;  4M78 F;  3INZ A;  1GGM A;  2F5K A;  1NJ6 A;  4E7K A;  3QYG B;  1JB0 E;  4O2D A;  2RHI A;  2RJF A;  2RHX A;  1M4Z A;  5KCO A;  1YFT A;  2CIM A;  2ZNJ A;  4YRM A;  3OYN A;  5GMK j;  4XK8 E;  2BKD N;  3CCS A;  3HSB A;  3DB3 A;  3SB2 A;  5GMK i;  4NL3 A;  3L42 A;  3VQW A;  4YRF A;  4RG8 A;  3DKM A;  4K88 A;  2R57 A;  1JJ2 S;  4C92 E;  2V8I A;  2CZ1 B;  1KQ2 A;  5ELO A;  4MZP A;  5LJ5 g;  2P0L A;  1WJS A;  3RER A;  1ADJ A;  1B70 A;  3JB9 H;  3A8G B;  2EFI A;  4M75 B;  5LJ3 d;  2MAM A;  3P8V A;  4E47 A;  4OGC A;  1XTD A;  3E9F A;  5LJ5 j;  1BI3 A;  3VYH B;  3UH0 A;  4ZTJ A;  3BY7 A;  4NL2 A;  4ATO A;  4P73 A;  3QJ6 A;  3KBG A;  3I7F A;  3BJU A;  2K57 A;  2LT1 A;  1Y96 A;  4L59 A;  2DU5 A;  5D6Y A;  4C92 F;  2Q7H A;  1UGP B;  3M5A A;  5CKH A;  4Q15 A;  3CEY A;  3R6O A;  1VQM A;  2KDS A;  3PMT A;  1X55 A;  5C51 B;  4IUR A;  2I4O A;  4E7H A;  2DD4 A;  1BKB A;  2E5Q A;  3QYH B;  4XTX A;  4YRP A;  4J6W A;  4CS4 A;  4PJO C;  4RG2 A;  5F5W A;  4BDZ A;  4EMK B;  1VQ8 T;  2K5I A;  4LDW A;  3OYA A;  4LVL A;  3ZEH A;  1BBW A;  2KSS A;  3V8J A;  3OYG A;  3HY1 A;  4C92 B;  1G3Y A;  3EFR A;  3CC7 T;  2LQK A;  4M7A F;  1XNI A;  4X5O A;  5IAY A;  1OYX A;  4M7A C;  1G3S A;  3OYD A;  4KR2 A;  2L8D A;  4KBM B;  4WI1 A;  3PZC A;  4TQD A;  4YRT A;  3P8T A;  4L5G A;  2WSE E;  5GAO r;  3UGQ A;  4JUV A;  4P72 A;  3CBM A;  3TRE A;  2RJD A;  3MF2 A;  3M59 A;  4IUP A;  2HD0 A;  3NTK A;  1B70 B;  2YLB A;  2QHT A;  1QE0 A;  1KHC A;  4M78 E;  3OYC A;  5LJ3 e;  5HK0 A;  4HCC A;  3JB9 D;  3JAM E;  3RES A;  2EQJ A;  1N8R U;  2LC4 A;  3P8H A;  2ZZE A;  3UT1 A;  4XEO A;  3MEV A;  3FJP A;  3GNG A;  3S3N A;  1SRY A;  4OLF A;  4KT0 E;  3MET A;  1JBM A;  2P5I A;  4H2W A;  2LVM A;  5DLO A;  5GAN e;  4M75 G;  4YRC A;  2RJC A;  2K5F A;  3WQZ A;  2OTL A;  3CCS T;  4FM4 B;  3X25 B;  3VQV A;  1D3B A;  3A8M B;  2HAX A;  4RQE A;  4JRI A;  3FEO A;  2PMF A;  3GPL A;  1G5I A;  2J3L A;  4HKE A;  4IUU A;  3WVD B;  2O4X B;  3KXT A;  3JCM g;  4Y91 A;  3QJY A;  2VUB A;  2XDB A;  1HTT A;  1E24 A;  4YYE A;  3LW5 E;  3OW2 A;  2CJA A;  4OGE A;  3TU4 K;  2XKO C;  5GAO q;  2IVW A;  3OSS C;  5C0M A;  5A0G A;  4LVI A;  3URG A;  4FSX A;  2X4X A;  1X6O A;  3QO8 A;  3W3S A;  4YRN A;  1K9M C;  2ZZF A;  2KVQ G;  5EG2 A;  2ARU A;  5CKB A;  4XU2 A;  1BI0 A;  3NEL A;  4UPA A;  4C0D B;  1NJI C;  3QZ5 B;  1YFS A;  2VXF A;  3DLL A;  2GCX A;  4XQ3 A;  1VQ6 A;  1U8R A;  3GP8 A;  1NJI U;  4YRO A;  2PUO B;  4QQ6 A;  3G1Z A;  2XI9 A;  3GOX A;  5LJ3 j;  4LVM A;  3G71 T;  2KK4 A;  2JNG A;  3MP8 A;  2E6N A;  5GAN 4;  1R8O B;  1QVP A;  1VQ8 A;  1LNX A;  2ZT8 A;  3M55 A;  1JRI A;  2DD5 A;  3OYY A;  1VUB A;  3QBY A;  4M7D D;  4OMF B;  4JRK A;  2F69 A;  4XTY A;  3FRN A;  3CC7 A;  4B9W A;  4NS5 A;  3C4S A;  1NE8 A;  4H02 A;  1Q7Y C;  5I2M A;  2DVE A;  2CZ7 B;  1VQL T;  4HT8 A;  4M78 B;  3WXM B;  3JCM W;  5LJ5 e;  1M9S A;  2DAQ A;  2RHS A;  2XIC A;  4BE0 A;  3GLX A;  4PNO A;  4OB3 B;  3QUI A;  1X2G A;  2DZ9 A;  3LSQ A;  4PHC A;  1QF6 A;  1DJ7 B;  2CYZ B;  4LD9 K;  2RHZ A;  2XU8 A;  3UGT A;  3CCE T;  2LT4 A;  3V8K A;  4ELY C;  4R56 A;  3OS2 A;  3BDL A;  3M57 A;  1W66 A;  2CZ6 B;  4ZN1 A;  1ZHI A;  3JCM c;  3QII A;  3KUF A;  1VQ5 A;  1M90 C;  1KD1 U;  4M7D B;  2ODR D;  1HK9 A;  3ASK A;  1YI2 T;  2X4J A;  3LLR A;  3CMA A;  2DIG A;  2VGM A;  3VYG A;  4FT2 A;  3OYL A;  1G3W A;  1YJ9 A;  3A32 A;  2DQ3 A;  1FXX A;  3JRZ A;  3P8D A;  1PSE A;  5J3B A;  1KG1 A;  4RDX A;  1B76 A;  2ZIM A;  1VQK A;  3VUZ A;  3I55 A;  1YCY A;  2D0Q B;  5GAN 2;  4EMK A;  4BE1 A;  4H2X B;  2D6F A;  4J6X A;  4C92 C;  4YP0 A;  3SFM A;  1B7Y B;  2A7Y A;  3JCM e;  1BI2 A;  3HXZ A;  3M58 A;  5GAM d;  1W4S A;  1J5W A;  5GAN 5;  2L89 A;  4X9C A;  1E1T A;  2IY5 B;  4YDQ A;  3CC4 A;  3OYK A;  1X56 A;  3TEE A;  3CD6 A;  4ZGJ B;  3OMC A;  3CCQ A;  1YBY A;  4C8Q F;  3EFS A;  4BI8 B;  4P71 A;  3WVE B;  2WSF E;  5I2S A;  12AS A;  3OD1 A;  1Q86 U;  4BY6 B;  1FX7 A;  3I56 T;  2M0O A;  1MHN A;  3BW1 A;  3JB9 J;  3HRT A;  4PLI A;  2GFU A;  4QQD A;  3PTA A;  4YRK A;  2ZPG B;  4YRR A;  4ZGE B;  2FB7 A;  4EMK C;  3JCM Q;  4TVY A;  1C0A A;  4MZM A;  4C92 A;  2XID A;  3A7U A;  3C95 A;  1RI0 A;  1ZQ1 A;  5DLQ E;  1V29 B;  2JOY A;  2AKW B;  2ZPE B;  1X75 C;  1MGQ A;  4P72 C;  5GAO n;  2X4W A;  1M1K U;  1USY C;  2RO0 A;  3M54 A;  1NPR A;  4N4I A;  2Q7G A;  5LJ3 h;  1NJ1 A;  2E10 A;  4ZGD B;  4EDU A;  3CCL A;  3TUP A;  4P3N A;  3AHU A;  2ZXF A;  2MMP A;  2XDD A;  3SWN A;  3JCM f;  1LYL A;  1RIQ A;  4LNS A;  3PMI A;  3G6E A;  5GAN d;  3V7S A;  1VQ7 T;  5GMK l;  1VQL A;  2Q5I A;  3A5Z B;  1YIT A;  3QHS A;  3M4Q A;  3PCO B;  2E64 A;  4LDV A;  3OYM A;  2ZGW A;  4CH5 A;  3OYB A;  2OTJ T;  1P92 A;  2MWO A;  1N9S A;  1B7Y A;  4MZT A;  1Y71 A;  5L8R E;  3MQZ A;  3MF1 A;  1NYR A;  3REX A;  1QP3 A;  3NTI A;  1M1G A;  3HKS A;  4XTW A;  4DPG A;  4KUI A;  2AHJ B;  5CIU A;  1YIJ A;  2DTI A;  4M7A E;  2ALY B;  3N5B B;  2WSC E;  11AS A;  3A8O B;  4M75 F;  2R58 A;  4EO4 A;  1WQ7 A;  2RH2 A;  4Z02 A;  4PJO G;  4UP8 A;  2KAF A;  3L2Q A;  4M78 C;  2FL7 A;  3X26 B;  4C5H A;  3DB4 A;  1VQ4 A;  4FIB A;  3OS1 A;  2XHC A;  4HWR A;  4OF1 A;  4PL6 A;  3VV0 A;  2RA2 A;  4CRI A;  1ASY A;  3S3O A;  2P4T A;  2QQR A;  2RHQ A;  4TWA A;  2K3X A;  5FU6 B;  2P0P A;  3OBY A;  2JTM A;  2EKO A;  2M9U A;  5CK9 A;  3CCR A;  3MP1 A;  2E5A A;  1GXI E;  3E9H A;  4UC4 A;  2VGN A;  1PYS B;  2DIQ A;  3UWN A;  2EAY A;  5J26 A;  2LTO A;  3HPW A;  4FT4 A;  3CCV T;  5LJ5 d;  1BYM A;  2QEX A;  4P3O A;  1FYF A;  4JLG A;  1X2H A;  3ME9 A;  4H2V A;  3JCM h;  1QP2 A;  2IG0 A;  1BBU A;  5KCH A;  5ELN A;  1YGB A;  4XTZ A;  4L6V 5;  4HT4 A;  5A2Q E;  1ADY A;  1SSF A;  3G7Z A;  3L2U A;  3M9Q A;  4P71 C;  3CCM A;  4M77 A;  4O6J A;  2PME A;  4M7A B;  1I4K 1;  5GAN 6;  1B34 B;  4M7D A;  5A0L A;  1BIB A;  1Q7Y U;  3OBW A;  5GAO p;  2DXC A;  1G5V A;  1YFR A;  2G3R A;  2GFA A;  2JVV A;  4PLL A;  2XK0 A;  4FU6 A;  2XGT A;  2MF2 A;  2QQB A;  5GAM h;  1YJN A;  4MDX A;  4LVJ A;  1KC8 U;  4H2X A;  3OA6 A;  4FL6 A;  3MEW A;  1NJ8 A;  3LH0 A;  2ZIO A;  5GAO m;  2C8M A;  1VQN T;  1EIF A;  4ZTF A;  1U1T A;  3J7A F;  3CCJ A;  5I21 A;  4LDX A;  4A4G A;  4NOY A;  4WF2 A;  4H2Y A;  3CCR T;  4BE2 A;  4HT9 A;  2RHU A;  4M7D C;  3IKL A;  3VU3 C;  4BI3 A;  5CR2 A;  3CC2 A;  1I81 A;  4KR3 A;  3SD4 A;  3LWI A;  1YIJ T;  1D3B B;  3A8L B;  3NEN A;  1KHI A;  2RK2 A;  1M1F A;  3HRS A;  2E70 A;  2NS6 A;  3J80 E;  4KUL A;  3NTH A;  3OS0 A;  5CAI A;  3NFC A;  2HNI A;  2VYT A;  3RMS A;  5FRM A;  3PCO A;  1IL2 A;  4XAX B;  1YHQ A;  1USY A;  3QO3 A;  3MP6 A;  4P73 C;  3CCU A;  2DTO A;  3CPW S;  4CS3 A;  3G4S T;  3OSV A;  4P74 C;  4M7A A;  3HFV A;  4BY6 C;  4Y28 E;  3VQY A;  1EIY A;  5GAM f;  2K2V A;  1VQ4 T;  4PJO B;  2ZNI A;  2FHD A;  2E65 A;  3M4Y A;  4J83 A;  2F5T X;  4RKU E;  3OYJ A;  3A5Z A;  5LJ3 f;  3QKJ A;  4YPF A;  4KQE A;  4D6W A;  3X20 B;  1H4S A;  4H2S A;  1FWZ A;  1RL2 A;  1QVF S;  3RAC A;  2E41 A;  2XD0 A;  4M77 G;  1WJR A;  4J7I A;  4JRQ A;  1W2B S;  4M7A D;  2QTX A;  1X01 A;  5CO7 A;  3OYF A;  2HQE A;  2K3Y A;  2VXE A;  2MWP A;  4LDY A;  2O4X A;  1VQZ A;  2E1H A;  4C92 D;  3CCM T;  4XTU A;  3J81 E;  1OZ3 A;  4WJ3 M;  1WNL A;  5GMK h;  3CXC A;  5FRO A;  3JCM J;  1H4Q A;  4EX5 A;  1PYS A;  2I4N A;  4TVA A;  1N27 A;  4ZN3 A;  4C0Z A;  4JDS A;  2PQW A;  5FRN A;  5C53 B;  3ER0 A;  3OMG A;  3M53 A;  3JCM X;  3QSU A;  3HFZ A;  1M1K C;  2EYQ A;  3CME A;  1Q81 C;  5C52 B;  2I2L A;  4N4G A;  1I8F A;  1YI2 A;  2PUK B;  4M77 E;  3NEM A;  3NET A;  2ALY A;  3ZBD A;  2PU9 B;  4BD3 A;  1E22 A;  4C92 G;  1VQO A;  3KFU A;  4WJ4 A;  3P8B B;  2M1H A;  3Q1J A;  2EQK A;  2LX9 A;  5FLX E;  2DU7 A;  1UGR B;  1NPP A;  1Q86 C;  4M77 D;  3TEG A;  5LJ5 h;  3LC0 A;  3LGL A;  1TH7 A;  3QXE B;  1KMN A;  4HVC A;  3UFG A;  4BB7 A;  3BDU A;  4II1 A;  2JTF A;  2XG8 D;  3FLG A;  3RKX A;  4PJO E;  4XU1 A;  4PJO F;  3OYH A;  3CPW A;  4C8Q A;  1Y07 A;  3HXX A;  3RF1 A;  4DOV A;  2NLU A;  1S72 A;  5M9O A;  3M4P A;  2Y4X A;  2P0Q A;  4HWS A;  5CVI A;  3CMA T;  3SDZ A;  2R5M A;  2RHQ B;  2ZCF B;  1M5Q 1;  4J8O A;  1ASZ A;  3RUX A;  3QNE A;  2CJB A;  2R5A A;  3FB9 A;  4BWA A;  4G84 A;  2OTJ A;  5GAO l;  3HY0 A;  3LGF A;  2ZT5 A;  1G51 A;  3JCM P;  3H8Z A;  1W2B A;  1Q82 U;  4OVA A;  5DM7 R;  3V7C A;  4BW9 A;  1UGQ B;  4M77 B;  4R55 A;  2QQ9 A;  3VKI A;  2PVD B;  4A4K A;  3HP9 A;  4P74 A;  2HBP A;  3HFN A;  5GAM g;  4C8Q E;  3JCM b;  3MCA B;  3L2W A;  5FU6 C;  4M78 D;  3PNW C;  4N0A A;  4M77 C;  5K1P A;  2LNV A;  4O5V A;  3RKW A;  4C0D C;  2ZPF B;  4TTV A;  2JN0 A;  2AKW A;  2XDP A;  3MO8 A;  4HWP A;  4E51 A;  3S6W A;  3A5Y A;  4P75 C;  2IY5 A;  4HA8 A;  2X4Y A;  2A3L A;  3EAE A;  4F7U A;  2QXF A;  2CGH A;  3LX7 A;  1WU7 A;  2OTL T;  2V8J A;  4AH6 A;  4IUQ A;  1QVG A;  2J3M A;  1NJ2 A;  2ART A;  3QZ9 B;  3IKM B;  5GAN h;  3L4G A;  4E7J A;  2Q5H A;  4BDY A;  4QVC A;  1BIA A;  1OZ2 A;  1JJC B;  3PGG A;  2JZ2 A;  4L87 A;  4YRJ A;  2VC8 A;  3RIR A;  2QI2 A;  2FVU A;  4M7D F;  1KMM A;  5LJ5 f;  1VQ9 T;  4JLI A;  3LSS A;  5GMK m;  4ZIB A;  3CCV A;  2ODR C;  3QO7 A;  3QPH A;  4M75 C;  4IUT A;  1HC7 A;  5IT9 E;  1SER A;  4J15 A;  4LVK A;  2WAC A;  5CKF A;  5GAN 7;  3L2V A;  1L0W A;  1YIT T;  2L5Q A;  1H4V B;  4GLK A;  1G5H A;  3IG2 A;  5LL6 S;  3DLM A;  1UEB A;  1KQS A;  5E3I A;  5KE2 A;  4K86 A;  4M78 G;  1Y96 B;  4TVW A;  4N0A C;  2M16 A;  2C06 A;  3TEH B;  4YRL A;  2CZ0 B;  4PG3 A;  2CKK A;  2OAU A;  4M75 A;  3LWH A;  1Q82 C;  2RHS B;  4M7D E;  1EQR A;  2LCC A;  1NNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...