2HNIA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, k111a mutation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
230
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 67
structure length 230
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2hniA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2hniA01
3JCMb 1JJCA 1HK9A 1E24A 3QO8A 2C7IA 4H2YA 4M7AF 3HY0A 4M78C 1EQRA 5C53B 4XQ3A 2E41A 3HFOA 3R07A 4XTVA 4A54A 1LJOA 2E10A 4LNSA 2P5IA 1L0WA 4J6XA 5E3IA 3NEMA 3JCMf 1WU7A 3E9IA 1X2HA 1J5WA 3V8JA 2FYKA 3KFUA 2DEQA 1SETA 5LJ3f 4WF2A 4M7DE 4JLIA 1EIYB 2EJ9A 3A5ZA 4F7UA 3JB9F 2ODRC 1YFSA 4YROA 4ZTUB 5LJ5g 5K1PA 4HVCA 4M77A 1NJ1A 5GAN4 1EFWA 4PJOC 4BWAA 2PMFA 1M8VA 4H2SA 4YRSA 3QO5A 1H4SA 3HSBA 4M7AC 2ZNIA 5GAN8 5GAN2 4TQFA 4YCUA 3PZCA 3A31A 4J6WA 3QO3A 4M7DB 5GANe 4H2XA 4M7DD 1KMNA 2AKWA 5GANh 3TUPA 4JRIA 1HC7A 12ASA 1I81A 5GMKl 3DSQA 1PYSA 3AHUA 2Q7GA 4P72A 4M77D 4K86A 4DPGA 3MEYA 3HXXA 3A32A 2AMCA 4L87A 3PGGA 3JCMW 1USYA 4HWSA 4CH3A 1BIAA 2VC8A 1N9RA 1G5IA 4H2WA 3JCMe 4TVAA 1VQZA 4YRCA 1NYRA 5GAN3 2ALYA 4C8QG 3OD1A 2QHVA 1LNXA 4K88A 1YFRA 4CS4A 3RIRA 3M4QA 1B34B 3PCOB 1JBMA 3NENA 4YYEA 1M5Q1 3ICAA 4M75B 2ZR3A 3RKXA 4M75D 2RHSB 1YB3A 2QHSA 3RERA 3MF1A 3HFVA 3MF2A 5LJ3j 4NCXA 4MMLA 3JB9H 1NNHA 4XTWA 3SWNC 1C0AA 4M7DF 2RD1A 5LJ5e 3L2ZA 2XGTA 5GMKh 3QO7A 2RA2A 4F7UG 2ZT7A 5LJ5h 4PG3A 4JRKA 1H4QA 4KR3A 1EVLA 4P71A 2DVEA 1N9SA 5CAIA 4F7UF 4HWOA 4M77G 3IKMB 5GANf 1EIYA 2YLBA 4YCVA 3M4PA 4M77F 3JCMJ 2QHUA 1Y96A 4PJOG 2CJAA 3TEHB 3LSQA 1LYLA 3QTCA 1X55A 5LJ3d 2VXEA 4M7AG 4HWTA 1IL2A 4H02A 5C51B 2DXTA 4J5YA 4CS3A 4XEOA 3P8TA 4XTXA 4XU0A 3JCMQ 4BW9A 1U1TA 4C92E 4TWAA 1GGMA 3NELA 5GAMg 3G1ZA 4YCWA 4M7DA 1KMMA 4P74A 2JN0A 4YRPA 1B70B 2DTHA 4C8QE 4XTUA 4M75F 4NL2A 3JB9G 1YFTA 4YRJA 5GMKm 4M77C 1E1OA 1D3BB 4HWRA 1Y96B 2DTOA 3HXUA 4OLFA 3HXZA 4UP8A 4YRIA 1FYFA 4M78E 5I21A 3V7CA 3CMQA 4KQEA 3VBBA 1N9WA 3HXYA 1SRYA 4C92B 2QHTA 3QHSA 4C92D 2DDZA 4UP9A 4O2DA 2RHQB 3UFGA 4CH4A 4YRGA 2C8MA 2ZCEA 3SB2A 3L1AA 4KR2A 4X9DA 5LJ5f 1B7YB 4XEMA 3INZA 2ZIOA 3RKYA 3BW1A 3P8YA 1B34A 3PCOA 4P72C 5C52B 4M75C 2CJ9A 4YRMA 3FIFA 3RUXA 4N0AA 3UH0A 1BBWA 4M75A 4TQDA 4PJOE 2RHSA 3IKLA 1E22A 4M78B 3EFSA 2ZT6A 4CH6A 4YRRA 1Z7MA 4TTVA 4M7AE 3HRKA 2E65A 1USYC 2I4OA 2YHTA 3VQVA 3HRIA 3W3SA 3V8KA 2E5AA 5GANj 1HTTA 4YRQA 1SERA 4P75A 4XU3A 1X56A 3FJPA 3HFNA 2I4NA 2EL9A 4Q15A 2ODRD 3V7RA 1TH7A 4PJOB 3TEHA 4NOYA 4TVYA 3JCMP 1Z7NA 5GAN7 5GAMe 2EWNA 1X54A 3HTZA 4M7AB 5GANd 4C92F 5GAMh 1WNLA 4G85A 2J3LA 3RESA 3RF1A 3HY1A 4RCBA 1NJ5A 4M7DG 4NL3A 1E1TA 2DJZA 2J3MA 3NETA 3QNEA 5GMKe 4EO4A 4RQEA 1I5LA 2E3CA 4P71C 4HA8A 4WJ3M 1X2GA 2DZCA 4RQFA 1B70A 2EJFA 2EJGA 4H2UA 2I4LA 4XTZA 3HXWA 2CJBA 2ARUA 2G4CA 3UGQA 2ARTA 4CH5A 1D3BA 3JCMd 1ADJA 3A7UA 2ZT8A 2Q7HA 4V2SA 5GMKj 4CS2A 3HXVA 4P3OA 5LJ5j 2DZ9A 4EMHA 2VXFA 4YREA 2DTIA 3VQYA 2HNIA 2DU7A 4RDXA 5GAOr 1LOJA 4PNOA 5DY9A 4C92A 3HFZB 2RHQA 4P73C 5F5WA 4M7DC 1SESA 4AH6A 2DU5A 2IY5B 4P74C 11ASA 1WQWA 1WQ7A 1B7YA 4P73A 2I2LA 3JCMg 4K87A 4M75G 4X9CA 5GAOq 2ZZGA 4YRFA 4EMKA 4YRNA 2DQ0A 3E9HA 3BY7A 5GMKi 5LJ3g 1QF6A 3UGTA 3LSSA 1WPYA 5LJ5d 2FB7A 3IG2A 3VQXA 4M78A 1B8AA 4J15A 1JRIA 5GAMf 3REUA 3JCMc 4Y91A 3SWNB 2EAYA 4DQ2A 2DXUA 5GAOl 1WLEA 4A53A 3JCMV 3JB9J 1HXDA 1NYQA 3WQZA 3BDUA 1QE0A 4Q6GA 1RIQA 3RL6A 4RMFA 4WJ4A 2E1HA 4TVWA 2ZT5A 4C8QB 1EVKA 4MMKA 4C8QD 1KQ1A 1MGQA 3A7RA 2AKWB 4F7UE 2DKGA 2P0LA 4N0AC 3IALA 2QTXA 1JJCB 4YP0A 4EMKB 2ARSA 3VQWA 2E64A 2Q5HA 4M77E 2ZR2A 4PJOA 4YPFA 1NJ2A 4WI1A 1WYDA 2CGHA 1H4VB 3M4GA 4J6YA 4M7AA 1W66A 4ZIBA 4X5OA 5ELOA 4M78D 2RM4A 3V7SA 1YGBA 2PMEA 4RCCA 1YCYA 3JCMX 4H2VA 1G51A 3REXA 3RGLA 3I7FA 3ERRA 4JUVA 2ZZFA 5GAOp 4ZTZB 4P75C 3L4GA 4YRLA 3FB9A 4F7UB 4QVCA 4UP7A 3EFRA 4YRTA 3JB9I 4HT8A 4M77B 1ATIA 4XTYA 1H641 4EMGA 4M75E 4E51A 4QVDA 3A74A 2ZTGA 3LC0A 2Y90A 5ELNA 2ZINA 1I4K1 2YLCA 4PJOD 4C92G 1X01A 1BIBA 2CIMA 5GAN5 4PHCA 4M7AD 4YDQA 5GAN6 2ZIMA 1ADYA 3QSUA 3JCMh 3HFZA 4OP0A 1U1SA 5LJ3e 2DQ3A 4XU2A 4C8QF 4H2XB 5LJ3h 4G84A 1ASZA 3GIBA 2ZZEA 2IY5A 1KQ2A 1H4TA 5K1XA 3L4GB 1PYSB 3V8LA 1EOVA 4HWPA 2Q7EA 1NJ8A 5GAMj 1B76A 2ZNJA 1KOGA 4M78G 1G5HA 4H2TA 5GANg 3JB9D 4HT9A 2I4MA 4M78F 2K57A 1ASYA 2AMCB 3A5YA 4P3PA 2Q5IA 3SWNA 4C92C 2ZXFA 3BJUA 4TVAB 2XTIA 3VU3C 5GAOm 2ALYB 1NJ6A 4EX5A 1I8FA 3P8VA 4UPAA 4XU1A 3QUIA 1BBUA 3TEGA 5GAOn 4C8QC 4P3NA 3RACA 5GAMd 3RKWA 2ZGWA 4C8QA 4YRKA 2RB6A 4EMKC 5HGQA 5KNNA 3BFMA 3A7AA 4PJOF
chains in the Genus database with same CATH superfamily
2VGMA 2KQWA 1E24A 1OPKA 2A28A 2HCKA 5FRMA 3HY0A 3HPWA 2QQBA 3CCJA 3PNWC 1EQRA 1YJNT 2RHZA 2QEXA 2BE9B 1V76A 1D1AA 2EIFA 2KRMA 3DLLA 4ELYC 1RL2A 1E6GA 2KAFA 3H6ZA 3NEMA 1WHMA 2ZPEB 2A36A 1Q7YR 3BE3A 2CSQA 3GLXA 1NJIU 3JB9F 3J7AF 1XOVA 4ZTUB 4YROA 4F04B 4HVCA 1NJ1A 3ULRB 4BWAA 2K4YA 3H8ZA 1GFDA 1EFNA 4FYVB 4BDZA 3CCLT 1U3OA 4TQFA 3I55A 2OI3A 4QQDA 3A31A 2NUTB 1VOMA 3M55A 2EQUA 4M7DB 2FZGB 4M7DD 2K3XA 2YUOA 2QA4Q 1QVFS 1I81A 1G3SA 4F16A 2HKNA 2Q7GA 2KK4A 3EG1A 3PMIA 2ZPIB 1YJWQ 4OB2B 1VQOT 2YRDA 1K1ZA 5CIUA 3UATA 4M77D 4KUDK 4DPGA 2E5KA 3OYLA 3PGGA 1VQ5Q 1USYA 2M1HA 2AHJB 1G5IA 1BCMA 2V8IA 4TVAA 1N27A 2EBPA 1Z9ZA 2ALYA 2QHVA 3CC4T 3ZFJA 2BZXA 1J3TA 4CS4A 1GCPA 4AT1B 3M0TA 3MEVA 2HBWA 2CP0A 4JJNK 1AWXA 1WJSA 3MEUA 2VV5A 3H9NA 2MK5A 4J7IA 1JJ2S 2KEAA 2DPPB 1M5Q1 1K0XA 2GQIA 3OYCA 4HVVA 4N4HA 1VQMT 2BZYA 1WXUA 1GRIA 4ZGJB 1LVKA 1K4US 2L2PA 3MJXA 4WCIA 4BUGA 4XTWA 2QQAA 2PQWA 4ANJA 2RD1A 2KNBB 4X34A 3MO8A 3UWNA 5GMKh 1PM3A 2KDSA 4F7UG 2ZT7A 4JRKA 1NEGA 2WACA 4HWOA 3FEOA 1M3AA 3IKMB 1EIYA 2PVGB 3GP8A 3M4PA 3CXCS 1BI2A 3JCMJ 2QHUA 2X3XD 2CJAA 1KG1A 3CD6Q 3TEHB 2CZ6B 3A8OB 2F5KA 2L3QA 2LQ8A 2X3WD 1W2BS 2DM1A 2RN8A 5C51B 2A0FB 2DXTA 1M3BA 1QVGP 1D1BA 3QJYA 5A0DA 2CH4W 3D7SB 1Y57A 2QAZA 2JS0A 4C92E 1UTIA 1GGMA 1X6OA 4YCWA 5J26A 3KBGA 4YRPA 1X43A 4BD3A 2L89A 1NLOC 2EQJA 4FIBA 1BU1A 1SHGA 2YT6A 3JB9G 1YFTA 4YRJA 1ZX6A 1E1OA 1Y96B 1ZHIA 5CQXA 3HXUA 3QZ5B 3I5SA 2COYA 1ARKA 1FYFA 3DKMA 4M78E 5EG2A 3CC7T 3CMQA 2CZ7B 3V7CA 4RMOA 4KQEA 3N5BB 3QBYA 1N9WA 4JLGA 2C0TA 4J7FA 3EH1A 4O2DA 2RHQB 1E7OA 4YRGA 4OGEA 2C8MA 3SB2A 4C0FA 5IHNA 2K3BA 1D0XA 2B8AA 1Q82U 3RKYA 2CREA 3BW1A 1R8OB 3PCOA 4PFZA 4M75C 1RAFB 2ATCB 2VVKA 1SSFA 1BBWA 1S72Q 4M75A 3PVLA 3EG0A 2PVOB 4FT4A 3GF5A 3NPFA 4CH6A 4YRRA 2W10A 1K9AA 2I4OA 3W3SA 3VQVA 2HAXA 1HTTA 3QG1A 1UFFA 3OS1A 2ESWA 1Y0MA 3X28B 3CCSQ 2EFIA 3HFNA 2M0OA 4OMMA 1SKUB 4AFSC 3JCMP 1VQ6T 2J6OA 2EYYA 2LP5A 5GANd 1RAHB 2JS2A 4E7JA 2J3LA 1OZ3A 2DL4A 4X1VA 1UHCA 3GOXA 4CC4B 2ABLA 2CP3A 5D6XA 4ZTFA 1NJ5A 2J3MA 3L2VA 1UHFA 5GMKe 1MV0B 4EO4A 1Q86C 4KGZB 1RACB 3TEEA 3NFCA 3C0CA 4LUDA 1VQ9A 3UA7A 1VQKA 4L5GA 4XTZA 1KSWA 4LVIA 4CH5A 1D3BA 1QLYA 1TWBA 3JCMd 2LCSA 1O9SA 3M0SA 1NZ9A 2F5TX 1ADJA 3CMAA 1I5OB 4DBRA 4CS2A 1PKSA 2DTIA 1N5ZA 2Y4XA 2COZA 4PNOA 3HFZB 1NYGA 3IQLA 4AH6A 2DU5A 3CPWP 4FYWB 1WQWA 4D8DA 1WQ7A 1B7YA 5IXFA 3THKA 5D7UA 1M1KU 5GAOq 2DBKA 4JRPA 3BY7A 1YNZA 3UGTA 1B3QA 3LSSA 2NWMA 1Q86U 3F70A 3E2UA 5LJ5d 2FB7A 3EHQA 3IG2A 2Z0WA 3GPLA 2OTLT 3CCUT 3OBYA 1VQPA 4J9DA 1YIJQ 1B8AA 2QTVA 1S1NA 1JRIA 1P92A 2JNGA 5CKHA 1VA7A 3G71T 4A53A 5FU6C 3JCMV 2L0AA 4OB0B 3ZBDA 1NYQA 3WQZA 3BDUA 1U8RA 1QKXA 4RMFA 1AT1B 1UGVA 3I56T 1K73C 1RI9A 5CVIA 1QVFA 4C5EA 2BZ8A 3FJ5A 1QP3A 2D8JA 4N0AC 3VQWA 2E64A 3PT9A 3UT1A 4PJOA 2O9SA 1EZZB 2EGEA 1WYDA 4M7AA 1MNDA 1DJ7B 1UG1A 2NUPA 2AZSA 1W66A 2DAQA 4ZIBA 2C0IA 1KQSP 4X5OA 1VUBA 4M78D 2NYSA 3CCRA 5DM7R 5IHKA 4IUVA 4RTZA 4LNPA 3X20B 2OAWA 2XDBA 2NS6A 1AZEA 3L2UA 4JUVA 3RR6A 3M9QA 4F7UB 4QVCA 3NTHA 4BI3A 2RPNA 1JJ2A 2JTEA 3TSWA 2KRNA 3OYDA 1YBYA 3CBPA 4ELZC 2ZINA 4OB1B 1K73U 1X01A 1M4ZA 2HSPA 1G2BA 1VQLQ 2CIMA 1G3WA 1HSQA 3MEAA 3T9NA 2CH4A 3VRZA 2D0NA 2WSEE 1T3LA 4C8QF 5LJ3h 1ASZA 2FO0A 3C95A 2ZZEA 1QVGS 1EIFA 1VQ9Q 4Z02A 4E7KA 4FYXB 1JXOA 1E6HA 3OS5A 3CXCA 1ACMB 1EOVA 1NJ8A 1Q81C 1YJ9A 2P4RA 1QW1A 1BCOA 2DL8A 5GANg 3JB9D 2I4MA 1W70A 1W2BA 3G6EQ 1RADB 3OB9A 1ASYA 1MHNA 5DLOA 2DYIA 5CO7A 1PCXA 4IUUA 5A2QE 3QZ9B 2ZXFA 3CCQT 1QQJA 2XTIA 2E6ZA 4C0DB 4A63B 5GAOm 1Y7XA 1GCQA 1VQNQ 2RJCA 5AT1B 1BBUA 3TEGA 1AVZC 5GAMd 1VYVA 2LCCA 3LGFA 2ZGWA 3E1SA 2MF2A 1KD1R 2RB6A 4EMKC 5HGQA 5KNNA 2BUDA 2AKWA 3A7AA 3TVTA 3JCMb 1JJCA 4BACA 3QO8A 2BTTA 3M58A 2YUPA 1KD1C 4XQ3A 4RTVA 5CKDA 1YI2A 2K2VA 2E41A 3HFOA 1SHFA 4XTVA 2ZPBB 1Q81U 3EAEA 1L0WA 5E3IA 1X2KA 1WU7A 3E9IA 3H0IA 3X26B 1X2HA 1AWWA 2FYKA 5LJ3f 4M7DE 2RQVA 2ZPFB 3CBMA 4JLIA 4LD6A 2CP7A 4KGXB 1FYNA 3A5ZA 1TUDA 1VQ8A 1I1JA 5FWCA 5LJ5g 2EW3A 4M77A 5GAN4 2LNHB 5C6SA 1YHQT 3M0RA 1BI1A 3QWXX 2PMFA 3S6WA 2CUBA 4DOVA 3OYMA 3A98A 2OTJT 4IUPA 2HMAA 1M90R 2DILA 3EFOB 4OMQA 4IIMA 3CCMA 3TQ7P 1HYOA 3VS1A 4DOWA 4H2XA 5GJVB 2QASA 4XK8E 1KMNA 1HC7A 1VQ4T 1VYUA 2DLPA 4M4ZA 4LVMA 4JDSA 5IAYA 4XAXB 5FLXE 2WSFE 2JTMA 1WLPB 4DEYA 3JCMW 2LDMA 4CH3A 5IT9E 5FU6B 2WSCE 4LUEA 4YRCA 1M2VB 4C8QG 4ATOA 1LNXA 4FU6A 1QCOA 1BI0A 3QWYA 2V8JA 1KHIA 2M9UA 3RIRA 3M4QA 4OMNA 1JBMA 3MP1A 1UE9A 3META 3QXEB 3TREA 3ICAA 4PK4A 2O01E 3CPWS 3JRZA 2XKOC 3DLMA 3CEYA 2RHSB 2DXBA 1TSFA 1WZOA 1YJNA 1NJIR 2QHSA 3MF1A 4N4IA 4NCXA 2XMFA 1NNHA 4OF1A 1C0AA 2J7IA 5L23A 3L2ZA 3QO7A 2RA2A 4GY5A 4J9IA 1UGSB 1H4QA 2G6FX 1IHWA 4KR3A 2DVEA 2QQRA 5L8RE 3UF4A 4F7UF 4DA4A 1T3SA 3QIIA 1YN8A 4PLLA 5CKFA 2QA4T 2HZYA 1Y96A 1OQKA 4CC3A 1OX8A 3ZEHA 3PTAA 1T0HA 1BYMA 1YJWT 8ATCB 4HWTA 3CCLA 4H02A 2QQ9A 4XEOA 2A37A 4P5NA 1TS9A 1G5VA 4XU0A 2ECZA 4J9EA 4JRQA 3I9QA 3LYIA 4Z89A 5GAMg 4OB3B 2J05A 4PKCC 4JPBW 2R5MA 1KQSS 1PSEA 4JJDA 4K11A 1VQ8Q 3CC2Q 4P74A 4ESRA 4C8QE 3C94A 4M75F 2JZ2A 3VS5A 3OMCA 5GMKm 1VQOA 4LDUA 4B6MA 4HWRA 5IN1A 1QMCA 2DTOA 4N4GA 4JZ4A 4OLFA 3HXZA 4L59A 4J9GA 2FVUA 4UP8A 1ZUUA 1RAGB 4QT7A 4YRIA 2KT8A 2XDDA 4RTYA 1VQ7Q 2DDZA 4UP9A 3UFGA 3CC4A 3LLRA 2ZCEA 1N8RC 4OVAA 4XEMA 2X51A 2ZIOA 3P8YA 2VGNA 1B34A 5C52B 2HQXA 1OZ2A 1RABB 4YRMA 3RUXA 4A4FA 3L2QA 3UH0A 1V29B 1VQMA 3IKLA 3CD6T 5KYNA 4ZGDB 4MDWA 4ZTJA 1OPLA 1ZQ1A 3EFSA 4QQGA 1AWJA 3M0UA 1VIEA 1WXTA 4BE0A 1Z7MA 4TTVA 2DE0X 2L8DA 3HRKA 2E65A 1USYC 1SRMA 2RJEA 3RBBB 3HRIA 3G4SQ 1BK2A 5GANj 2ZPHB 3KXTA 2E70A 3CCVQ 2PUOB 3LW5E 2XICA 3VS6A 3QJ6A 1QVGA 1M1GA 2MWOA 2M16A 5I22A 4ORZA 3CCEQ 4XU3A 1X56A 1WI7A 3V7RA 4DBHA 1TH7A 4NOYA 2JJ9A 1QCFA 5EC7A 1N8RU 1H8KA 1X54A 2LX9A 5FRNA 2DRMA 3A8HB 1Q7YU 2K9GA 4ME7A 1ZUKA 3RESA 4BDYA 3J81E 3CMEQ 2EYXA 4NL3A 4II1A 1E1TA 1C0MA 2DJZA 3NETA 4RQEA 1I5LA 1M9SA 1D0YA 5FROA 3QDFA 4CI0C 1OEBA 1B70A 2OAUA 2I4LA 2CUDA 3EGDA 2CJBA 2XI9A 4E2FB 2LRQA 1Q82R 1WHHA 2O4XA 2YUQA 3CCJQ 2R58A 1S72T 4V2SA 3CC7A 1M1FA 2RHXA 2QEXQ 2ENMA 5LJ5j 1A0NB 4FSXA 1UB4A 4E7ZA 4QW2A 2DA9A 2J6KA 1Q82C 2F2WA 4C92A 1KFZA 2E3IA 2LNVA 2EKHA 4P73C 2KRSA 5F5WA 4AG1C 1SESA 2IY5B 1PG5B 4RTUA 11ASA 2DBMA 4P73A 3SD4A 1VQOQ 4M75G 2JMCA 2DJQA 1IRXA 3SDZA 2RO0A 3CCST 3E9HA 1RAIB 1QF6A 1WPYA 2CP2A 4J9HA 3S3MA 1H92A 5KYWA 3VQXA 2SEMA 1K76A 4M78A 2AZVA 3JCMc 4Y91A 2RH2A 3I55Q 4HT4A 3CC4Q 3EG9B 2EAYA 4DQ2A 1WLEA 1UECA 4RTXA 3JB9J 2DEUA 1UJ0A 3LH0A 4WJ4A 2E1HA 4TVWA 2FPEA 4C8QB 4MMKA 4C8QD 4F17A 4F7UE 2P0LA 5KYUB 1VQMQ 3IALA 2ARSA 4LDYA 1VQ6A 2Q5HA 1QP2A 1NJ2A 4WI1A 1D1CA 2F1LA 1NBEB 1ZSZA 1YFNA 3OYAA 2VWFA 2FG0A 2GGRA 1YITT 3P8HA 3JCMX 2E4HA 4IUTA 2RI5A 4C5HA 1JB0E 2ZZFA 5GAOp 3S3NA 1WHKA 2LJ3A 1FWZA 4RKUE 4HCZA 3O8VA 3JB9I 1XQHA 4XTYA 3ASKA 4M75E 3CPWA 4QVDA 1W1FA 3VUBA 1M27C 3LC0A 4QVZA 5D6WA 1M1KR 1I4K1 4LVKA 2YWWA 2XU8A 1YIJT 2RQUA 2OX7A 2QI2A 1Q86R 3MEWA 2ZIMA 1ADYA 3A8GB 3REBB 1O75A 2F2VA 3JCMh 2QDLA 2CZ0B 1M1KC 1U1SA 2XG8D 3EHRA 1ZLMA 1SRLA 5FU7C 2DL3A 2EKOA 1KIKA 1AHJB 2QDYB 1KJWA 1OULA 1ZBJA 3L4GB 3KUFA 3V8LA 3OW2A 1AOJA 2P84A 2RNAA 5GAMj 2ZNJA 2Y4YA 4R56A 1WHJA 2E12A 1G5HA 4H2TA 8AT1B 2OTLA 3CCUA 2K57A 4BY6C 2DF6A 1AEYA 3VS4A 5DLQE 5A0LA 2IIMA 9ATCB 5I2SA 3G71A 3OQ5A 4Z8AA 1M2OA 2HQEA 2RHUA 3SWNA 4TVAB 1WJQA 4BI4A 1T0JA 1NG2A 1WX6A 2ALYB 2K5IA 4XU1A 2GFUA 5GAOn 3I56A 4P3NA 1KQSA 4IUQA 3RKWA 4RTWA 5J3BA 2QYZA 2IVWA 5KYXA 1AD5A 2PMEA 2KXCA 1HK9A 2K5LA 2C7IA 4OMOA 3HTRA 4NS5A 5C53B 2J6FA 5CKEA 4A54A 1LJOA 2EQIA 3L2WA 1X6GA 4VUBA 1VQLT 3JCMf 1KC8U 1K73R 3KFUA 3OYGA 2QQSA 1GL5A 1BBZA 1EIYB 1RLQC 2EJ9A 1YFSA 1WHGA 3PFSA 2A8EA 5K1PA 4RTTA 3HRTA 4PJOC 2DYBA 4DEXA 1CKAA 3OSSC 2DIGA 3A8MB 4H2SA 1H4SA 3HSBA 4M7AC 5IXBA 4JJCA 5GAN8 4LN2A 7AT1B 4YCUA 3PZCA 1OV3A 4CC7A 3OYKA 4B9XA 1TOVA 1LCKA 2DMOA 4J6WA 3U23A 5GANe 3I5RA 5FW9A 1VQNT 2E5QA 2JTFA 4JRIA 12ASA 4FYYB 3PIOA 3R6NA 2C06A 1WYXA 3DSQA 1PYSA 3AHUA 4P72A 2PVDB 3J80E 3O5ZA 2X4YA 1IGQA 1IO6A 4K86A 1NYFA 3CCQA 3E19A 2AMCA 4O6JA 2XD0A 3A1PA 4HWSA 1BIAA 1N9RA 3JCMe 1IB8A 5GAN3 1JU5C 3LX7A 1MMDA 2X4JA 4KRTA 1Q81R 1YFRA 4MZMA 1Y07A 2QK0A 2GF7A 3VRYA 2KVQG 1VQKQ 3PCOB 4RG2A 2FPFA 4Y92A 2EPDA 3CCUQ 3L42A 4M75B 2C0OA 3RKXA 1K8AU 4J8OA 4M75D 3CMAQ 1PWTA 1PRLC 3DB4A 2ZPGB 3MHXA 3OBWA 3RERA 1ABOA 2SRCA 3MF2A 2DO3A 4MMLA 3E9GA 1OU9A 2RK1A 1QVPA 2DK3A 1GCQC 5LJ5e 1IXDA 1ABQA 4MDXA 4PG3A 4P71A 4PLIA 5CAIA 4PJNA 4M77G 4J9BA 2VUBA 1WGSA 2YLBA 4YCVA 3ME9A 1PC0A 1YHQA 3VV0A 3OYHA 5LJ3d 2OTJA 2VXEA 4FSSA 1VQPQ 1IL2A 2GFAA 1FMKA 4J5YA 3GNFB 1G3TA 4JS5A 4XTXA 1IZ6A 4BW9A 1U1TA 4TWAA 3NELA 3FRNA 3G1ZA 5KCOA 2NUTA 1UGPB 4M7DA 2K3YA 1VQ4A 3EGXB 1JO8A 2DTHA 3PIPA 4XTUA 1XNIA 2O2OA 4OMLA 3VS3A 2XIDA 4M77C 3VS7A 1D3BB 3HL8A 4AFUC 2MOXA 2EVRA 1YWPA 4BE2A 1X6BA 5HCKA 2M51A 4BY6B 4JZ3A 2LVMA 2R5AA 1NPRA 2D1XA 3HKSA 3CCRQ 3HXYA 4FL6A 4F14A 2QHTA 1C6VX 3G1JA 4EPCA 2VASA 2HD0A 5HK3A 3L1AA 4X9DA 1B7YB 2EYQA 3INZA 2CP6A 4AG2C 2CJ9A 2KY9A 3FIFA 1FXXA 1G3YA 3MP8A 4PFOA 1GXIE 1C1AA 4EDUA 4A4GA 5KCHA 4PJLA 4TQDA 2O9VA 3M59A 1K9MC 5D6YA 1X69A 2ZT6A 2LQWA 2AKLA 3AT1B 4MZTA 2E5AA 1VYTA 4HKEA 1SERA 1RUWA 3H0FA 2KXDA 2P4TA 2D6FA 3M0QA 2GNCA 1ZUYA 2K79A 2QA4A 4QQ6A 4P75A 3CC2T 1X75C 3Q1JA 4ZNXA 3FJPA 2FHDA 2I4NA 1YJ9Q 2EL9A 1NE8A 5CKBA 2DVJA 1FMWA 2ZCFB 1YJWA 4PJOB 3NTIA 3VS2A 3TEHA 4TVYA 1Z7NA 2E3HA 2YDLA 5GAMe 4C5IA 5GAN7 3HTZA 4M7AB 2KYMA 4C92F 1BKBA 1WNLA 3PMTA 4G85A 3RF1A 3QYHB 2LT1A 4J9CA 2MIOA 2CT4A 3QYGB 3QNEA 2DRKA 1VQ7T 1K9MU 4KH1B 2IPOB 1WHLA 3KFVA 2CZ1B 1JEGA 2PU9B 2KI7A 4WJ3M 1X2GA 4YTLA 4RQFA 4QKUA 4JJBA 1QWFA 3RMQA 2CP5A 2O88A 3HXWA 3UGQA 4FM4B 2CT3A 3OYBA 3A7UA 3MQZA 2P0KA 4PJMA 1YI2Q 5GMKj 4P3OA 3LWHA 2DZ9A 4EMHA 2VXFA 3VQYA 2HNIA 2DU7A 5GAOr 3MP6A 5CQYA 3GBQA 2RHIA 1GBQA 3G4ST 2RHQA 2X4WA 1VQ5T 3CCVT 4KGVB 4P74C 1WIEA 3NTKA 4X9CA 4YRFA 3M4YA 3CCET 2FPDA 5LJ3g 4BI8B 1I07A 3CD6A 2NLUA 2H8HA 4J15A 2G3RA 3REUA 2D0QB 5CCAA 3MKDA 2DXUA 2V1QA 2A3LA 1W6XA 4MZPA 5GAOl 3CCMQ 1N8RR 3SEMA 3C4SA 4IURA 3CMET 1QE0A 4Q6GA 3RL6A 5CR2A 3GNGA 1NLPC 2ZT5A 3BDLA 2RHYA 3M5AA 1KQ1A 2AKWB 1Q7YC 4O5VA 1JJCB 3WVDB 4EMKB 4UC4A 2FRYA 2ZR2A 4YPFA 3P8BB 2DD4A 1Y71A 2MMPA 3SHWA 2CKKA 2LZ6B 3TU4K 4C0ZA 3M4GA 4J6YA 1QCNA 3RNJA 3CCJT 2JM8A 1M3CA 2RM4A 3V7SA 4HVWA 2QEXT 1YCYA 2X35A 1G51A 4LDXA 3I7FA 5KE3A 4CRIA 1YP5A 3UPUA 3A5ZB 1HJDA 2VKNA 3FB9A 3L4GA 4UP7A 4KULA 3JAME 3EFRA 4YRTA 2XK0A 2GTJA 2V26A 3NMZC 2V8KA 4HT8A 4M77B 1H641 2RI3A 4E51A 4C5GA 3DB3A 2KE9A 4E7SA 1S72A 2ZTGA 1YJNQ 1ZA1B 2RMOA 5ELNA 4IIOA 4C92G 4DBQA 4YDQA 3OS0A 2RQRA 1Z9QA 2HL3A 2GQVA 3I55T 2QGFB 3HFZA 1ZSGA 6AT1B 2HQHA 2DQ3A 4XU2A 1UUEA 4H2XB 1QWEA 3HRUA 4G84A 4PFPA 1UGQB 3GIBA 2CSIA 1WJRA 3HHTB 2DERA 3LWIA 2AT1B 3CCSA 1KQ2A 5K1XA 2LX7A 2COWA 2EYWA 1CKBA 1B76A 1JXMA 4KT0E 2A7YA 5GJWB 1KOGA 5KYYB 4M78G 4AFZC 2LQKA 4A4KA 2KMTA 3CCLQ 1RAAB 1HD3A 2DL5A 1RAEB 5A0GA 3OYIA 1MMGA 2H3JA 3A5YA 2RQTA 1SPKA 2J06A 1V1CA 2Q5IA 1G83A 4C92C 3BJUA 1NJ6A 4PL6A 1I8FA 1X2QA 1M8MA 4UPAA 1YCSB 3M56A 2KT1A 1WDXA 3BFMA 1VIFA 4PJOF 4H2YA 4M7AF 4M78C 1B07A 1NM7A 1KK7A 2CYZB 3X24B 3R07A 1H3HA 2EYZA 2E10A 1U5SA 4LNSA 2P5IA 1YITA 4J6XA 3ZL7C 2YRVA 4J9FA 3CQTA 2RF0A 4RG8A 4ZN1A 3MCAB 1J5WA 3V8JA 2DEQA 2E6NA 1SETA 4WF2A 4GBQA 2KROA 3I35A 1EX4A 4F7UA 5I11A 2ODRC 2FL7A 4KH0B 1EFWA 1PD0A 1TTHB 2DXCA 1PHTA 1M8VA 4YRSA 2XHCA 3QO5A 1ZSZC 1OOTA 1YIJA 2ZNIA 1W4SA 5ECAA 5GAN2 2VYTA 2B86A 1X27A 4JS4A 1PKTA 5C0MA 3OYEA 2P0PA 3QO3A 2R57A 3VS0A 4LE9A 2PUKB 2LJ1A 1MMNA 2H3EB 3TUPA 5GANh 3LGLA 3JV3A 1CSKA 2QGGA 3HP9A 4E7HA 5GMKl 3NHNA 2VB6A 5CK9A 1SSHA 3NGPA 3VJPA 2IG0A 4E7IA 2MI6A 2OJ2A 3MEYA 1IHVA 2KGTA 3HXXA 3A32A 1I0CA 4L87A 1KHCA 4C0DC 4LVLA 1NPPA 4OGCA 2VC8A 2MCNA 4H2WA 3QDRB 1VQZA 2JXBA 1NYRA 2K6DA 2HBPA 3OD1A 2RJDA 4K88A 2LTOA 3M0PA 2RJFA 4HXJA 3EGUA 1OU8A 1B34B 1KC8R 3NENA 2EQKA 2YRCA 3CPFA 4YYEA 2PZ1A 3WXMB 4D8KA 2ZR3A 3X25B 1YB3A 3CC7Q 1KC8C 2D9TA 3HFVA 1B7TA 2DFUA 1IREB 5LJ3j 4BE1A 2F69A 3JB9H 1VQLA 2JMAA 3SWNC 1G8XA 4M7DF 3M53A 2XGTA 1MMAA 5LJ5h 3EGXA 1EVLA 4A4EA 1PRMC 1XTDA 1N9SA 2QG9B 4KBMB 2XDPA 3R6OA 5GANf 1WXBA 3P8DA 4E47A 1PSFA 4PJJA 4M77F 2CS7A 4PJOG 3RDVA 2MPXC 1WA7A 3LSQA 3OYNA 1LYLA 3QTCA 3VYHB 1X55A 4M7AG 4HCCA 3G6EA 2BIVA 1YITQ 1F1BB 2FZCB 2KSSA 4CS3A 3EFOA 3P8TA 2JOYA 1OX9A 5IHIA 2X9HA 3JCMQ 4ZGEB 4J83A 1VQNA 4HVUA 1KMMA 2D8HA 1YWOA 2JN0A 5IH2A 2L5QA 1B70B 4NL2A 3EGDB 2GBQA 1VQ9T 1VQKT 1VQ6Q 1MUZA 2FZKB 3CBOA 1H3ZA 2O4XB 4OMFB 1GFCA 1QKWA 3UDCA 3CMAT 5M9OA 2ROTA 2MYSA 5I21A 2F2XA 3VBBA 1K8AR 3G6ET 1SRYA 1ZA2B 4C92B 3OW2P 3QHSA 2FRWA 4C92D 4CH4A 3VYGA 1M2VA 2JT4A 4TVRA 2L3RA 2HDAA 4KR2A 1K0SA 5LJ5f 2K2MA 4LDVA 5J39A 5HKCA 1K8AC 3TCJA 3FC3A 1BI3A 2PTKA 1SEMA 4R0KA 4P72C 4N0AA 4FCYA 1TXQA 1TG0A 3VUZA 1RLPC 4PJOE 2RHSA 5KYWB 1E22A 2K5FA 2KBTA 2RK2A 4LXCA 2AIRB 4M78B 4M7AE 2W0ZA 1VQPT 2O31A 1M30A 2YHTA 2PNIA 2ROLA 1NEBA 3V8KA 2ED1A 4AMCA 4D6WA 5HK0A 4YRQA 2A08A 3OYFA 1UJYA 1JQQA 1MNEA 3OYJA 1UEBA 3UA6A 3QKJA 4FW1A 3OMGA 3H41A 2GTOA 4Q15A 2ODRD 2MWPA 4Z88A 2OTLQ 2NUZA 1OYXA 4AFQC 2EWNA 3TSZA 2DX1A 2ED0A 1ZSZB 3G71Q 2JW4A 5GAMh 3OA6A 3EG2A 3HRSA 4LVJA 3HY1A 4RCBA 4WTOB 4M7DG 1QVFP 3CCRT 3VKIA 1LPLA 1UDLA 1MV3A 2E3CA 2LC4A 3I56Q 4HA8A 4P71C 1D0ZA 1FX7A 2EQMA 2DZCA 2EJFA 2EJGA 4H2UA 4CC2A 4C0GA 2ARUA 2G4CA 3REAB 2ARTA 2HSEB 1SF9A 2LQNA 3C12A 1RI0A 2ZT8A 2Q7HA 1OI1A 2K7AA 1TUGB 5FWBA 4E6RA 4LD9K 3HXVA 4L6V5 1UGRB 2LMJA 4YREA 4RDXA 2YXYA 3FLGA 4A4HA 1LOJA 5DY9A 3L2RA 2MAMA 2CDTA 1JJ2P 4KUIA 2BKDN 4M7DC 5KE2A 5FU7B 4OMPA 2I2LA 3JCMg 4K87A 2ZZGA 4E7LA 1IGUA 4EMKA 4RUGA 2DQ0A 4YRNA 5GMKi 3G7ZA 1YJ9T 2KYBA 2RI2A 3QPHA 5LL6S 2V1RA 5GAMf 3SWNB 5AYFA 1XJWB 2FEIA 2AK5A 2ZZDA 3OYYA 3CXCP 1HXDA 2LT4A 2KR3A 5KYUA 4FT2A 1RIQA 3EH2A 3RMSA 3CC2A 1D09B 2RQWA 3E9FA 2JM9A 3PE0A 2X4XA 1W2BP 1FMVA 5KYXB 1EVKA 1MGQA 3A7RA 3ER0A 2DKGA 1K9MR 2QTXA 4YP0A 4M77E 2LJ0A 2GCXA 2CGHA 4GLMA 4LDWA 1H4VB 2DNUA 4B9WA 3CCQQ 3URGA 5ELOA 1YI2T 1YGBA 3M54A 2HKQB 2HL5C 1VQ7A 4RCCA 1M90C 1R0BG 1KD1U 4H2VA 3REXA 2L3SA 3RGLA 3ERRA 4ZTZB 4P75C 4YRLA 2YSQA 3PVQA 3MPUB 2M02A 1VQ8T 5KYYA 1ATIA 3SFMA 4EMGA 2DD5A 2JVVA 5HY6A 4Q5WA 3A74A 2Y90A 4PJOD 2YLCA 4EIKA 3FDRA 2L3PA 2DETA 1BIBA 1SG5A 2YUNA 2NUPB 4PHCA 5GAN5 4M7AD 5GAN6 3EG3A 4R55A 3S3OA 3G4SA 1AWOA 2EGCA 3QSUA 3OSVA 4OP0A 1VQ5A 3CCVA 5LJ3e 2QXFA 3CCMT 2ZAEA 2IY5A 3WVEB 2HEQA 2JUFA 1R77A 2DIQA 3CCEA 1H4TA 1Q95G 3LH5A 1PYSB 1U06A 1R0CB 4HWPA 2Q7EA 2AKKA 3OS2A 1M90U 3M57A 1YHQQ 2OTJQ 4HT9A 4M78F 3OY9A 5KH6A 3A8LB 4BB7A 1PD1A 2LCLA 1PNJA 1WFWA 1N6AA 2AMCB 1NJIC 4P3PA 1BB9A 5I2MA 1TUCA 3EG9A 3CMEA 2EGAA 3VU3C 4ZN3A 4EX5A 4FW2A 1TU0B 3P8VA 4GLKA 3QUIA 1GBRA 1AZGB 1VQ4Q 4C8QC 3RACA 4Y28E 3H0HA 2I0NA 3OW2S 4C8QA 4IKFA 2M0YA 4YRKA 1ZBXA 3JSCA 2DL7A 4DBFA 2BE7D 2P0QA 4HCBA 4HCKA
chains in the Genus database with same CATH topology
2VGMA 2KQWA 1E24A 5FRMA 3HY0A 3HPWA 2QQBA 3CCJA 3PNWC 1EQRA 1YJNT 2RHZA 2QEXA 2EIFA 3DLLA 4ELYC 1RL2A 2KAFA 3H6ZA 3NEMA 2ZPEB 3GLXA 1NJIU 3JB9F 3J7AF 1XOVA 4ZTUB 4YROA 4HVCA 1NJ1A 4BWAA 2K4YA 3H8ZA 4BDZA 3CCLT 4TQFA 3I55A 4QQDA 3A31A 3M55A 2EQUA 4M7DB 4M7DD 2K3XA 1QVFS 1I81A 1G3SA 2Q7GA 2KK4A 3PMIA 2ZPIB 4OB2B 1VQOT 5CIUA 4M77D 4KUDK 4DPGA 3OYLA 3PGGA 1USYA 2M1HA 2AHJB 1G5IA 2V8IA 4TVAA 1N27A 2ALYA 2QHVA 3CC4T 3ZFJA 4CS4A 3MEVA 4JJNK 1WJSA 3MEUA 2VV5A 4J7IA 1JJ2S 2DPPB 1M5Q1 3OYCA 4N4HA 1VQMT 4ZGJB 4BUGA 4XTWA 2QQAA 2PQWA 2RD1A 4X34A 3MO8A 3UWNA 5GMKh 2KDSA 2ZT7A 4F7UG 4JRKA 2WACA 4HWOA 3FEOA 3IKMB 1EIYA 2PVGB 3GP8A 3M4PA 3CXCS 1BI2A 3JCMJ 2QHUA 2CJAA 1KG1A 3TEHB 2CZ6B 3A8OB 2F5KA 2LQ8A 1W2BS 5C51B 2DXTA 3QJYA 5A0DA 4C92E 1GGMA 1X6OA 4YCWA 5J26A 3KBGA 4YRPA 4BD3A 2L89A 2EQJA 4FIBA 1YFTA 3JB9G 4YRJA 1E1OA 1Y96B 1ZHIA 5CQXA 3HXUA 3QZ5B 1FYFA 3DKMA 4M78E 5EG2A 3CC7T 3CMQA 2CZ7B 3V7CA 4RMOA 4KQEA 3N5BB 3QBYA 1N9WA 4JLGA 4J7FA 4O2DA 2RHQB 4YRGA 4OGEA 2C8MA 3SB2A 4C0FA 2B8AA 1Q82U 3RKYA 3BW1A 1R8OB 3PCOA 4M75C 1SSFA 1BBWA 4M75A 2PVOB 4FT4A 3GF5A 4CH6A 4YRRA 2I4OA 3W3SA 3VQVA 2HAXA 1HTTA 3QG1A 3OS1A 3X28B 2EFIA 3HFNA 2M0OA 3JCMP 1VQ6T 5GANd 4E7JA 2J3LA 1OZ3A 3GOXA 4ZTFA 1NJ5A 5D6XA 2J3MA 3L2VA 5GMKe 4EO4A 1Q86C 3TEEA 3NFCA 1VQ9A 1VQKA 4L5GA 4XTZA 4LVIA 4CH5A 1D3BA 3JCMd 1O9SA 1NZ9A 2F5TX 1ADJA 3CMAA 4CS2A 2DTIA 2Y4XA 4PNOA 3HFZB 4AH6A 2DU5A 1WQWA 1WQ7A 1B7YA 1M1KU 5GAOq 4JRPA 3BY7A 3UGTA 3LSSA 1Q86U 3F70A 5LJ5d 2FB7A 3IG2A 3GPLA 2OTLT 3CCUT 3OBYA 1VQPA 1B8AA 1JRIA 1P92A 2JNGA 5CKHA 3G71T 4A53A 5FU6C 3JCMV 4OB0B 3ZBDA 1NYQA 3WQZA 3BDUA 1U8RA 4RMFA 3I56T 1K73C 5CVIA 1QVFA 4C5EA 1QP3A 4N0AC 3VQWA 2E64A 3PT9A 3UT1A 4PJOA 1WYDA 4M7AA 1DJ7B 1W66A 4ZIBA 2DAQA 4X5OA 1VUBA 4M78D 3CCRA 5DM7R 4IUVA 3X20B 2XDBA 2NS6A 3L2UA 4JUVA 3M9QA 4F7UB 4QVCA 3NTHA 4BI3A 1JJ2A 3OYDA 1YBYA 3CBPA 4ELZC 2ZINA 4OB1B 1K73U 1X01A 1M4ZA 2CIMA 1G3WA 3MEAA 3T9NA 2WSEE 4C8QF 5LJ3h 1ASZA 2ZZEA 3C95A 1QVGS 1EIFA 4Z02A 4E7KA 3OS5A 3CXCA 1EOVA 1NJ8A 1Q81C 1YJ9A 1QW1A 5GANg 3JB9D 2I4MA 1W2BA 3OB9A 1ASYA 1MHNA 5DLOA 5CO7A 4IUUA 5A2QE 3QZ9B 2ZXFA 3CCQT 2XTIA 2E6ZA 4C0DB 5GAOm 1Y7XA 2RJCA 1BBUA 3TEGA 5GAMd 2LCCA 3LGFA 2ZGWA 3E1SA 2MF2A 2RB6A 4EMKC 5HGQA 5KNNA 2AKWA 2BUDA 3A7AA 3JCMb 1JJCA 4BACA 3QO8A 3M58A 1KD1C 4XQ3A 5CKDA 1YI2A 2K2VA 2E41A 3HFOA 4XTVA 2ZPBB 1Q81U 3EAEA 1L0WA 5E3IA 1WU7A 3E9IA 3X26B 1X2HA 2FYKA 5LJ3f 4M7DE 2ZPFB 3CBMA 4JLIA 4LD6A 3A5ZA 1VQ8A 5LJ5g 4M77A 5GAN4 5C6SA 1YHQT 1BI1A 2PMFA 3S6WA 3OYMA 4DOVA 2OTJT 4IUPA 3CCMA 4DOWA 4H2XA 4XK8E 1KMNA 1HC7A 1VQ4T 4LVMA 4JDSA 5IAYA 4XAXB 5FLXE 2WSFE 2JTMA 3JCMW 2LDMA 4CH3A 5IT9E 5FU6B 2WSCE 4YRCA 4C8QG 4ATOA 1LNXA 4FU6A 1BI0A 2V8JA 1KHIA 2M9UA 3RIRA 3M4QA 1JBMA 3MP1A 3META 3QXEB 3TREA 3ICAA 2O01E 3CPWS 3JRZA 2XKOC 3DLMA 3CEYA 2RHSB 2DXBA 1YJNA 2QHSA 3MF1A 4N4IA 4NCXA 1NNHA 4OF1A 1C0AA 3L2ZA 3QO7A 2RA2A 4GY5A 1UGSB 1H4QA 4KR3A 2DVEA 2QQRA 5L8RE 4DA4A 4F7UF 3QIIA 4PLLA 5CKFA 2QA4T 1Y96A 3ZEHA 3PTAA 1BYMA 1YJWT 4HWTA 3CCLA 4H02A 2QQ9A 4XEOA 4P5NA 1G5VA 4XU0A 4JRQA 3LYIA 5GAMg 4OB3B 4PKCC 2R5MA 1KQSS 1PSEA 4P74A 4C8QE 3C94A 4M75F 2JZ2A 3OMCA 5GMKm 1VQOA 4LDUA 4HWRA 5IN1A 2DTOA 4N4GA 4OLFA 3HXZA 4L59A 2FVUA 4UP8A 4YRIA 2XDDA 2DDZA 4UP9A 3UFGA 3CC4A 3LLRA 2ZCEA 1N8RC 4OVAA 4XEMA 2ZIOA 3P8YA 2VGNA 1B34A 5C52B 2HQXA 1OZ2A 4YRMA 3RUXA 4A4FA 3L2QA 3UH0A 1V29B 1VQMA 3IKLA 3CD6T 4ZGDB 4MDWA 4ZTJA 4QQGA 1ZQ1A 3EFSA 1VIEA 4BE0A 1Z7MA 4TTVA 2L8DA 3HRKA 2E65A 1USYC 2RJEA 3HRIA 5GANj 2ZPHB 3KXTA 2E70A 2PUOB 3LW5E 2XICA 3QJ6A 1QVGA 1M1GA 2MWOA 2M16A 4XU3A 1X56A 3V7RA 1TH7A 4NOYA 1N8RU 1X54A 2LX9A 5FRNA 3A8HB 1Q7YU 4ME7A 3RESA 4BDYA 3J81E 4NL3A 4II1A 1E1TA 2DJZA 3NETA 4RQEA 1I5LA 1M9SA 5FROA 4CI0C 1B70A 2OAUA 2I4LA 2CJBA 2XI9A 2LRQA 2O4XA 2R58A 1S72T 4V2SA 3CC7A 1M1FA 2RHXA 5LJ5j 4FSXA 1UB4A 4QW2A 1Q82C 4C92A 2LNVA 4P73C 5F5WA 1SESA 2IY5B 11ASA 4P73A 3SD4A 4M75G 3SDZA 3CCST 2RO0A 3E9HA 1QF6A 1WPYA 3S3MA 3VQXA 4M78A 3JCMc 4Y91A 2RH2A 4HT4A 2EAYA 4DQ2A 1WLEA 3JB9J 3LH0A 4WJ4A 2E1HA 4TVWA 4C8QB 4MMKA 4C8QD 4F7UE 2P0LA 3IALA 2ARSA 4LDYA 1VQ6A 2Q5HA 1QP2A 1NJ2A 4WI1A 3OYAA 1YITT 3P8HA 3JCMX 4IUTA 2RI5A 4C5HA 1JB0E 2ZZFA 5GAOp 3S3NA 1FWZA 4RKUE 4HCZA 3O8VA 3JB9I 1XQHA 4XTYA 3ASKA 4M75E 3CPWA 4QVDA 3VUBA 3LC0A 4QVZA 5D6WA 1I4K1 4LVKA 2XU8A 1YIJT 2QI2A 3MEWA 2ZIMA 1ADYA 3A8GB 1O75A 3JCMh 1M1KC 2CZ0B 1U1SA 2XG8D 5FU7C 2EKOA 1AHJB 2QDYB 3L4GB 3KUFA 3V8LA 3OW2A 5GAMj 2ZNJA 2Y4YA 4R56A 2E12A 1G5HA 4H2TA 2OTLA 3CCUA 2K57A 4BY6C 5DLQE 5A0LA 5I2SA 3G71A 3OQ5A 2HQEA 2RHUA 3SWNA 4TVAB 1WJQA 4BI4A 2ALYB 2K5IA 4XU1A 2GFUA 5GAOn 3I56A 4P3NA 1KQSA 4IUQA 3RKWA 5J3BA 2IVWA 2PMEA 1HK9A 2K5LA 2C7IA 4NS5A 5C53B 5CKEA 4A54A 1LJOA 3L2WA 4VUBA 1VQLT 3JCMf 1KC8U 3KFUA 3OYGA 2QQSA 1EIYB 2EJ9A 1YFSA 3PFSA 2A8EA 5K1PA 3HRTA 4PJOC 3OSSC 2DIGA 3A8MB 4H2SA 1H4SA 3HSBA 4M7AC 5GAN8 4YCUA 3PZCA 3OYKA 4B9XA 4J6WA 5GANe 1VQNT 2E5QA 2JTFA 4JRIA 12ASA 3PIOA 2C06A 3DSQA 1PYSA 3AHUA 4P72A 2PVDB 3J80E 2X4YA 4K86A 3CCQA 3E19A 2AMCA 4O6JA 2XD0A 4HWSA 1BIAA 1N9RA 3JCMe 5GAN3 3LX7A 2X4JA 1YFRA 4MZMA 1Y07A 2GF7A 2KVQG 3PCOB 4RG2A 3L42A 4M75B 3RKXA 1K8AU 4J8OA 4M75D 3DB4A 2ZPGB 3MHXA 3OBWA 3RERA 3MF2A 2DO3A 4MMLA 3E9GA 2RK1A 1QVPA 2DK3A 5LJ5e 4MDXA 4PG3A 4P71A 4PLIA 5CAIA 4M77G 2VUBA 1WGSA 2YLBA 4YCVA 3ME9A 1YHQA 3VV0A 3OYHA 5LJ3d 2OTJA 2VXEA 1IL2A 2GFAA 4J5YA 3GNFB 1G3TA 4JS5A 4XTXA 1IZ6A 4BW9A 1U1TA 4TWAA 3NELA 3FRNA 3G1ZA 5KCOA 1UGPB 4M7DA 2K3YA 1VQ4A 2DTHA 3PIPA 4XTUA 1XNIA 2XIDA 4M77C 1D3BB 3HL8A 4BE2A 4BY6B 2LVMA 2R5AA 1NPRA 3HKSA 3HXYA 4FL6A 2QHTA 4EPCA 2HD0A 5HK3A 3L1AA 4X9DA 1B7YB 2EYQA 3INZA 2CJ9A 2KY9A 3FIFA 1FXXA 1G3YA 3MP8A 1GXIE 4EDUA 4A4GA 5KCHA 4TQDA 3M59A 1K9MC 5D6YA 2ZT6A 4MZTA 2E5AA 4HKEA 1SERA 2P4TA 2D6FA 2QA4A 4QQ6A 4P75A 3CC2T 1X75C 3Q1JA 3FJPA 2FHDA 2I4NA 2EL9A 1NE8A 5CKBA 2ZCFB 4PJOB 1YJWA 3TEHA 3NTIA 4TVYA 1Z7NA 5GAN7 5GAMe 4C5IA 3HTZA 4M7AB 4C92F 1BKBA 1WNLA 3PMTA 4G85A 3RF1A 3QYHB 2LT1A 3QYGB 3QNEA 1VQ7T 1K9MU 2CZ1B 4WJ3M 2PU9B 1X2GA 4YTLA 4RQFA 3RMQA 3HXWA 3UGQA 4FM4B 3OYBA 3A7UA 3MQZA 2P0KA 5GMKj 4P3OA 3LWHA 2DZ9A 4EMHA 2VXFA 3VQYA 2HNIA 2DU7A 5GAOr 3MP6A 5CQYA 2RHIA 3G4ST 2RHQA 2X4WA 1VQ5T 3CCVT 4P74C 3NTKA 4X9CA 4YRFA 3M4YA 3CCET 5LJ3g 4BI8B 3CD6A 2NLUA 4J15A 2G3RA 3REUA 2D0QB 5CCAA 2DXUA 5GAOl 2A3LA 4MZPA 3C4SA 4IURA 3CMET 1QE0A 4Q6GA 3RL6A 5CR2A 3GNGA 2ZT5A 3BDLA 2RHYA 3M5AA 1KQ1A 2AKWB 1Q7YC 4O5VA 1JJCB 3WVDB 4EMKB 4UC4A 2ZR2A 4YPFA 3P8BB 2DD4A 1Y71A 2MMPA 2CKKA 3TU4K 4C0ZA 3M4GA 4J6YA 3CCJT 2RM4A 3V7SA 2QEXT 1YCYA 2X35A 1G51A 4LDXA 3I7FA 5KE3A 4CRIA 3UPUA 3A5ZB 3L4GA 3FB9A 4UP7A 4KULA 3JAME 3EFRA 4YRTA 2XK0A 4HT8A 2V8KA 4M77B 1H641 2RI3A 4E51A 4C5GA 3DB3A 1S72A 2ZTGA 5ELNA 4C92G 4YDQA 3OS0A 3HFZA 2GQVA 3I55T 2DQ3A 4XU2A 4H2XB 3HRUA 4G84A 1UGQB 3GIBA 1WJRA 3HHTB 3LWIA 1KQ2A 3CCSA 5K1XA 1B76A 4KT0E 2A7YA 1KOGA 4M78G 2LQKA 4A4KA 2KMTA 5A0GA 3OYIA 2H3JA 3A5YA 2Q5IA 4C92C 3BJUA 1NJ6A 4PL6A 1I8FA 4UPAA 3M56A 3BFMA 1VIFA 4PJOF 4H2YA 4M7AF 4M78C 2CYZB 3X24B 3R07A 4LNSA 2E10A 2P5IA 1YITA 4J6XA 2YRVA 4RG8A 4ZN1A 3MCAB 1J5WA 3V8JA 2DEQA 2E6NA 1SETA 4WF2A 4F7UA 2ODRC 2FL7A 1EFWA 2DXCA 1M8VA 4YRSA 2XHCA 3QO5A 1YIJA 2ZNIA 1W4SA 5GAN2 2VYTA 4JS4A 5C0MA 3OYEA 2P0PA 3QO3A 2R57A 2PUKB 3TUPA 5GANh 3LGLA 3HP9A 4E7HA 5GMKl 5CK9A 3VJPA 2IG0A 4E7IA 2MI6A 3MEYA 3HXXA 3A32A 4L87A 1KHCA 4C0DC 4LVLA 1NPPA 4OGCA 2VC8A 4H2WA 3QDRB 1VQZA 1NYRA 2HBPA 3OD1A 2RJDA 4K88A 2LTOA 2RJFA 1B34B 3NENA 2EQKA 3CPFA 4YYEA 3WXMB 2ZR3A 3X25B 1YB3A 1KC8C 2D9TA 3HFVA 1IREB 5LJ3j 4BE1A 2F69A 3JB9H 1VQLA 3SWNC 4M7DF 3M53A 2XGTA 5LJ5h 1EVLA 4A4EA 1XTDA 1N9SA 4KBMB 2XDPA 3R6OA 5GANf 3P8DA 4E47A 1PSFA 4M77F 2CS7A 4PJOG 3LSQA 3OYNA 1LYLA 3QTCA 3VYHB 1X55A 4M7AG 4HCCA 3G6EA 2BIVA 2KSSA 4CS3A 3P8TA 2JOYA 3JCMQ 4ZGEB 4J83A 1VQNA 1KMMA 2JN0A 2L5QA 1B70B 4NL2A 1VQ9T 1VQKT 3CBOA 1H3ZA 2O4XB 4OMFB 3UDCA 3CMAT 5M9OA 5I21A 3VBBA 3G6ET 1SRYA 4C92B 3QHSA 4C92D 4CH4A 3VYGA 4TVRA 2L3RA 4KR2A 5LJ5f 4LDVA 5J39A 5HKCA 1K8AC 3TCJA 3FC3A 1BI3A 4P72C 4N0AA 3VUZA 4PJOE 2RHSA 1E22A 2K5FA 2RK2A 4M78B 4M7AE 1VQPT 2YHTA 3V8KA 4YRQA 4D6WA 5HK0A 3OYFA 3OYJA 1UEBA 3QKJA 3OMGA 4Q15A 2ODRD 2MWPA 1OYXA 2EWNA 3OA6A 5GAMh 3HRSA 4LVJA 3HY1A 4RCBA 4M7DG 3CCRT 3VKIA 2E3CA 2LC4A 4P71C 4HA8A 1FX7A 2EQMA 2DZCA 2EJFA 2EJGA 4H2UA 4C0GA 2ARUA 2G4CA 2ARTA 3C12A 1RI0A 2ZT8A 2Q7HA 1OI1A 4LD9K 3HXVA 4L6V5 1UGRB 4YREA 4RDXA 3FLGA 4A4HA 1LOJA 5DY9A 3L2RA 2MAMA 4KUIA 2BKDN 4M7DC 5KE2A 5FU7B 2I2LA 3JCMg 4K87A 2ZZGA 4E7LA 4EMKA 4YRNA 2DQ0A 5GMKi 3G7ZA 1YJ9T 2RI2A 3QPHA 5LL6S 5GAMf 3SWNB 5AYFA 2ZZDA 3OYYA 1HXDA 2LT4A 4FT2A 1RIQA 3RMSA 3CC2A 3E9FA 2X4XA 1EVKA 1MGQA 3A7RA 3ER0A 2DKGA 2QTXA 4YP0A 4M77E 2GCXA 2CGHA 4LDWA 1H4VB 4B9WA 3URGA 5ELOA 1YI2T 1YGBA 3M54A 1VQ7A 4RCCA 1M90C 1KD1U 4H2VA 3REXA 3RGLA 3ERRA 4ZTZB 4P75C 4YRLA 1VQ8T 1ATIA 3SFMA 4EMGA 2DD5A 2JVVA 5HY6A 4Q5WA 3A74A 2Y90A 4PJOD 2YLCA 3FDRA 1BIBA 4PHCA 5GAN5 4M7AD 5GAN6 4R55A 3S3OA 3G4SA 3QSUA 3OSVA 4OP0A 1VQ5A 3CCVA 5LJ3e 2QXFA 3CCMT 2IY5A 3WVEB 2JUFA 2DIQA 3CCEA 1H4TA 1PYSB 4HWPA 2Q7EA 3OS2A 1M90U 3M57A 4HT9A 4M78F 3OY9A 5KH6A 3A8LB 4BB7A 2LCLA 1N6AA 2AMCB 1NJIC 4P3PA 5I2MA 3CMEA 3VU3C 4ZN3A 4EX5A 3P8VA 4GLKA 3QUIA 4C8QC 3RACA 4Y28E 3OW2S 4C8QA 4IKFA 4YRKA 1ZBXA 3JSCA 2P0QA 4HCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM b;  1JJC A;  1HK9 A;  1E24 A;  3QO8 A;  2C7I A;  4H2Y A;  4M7A F;  3HY0 A;  4M78 C;  1EQR A;  5C53 B;  4XQ3 A;  2E41 A;  3HFO A;  3R07 A;  4XTV A;  4A54 A;  1LJO A;  2E10 A;  4LNS A;  2P5I A;  1L0W A;  4J6X A;  5E3I A;  3NEM A;  3JCM f;  1WU7 A;  3E9I A;  1X2H A;  1J5W A;  3V8J A;  2FYK A;  3KFU A;  2DEQ A;  1SET A;  5LJ3 f;  4WF2 A;  4M7D E;  4JLI A;  1EIY B;  2EJ9 A;  3A5Z A;  4F7U A;  3JB9 F;  2ODR C;  1YFS A;  4YRO A;  4ZTU B;  5LJ5 g;  5K1P A;  4HVC A;  4M77 A;  1NJ1 A;  5GAN 4;  1EFW A;  4PJO C;  4BWA A;  2PMF A;  1M8V A;  4H2S A;  4YRS A;  3QO5 A;  1H4S A;  3HSB A;  4M7A C;  2ZNI A;  5GAN 8;  5GAN 2;  4TQF A;  4YCU A;  3PZC A;  3A31 A;  4J6W A;  3QO3 A;  4M7D B;  5GAN e;  4H2X A;  4M7D D;  1KMN A;  2AKW A;  5GAN h;  3TUP A;  4JRI A;  1HC7 A;  12AS A;  1I81 A;  5GMK l;  3DSQ A;  1PYS A;  3AHU A;  2Q7G A;  4P72 A;  4M77 D;  4K86 A;  4DPG A;  3MEY A;  3HXX A;  3A32 A;  2AMC A;  4L87 A;  3PGG A;  3JCM W;  1USY A;  4HWS A;  4CH3 A;  1BIA A;  2VC8 A;  1N9R A;  1G5I A;  4H2W A;  3JCM e;  4TVA A;  1VQZ A;  4YRC A;  1NYR A;  5GAN 3;  2ALY A;  4C8Q G;  3OD1 A;  2QHV A;  1LNX A;  4K88 A;  1YFR A;  4CS4 A;  3RIR A;  3M4Q A;  1B34 B;  3PCO B;  1JBM A;  3NEN A;  4YYE A;  1M5Q 1;  3ICA A;  4M75 B;  2ZR3 A;  3RKX A;  4M75 D;  2RHS B;  1YB3 A;  2QHS A;  3RER A;  3MF1 A;  3HFV A;  3MF2 A;  5LJ3 j;  4NCX A;  4MML A;  3JB9 H;  1NNH A;  4XTW A;  3SWN C;  1C0A A;  4M7D F;  2RD1 A;  5LJ5 e;  3L2Z A;  2XGT A;  5GMK h;  3QO7 A;  2RA2 A;  4F7U G;  2ZT7 A;  5LJ5 h;  4PG3 A;  4JRK A;  1H4Q A;  4KR3 A;  1EVL A;  4P71 A;  2DVE A;  1N9S A;  5CAI A;  4F7U F;  4HWO A;  4M77 G;  3IKM B;  5GAN f;  1EIY A;  2YLB A;  4YCV A;  3M4P A;  4M77 F;  3JCM J;  2QHU A;  1Y96 A;  4PJO G;  2CJA A;  3TEH B;  3LSQ A;  1LYL A;  3QTC A;  1X55 A;  5LJ3 d;  2VXE A;  4M7A G;  4HWT A;  1IL2 A;  4H02 A;  5C51 B;  2DXT A;  4J5Y A;  4CS3 A;  4XEO A;  3P8T A;  4XTX A;  4XU0 A;  3JCM Q;  4BW9 A;  1U1T A;  4C92 E;  4TWA A;  1GGM A;  3NEL A;  5GAM g;  3G1Z A;  4YCW A;  4M7D A;  1KMM A;  4P74 A;  2JN0 A;  4YRP A;  1B70 B;  2DTH A;  4C8Q E;  4XTU A;  4M75 F;  4NL2 A;  3JB9 G;  1YFT A;  4YRJ A;  5GMK m;  4M77 C;  1E1O A;  1D3B B;  4HWR A;  1Y96 B;  2DTO A;  3HXU A;  4OLF A;  3HXZ A;  4UP8 A;  4YRI A;  1FYF A;  4M78 E;  5I21 A;  3V7C A;  3CMQ A;  4KQE A;  3VBB A;  1N9W A;  3HXY A;  1SRY A;  4C92 B;  2QHT A;  3QHS A;  4C92 D;  2DDZ A;  4UP9 A;  4O2D A;  2RHQ B;  3UFG A;  4CH4 A;  4YRG A;  2C8M A;  2ZCE A;  3SB2 A;  3L1A A;  4KR2 A;  4X9D A;  5LJ5 f;  1B7Y B;  4XEM A;  3INZ A;  2ZIO A;  3RKY A;  3BW1 A;  3P8Y A;  1B34 A;  3PCO A;  4P72 C;  5C52 B;  4M75 C;  2CJ9 A;  4YRM A;  3FIF A;  3RUX A;  4N0A A;  3UH0 A;  1BBW A;  4M75 A;  4TQD A;  4PJO E;  2RHS A;  3IKL A;  1E22 A;  4M78 B;  3EFS A;  2ZT6 A;  4CH6 A;  4YRR A;  1Z7M A;  4TTV A;  4M7A E;  3HRK A;  2E65 A;  1USY C;  2I4O A;  2YHT A;  3VQV A;  3HRI A;  3W3S A;  3V8K A;  2E5A A;  5GAN j;  1HTT A;  4YRQ A;  1SER A;  4P75 A;  4XU3 A;  1X56 A;  3FJP A;  3HFN A;  2I4N A;  2EL9 A;  4Q15 A;  2ODR D;  3V7R A;  1TH7 A;  4PJO B;  3TEH A;  4NOY A;  4TVY A;  3JCM P;  1Z7N A;  5GAN 7;  5GAM e;  2EWN A;  1X54 A;  3HTZ A;  4M7A B;  5GAN d;  4C92 F;  5GAM h;  1WNL A;  4G85 A;  2J3L A;  3RES A;  3RF1 A;  3HY1 A;  4RCB A;  1NJ5 A;  4M7D G;  4NL3 A;  1E1T A;  2DJZ A;  2J3M A;  3NET A;  3QNE A;  5GMK e;  4EO4 A;  4RQE A;  1I5L A;  2E3C A;  4P71 C;  4HA8 A;  4WJ3 M;  1X2G A;  2DZC A;  4RQF A;  1B70 A;  2EJF A;  2EJG A;  4H2U A;  2I4L A;  4XTZ A;  3HXW A;  2CJB A;  2ARU A;  2G4C A;  3UGQ A;  2ART A;  4CH5 A;  1D3B A;  3JCM d;  1ADJ A;  3A7U A;  2ZT8 A;  2Q7H A;  4V2S A;  5GMK j;  4CS2 A;  3HXV A;  4P3O A;  5LJ5 j;  2DZ9 A;  4EMH A;  2VXF A;  4YRE A;  2DTI A;  3VQY A;  2HNI A;  2DU7 A;  4RDX A;  5GAO r;  1LOJ A;  4PNO A;  5DY9 A;  4C92 A;  3HFZ B;  2RHQ A;  4P73 C;  5F5W A;  4M7D C;  1SES A;  4AH6 A;  2DU5 A;  2IY5 B;  4P74 C;  11AS A;  1WQW A;  1WQ7 A;  1B7Y A;  4P73 A;  2I2L A;  3JCM g;  4K87 A;  4M75 G;  4X9C A;  5GAO q;  2ZZG A;  4YRF A;  4EMK A;  4YRN A;  2DQ0 A;  3E9H A;  3BY7 A;  5GMK i;  5LJ3 g;  1QF6 A;  3UGT A;  3LSS A;  1WPY A;  5LJ5 d;  2FB7 A;  3IG2 A;  3VQX A;  4M78 A;  1B8A A;  4J15 A;  1JRI A;  5GAM f;  3REU A;  3JCM c;  4Y91 A;  3SWN B;  2EAY A;  4DQ2 A;  2DXU A;  5GAO l;  1WLE A;  4A53 A;  3JCM V;  3JB9 J;  1HXD A;  1NYQ A;  3WQZ A;  3BDU A;  1QE0 A;  4Q6G A;  1RIQ A;  3RL6 A;  4RMF A;  4WJ4 A;  2E1H A;  4TVW A;  2ZT5 A;  4C8Q B;  1EVK A;  4MMK A;  4C8Q D;  1KQ1 A;  1MGQ A;  3A7R A;  2AKW B;  4F7U E;  2DKG A;  2P0L A;  4N0A C;  3IAL A;  2QTX A;  1JJC B;  4YP0 A;  4EMK B;  2ARS A;  3VQW A;  2E64 A;  2Q5H A;  4M77 E;  2ZR2 A;  4PJO A;  4YPF A;  1NJ2 A;  4WI1 A;  1WYD A;  2CGH A;  1H4V B;  3M4G A;  4J6Y A;  4M7A A;  1W66 A;  4ZIB A;  4X5O A;  5ELO A;  4M78 D;  2RM4 A;  3V7S A;  1YGB A;  2PME A;  4RCC A;  1YCY A;  3JCM X;  4H2V A;  1G51 A;  3REX A;  3RGL A;  3I7F A;  3ERR A;  4JUV A;  2ZZF A;  5GAO p;  4ZTZ B;  4P75 C;  3L4G A;  4YRL A;  3FB9 A;  4F7U B;  4QVC A;  4UP7 A;  3EFR A;  4YRT A;  3JB9 I;  4HT8 A;  4M77 B;  1ATI A;  4XTY A;  1H64 1;  4EMG A;  4M75 E;  4E51 A;  4QVD A;  3A74 A;  2ZTG A;  3LC0 A;  2Y90 A;  5ELN A;  2ZIN A;  1I4K 1;  2YLC A;  4PJO D;  4C92 G;  1X01 A;  1BIB A;  2CIM A;  5GAN 5;  4PHC A;  4M7A D;  4YDQ A;  5GAN 6;  2ZIM A;  1ADY A;  3QSU A;  3JCM h;  3HFZ A;  4OP0 A;  1U1S A;  5LJ3 e;  2DQ3 A;  4XU2 A;  4C8Q F;  4H2X B;  5LJ3 h;  4G84 A;  1ASZ A;  3GIB A;  2ZZE A;  2IY5 A;  1KQ2 A;  1H4T A;  5K1X A;  3L4G B;  1PYS B;  3V8L A;  1EOV A;  4HWP A;  2Q7E A;  1NJ8 A;  5GAM j;  1B76 A;  2ZNJ A;  1KOG A;  4M78 G;  1G5H A;  4H2T A;  5GAN g;  3JB9 D;  4HT9 A;  2I4M A;  4M78 F;  2K57 A;  1ASY A;  2AMC B;  3A5Y A;  4P3P A;  2Q5I A;  3SWN A;  4C92 C;  2ZXF A;  3BJU A;  4TVA B;  2XTI A;  3VU3 C;  5GAO m;  2ALY B;  1NJ6 A;  4EX5 A;  1I8F A;  3P8V A;  4UPA A;  4XU1 A;  3QUI A;  1BBU A;  3TEG A;  5GAO n;  4C8Q C;  4P3N A;  3RAC A;  5GAM d;  3RKW A;  2ZGW A;  4C8Q A;  4YRK A;  2RB6 A;  4EMK C;  5HGQ A;  5KNN A;  3BFM A;  3A7A A;  4PJO F; 
#chains in the Genus database with same CATH topology
 2VGM A;  2KQW A;  1E24 A;  1OPK A;  2A28 A;  2HCK A;  5FRM A;  3HY0 A;  3HPW A;  2QQB A;  3CCJ A;  3PNW C;  1EQR A;  1YJN T;  2RHZ A;  2QEX A;  2BE9 B;  1V76 A;  1D1A A;  2EIF A;  2KRM A;  3DLL A;  4ELY C;  1RL2 A;  1E6G A;  2KAF A;  3H6Z A;  3NEM A;  1WHM A;  2ZPE B;  2A36 A;  1Q7Y R;  3BE3 A;  2CSQ A;  3GLX A;  1NJI U;  3JB9 F;  3J7A F;  1XOV A;  4ZTU B;  4YRO A;  4F04 B;  4HVC A;  1NJ1 A;  3ULR B;  4BWA A;  2K4Y A;  3H8Z A;  1GFD A;  1EFN A;  4FYV B;  4BDZ A;  3CCL T;  1U3O A;  4TQF A;  3I55 A;  2OI3 A;  4QQD A;  3A31 A;  2NUT B;  1VOM A;  3M55 A;  2EQU A;  4M7D B;  2FZG B;  4M7D D;  2K3X A;  2YUO A;  2QA4 Q;  1QVF S;  1I81 A;  1G3S A;  4F16 A;  2HKN A;  2Q7G A;  2KK4 A;  3EG1 A;  3PMI A;  2ZPI B;  1YJW Q;  4OB2 B;  1VQO T;  2YRD A;  1K1Z A;  5CIU A;  3UAT A;  4M77 D;  4KUD K;  4DPG A;  2E5K A;  3OYL A;  3PGG A;  1VQ5 Q;  1USY A;  2M1H A;  2AHJ B;  1G5I A;  1BCM A;  2V8I A;  4TVA A;  1N27 A;  2EBP A;  1Z9Z A;  2ALY A;  2QHV A;  3CC4 T;  3ZFJ A;  2BZX A;  1J3T A;  4CS4 A;  1GCP A;  4AT1 B;  3M0T A;  3MEV A;  2HBW A;  2CP0 A;  4JJN K;  1AWX A;  1WJS A;  3MEU A;  2VV5 A;  3H9N A;  2MK5 A;  4J7I A;  1JJ2 S;  2KEA A;  2DPP B;  1M5Q 1;  1K0X A;  2GQI A;  3OYC A;  4HVV A;  4N4H A;  1VQM T;  2BZY A;  1WXU A;  1GRI A;  4ZGJ B;  1LVK A;  1K4U S;  2L2P A;  3MJX A;  4WCI A;  4BUG A;  4XTW A;  2QQA A;  2PQW A;  4ANJ A;  2RD1 A;  2KNB B;  4X34 A;  3MO8 A;  3UWN A;  5GMK h;  1PM3 A;  2KDS A;  4F7U G;  2ZT7 A;  4JRK A;  1NEG A;  2WAC A;  4HWO A;  3FEO A;  1M3A A;  3IKM B;  1EIY A;  2PVG B;  3GP8 A;  3M4P A;  3CXC S;  1BI2 A;  3JCM J;  2QHU A;  2X3X D;  2CJA A;  1KG1 A;  3CD6 Q;  3TEH B;  2CZ6 B;  3A8O B;  2F5K A;  2L3Q A;  2LQ8 A;  2X3W D;  1W2B S;  2DM1 A;  2RN8 A;  5C51 B;  2A0F B;  2DXT A;  1M3B A;  1QVG P;  1D1B A;  3QJY A;  5A0D A;  2CH4 W;  3D7S B;  1Y57 A;  2QAZ A;  2JS0 A;  4C92 E;  1UTI A;  1GGM A;  1X6O A;  4YCW A;  5J26 A;  3KBG A;  4YRP A;  1X43 A;  4BD3 A;  2L89 A;  1NLO C;  2EQJ A;  4FIB A;  1BU1 A;  1SHG A;  2YT6 A;  3JB9 G;  1YFT A;  4YRJ A;  1ZX6 A;  1E1O A;  1Y96 B;  1ZHI A;  5CQX A;  3HXU A;  3QZ5 B;  3I5S A;  2COY A;  1ARK A;  1FYF A;  3DKM A;  4M78 E;  5EG2 A;  3CC7 T;  3CMQ A;  2CZ7 B;  3V7C A;  4RMO A;  4KQE A;  3N5B B;  3QBY A;  1N9W A;  4JLG A;  2C0T A;  4J7F A;  3EH1 A;  4O2D A;  2RHQ B;  1E7O A;  4YRG A;  4OGE A;  2C8M A;  3SB2 A;  4C0F A;  5IHN A;  2K3B A;  1D0X A;  2B8A A;  1Q82 U;  3RKY A;  2CRE A;  3BW1 A;  1R8O B;  3PCO A;  4PFZ A;  4M75 C;  1RAF B;  2ATC B;  2VVK A;  1SSF A;  1BBW A;  1S72 Q;  4M75 A;  3PVL A;  3EG0 A;  2PVO B;  4FT4 A;  3GF5 A;  3NPF A;  4CH6 A;  4YRR A;  2W10 A;  1K9A A;  2I4O A;  3W3S A;  3VQV A;  2HAX A;  1HTT A;  3QG1 A;  1UFF A;  3OS1 A;  2ESW A;  1Y0M A;  3X28 B;  3CCS Q;  2EFI A;  3HFN A;  2M0O A;  4OMM A;  1SKU B;  4AFS C;  3JCM P;  1VQ6 T;  2J6O A;  2EYY A;  2LP5 A;  5GAN d;  1RAH B;  2JS2 A;  4E7J A;  2J3L A;  1OZ3 A;  2DL4 A;  4X1V A;  1UHC A;  3GOX A;  4CC4 B;  2ABL A;  2CP3 A;  5D6X A;  4ZTF A;  1NJ5 A;  2J3M A;  3L2V A;  1UHF A;  5GMK e;  1MV0 B;  4EO4 A;  1Q86 C;  4KGZ B;  1RAC B;  3TEE A;  3NFC A;  3C0C A;  4LUD A;  1VQ9 A;  3UA7 A;  1VQK A;  4L5G A;  4XTZ A;  1KSW A;  4LVI A;  4CH5 A;  1D3B A;  1QLY A;  1TWB A;  3JCM d;  2LCS A;  1O9S A;  3M0S A;  1NZ9 A;  2F5T X;  1ADJ A;  3CMA A;  1I5O B;  4DBR A;  4CS2 A;  1PKS A;  2DTI A;  1N5Z A;  2Y4X A;  2COZ A;  4PNO A;  3HFZ B;  1NYG A;  3IQL A;  4AH6 A;  2DU5 A;  3CPW P;  4FYW B;  1WQW A;  4D8D A;  1WQ7 A;  1B7Y A;  5IXF A;  3THK A;  5D7U A;  1M1K U;  5GAO q;  2DBK A;  4JRP A;  3BY7 A;  1YNZ A;  3UGT A;  1B3Q A;  3LSS A;  2NWM A;  1Q86 U;  3F70 A;  3E2U A;  5LJ5 d;  2FB7 A;  3EHQ A;  3IG2 A;  2Z0W A;  3GPL A;  2OTL T;  3CCU T;  3OBY A;  1VQP A;  4J9D A;  1YIJ Q;  1B8A A;  2QTV A;  1S1N A;  1JRI A;  1P92 A;  2JNG A;  5CKH A;  1VA7 A;  3G71 T;  4A53 A;  5FU6 C;  3JCM V;  2L0A A;  4OB0 B;  3ZBD A;  1NYQ A;  3WQZ A;  3BDU A;  1U8R A;  1QKX A;  4RMF A;  1AT1 B;  1UGV A;  3I56 T;  1K73 C;  1RI9 A;  5CVI A;  1QVF A;  4C5E A;  2BZ8 A;  3FJ5 A;  1QP3 A;  2D8J A;  4N0A C;  3VQW A;  2E64 A;  3PT9 A;  3UT1 A;  4PJO A;  2O9S A;  1EZZ B;  2EGE A;  1WYD A;  4M7A A;  1MND A;  1DJ7 B;  1UG1 A;  2NUP A;  2AZS A;  1W66 A;  2DAQ A;  4ZIB A;  2C0I A;  1KQS P;  4X5O A;  1VUB A;  4M78 D;  2NYS A;  3CCR A;  5DM7 R;  5IHK A;  4IUV A;  4RTZ A;  4LNP A;  3X20 B;  2OAW A;  2XDB A;  2NS6 A;  1AZE A;  3L2U A;  4JUV A;  3RR6 A;  3M9Q A;  4F7U B;  4QVC A;  3NTH A;  4BI3 A;  2RPN A;  1JJ2 A;  2JTE A;  3TSW A;  2KRN A;  3OYD A;  1YBY A;  3CBP A;  4ELZ C;  2ZIN A;  4OB1 B;  1K73 U;  1X01 A;  1M4Z A;  2HSP A;  1G2B A;  1VQL Q;  2CIM A;  1G3W A;  1HSQ A;  3MEA A;  3T9N A;  2CH4 A;  3VRZ A;  2D0N A;  2WSE E;  1T3L A;  4C8Q F;  5LJ3 h;  1ASZ A;  2FO0 A;  3C95 A;  2ZZE A;  1QVG S;  1EIF A;  1VQ9 Q;  4Z02 A;  4E7K A;  4FYX B;  1JXO A;  1E6H A;  3OS5 A;  3CXC A;  1ACM B;  1EOV A;  1NJ8 A;  1Q81 C;  1YJ9 A;  2P4R A;  1QW1 A;  1BCO A;  2DL8 A;  5GAN g;  3JB9 D;  2I4M A;  1W70 A;  1W2B A;  3G6E Q;  1RAD B;  3OB9 A;  1ASY A;  1MHN A;  5DLO A;  2DYI A;  5CO7 A;  1PCX A;  4IUU A;  5A2Q E;  3QZ9 B;  2ZXF A;  3CCQ T;  1QQJ A;  2XTI A;  2E6Z A;  4C0D B;  4A63 B;  5GAO m;  1Y7X A;  1GCQ A;  1VQN Q;  2RJC A;  5AT1 B;  1BBU A;  3TEG A;  1AVZ C;  5GAM d;  1VYV A;  2LCC A;  3LGF A;  2ZGW A;  3E1S A;  2MF2 A;  1KD1 R;  2RB6 A;  4EMK C;  5HGQ A;  5KNN A;  2BUD A;  2AKW A;  3A7A A;  3TVT A;  3JCM b;  1JJC A;  4BAC A;  3QO8 A;  2BTT A;  3M58 A;  2YUP A;  1KD1 C;  4XQ3 A;  4RTV A;  5CKD A;  1YI2 A;  2K2V A;  2E41 A;  3HFO A;  1SHF A;  4XTV A;  2ZPB B;  1Q81 U;  3EAE A;  1L0W A;  5E3I A;  1X2K A;  1WU7 A;  3E9I A;  3H0I A;  3X26 B;  1X2H A;  1AWW A;  2FYK A;  5LJ3 f;  4M7D E;  2RQV A;  2ZPF B;  3CBM A;  4JLI A;  4LD6 A;  2CP7 A;  4KGX B;  1FYN A;  3A5Z A;  1TUD A;  1VQ8 A;  1I1J A;  5FWC A;  5LJ5 g;  2EW3 A;  4M77 A;  5GAN 4;  2LNH B;  5C6S A;  1YHQ T;  3M0R A;  1BI1 A;  3QWX X;  2PMF A;  3S6W A;  2CUB A;  4DOV A;  3OYM A;  3A98 A;  2OTJ T;  4IUP A;  2HMA A;  1M90 R;  2DIL A;  3EFO B;  4OMQ A;  4IIM A;  3CCM A;  3TQ7 P;  1HYO A;  3VS1 A;  4DOW A;  4H2X A;  5GJV B;  2QAS A;  4XK8 E;  1KMN A;  1HC7 A;  1VQ4 T;  1VYU A;  2DLP A;  4M4Z A;  4LVM A;  4JDS A;  5IAY A;  4XAX B;  5FLX E;  2WSF E;  2JTM A;  1WLP B;  4DEY A;  3JCM W;  2LDM A;  4CH3 A;  5IT9 E;  5FU6 B;  2WSC E;  4LUE A;  4YRC A;  1M2V B;  4C8Q G;  4ATO A;  1LNX A;  4FU6 A;  1QCO A;  1BI0 A;  3QWY A;  2V8J A;  1KHI A;  2M9U A;  3RIR A;  3M4Q A;  4OMN A;  1JBM A;  3MP1 A;  1UE9 A;  3MET A;  3QXE B;  3TRE A;  3ICA A;  4PK4 A;  2O01 E;  3CPW S;  3JRZ A;  2XKO C;  3DLM A;  3CEY A;  2RHS B;  2DXB A;  1TSF A;  1WZO A;  1YJN A;  1NJI R;  2QHS A;  3MF1 A;  4N4I A;  4NCX A;  2XMF A;  1NNH A;  4OF1 A;  1C0A A;  2J7I A;  5L23 A;  3L2Z A;  3QO7 A;  2RA2 A;  4GY5 A;  4J9I A;  1UGS B;  1H4Q A;  2G6F X;  1IHW A;  4KR3 A;  2DVE A;  2QQR A;  5L8R E;  3UF4 A;  4F7U F;  4DA4 A;  1T3S A;  3QII A;  1YN8 A;  4PLL A;  5CKF A;  2QA4 T;  2HZY A;  1Y96 A;  1OQK A;  4CC3 A;  1OX8 A;  3ZEH A;  3PTA A;  1T0H A;  1BYM A;  1YJW T;  8ATC B;  4HWT A;  3CCL A;  4H02 A;  2QQ9 A;  4XEO A;  2A37 A;  4P5N A;  1TS9 A;  1G5V A;  4XU0 A;  2ECZ A;  4J9E A;  4JRQ A;  3I9Q A;  3LYI A;  4Z89 A;  5GAM g;  4OB3 B;  2J05 A;  4PKC C;  4JPB W;  2R5M A;  1KQS S;  1PSE A;  4JJD A;  4K11 A;  1VQ8 Q;  3CC2 Q;  4P74 A;  4ESR A;  4C8Q E;  3C94 A;  4M75 F;  2JZ2 A;  3VS5 A;  3OMC A;  5GMK m;  1VQO A;  4LDU A;  4B6M A;  4HWR A;  5IN1 A;  1QMC A;  2DTO A;  4N4G A;  4JZ4 A;  4OLF A;  3HXZ A;  4L59 A;  4J9G A;  2FVU A;  4UP8 A;  1ZUU A;  1RAG B;  4QT7 A;  4YRI A;  2KT8 A;  2XDD A;  4RTY A;  1VQ7 Q;  2DDZ A;  4UP9 A;  3UFG A;  3CC4 A;  3LLR A;  2ZCE A;  1N8R C;  4OVA A;  4XEM A;  2X51 A;  2ZIO A;  3P8Y A;  2VGN A;  1B34 A;  5C52 B;  2HQX A;  1OZ2 A;  1RAB B;  4YRM A;  3RUX A;  4A4F A;  3L2Q A;  3UH0 A;  1V29 B;  1VQM A;  3IKL A;  3CD6 T;  5KYN A;  4ZGD B;  4MDW A;  4ZTJ A;  1OPL A;  1ZQ1 A;  3EFS A;  4QQG A;  1AWJ A;  3M0U A;  1VIE A;  1WXT A;  4BE0 A;  1Z7M A;  4TTV A;  2DE0 X;  2L8D A;  3HRK A;  2E65 A;  1USY C;  1SRM A;  2RJE A;  3RBB B;  3HRI A;  3G4S Q;  1BK2 A;  5GAN j;  2ZPH B;  3KXT A;  2E70 A;  3CCV Q;  2PUO B;  3LW5 E;  2XIC A;  3VS6 A;  3QJ6 A;  1QVG A;  1M1G A;  2MWO A;  2M16 A;  5I22 A;  4ORZ A;  3CCE Q;  4XU3 A;  1X56 A;  1WI7 A;  3V7R A;  4DBH A;  1TH7 A;  4NOY A;  2JJ9 A;  1QCF A;  5EC7 A;  1N8R U;  1H8K A;  1X54 A;  2LX9 A;  5FRN A;  2DRM A;  3A8H B;  1Q7Y U;  2K9G A;  4ME7 A;  1ZUK A;  3RES A;  4BDY A;  3J81 E;  3CME Q;  2EYX A;  4NL3 A;  4II1 A;  1E1T A;  1C0M A;  2DJZ A;  3NET A;  4RQE A;  1I5L A;  1M9S A;  1D0Y A;  5FRO A;  3QDF A;  4CI0 C;  1OEB A;  1B70 A;  2OAU A;  2I4L A;  2CUD A;  3EGD A;  2CJB A;  2XI9 A;  4E2F B;  2LRQ A;  1Q82 R;  1WHH A;  2O4X A;  2YUQ A;  3CCJ Q;  2R58 A;  1S72 T;  4V2S A;  3CC7 A;  1M1F A;  2RHX A;  2QEX Q;  2ENM A;  5LJ5 j;  1A0N B;  4FSX A;  1UB4 A;  4E7Z A;  4QW2 A;  2DA9 A;  2J6K A;  1Q82 C;  2F2W A;  4C92 A;  1KFZ A;  2E3I A;  2LNV A;  2EKH A;  4P73 C;  2KRS A;  5F5W A;  4AG1 C;  1SES A;  2IY5 B;  1PG5 B;  4RTU A;  11AS A;  2DBM A;  4P73 A;  3SD4 A;  1VQO Q;  4M75 G;  2JMC A;  2DJQ A;  1IRX A;  3SDZ A;  2RO0 A;  3CCS T;  3E9H A;  1RAI B;  1QF6 A;  1WPY A;  2CP2 A;  4J9H A;  3S3M A;  1H92 A;  5KYW A;  3VQX A;  2SEM A;  1K76 A;  4M78 A;  2AZV A;  3JCM c;  4Y91 A;  2RH2 A;  3I55 Q;  4HT4 A;  3CC4 Q;  3EG9 B;  2EAY A;  4DQ2 A;  1WLE A;  1UEC A;  4RTX A;  3JB9 J;  2DEU A;  1UJ0 A;  3LH0 A;  4WJ4 A;  2E1H A;  4TVW A;  2FPE A;  4C8Q B;  4MMK A;  4C8Q D;  4F17 A;  4F7U E;  2P0L A;  5KYU B;  1VQM Q;  3IAL A;  2ARS A;  4LDY A;  1VQ6 A;  2Q5H A;  1QP2 A;  1NJ2 A;  4WI1 A;  1D1C A;  2F1L A;  1NBE B;  1ZSZ A;  1YFN A;  3OYA A;  2VWF A;  2FG0 A;  2GGR A;  1YIT T;  3P8H A;  3JCM X;  2E4H A;  4IUT A;  2RI5 A;  4C5H A;  1JB0 E;  2ZZF A;  5GAO p;  3S3N A;  1WHK A;  2LJ3 A;  1FWZ A;  4RKU E;  4HCZ A;  3O8V A;  3JB9 I;  1XQH A;  4XTY A;  3ASK A;  4M75 E;  3CPW A;  4QVD A;  1W1F A;  3VUB A;  1M27 C;  3LC0 A;  4QVZ A;  5D6W A;  1M1K R;  1I4K 1;  4LVK A;  2YWW A;  2XU8 A;  1YIJ T;  2RQU A;  2OX7 A;  2QI2 A;  1Q86 R;  3MEW A;  2ZIM A;  1ADY A;  3A8G B;  3REB B;  1O75 A;  2F2V A;  3JCM h;  2QDL A;  2CZ0 B;  1M1K C;  1U1S A;  2XG8 D;  3EHR A;  1ZLM A;  1SRL A;  5FU7 C;  2DL3 A;  2EKO A;  1KIK A;  1AHJ B;  2QDY B;  1KJW A;  1OUL A;  1ZBJ A;  3L4G B;  3KUF A;  3V8L A;  3OW2 A;  1AOJ A;  2P84 A;  2RNA A;  5GAM j;  2ZNJ A;  2Y4Y A;  4R56 A;  1WHJ A;  2E12 A;  1G5H A;  4H2T A;  8AT1 B;  2OTL A;  3CCU A;  2K57 A;  4BY6 C;  2DF6 A;  1AEY A;  3VS4 A;  5DLQ E;  5A0L A;  2IIM A;  9ATC B;  5I2S A;  3G71 A;  3OQ5 A;  4Z8A A;  1M2O A;  2HQE A;  2RHU A;  3SWN A;  4TVA B;  1WJQ A;  4BI4 A;  1T0J A;  1NG2 A;  1WX6 A;  2ALY B;  2K5I A;  4XU1 A;  2GFU A;  5GAO n;  3I56 A;  4P3N A;  1KQS A;  4IUQ A;  3RKW A;  4RTW A;  5J3B A;  2QYZ A;  2IVW A;  5KYX A;  1AD5 A;  2PME A;  2KXC A;  1HK9 A;  2K5L A;  2C7I A;  4OMO A;  3HTR A;  4NS5 A;  5C53 B;  2J6F A;  5CKE A;  4A54 A;  1LJO A;  2EQI A;  3L2W A;  1X6G A;  4VUB A;  1VQL T;  3JCM f;  1KC8 U;  1K73 R;  3KFU A;  3OYG A;  2QQS A;  1GL5 A;  1BBZ A;  1EIY B;  1RLQ C;  2EJ9 A;  1YFS A;  1WHG A;  3PFS A;  2A8E A;  5K1P A;  4RTT A;  3HRT A;  4PJO C;  2DYB A;  4DEX A;  1CKA A;  3OSS C;  2DIG A;  3A8M B;  4H2S A;  1H4S A;  3HSB A;  4M7A C;  5IXB A;  4JJC A;  5GAN 8;  4LN2 A;  7AT1 B;  4YCU A;  3PZC A;  1OV3 A;  4CC7 A;  3OYK A;  4B9X A;  1TOV A;  1LCK A;  2DMO A;  4J6W A;  3U23 A;  5GAN e;  3I5R A;  5FW9 A;  1VQN T;  2E5Q A;  2JTF A;  4JRI A;  12AS A;  4FYY B;  3PIO A;  3R6N A;  2C06 A;  1WYX A;  3DSQ A;  1PYS A;  3AHU A;  4P72 A;  2PVD B;  3J80 E;  3O5Z A;  2X4Y A;  1IGQ A;  1IO6 A;  4K86 A;  1NYF A;  3CCQ A;  3E19 A;  2AMC A;  4O6J A;  2XD0 A;  3A1P A;  4HWS A;  1BIA A;  1N9R A;  3JCM e;  1IB8 A;  5GAN 3;  1JU5 C;  3LX7 A;  1MMD A;  2X4J A;  4KRT A;  1Q81 R;  1YFR A;  4MZM A;  1Y07 A;  2QK0 A;  2GF7 A;  3VRY A;  2KVQ G;  1VQK Q;  3PCO B;  4RG2 A;  2FPF A;  4Y92 A;  2EPD A;  3CCU Q;  3L42 A;  4M75 B;  2C0O A;  3RKX A;  1K8A U;  4J8O A;  4M75 D;  3CMA Q;  1PWT A;  1PRL C;  3DB4 A;  2ZPG B;  3MHX A;  3OBW A;  3RER A;  1ABO A;  2SRC A;  3MF2 A;  2DO3 A;  4MML A;  3E9G A;  1OU9 A;  2RK1 A;  1QVP A;  2DK3 A;  1GCQ C;  5LJ5 e;  1IXD A;  1ABQ A;  4MDX A;  4PG3 A;  4P71 A;  4PLI A;  5CAI A;  4PJN A;  4M77 G;  4J9B A;  2VUB A;  1WGS A;  2YLB A;  4YCV A;  3ME9 A;  1PC0 A;  1YHQ A;  3VV0 A;  3OYH A;  5LJ3 d;  2OTJ A;  2VXE A;  4FSS A;  1VQP Q;  1IL2 A;  2GFA A;  1FMK A;  4J5Y A;  3GNF B;  1G3T A;  4JS5 A;  4XTX A;  1IZ6 A;  4BW9 A;  1U1T A;  4TWA A;  3NEL A;  3FRN A;  3G1Z A;  5KCO A;  2NUT A;  1UGP B;  4M7D A;  2K3Y A;  1VQ4 A;  3EGX B;  1JO8 A;  2DTH A;  3PIP A;  4XTU A;  1XNI A;  2O2O A;  4OML A;  3VS3 A;  2XID A;  4M77 C;  3VS7 A;  1D3B B;  3HL8 A;  4AFU C;  2MOX A;  2EVR A;  1YWP A;  4BE2 A;  1X6B A;  5HCK A;  2M51 A;  4BY6 B;  4JZ3 A;  2LVM A;  2R5A A;  1NPR A;  2D1X A;  3HKS A;  3CCR Q;  3HXY A;  4FL6 A;  4F14 A;  2QHT A;  1C6V X;  3G1J A;  4EPC A;  2VAS A;  2HD0 A;  5HK3 A;  3L1A A;  4X9D A;  1B7Y B;  2EYQ A;  3INZ A;  2CP6 A;  4AG2 C;  2CJ9 A;  2KY9 A;  3FIF A;  1FXX A;  1G3Y A;  3MP8 A;  4PFO A;  1GXI E;  1C1A A;  4EDU A;  4A4G A;  5KCH A;  4PJL A;  4TQD A;  2O9V A;  3M59 A;  1K9M C;  5D6Y A;  1X69 A;  2ZT6 A;  2LQW A;  2AKL A;  3AT1 B;  4MZT A;  2E5A A;  1VYT A;  4HKE A;  1SER A;  1RUW A;  3H0F A;  2KXD A;  2P4T A;  2D6F A;  3M0Q A;  2GNC A;  1ZUY A;  2K79 A;  2QA4 A;  4QQ6 A;  4P75 A;  3CC2 T;  1X75 C;  3Q1J A;  4ZNX A;  3FJP A;  2FHD A;  2I4N A;  1YJ9 Q;  2EL9 A;  1NE8 A;  5CKB A;  2DVJ A;  1FMW A;  2ZCF B;  1YJW A;  4PJO B;  3NTI A;  3VS2 A;  3TEH A;  4TVY A;  1Z7N A;  2E3H A;  2YDL A;  5GAM e;  4C5I A;  5GAN 7;  3HTZ A;  4M7A B;  2KYM A;  4C92 F;  1BKB A;  1WNL A;  3PMT A;  4G85 A;  3RF1 A;  3QYH B;  2LT1 A;  4J9C A;  2MIO A;  2CT4 A;  3QYG B;  3QNE A;  2DRK A;  1VQ7 T;  1K9M U;  4KH1 B;  2IPO B;  1WHL A;  3KFV A;  2CZ1 B;  1JEG A;  2PU9 B;  2KI7 A;  4WJ3 M;  1X2G A;  4YTL A;  4RQF A;  4QKU A;  4JJB A;  1QWF A;  3RMQ A;  2CP5 A;  2O88 A;  3HXW A;  3UGQ A;  4FM4 B;  2CT3 A;  3OYB A;  3A7U A;  3MQZ A;  2P0K A;  4PJM A;  1YI2 Q;  5GMK j;  4P3O A;  3LWH A;  2DZ9 A;  4EMH A;  2VXF A;  3VQY A;  2HNI A;  2DU7 A;  5GAO r;  3MP6 A;  5CQY A;  3GBQ A;  2RHI A;  1GBQ A;  3G4S T;  2RHQ A;  2X4W A;  1VQ5 T;  3CCV T;  4KGV B;  4P74 C;  1WIE A;  3NTK A;  4X9C A;  4YRF A;  3M4Y A;  3CCE T;  2FPD A;  5LJ3 g;  4BI8 B;  1I07 A;  3CD6 A;  2NLU A;  2H8H A;  4J15 A;  2G3R A;  3REU A;  2D0Q B;  5CCA A;  3MKD A;  2DXU A;  2V1Q A;  2A3L A;  1W6X A;  4MZP A;  5GAO l;  3CCM Q;  1N8R R;  3SEM A;  3C4S A;  4IUR A;  3CME T;  1QE0 A;  4Q6G A;  3RL6 A;  5CR2 A;  3GNG A;  1NLP C;  2ZT5 A;  3BDL A;  2RHY A;  3M5A A;  1KQ1 A;  2AKW B;  1Q7Y C;  4O5V A;  1JJC B;  3WVD B;  4EMK B;  4UC4 A;  2FRY A;  2ZR2 A;  4YPF A;  3P8B B;  2DD4 A;  1Y71 A;  2MMP A;  3SHW A;  2CKK A;  2LZ6 B;  3TU4 K;  4C0Z A;  3M4G A;  4J6Y A;  1QCN A;  3RNJ A;  3CCJ T;  2JM8 A;  1M3C A;  2RM4 A;  3V7S A;  4HVW A;  2QEX T;  1YCY A;  2X35 A;  1G51 A;  4LDX A;  3I7F A;  5KE3 A;  4CRI A;  1YP5 A;  3UPU A;  3A5Z B;  1HJD A;  2VKN A;  3FB9 A;  3L4G A;  4UP7 A;  4KUL A;  3JAM E;  3EFR A;  4YRT A;  2XK0 A;  2GTJ A;  2V26 A;  3NMZ C;  2V8K A;  4HT8 A;  4M77 B;  1H64 1;  2RI3 A;  4E51 A;  4C5G A;  3DB3 A;  2KE9 A;  4E7S A;  1S72 A;  2ZTG A;  1YJN Q;  1ZA1 B;  2RMO A;  5ELN A;  4IIO A;  4C92 G;  4DBQ A;  4YDQ A;  3OS0 A;  2RQR A;  1Z9Q A;  2HL3 A;  2GQV A;  3I55 T;  2QGF B;  3HFZ A;  1ZSG A;  6AT1 B;  2HQH A;  2DQ3 A;  4XU2 A;  1UUE A;  4H2X B;  1QWE A;  3HRU A;  4G84 A;  4PFP A;  1UGQ B;  3GIB A;  2CSI A;  1WJR A;  3HHT B;  2DER A;  3LWI A;  2AT1 B;  3CCS A;  1KQ2 A;  5K1X A;  2LX7 A;  2COW A;  2EYW A;  1CKB A;  1B76 A;  1JXM A;  4KT0 E;  2A7Y A;  5GJW B;  1KOG A;  5KYY B;  4M78 G;  4AFZ C;  2LQK A;  4A4K A;  2KMT A;  3CCL Q;  1RAA B;  1HD3 A;  2DL5 A;  1RAE B;  5A0G A;  3OYI A;  1MMG A;  2H3J A;  3A5Y A;  2RQT A;  1SPK A;  2J06 A;  1V1C A;  2Q5I A;  1G83 A;  4C92 C;  3BJU A;  1NJ6 A;  4PL6 A;  1I8F A;  1X2Q A;  1M8M A;  4UPA A;  1YCS B;  3M56 A;  2KT1 A;  1WDX A;  3BFM A;  1VIF A;  4PJO F;  4H2Y A;  4M7A F;  4M78 C;  1B07 A;  1NM7 A;  1KK7 A;  2CYZ B;  3X24 B;  3R07 A;  1H3H A;  2EYZ A;  2E10 A;  1U5S A;  4LNS A;  2P5I A;  1YIT A;  4J6X A;  3ZL7 C;  2YRV A;  4J9F A;  3CQT A;  2RF0 A;  4RG8 A;  4ZN1 A;  3MCA B;  1J5W A;  3V8J A;  2DEQ A;  2E6N A;  1SET A;  4WF2 A;  4GBQ A;  2KRO A;  3I35 A;  1EX4 A;  4F7U A;  5I11 A;  2ODR C;  2FL7 A;  4KH0 B;  1EFW A;  1PD0 A;  1TTH B;  2DXC A;  1PHT A;  1M8V A;  4YRS A;  2XHC A;  3QO5 A;  1ZSZ C;  1OOT A;  1YIJ A;  2ZNI A;  1W4S A;  5ECA A;  5GAN 2;  2VYT A;  2B86 A;  1X27 A;  4JS4 A;  1PKT A;  5C0M A;  3OYE A;  2P0P A;  3QO3 A;  2R57 A;  3VS0 A;  4LE9 A;  2PUK B;  2LJ1 A;  1MMN A;  2H3E B;  3TUP A;  5GAN h;  3LGL A;  3JV3 A;  1CSK A;  2QGG A;  3HP9 A;  4E7H A;  5GMK l;  3NHN A;  2VB6 A;  5CK9 A;  1SSH A;  3NGP A;  3VJP A;  2IG0 A;  4E7I A;  2MI6 A;  2OJ2 A;  3MEY A;  1IHV A;  2KGT A;  3HXX A;  3A32 A;  1I0C A;  4L87 A;  1KHC A;  4C0D C;  4LVL A;  1NPP A;  4OGC A;  2VC8 A;  2MCN A;  4H2W A;  3QDR B;  1VQZ A;  2JXB A;  1NYR A;  2K6D A;  2HBP A;  3OD1 A;  2RJD A;  4K88 A;  2LTO A;  3M0P A;  2RJF A;  4HXJ A;  3EGU A;  1OU8 A;  1B34 B;  1KC8 R;  3NEN A;  2EQK A;  2YRC A;  3CPF A;  4YYE A;  2PZ1 A;  3WXM B;  4D8K A;  2ZR3 A;  3X25 B;  1YB3 A;  3CC7 Q;  1KC8 C;  2D9T A;  3HFV A;  1B7T A;  2DFU A;  1IRE B;  5LJ3 j;  4BE1 A;  2F69 A;  3JB9 H;  1VQL A;  2JMA A;  3SWN C;  1G8X A;  4M7D F;  3M53 A;  2XGT A;  1MMA A;  5LJ5 h;  3EGX A;  1EVL A;  4A4E A;  1PRM C;  1XTD A;  1N9S A;  2QG9 B;  4KBM B;  2XDP A;  3R6O A;  5GAN f;  1WXB A;  3P8D A;  4E47 A;  1PSF A;  4PJJ A;  4M77 F;  2CS7 A;  4PJO G;  3RDV A;  2MPX C;  1WA7 A;  3LSQ A;  3OYN A;  1LYL A;  3QTC A;  3VYH B;  1X55 A;  4M7A G;  4HCC A;  3G6E A;  2BIV A;  1YIT Q;  1F1B B;  2FZC B;  2KSS A;  4CS3 A;  3EFO A;  3P8T A;  2JOY A;  1OX9 A;  5IHI A;  2X9H A;  3JCM Q;  4ZGE B;  4J83 A;  1VQN A;  4HVU A;  1KMM A;  2D8H A;  1YWO A;  2JN0 A;  5IH2 A;  2L5Q A;  1B70 B;  4NL2 A;  3EGD B;  2GBQ A;  1VQ9 T;  1VQK T;  1VQ6 Q;  1MUZ A;  2FZK B;  3CBO A;  1H3Z A;  2O4X B;  4OMF B;  1GFC A;  1QKW A;  3UDC A;  3CMA T;  5M9O A;  2ROT A;  2MYS A;  5I21 A;  2F2X A;  3VBB A;  1K8A R;  3G6E T;  1SRY A;  1ZA2 B;  4C92 B;  3OW2 P;  3QHS A;  2FRW A;  4C92 D;  4CH4 A;  3VYG A;  1M2V A;  2JT4 A;  4TVR A;  2L3R A;  2HDA A;  4KR2 A;  1K0S A;  5LJ5 f;  2K2M A;  4LDV A;  5J39 A;  5HKC A;  1K8A C;  3TCJ A;  3FC3 A;  1BI3 A;  2PTK A;  1SEM A;  4R0K A;  4P72 C;  4N0A A;  4FCY A;  1TXQ A;  1TG0 A;  3VUZ A;  1RLP C;  4PJO E;  2RHS A;  5KYW B;  1E22 A;  2K5F A;  2KBT A;  2RK2 A;  4LXC A;  2AIR B;  4M78 B;  4M7A E;  2W0Z A;  1VQP T;  2O31 A;  1M30 A;  2YHT A;  2PNI A;  2ROL A;  1NEB A;  3V8K A;  2ED1 A;  4AMC A;  4D6W A;  5HK0 A;  4YRQ A;  2A08 A;  3OYF A;  1UJY A;  1JQQ A;  1MNE A;  3OYJ A;  1UEB A;  3UA6 A;  3QKJ A;  4FW1 A;  3OMG A;  3H41 A;  2GTO A;  4Q15 A;  2ODR D;  2MWP A;  4Z88 A;  2OTL Q;  2NUZ A;  1OYX A;  4AFQ C;  2EWN A;  3TSZ A;  2DX1 A;  2ED0 A;  1ZSZ B;  3G71 Q;  2JW4 A;  5GAM h;  3OA6 A;  3EG2 A;  3HRS A;  4LVJ A;  3HY1 A;  4RCB A;  4WTO B;  4M7D G;  1QVF P;  3CCR T;  3VKI A;  1LPL A;  1UDL A;  1MV3 A;  2E3C A;  2LC4 A;  3I56 Q;  4HA8 A;  4P71 C;  1D0Z A;  1FX7 A;  2EQM A;  2DZC A;  2EJF A;  2EJG A;  4H2U A;  4CC2 A;  4C0G A;  2ARU A;  2G4C A;  3REA B;  2ART A;  2HSE B;  1SF9 A;  2LQN A;  3C12 A;  1RI0 A;  2ZT8 A;  2Q7H A;  1OI1 A;  2K7A A;  1TUG B;  5FWB A;  4E6R A;  4LD9 K;  3HXV A;  4L6V 5;  1UGR B;  2LMJ A;  4YRE A;  4RDX A;  2YXY A;  3FLG A;  4A4H A;  1LOJ A;  5DY9 A;  3L2R A;  2MAM A;  2CDT A;  1JJ2 P;  4KUI A;  2BKD N;  4M7D C;  5KE2 A;  5FU7 B;  4OMP A;  2I2L A;  3JCM g;  4K87 A;  2ZZG A;  4E7L A;  1IGU A;  4EMK A;  4RUG A;  2DQ0 A;  4YRN A;  5GMK i;  3G7Z A;  1YJ9 T;  2KYB A;  2RI2 A;  3QPH A;  5LL6 S;  2V1R A;  5GAM f;  3SWN B;  5AYF A;  1XJW B;  2FEI A;  2AK5 A;  2ZZD A;  3OYY A;  3CXC P;  1HXD A;  2LT4 A;  2KR3 A;  5KYU A;  4FT2 A;  1RIQ A;  3EH2 A;  3RMS A;  3CC2 A;  1D09 B;  2RQW A;  3E9F A;  2JM9 A;  3PE0 A;  2X4X A;  1W2B P;  1FMV A;  5KYX B;  1EVK A;  1MGQ A;  3A7R A;  3ER0 A;  2DKG A;  1K9M R;  2QTX A;  4YP0 A;  4M77 E;  2LJ0 A;  2GCX A;  2CGH A;  4GLM A;  4LDW A;  1H4V B;  2DNU A;  4B9W A;  3CCQ Q;  3URG A;  5ELO A;  1YI2 T;  1YGB A;  3M54 A;  2HKQ B;  2HL5 C;  1VQ7 A;  4RCC A;  1M90 C;  1R0B G;  1KD1 U;  4H2V A;  3REX A;  2L3S A;  3RGL A;  3ERR A;  4ZTZ B;  4P75 C;  4YRL A;  2YSQ A;  3PVQ A;  3MPU B;  2M02 A;  1VQ8 T;  5KYY A;  1ATI A;  3SFM A;  4EMG A;  2DD5 A;  2JVV A;  5HY6 A;  4Q5W A;  3A74 A;  2Y90 A;  4PJO D;  2YLC A;  4EIK A;  3FDR A;  2L3P A;  2DET A;  1BIB A;  1SG5 A;  2YUN A;  2NUP B;  4PHC A;  5GAN 5;  4M7A D;  5GAN 6;  3EG3 A;  4R55 A;  3S3O A;  3G4S A;  1AWO A;  2EGC A;  3QSU A;  3OSV A;  4OP0 A;  1VQ5 A;  3CCV A;  5LJ3 e;  2QXF A;  3CCM T;  2ZAE A;  2IY5 A;  3WVE B;  2HEQ A;  2JUF A;  1R77 A;  2DIQ A;  3CCE A;  1H4T A;  1Q95 G;  3LH5 A;  1PYS B;  1U06 A;  1R0C B;  4HWP A;  2Q7E A;  2AKK A;  3OS2 A;  1M90 U;  3M57 A;  1YHQ Q;  2OTJ Q;  4HT9 A;  4M78 F;  3OY9 A;  5KH6 A;  3A8L B;  4BB7 A;  1PD1 A;  2LCL A;  1PNJ A;  1WFW A;  1N6A A;  2AMC B;  1NJI C;  4P3P A;  1BB9 A;  5I2M A;  1TUC A;  3EG9 A;  3CME A;  2EGA A;  3VU3 C;  4ZN3 A;  4EX5 A;  4FW2 A;  1TU0 B;  3P8V A;  4GLK A;  3QUI A;  1GBR A;  1AZG B;  1VQ4 Q;  4C8Q C;  3RAC A;  4Y28 E;  3H0H A;  2I0N A;  3OW2 S;  4C8Q A;  4IKF A;  2M0Y A;  4YRK A;  1ZBX A;  3JSC A;  2DL7 A;  4DBF A;  2BE7 D;  2P0Q A;  4HCB A;  4HCK A; 
#chains in the Genus database with same CATH homology
 2VGM A;  2KQW A;  1E24 A;  5FRM A;  3HY0 A;  3HPW A;  2QQB A;  3CCJ A;  3PNW C;  1EQR A;  1YJN T;  2RHZ A;  2QEX A;  2EIF A;  3DLL A;  4ELY C;  1RL2 A;  2KAF A;  3H6Z A;  3NEM A;  2ZPE B;  3GLX A;  1NJI U;  3JB9 F;  3J7A F;  1XOV A;  4ZTU B;  4YRO A;  4HVC A;  1NJ1 A;  4BWA A;  2K4Y A;  3H8Z A;  4BDZ A;  3CCL T;  4TQF A;  3I55 A;  4QQD A;  3A31 A;  3M55 A;  2EQU A;  4M7D B;  4M7D D;  2K3X A;  1QVF S;  1I81 A;  1G3S A;  2Q7G A;  2KK4 A;  3PMI A;  2ZPI B;  4OB2 B;  1VQO T;  5CIU A;  4M77 D;  4KUD K;  4DPG A;  3OYL A;  3PGG A;  1USY A;  2M1H A;  2AHJ B;  1G5I A;  2V8I A;  4TVA A;  1N27 A;  2ALY A;  2QHV A;  3CC4 T;  3ZFJ A;  4CS4 A;  3MEV A;  4JJN K;  1WJS A;  3MEU A;  2VV5 A;  4J7I A;  1JJ2 S;  2DPP B;  1M5Q 1;  3OYC A;  4N4H A;  1VQM T;  4ZGJ B;  4BUG A;  4XTW A;  2QQA A;  2PQW A;  2RD1 A;  4X34 A;  3MO8 A;  3UWN A;  5GMK h;  2KDS A;  2ZT7 A;  4F7U G;  4JRK A;  2WAC A;  4HWO A;  3FEO A;  3IKM B;  1EIY A;  2PVG B;  3GP8 A;  3M4P A;  3CXC S;  1BI2 A;  3JCM J;  2QHU A;  2CJA A;  1KG1 A;  3TEH B;  2CZ6 B;  3A8O B;  2F5K A;  2LQ8 A;  1W2B S;  5C51 B;  2DXT A;  3QJY A;  5A0D A;  4C92 E;  1GGM A;  1X6O A;  4YCW A;  5J26 A;  3KBG A;  4YRP A;  4BD3 A;  2L89 A;  2EQJ A;  4FIB A;  1YFT A;  3JB9 G;  4YRJ A;  1E1O A;  1Y96 B;  1ZHI A;  5CQX A;  3HXU A;  3QZ5 B;  1FYF A;  3DKM A;  4M78 E;  5EG2 A;  3CC7 T;  3CMQ A;  2CZ7 B;  3V7C A;  4RMO A;  4KQE A;  3N5B B;  3QBY A;  1N9W A;  4JLG A;  4J7F A;  4O2D A;  2RHQ B;  4YRG A;  4OGE A;  2C8M A;  3SB2 A;  4C0F A;  2B8A A;  1Q82 U;  3RKY A;  3BW1 A;  1R8O B;  3PCO A;  4M75 C;  1SSF A;  1BBW A;  4M75 A;  2PVO B;  4FT4 A;  3GF5 A;  4CH6 A;  4YRR A;  2I4O A;  3W3S A;  3VQV A;  2HAX A;  1HTT A;  3QG1 A;  3OS1 A;  3X28 B;  2EFI A;  3HFN A;  2M0O A;  3JCM P;  1VQ6 T;  5GAN d;  4E7J A;  2J3L A;  1OZ3 A;  3GOX A;  4ZTF A;  1NJ5 A;  5D6X A;  2J3M A;  3L2V A;  5GMK e;  4EO4 A;  1Q86 C;  3TEE A;  3NFC A;  1VQ9 A;  1VQK A;  4L5G A;  4XTZ A;  4LVI A;  4CH5 A;  1D3B A;  3JCM d;  1O9S A;  1NZ9 A;  2F5T X;  1ADJ A;  3CMA A;  4CS2 A;  2DTI A;  2Y4X A;  4PNO A;  3HFZ B;  4AH6 A;  2DU5 A;  1WQW A;  1WQ7 A;  1B7Y A;  1M1K U;  5GAO q;  4JRP A;  3BY7 A;  3UGT A;  3LSS A;  1Q86 U;  3F70 A;  5LJ5 d;  2FB7 A;  3IG2 A;  3GPL A;  2OTL T;  3CCU T;  3OBY A;  1VQP A;  1B8A A;  1JRI A;  1P92 A;  2JNG A;  5CKH A;  3G71 T;  4A53 A;  5FU6 C;  3JCM V;  4OB0 B;  3ZBD A;  1NYQ A;  3WQZ A;  3BDU A;  1U8R A;  4RMF A;  3I56 T;  1K73 C;  5CVI A;  1QVF A;  4C5E A;  1QP3 A;  4N0A C;  3VQW A;  2E64 A;  3PT9 A;  3UT1 A;  4PJO A;  1WYD A;  4M7A A;  1DJ7 B;  1W66 A;  4ZIB A;  2DAQ A;  4X5O A;  1VUB A;  4M78 D;  3CCR A;  5DM7 R;  4IUV A;  3X20 B;  2XDB A;  2NS6 A;  3L2U A;  4JUV A;  3M9Q A;  4F7U B;  4QVC A;  3NTH A;  4BI3 A;  1JJ2 A;  3OYD A;  1YBY A;  3CBP A;  4ELZ C;  2ZIN A;  4OB1 B;  1K73 U;  1X01 A;  1M4Z A;  2CIM A;  1G3W A;  3MEA A;  3T9N A;  2WSE E;  4C8Q F;  5LJ3 h;  1ASZ A;  2ZZE A;  3C95 A;  1QVG S;  1EIF A;  4Z02 A;  4E7K A;  3OS5 A;  3CXC A;  1EOV A;  1NJ8 A;  1Q81 C;  1YJ9 A;  1QW1 A;  5GAN g;  3JB9 D;  2I4M A;  1W2B A;  3OB9 A;  1ASY A;  1MHN A;  5DLO A;  5CO7 A;  4IUU A;  5A2Q E;  3QZ9 B;  2ZXF A;  3CCQ T;  2XTI A;  2E6Z A;  4C0D B;  5GAO m;  1Y7X A;  2RJC A;  1BBU A;  3TEG A;  5GAM d;  2LCC A;  3LGF A;  2ZGW A;  3E1S A;  2MF2 A;  2RB6 A;  4EMK C;  5HGQ A;  5KNN A;  2AKW A;  2BUD A;  3A7A A;  3JCM b;  1JJC A;  4BAC A;  3QO8 A;  3M58 A;  1KD1 C;  4XQ3 A;  5CKD A;  1YI2 A;  2K2V A;  2E41 A;  3HFO A;  4XTV A;  2ZPB B;  1Q81 U;  3EAE A;  1L0W A;  5E3I A;  1WU7 A;  3E9I A;  3X26 B;  1X2H A;  2FYK A;  5LJ3 f;  4M7D E;  2ZPF B;  3CBM A;  4JLI A;  4LD6 A;  3A5Z A;  1VQ8 A;  5LJ5 g;  4M77 A;  5GAN 4;  5C6S A;  1YHQ T;  1BI1 A;  2PMF A;  3S6W A;  3OYM A;  4DOV A;  2OTJ T;  4IUP A;  3CCM A;  4DOW A;  4H2X A;  4XK8 E;  1KMN A;  1HC7 A;  1VQ4 T;  4LVM A;  4JDS A;  5IAY A;  4XAX B;  5FLX E;  2WSF E;  2JTM A;  3JCM W;  2LDM A;  4CH3 A;  5IT9 E;  5FU6 B;  2WSC E;  4YRC A;  4C8Q G;  4ATO A;  1LNX A;  4FU6 A;  1BI0 A;  2V8J A;  1KHI A;  2M9U A;  3RIR A;  3M4Q A;  1JBM A;  3MP1 A;  3MET A;  3QXE B;  3TRE A;  3ICA A;  2O01 E;  3CPW S;  3JRZ A;  2XKO C;  3DLM A;  3CEY A;  2RHS B;  2DXB A;  1YJN A;  2QHS A;  3MF1 A;  4N4I A;  4NCX A;  1NNH A;  4OF1 A;  1C0A A;  3L2Z A;  3QO7 A;  2RA2 A;  4GY5 A;  1UGS B;  1H4Q A;  4KR3 A;  2DVE A;  2QQR A;  5L8R E;  4DA4 A;  4F7U F;  3QII A;  4PLL A;  5CKF A;  2QA4 T;  1Y96 A;  3ZEH A;  3PTA A;  1BYM A;  1YJW T;  4HWT A;  3CCL A;  4H02 A;  2QQ9 A;  4XEO A;  4P5N A;  1G5V A;  4XU0 A;  4JRQ A;  3LYI A;  5GAM g;  4OB3 B;  4PKC C;  2R5M A;  1KQS S;  1PSE A;  4P74 A;  4C8Q E;  3C94 A;  4M75 F;  2JZ2 A;  3OMC A;  5GMK m;  1VQO A;  4LDU A;  4HWR A;  5IN1 A;  2DTO A;  4N4G A;  4OLF A;  3HXZ A;  4L59 A;  2FVU A;  4UP8 A;  4YRI A;  2XDD A;  2DDZ A;  4UP9 A;  3UFG A;  3CC4 A;  3LLR A;  2ZCE A;  1N8R C;  4OVA A;  4XEM A;  2ZIO A;  3P8Y A;  2VGN A;  1B34 A;  5C52 B;  2HQX A;  1OZ2 A;  4YRM A;  3RUX A;  4A4F A;  3L2Q A;  3UH0 A;  1V29 B;  1VQM A;  3IKL A;  3CD6 T;  4ZGD B;  4MDW A;  4ZTJ A;  4QQG A;  1ZQ1 A;  3EFS A;  1VIE A;  4BE0 A;  1Z7M A;  4TTV A;  2L8D A;  3HRK A;  2E65 A;  1USY C;  2RJE A;  3HRI A;  5GAN j;  2ZPH B;  3KXT A;  2E70 A;  2PUO B;  3LW5 E;  2XIC A;  3QJ6 A;  1QVG A;  1M1G A;  2MWO A;  2M16 A;  4XU3 A;  1X56 A;  3V7R A;  1TH7 A;  4NOY A;  1N8R U;  1X54 A;  2LX9 A;  5FRN A;  3A8H B;  1Q7Y U;  4ME7 A;  3RES A;  4BDY A;  3J81 E;  4NL3 A;  4II1 A;  1E1T A;  2DJZ A;  3NET A;  4RQE A;  1I5L A;  1M9S A;  5FRO A;  4CI0 C;  1B70 A;  2OAU A;  2I4L A;  2CJB A;  2XI9 A;  2LRQ A;  2O4X A;  2R58 A;  1S72 T;  4V2S A;  3CC7 A;  1M1F A;  2RHX A;  5LJ5 j;  4FSX A;  1UB4 A;  4QW2 A;  1Q82 C;  4C92 A;  2LNV A;  4P73 C;  5F5W A;  1SES A;  2IY5 B;  11AS A;  4P73 A;  3SD4 A;  4M75 G;  3SDZ A;  3CCS T;  2RO0 A;  3E9H A;  1QF6 A;  1WPY A;  3S3M A;  3VQX A;  4M78 A;  3JCM c;  4Y91 A;  2RH2 A;  4HT4 A;  2EAY A;  4DQ2 A;  1WLE A;  3JB9 J;  3LH0 A;  4WJ4 A;  2E1H A;  4TVW A;  4C8Q B;  4MMK A;  4C8Q D;  4F7U E;  2P0L A;  3IAL A;  2ARS A;  4LDY A;  1VQ6 A;  2Q5H A;  1QP2 A;  1NJ2 A;  4WI1 A;  3OYA A;  1YIT T;  3P8H A;  3JCM X;  4IUT A;  2RI5 A;  4C5H A;  1JB0 E;  2ZZF A;  5GAO p;  3S3N A;  1FWZ A;  4RKU E;  4HCZ A;  3O8V A;  3JB9 I;  1XQH A;  4XTY A;  3ASK A;  4M75 E;  3CPW A;  4QVD A;  3VUB A;  3LC0 A;  4QVZ A;  5D6W A;  1I4K 1;  4LVK A;  2XU8 A;  1YIJ T;  2QI2 A;  3MEW A;  2ZIM A;  1ADY A;  3A8G B;  1O75 A;  3JCM h;  1M1K C;  2CZ0 B;  1U1S A;  2XG8 D;  5FU7 C;  2EKO A;  1AHJ B;  2QDY B;  3L4G B;  3KUF A;  3V8L A;  3OW2 A;  5GAM j;  2ZNJ A;  2Y4Y A;  4R56 A;  2E12 A;  1G5H A;  4H2T A;  2OTL A;  3CCU A;  2K57 A;  4BY6 C;  5DLQ E;  5A0L A;  5I2S A;  3G71 A;  3OQ5 A;  2HQE A;  2RHU A;  3SWN A;  4TVA B;  1WJQ A;  4BI4 A;  2ALY B;  2K5I A;  4XU1 A;  2GFU A;  5GAO n;  3I56 A;  4P3N A;  1KQS A;  4IUQ A;  3RKW A;  5J3B A;  2IVW A;  2PME A;  1HK9 A;  2K5L A;  2C7I A;  4NS5 A;  5C53 B;  5CKE A;  4A54 A;  1LJO A;  3L2W A;  4VUB A;  1VQL T;  3JCM f;  1KC8 U;  3KFU A;  3OYG A;  2QQS A;  1EIY B;  2EJ9 A;  1YFS A;  3PFS A;  2A8E A;  5K1P A;  3HRT A;  4PJO C;  3OSS C;  2DIG A;  3A8M B;  4H2S A;  1H4S A;  3HSB A;  4M7A C;  5GAN 8;  4YCU A;  3PZC A;  3OYK A;  4B9X A;  4J6W A;  5GAN e;  1VQN T;  2E5Q A;  2JTF A;  4JRI A;  12AS A;  3PIO A;  2C06 A;  3DSQ A;  1PYS A;  3AHU A;  4P72 A;  2PVD B;  3J80 E;  2X4Y A;  4K86 A;  3CCQ A;  3E19 A;  2AMC A;  4O6J A;  2XD0 A;  4HWS A;  1BIA A;  1N9R A;  3JCM e;  5GAN 3;  3LX7 A;  2X4J A;  1YFR A;  4MZM A;  1Y07 A;  2GF7 A;  2KVQ G;  3PCO B;  4RG2 A;  3L42 A;  4M75 B;  3RKX A;  1K8A U;  4J8O A;  4M75 D;  3DB4 A;  2ZPG B;  3MHX A;  3OBW A;  3RER A;  3MF2 A;  2DO3 A;  4MML A;  3E9G A;  2RK1 A;  1QVP A;  2DK3 A;  5LJ5 e;  4MDX A;  4PG3 A;  4P71 A;  4PLI A;  5CAI A;  4M77 G;  2VUB A;  1WGS A;  2YLB A;  4YCV A;  3ME9 A;  1YHQ A;  3VV0 A;  3OYH A;  5LJ3 d;  2OTJ A;  2VXE A;  1IL2 A;  2GFA A;  4J5Y A;  3GNF B;  1G3T A;  4JS5 A;  4XTX A;  1IZ6 A;  4BW9 A;  1U1T A;  4TWA A;  3NEL A;  3FRN A;  3G1Z A;  5KCO A;  1UGP B;  4M7D A;  2K3Y A;  1VQ4 A;  2DTH A;  3PIP A;  4XTU A;  1XNI A;  2XID A;  4M77 C;  1D3B B;  3HL8 A;  4BE2 A;  4BY6 B;  2LVM A;  2R5A A;  1NPR A;  3HKS A;  3HXY A;  4FL6 A;  2QHT A;  4EPC A;  2HD0 A;  5HK3 A;  3L1A A;  4X9D A;  1B7Y B;  2EYQ A;  3INZ A;  2CJ9 A;  2KY9 A;  3FIF A;  1FXX A;  1G3Y A;  3MP8 A;  1GXI E;  4EDU A;  4A4G A;  5KCH A;  4TQD A;  3M59 A;  1K9M C;  5D6Y A;  2ZT6 A;  4MZT A;  2E5A A;  4HKE A;  1SER A;  2P4T A;  2D6F A;  2QA4 A;  4QQ6 A;  4P75 A;  3CC2 T;  1X75 C;  3Q1J A;  3FJP A;  2FHD A;  2I4N A;  2EL9 A;  1NE8 A;  5CKB A;  2ZCF B;  4PJO B;  1YJW A;  3TEH A;  3NTI A;  4TVY A;  1Z7N A;  5GAN 7;  5GAM e;  4C5I A;  3HTZ A;  4M7A B;  4C92 F;  1BKB A;  1WNL A;  3PMT A;  4G85 A;  3RF1 A;  3QYH B;  2LT1 A;  3QYG B;  3QNE A;  1VQ7 T;  1K9M U;  2CZ1 B;  4WJ3 M;  2PU9 B;  1X2G A;  4YTL A;  4RQF A;  3RMQ A;  3HXW A;  3UGQ A;  4FM4 B;  3OYB A;  3A7U A;  3MQZ A;  2P0K A;  5GMK j;  4P3O A;  3LWH A;  2DZ9 A;  4EMH A;  2VXF A;  3VQY A;  2HNI A;  2DU7 A;  5GAO r;  3MP6 A;  5CQY A;  2RHI A;  3G4S T;  2RHQ A;  2X4W A;  1VQ5 T;  3CCV T;  4P74 C;  3NTK A;  4X9C A;  4YRF A;  3M4Y A;  3CCE T;  5LJ3 g;  4BI8 B;  3CD6 A;  2NLU A;  4J15 A;  2G3R A;  3REU A;  2D0Q B;  5CCA A;  2DXU A;  5GAO l;  2A3L A;  4MZP A;  3C4S A;  4IUR A;  3CME T;  1QE0 A;  4Q6G A;  3RL6 A;  5CR2 A;  3GNG A;  2ZT5 A;  3BDL A;  2RHY A;  3M5A A;  1KQ1 A;  2AKW B;  1Q7Y C;  4O5V A;  1JJC B;  3WVD B;  4EMK B;  4UC4 A;  2ZR2 A;  4YPF A;  3P8B B;  2DD4 A;  1Y71 A;  2MMP A;  2CKK A;  3TU4 K;  4C0Z A;  3M4G A;  4J6Y A;  3CCJ T;  2RM4 A;  3V7S A;  2QEX T;  1YCY A;  2X35 A;  1G51 A;  4LDX A;  3I7F A;  5KE3 A;  4CRI A;  3UPU A;  3A5Z B;  3L4G A;  3FB9 A;  4UP7 A;  4KUL A;  3JAM E;  3EFR A;  4YRT A;  2XK0 A;  4HT8 A;  2V8K A;  4M77 B;  1H64 1;  2RI3 A;  4E51 A;  4C5G A;  3DB3 A;  1S72 A;  2ZTG A;  5ELN A;  4C92 G;  4YDQ A;  3OS0 A;  3HFZ A;  2GQV A;  3I55 T;  2DQ3 A;  4XU2 A;  4H2X B;  3HRU A;  4G84 A;  1UGQ B;  3GIB A;  1WJR A;  3HHT B;  3LWI A;  1KQ2 A;  3CCS A;  5K1X A;  1B76 A;  4KT0 E;  2A7Y A;  1KOG A;  4M78 G;  2LQK A;  4A4K A;  2KMT A;  5A0G A;  3OYI A;  2H3J A;  3A5Y A;  2Q5I A;  4C92 C;  3BJU A;  1NJ6 A;  4PL6 A;  1I8F A;  4UPA A;  3M56 A;  3BFM A;  1VIF A;  4PJO F;  4H2Y A;  4M7A F;  4M78 C;  2CYZ B;  3X24 B;  3R07 A;  4LNS A;  2E10 A;  2P5I A;  1YIT A;  4J6X A;  2YRV A;  4RG8 A;  4ZN1 A;  3MCA B;  1J5W A;  3V8J A;  2DEQ A;  2E6N A;  1SET A;  4WF2 A;  4F7U A;  2ODR C;  2FL7 A;  1EFW A;  2DXC A;  1M8V A;  4YRS A;  2XHC A;  3QO5 A;  1YIJ A;  2ZNI A;  1W4S A;  5GAN 2;  2VYT A;  4JS4 A;  5C0M A;  3OYE A;  2P0P A;  3QO3 A;  2R57 A;  2PUK B;  3TUP A;  5GAN h;  3LGL A;  3HP9 A;  4E7H A;  5GMK l;  5CK9 A;  3VJP A;  2IG0 A;  4E7I A;  2MI6 A;  3MEY A;  3HXX A;  3A32 A;  4L87 A;  1KHC A;  4C0D C;  4LVL A;  1NPP A;  4OGC A;  2VC8 A;  4H2W A;  3QDR B;  1VQZ A;  1NYR A;  2HBP A;  3OD1 A;  2RJD A;  4K88 A;  2LTO A;  2RJF A;  1B34 B;  3NEN A;  2EQK A;  3CPF A;  4YYE A;  3WXM B;  2ZR3 A;  3X25 B;  1YB3 A;  1KC8 C;  2D9T A;  3HFV A;  1IRE B;  5LJ3 j;  4BE1 A;  2F69 A;  3JB9 H;  1VQL A;  3SWN C;  4M7D F;  3M53 A;  2XGT A;  5LJ5 h;  1EVL A;  4A4E A;  1XTD A;  1N9S A;  4KBM B;  2XDP A;  3R6O A;  5GAN f;  3P8D A;  4E47 A;  1PSF A;  4M77 F;  2CS7 A;  4PJO G;  3LSQ A;  3OYN A;  1LYL A;  3QTC A;  3VYH B;  1X55 A;  4M7A G;  4HCC A;  3G6E A;  2BIV A;  2KSS A;  4CS3 A;  3P8T A;  2JOY A;  3JCM Q;  4ZGE B;  4J83 A;  1VQN A;  1KMM A;  2JN0 A;  2L5Q A;  1B70 B;  4NL2 A;  1VQ9 T;  1VQK T;  3CBO A;  1H3Z A;  2O4X B;  4OMF B;  3UDC A;  3CMA T;  5M9O A;  5I21 A;  3VBB A;  3G6E T;  1SRY A;  4C92 B;  3QHS A;  4C92 D;  4CH4 A;  3VYG A;  4TVR A;  2L3R A;  4KR2 A;  5LJ5 f;  4LDV A;  5J39 A;  5HKC A;  1K8A C;  3TCJ A;  3FC3 A;  1BI3 A;  4P72 C;  4N0A A;  3VUZ A;  4PJO E;  2RHS A;  1E22 A;  2K5F A;  2RK2 A;  4M78 B;  4M7A E;  1VQP T;  2YHT A;  3V8K A;  4YRQ A;  4D6W A;  5HK0 A;  3OYF A;  3OYJ A;  1UEB A;  3QKJ A;  3OMG A;  4Q15 A;  2ODR D;  2MWP A;  1OYX A;  2EWN A;  3OA6 A;  5GAM h;  3HRS A;  4LVJ A;  3HY1 A;  4RCB A;  4M7D G;  3CCR T;  3VKI A;  2E3C A;  2LC4 A;  4P71 C;  4HA8 A;  1FX7 A;  2EQM A;  2DZC A;  2EJF A;  2EJG A;  4H2U A;  4C0G A;  2ARU A;  2G4C A;  2ART A;  3C12 A;  1RI0 A;  2ZT8 A;  2Q7H A;  1OI1 A;  4LD9 K;  3HXV A;  4L6V 5;  1UGR B;  4YRE A;  4RDX A;  3FLG A;  4A4H A;  1LOJ A;  5DY9 A;  3L2R A;  2MAM A;  4KUI A;  2BKD N;  4M7D C;  5KE2 A;  5FU7 B;  2I2L A;  3JCM g;  4K87 A;  2ZZG A;  4E7L A;  4EMK A;  4YRN A;  2DQ0 A;  5GMK i;  3G7Z A;  1YJ9 T;  2RI2 A;  3QPH A;  5LL6 S;  5GAM f;  3SWN B;  5AYF A;  2ZZD A;  3OYY A;  1HXD A;  2LT4 A;  4FT2 A;  1RIQ A;  3RMS A;  3CC2 A;  3E9F A;  2X4X A;  1EVK A;  1MGQ A;  3A7R A;  3ER0 A;  2DKG A;  2QTX A;  4YP0 A;  4M77 E;  2GCX A;  2CGH A;  4LDW A;  1H4V B;  4B9W A;  3URG A;  5ELO A;  1YI2 T;  1YGB A;  3M54 A;  1VQ7 A;  4RCC A;  1M90 C;  1KD1 U;  4H2V A;  3REX A;  3RGL A;  3ERR A;  4ZTZ B;  4P75 C;  4YRL A;  1VQ8 T;  1ATI A;  3SFM A;  4EMG A;  2DD5 A;  2JVV A;  5HY6 A;  4Q5W A;  3A74 A;  2Y90 A;  4PJO D;  2YLC A;  3FDR A;  1BIB A;  4PHC A;  5GAN 5;  4M7A D;  5GAN 6;  4R55 A;  3S3O A;  3G4S A;  3QSU A;  3OSV A;  4OP0 A;  1VQ5 A;  3CCV A;  5LJ3 e;  2QXF A;  3CCM T;  2IY5 A;  3WVE B;  2JUF A;  2DIQ A;  3CCE A;  1H4T A;  1PYS B;  4HWP A;  2Q7E A;  3OS2 A;  1M90 U;  3M57 A;  4HT9 A;  4M78 F;  3OY9 A;  5KH6 A;  3A8L B;  4BB7 A;  2LCL A;  1N6A A;  2AMC B;  1NJI C;  4P3P A;  5I2M A;  3CME A;  3VU3 C;  4ZN3 A;  4EX5 A;  3P8V A;  4GLK A;  3QUI A;  4C8Q C;  3RAC A;  4Y28 E;  3OW2 S;  4C8Q A;  4IKF A;  4YRK A;  1ZBX A;  3JSC A;  2P0Q A;  4HCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...