2HNIA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, k111a mutation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
230
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 67
structure length 230
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2hniA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2hniA01
4P71C 1L0WA 2XGTA 2DTHA 3VBBA 1PYSA 4M7DC 4H2YA 2ZGWA 2ZCEA 1D3BA 4RQFA 4XTZA 1Y96B 4KQEA 1NJ1A 4N0AC 2I4NA 3TEHB 2I4OA 3JCMe 2Y90A 1U1TA 4J6XA 3QSUA 2DKGA 1N9RA 3NETA 4HWOA 4XU3A 4WJ4A 1B8AA 2J3LA 3RKWA 4CS4A 2DXUA 1M8VA 3HRKA 1BBWA 4H2TA 3QNEA 2DTOA 3VQWA 3QO8A 1KQ1A 4M77G 3QO5A 4UP7A 3EFSA 4C92F 4EX5A 4M75F 2Q5HA 3V8LA 5GAOq 2QHUA 1LJOA 5GANj 3IKLA 4H2XB 3WQZA 3PCOB 1Y96A 2ZIMA 5GMKe 4J15A 3UGQA 3G1ZA 5GAN4 5GAMj 1B7YA 3A32A 4RCCA 4P71A 2IY5A 3V7RA 3FJPA 2DZ9A 4M7DA 3PGGA 2ZZFA 4C92E 1X2HA 2G4CA 1LNXA 4PHCA 1TH7A 5C51B 3ICAA 2E1HA 4N0AA 4C92B 4YRTA 4M75E 1EVKA 2PMEA 5GMKi 4EO4A 4E51A 1NJ5A 4PJOE 1X2GA 4M75B 1G51A 1YFSA 2ZT5A 1X01A 4P75A 1IL2A 4PJOB 5LJ5d 1B70B 2AKWA 3CMQA 1LYLA 4NL2A 4NOYA 4V2SA 4C92G 3GIBA 4H2XA 4C8QD 3M4GA 3HXVA 5ELNA 4M75G 4H2SA 4J6YA 5LJ5g 1HC7A 1YB3A 3A74A 2RB6A 5LJ3e 4P3OA 3RF1A 3HXWA 3RUXA 1JBMA 2P0LA 3AHUA 2ARTA 1NYRA 4F7UF 4M78D 3ERRA 4YRPA 2ZT8A 3E9IA 4Y91A 4ZTUB 3LSSA 1QF6A 1ADJA 2ZR3A 2ALYB 3V7CA 4EMKC 4XU1A 11ASA 2P5IA 3FIFA 1EIYA 3L4GB 4PJOA 3HFZA 3JCMd 3JB9I 3JB9G 1H4QA 4OP0A 2FB7A 5GAOl 3NELA 1Z7NA 3LC0A 4UP9A 3JCMQ 4G84A 5C52B 1KQ2A 3JCMg 2PMFA 3IG2A 4F7UE 3VQVA 2DXTA 4C8QF 3P8TA 4F7UB 1B34B 4JRIA 4O2DA 2ZNJA 5GAOn 5GMKm 3QTCA 2ZINA 4CH5A 4M78F 4F7UG 5LJ5h 2ODRD 4YRJA 4YYEA 3JCMV 3QUIA 4YPFA 1YFRA 4OLFA 3TUPA 4PNOA 4M7AD 3JB9J 2DQ0A 4NL3A 4M77E 4P75C 3L2ZA 2DVEA 2CGHA 3BY7A 1X56A 4YP0A 4XTUA 3RKXA 4BW9A 5GAN5 4K88A 4M77B 4C8QE 3RL6A 2E5AA 2Q5IA 3TEGA 2AMCB 2CJAA 3JB9D 3V7SA 5F5WA 3REXA 2VXFA 4EMKA 3SWNB 5GAN8 4M78E 2DU5A 3RGLA 2ZZGA 4C8QG 5GANe 4L87A 1MGQA 5K1PA 2RA2A 1NJ8A 3PZCA 2Q7HA 1E1TA 3MF2A 4XTVA 4YCUA 1QE0A 3HFOA 4QVDA 3JCMh 3HTZA 5LJ5f 3BDUA 1C0AA 5GAOp 4C92C 5GAMe 4M78G 3TEHA 4TVWA 1JJCB 3M4QA 4YRNA 4M75C 1HTTA 3HSBA 4YRGA 3UGTA 2EL9A 4M77A 4PJOC 1YFTA 4DQ2A 4CH4A 4M7AF 2DEQA 1I4K1 2RM4A 3IALA 4K86A 4P72A 1KOGA 3L1AA 4DPGA 4UPAA 2AMCA 5CAIA 5I21A 3JCMb 5KNNA 5LJ3g 4YRLA 2RHQB 2E65A 2EJGA 2ZTGA 5GAN3 4P3PA 4QVCA 4AH6A 1NYQA 2DJZA 4RCBA 4JUVA 4WF2A 3JB9F 1J5WA 2YHTA 2RHSB 1E22A 4YCVA 1EVLA 4HVCA 4EMGA 5GMKh 1BBUA 3M4PA 3NENA 12ASA 3P8YA 3REUA 3PCOA 2EAYA 4TWAA 2RD1A 3JCMf 4CH6A 3QHSA 4CS3A 5GMKl 4M7AE 1I81A 5GAN7 1B76A 3HY1A 2YLBA 3RKYA 3JCMc 4M7AB 2E64A 1HK9A 3INZA 3VQXA 2ARUA 4XTWA 2YLCA 3OD1A 3P8VA 4XEOA 4XTYA 3UH0A 4EMHA 1ASYA 1H4VB 4M7AG 3A7RA 4C92A 4MMKA 3RERA 4K87A 1YCYA 3HFNA 4M7DD 4YDQA 4ZTZB 4NCXA 4M75A 1BIAA 2CIMA 1B70A 3QO7A 4PG3A 2ZT6A 4YREA 1N9WA 3HXUA 5ELOA 4WJ3M 3RESA 4YROA 4J6WA 3V8JA 3HRIA 1PYSB 4A53A 1LOJA 3QO3A 3A31A 1E24A 2QHVA 4M77C 2DU7A 4P72C 3DSQA 4TTVA 3UFGA 4C8QC 2ALYA 3A7AA 1RIQA 1KMMA 5LJ5j 3BJUA 3JB9H 4P74A 2VXEA 3SWNC 4YRMA 1SETA 3HXYA 5GANg 4CH3A 1H641 5GAMd 4A54A 3L4GA 5E3IA 1ASZA 4RMFA 1SESA 4M7DF 4M78C 3MF1A 2ZXFA 5LJ3f 4PJOD 5GAMg 1H4TA 2Q7EA 1G5HA 2CJ9A 4C8QB 5C53B 5K1XA 4Q6GA 1ATIA 4F7UA 2ZZEA 1B34A 4JLIA 2ZT7A 1N9SA 2Q7GA 4M78B 5HGQA 1FYFA 4HWRA 1EFWA 3A7UA 1USYA 1BIBA 4G85A 1B7YB 1SERA 4XU2A 4M7DE 2IY5B 4HT9A 4M7DB 3JCMW 4YRIA 1E1OA 1U1SA 4TQDA 5LJ3d 4P73C 4TQFA 4YRQA 3BW1A 1JRIA 5GAOm 3MEYA 2DZCA 1Z7MA 4TVYA 4XTXA 4CS2A 4C8QA 4M7DG 1NJ6A 4H2UA 2ODRC 2AKWB 2CJBA 2EWNA 4PJOF 3SWNA 3R07A 3VQYA 1H4SA 3JCMX 5GANh 2DTIA 4HA8A 3I7FA 4M7AC 2HNIA 4YRCA 4M78A 1WYDA 1G5IA 4HWTA 5GAMh 5GMKj 2J3MA 3KFUA 4XEMA 4HWPA 4TVAB 5DY9A 4X9CA 2ZIOA 4P74C 1JJCA 2VC8A 1NNHA 4X5OA 3JCMJ 3VU3C 2XTIA 1WQWA 2E10A 1EIYB 1NJ2A 1X55A 3EFRA 2RHQA 4H02A 2EJ9A 2E3CA 3FB9A 3HFZB 4M77D 4YRSA 4HT8A 2FYKA 3HY0A 2QHSA 2ZNIA 5GANf 4XU0A 4YRFA 2I4MA 3JCMP 2DDZA 1KMNA 2ARSA 4MMLA 2QTXA 2I4LA 3V8KA 2RHSA 3HXZA 2ZR2A 3LSQA 4PJOG 4P73A 1SRYA 2C7IA 3W3SA 3HFVA 4X9DA 5GAMf 4RDXA 4J5YA 4H2WA 1WNLA 4JRKA 4TVAA 5LJ3j 5LJ3h 1USYC 5GAN2 1X54A 1ADYA 2DQ3A 1WLEA 3RIRA 4KR2A 3E9HA 4KR3A 3HXXA 4M7AA 4YCWA 1YGBA 4H2VA 1W66A 1D3BB 1WU7A 4ZIBA 4UP8A 3NEMA 5LJ5e 1HXDA 3A5YA 5GANd 4HWSA 1M5Q1 2JN0A 3RACA 4YRRA 1I5LA 4BWAA 5GAN6 3IKMB 2QHTA 2EJFA 3BFMA 2I2LA 3SB2A 2C8MA 2E41A 4M77F 1I8FA 4Q15A 1WQ7A 1EQRA 4YRKA 4C92D 4RQEA 4XQ3A 4EMKB 1WPYA 5GAOr 4LNSA 2K57A 3A5ZA 4M75D 4P3NA 1VQZA 4WI1A 1GGMA 1EOVA
chains in the Genus database with same CATH superfamily
2XGTA 2DTHA 5CIUA 2RJFA 1H92A 3E19A 4H2YA 2ZGWA 4KUDK 3OYFA 1Y96B 1NJ1A 2AKLA 5KCOA 2I4NA 2HZYA 2JVVA 3TEHB 2RQVA 2Y90A 1U1TA 4J6XA 2EW3A 3QSUA 3M57A 2K2MA 2MWPA 1VQMA 1N9RA 1FXXA 1RAAB 4XU3A 1VQNA 2NUTB 2VYTA 2OTLT 4E7SA 4CS4A 3CCLQ 2VVKA 4EPCA 5I2SA 3HRKA 3QNEA 5HK0A 1Q7YC 4M77G 3QO5A 4ZGJB 3EFSA 2HSEB 4EX5A 2AIRB 4OMOA 4M75F 4A4GA 1LJOA 5LL6S 5GANj 4H2XB 3A8OB 1JXOA 4NS5A 1VQOT 1YHQT 3G1ZA 2R5AA 2NLUA 2CUDA 2E6ZA 4ELYC 1X6GA 3X28B 1VQ8Q 1WJSA 4Y28E 3CXCP 2QDLA 2KRMA 2FPEA 4P71A 1P92A 5CK9A 1X69A 1Q86C 5KCHA 1TH7A 5C51B 4N0AA 1EVKA 2P84A 3IQLA 5GMKi 7AT1B 5HKCA 4PJOE 4M75B 1G51A 2LQKA 4FU6A 2ZPHB 2X3XD 2V8IA 4GBQA 3QDRB 2AKWA 2RO0A 1VQLA 4V2SA 4TVRA 3C94A 3M4GA 3WVEB 3I5SA 2LP5A 4J6YA 1M4ZA 2CKKA 3CCJQ 4BI4A 5KYWA 1O75A 2CSIA 1YJ9T 2B8AA 2P0LA 1RAHB 4F7UF 1WYXA 4FL6A 1IXDA 2LT4A 2QG9B 4YRPA 2ZT8A 3LSSA 1VQ4T 1ADJA 3CCST 2C0TA 2DAQA 3CQTA 1VQ5A 2DNUA 3FIFA 2QQRA 1B07A 3RMQA 2O01E 2JM9A 5I2MA 3HFZA 3EG1A 5CR2A 4HVWA 1F1BB 1G3TA 4JDSA 3SD4A 1G3WA 3QDFA 3L2WA 3IG2A 1UG1A 4L59A 1TU0B 2AT1B 4F7UB 1YFNA 3G71Q 1JJ2A 2CYZB 3OW2P 5GAOn 1QVFP 5GMKm 5KE3A 3QTCA 1WHLA 4KRTA 5CKBA 2PVGB 1U06A 2CT4A 2DM1A 2LQWA 2ODRD 1WI7A 2CP3A 3CCVA 1IZ6A 2CZ1B 3NTKA 3QUIA 2C0OA 3META 4OLFA 3I9QA 4P75C 3L2ZA 2DMOA 2CGHA 2DVEA 4YP0A 3SEMA 5GAN5 4K88A 1M1FA 2LJ3A 2VB6A 2CJAA 3JB9D 3GNGA 2NUZA 2DL4A 5GAN8 2AZVA 3MKDA 1PM3A 1NG2A 3H8ZA 2DU5A 2NWMA 1W2BP 1N8RC 5GANe 2RF0A 1MGQA 1NJ8A 3JSCA 5FLXE 3PZCA 2FEIA 1IREB 4FW1A 1KD1U 1E1TA 2KRSA 3HFOA 4KGZB 4QVDA 1YIJA 2JNGA 5LJ5f 4D8KA 2JTFA 3LYIA 3M0UA 1K73C 4TVWA 3CXCS 4GLKA 4M75C 2K79A 4A4EA 1HTTA 4IIMA 4J9DA 4M77A 5CKEA 4M7AF 1I4K1 1WXTA 2LJ1A 4K86A 4P72A 1KOGA 2EYXA 2W10A 3L1AA 5KE2A 4DPGA 4UPAA 2XHCA 3BDLA 2AMCA 5KNNA 4YRLA 2RHQB 2E65A 2D6FA 2EJGA 4JRPA 2ZTGA 2M9UA 2P4TA 2COYA 4OMQA 1ZSZB 1J5WA 3EH2A 4MDXA 2DX1A 2RHSB 5J3BA 3LX7A 4MZTA 4ZN3A 1ZBJA 3EG2A 3FJ5A 1Z9ZA 4HVCA 3NENA 1UECA 3H9NA 4ZN1A 4TWAA 2RD1A 4CRIA 4CH6A 5L23A 1JXMA 1I81A 1X43A 1VA7A 1QVGP 3HY1A 1MMDA 3VRYA 4M7AB 1NM7A 1HK9A 5D7UA 3INZA 1Q7YR 1BI1A 1BI0A 3OD1A 3P8VA 1MNEA 1NLOC 4XTYA 3UH0A 1U3OA 4EMHA 3OS0A 2QASA 1ASYA 2V8JA 5IH2A 3I55Q 4D8DA 3M55A 2F5TX 1VYTA 2K5LA 4LE9A 2A0FB 1ZHIA 3C4SA 4NCXA 4RG2A 1PRMC 2EYQA 2D8JA 1B70A 3CCMA 3S3MA 4B6MA 1SHFA 5KYUA 1ZSGA 2GBQA 1M1KU 3I56Q 3TVTA 4A63B 1AT1B 3HXUA 4WJ3M 1WZOA 1NJIU 4YROA 1Q86R 3E1SA 3JAME 3HRIA 2BZYA 2LX7A 3OW2S 1LOJA 1W6XA 2LRQA 1YWOA 3OYGA 2RQRA 1Q82C 1ABOA 5J26A 3CCET 2DLPA 1BI3A 2M02A 3FLGA 3HKSA 2C06A 2EBPA 5CQXA 1KMMA 1RIQA 3G4SA 2OTLA 4P74A 4YRMA 1GBQA 2DD4A 1H641 5GAMd 4A54A 3L4GA 4PK4A 1ZQ1A 3QXEB 3MF1A 3VS6A 5IHNA 5DLQE 1OZ2A 1X27A 4PJOD 5GAMg 4ELZC 1QW1A 4FW2A 5C53B 4J9CA 5K1XA 2WACA 1IRXA 2ED1A 4JPBW 1B7TA 5KYYA 1T3LA 1ATIA 1W2BS 4BACA 2YDLA 2ZT7A 2X4JA 1N9SA 1VQOA 3CCUT 4RKUE 2Q7GA 5HGQA 1YITQ 1EFWA 4E7IA 3A7UA 2BTTA 4YTLA 2JTEA 1BIBA 2EKHA 4G85A 1SERA 2E4HA 1AZEA 1QCFA 1AVZC 4QQDA 3OSSC 5FU7B 6AT1B 2XDDA 5GAOm 3CCQQ 1VQMT 1VQNT 4CS2A 4R56A 1KHIA 3NTHA 2YUQA 2DYIA 1PC0A 2H3EB 4OMMA 2ZPEB 1YP5A 2AKWB 2CJBA 1GL5A 2H3JA 3SWNA 3R07A 1H4SA 1QCOA 4OF1A 4M7AC 3G7ZA 4PLLA 4YRCA 4ZGEB 2KDSA 2E5QA 5CQYA 3PNWC 3KXTA 2O88A 2EKOA 2ZPBB 1MMAA 3R6NA 5GMKj 1NLPC 2P4RA 2RHYA 3KFUA 3NTIA 4TVAB 1QVGS 2FZGB 3REBB 1K0SA 3LWHA 2EQMA 2VC8A 2CZ6B 4A4HA 4AFUC 3CCSA 1NPPA 1AEYA 3E2UA 4IURA 3VU3C 2XTIA 1WQWA 1KD1C 4KGVB 3HPWA 1RI0A 1G8XA 4PKCC 1X55A 1N8RR 4WCIA 4BD3A 3EFRA 2EJ9A 3F70A 3HFZB 2WSFE 4DBRA 4YRSA 1YCSB 4LDVA 2L3SA 3SHWA 3HY0A 5GANf 4XU0A 1C1AA 1G3SA 1GCQA 1Y7XA 3OY9A 1K73R 1PHTA 2JZ2A 2PNIA 2RNAA 2C7IA 4J5YA 5FU6C 1WNLA 4JRKA 3M0PA 3CCLA 1IHWA 1OOTA 3P8BB 4RTZA 3ZEHA 3HXXA 1WFWA 1PD0A 3A1PA 4H2VA 1BI2A 2NUPA 2RQUA 4Q5WA 3UF4A 3OYHA 4XK8E 4HWSA 2DILA 2RQTA 1WLPB 1PD1A 1H3ZA 4YRRA 4BWAA 2M1HA 5GAN6 3IKMB 1OULA 3BFMA 4M77F 2DA9A 1K9AA 4KT0E 5HCKA 3GP8A 1UEBA 4M75D 2QQSA 9ATCB 2PZ1A 1Y57A 1EOVA 1MV0B 4P71C 1RLPC 4R0KA 4HCKA 3VBBA 1PYSA 3PTAA 3M0QA 2HQHA 2BE9B 4IUUA 1D3BA 2ZCEA 5FRMA 4RQFA 4N0AC 1VQ9Q 2L5QA 3CD6Q 1M1KC 3JCMe 1D0ZA 3CEYA 1NJIC 4LVLA 3EHRA 2J3LA 1G2BA 3H41A 2RPNA 2DXUA 4H2TA 2DVJA 2DTOA 1M27C 3VQWA 3TCJA 1KQ1A 1BYMA 4UP7A 4LDUA 3OBWA 4P5NA 3QG1A 1WDXA 5IT9E 4J83A 5KH6A 3P8DA 2DEUA 3IKLA 2ZIMA 2R58A 1UGVA 5GMKe 3UGQA 1QMCA 3P8HA 3G6EQ 1B7YA 1M2OA 2YRDA 1T3SA 4RCCA 1YIJT 3L2VA 1PG5B 2KE9A 2IY5A 3V7RA 2QAZA 1J3TA 3PGGA 3OYBA 4C92E 1KQSP 4JS5A 3ICAA 4QQ6A 1BB9A 2RI5A 4EO4A 1SKUB 4LDXA 1NJ5A 1X2GA 3R6OA 3UATA 3CC4Q 2ZPFB 1K76A 4PJOB 1B70B 2KEAA 4KH1B 4WTOB 4NOYA 3DKMA 5CCAA 4C92G 1VUBA 4IUVA 4H2SA 4DBFA 1R0CB 4LN2A 3A74A 2RB6A 1OEBA 4HCCA 3LW5E 2ARTA 2M16A 2DE0X 4ZTUB 4J7IA 4Z88A 2LX9A 4LD9K 1D1AA 1G5VA 2LCSA 2F2WA 2P5IA 3L4GB 2C0IA 2HL5C 4IUPA 2RJEA 3JB9G 1H4QA 4OP0A 5GAOl 1Z7NA 3LC0A 4UP9A 4PJNA 3MP1A 2PMFA 2F5KA 4D6WA 2LT1A 5KYYB 3CCMT 3P8TA 5L8RE 4KBMB 2ROTA 4O2DA 2ZNJA 3KFVA 1KD1R 3CC2T 3CCUA 2FO0A 2RN8A 2ZINA 4CH5A 2ZZDA 2EYYA 2COZA 5LJ5h 2A08A 2OAWA 1WA7A 1VQ7T 4LVJA 2A37A 4M7AD 2AHJB 4NL3A 4M77E 4BW9A 1X56A 4XTUA 1UJYA 2IIMA 4HCZA 4F04B 3EGUA 4C8QE 3RL6A 1C0MA 4FT2A 3G4ST 3VUZA 2BKDN 1I0CA 5F5WA 2EIFA 3OYYA 2DYBA 3SWNB 3VS5A 2D0NA 4M78E 3H0HA 4C8QG 2M0YA 3I55A 3UWNA 4CI0C 3CMAT 4ME7A 1H3HA 2Q7HA 3N5BB 4XTVA 1QE0A 3NMZC 2D0QB 1CKAA 3MEUA 1C0AA 5GAOp 2KNBB 4M78G 2JTMA 5IN1A 3M4QA 1K0XA 2E70A 3OYIA 3HSBA 4YRGA 1EZZB 3PVLA 3ZBDA 4PJOC 4CH4A 2O9VA 3I56A 2RM4A 1KQSS 4F17A 5CAIA 2RMOA 1T0JA 5LJ3g 1WHMA 1SPKA 4P3PA 1UDLA 3CC7T 1IGQA 3EGXA 2KQWA 4JUVA 2HQXA 2COWA 1VQPQ 2XK0A 1YJNT 4KULA 5HY6A 1NYGA 4CC2A 1M1KR 3TREA 1O9SA 4EIKA 1NJIR 2AZSA 3PCOA 2QA4T 3JCMf 5FROA 1R77A 1XQHA 2IG0A 4RMOA 2E64A 4MZMA 3VQXA 3PVQA 3DB3A 1N27A 2YRVA 2YLCA 2QI2A 1FYNA 4XEOA 4OB0B 2FZCB 4RUGA 1BKBA 1KSWA 4C92A 2DD5A 3OW2A 2MPXC 3HFNA 5I11A 4BE0A 4RG8A 2CIMA 1M3BA 4CC3A 2EQUA 3RNJA 4HKEA 1M30A 1YI2Q 2E5KA 2FHDA 5KYXA 3MEWA 2VKNA 5GJWB 3OYDA 1Q81U 4J6WA 1K8AU 1RACB 1WXUA 1PYSB 3CCQA 4A53A 2ESWA 2PU9B 2RK1A 4HT4A 3QO3A 4LDYA 5FWBA 1GCPA 3CCLT 4JJBA 3VYHB 4IIOA 5EC7A 4OGCA 2AK5A 3CBOA 2ALYA 3ZL7C 1W2BA 2CZ7B 3SWNC 3OYJA 2RJDA 4FIBA 4CH3A 3VKIA 2FRYA 5HK3A 2JOYA 1FWZA 4GLMA 3E9FA 2ZXFA 4RTUA 1S72Q 4BI8B 1H4TA 2GFAA 3MCAB 2BE7D 2OI3A 3GPLA 4C0FA 4JS4A 2Z0WA 1VQ8T 2ABLA 1D0XA 1B34A 2ZZEA 1NE8A 3NHNA 1FYFA 1AWOA 2XICA 1USYA 1B7YB 4XU2A 1JJ2P 4M7DE 1TTHB 1ZX6A 2HQEA 2IY5B 4HT9A 1Z9QA 1GCQC 3VJPA 3M0TA 1QWEA 4DOWA 2FPFA 4TVYA 2BZXA 3OMGA 3RBBB 2QQBA 4C8QA 3CCJT 3PT9A 4M7DG 1NJ6A 2D8HA 1M3CA 2FRWA 3QYHB 1SEMA 2ENMA 1WXBA 2EWNA 3VQYA 3JCMX 5GANh 4HA8A 8AT1B 4FYVB 3FC3A 1YJWQ 2HNIA 1SHGA 1GBRA 3CBMA 1OI1A 4M78A 2M51A 2G6FX 1LCKA 4O5VA 3VS2A 4HWTA 2KROA 4IKFA 2J3MA 1UHFA 1RAFB 2XD0A 2DL3A 5AYFA 3OYEA 1JJCA 3UA6A 3JCMJ 4FYXB 3Q1JA 4J9EA 1TUGB 5D6XA 2K5IA 1VQKQ 4Z02A 1XTDA 3LWIA 4H02A 3M9QA 4M77D 1PSFA 3OQ5A 3G71T 1M2VB 2QHSA 2DRKA 2ZPIB 2ARSA 4MMLA 4P73A 3RDVA 2ZR2A 1NPRA 2YRCA 4EDUA 1SRYA 4F16A 2HL3A 3W3SA 4X9DA 1KG1A 3FEOA 1UGPB 4LD6A 3A98A 2HMAA 3CC2A 5LJ3h 3NPFA 2DPPB 5A0LA 2KR3A 3FRNA 1ADYA 3SFMA 2RHIA 1QLYA 3RIRA 2D9TA 4KR2A 1JQQA 1M90U 3GLXA 3MJXA 3TU4K 1QVFS 2V8KA 1EIFA 2HEQA 2A36A 1VQ7A 2PUKB 1KK7A 2DFUA 5FU6B 4J9IA 3C0CA 3EFOA 4C5GA 2QHTA 1WJRA 2RH2A 2I2LA 3ULRB 2LNVA 2C8MA 1I8FA 3HRSA 1MMGA 2LNHB 4K11A 4HCBA 3DLLA 5GAOr 3VRZA 4LNSA 3A5ZA 2CH4W 1VQZA 3H0FA 4JZ4A 2VWFA 3DLMA 3M58A 3CMAA 3U23A 1VQLQ 1PKSA 4MDWA 2JT4A 1I1JA 3CC4A 2EVRA 4KH0B 2CP6A 3MEAA 2HCKA 2I4OA 4OMFB 3QBYA 4AG2C 2O9SA 1JJ2S 2J6FA 2DKGA 1Q81C 1K8AC 2QYZA 3NETA 4HWOA 3M56A 1B8AA 1E6GA 2YSQA 3EG9A 3OYAA 4AFSC 1M8VA 4BE2A 2GQVA 2GFUA 3UPUA 3D7SB 3CC7A 3GNFB 1QKWA 2FZKB 3M4YA 5M9OA 2R57A 1ZUUA 4C92F 1VQ5Q 1YJNA 2CSQA 1GFCA 2JM8A 1K9MU 1M3AA 2FVUA 5GAOq 1TUCA 4JJCA 2QA4A 3PCOB 4LXCA 1Y96A 5GAN4 4OMPA 3I55T 5KYWB 1YNZA 2HBPA 4QT7A 5GAMj 1XNIA 1D1CA 3A32A 2KRNA 1NYFA 3X26B 1I5OB 2K9GA 1E7OA 4M7DA 2DZ9A 2ZZFA 1YWPA 3GF5A 5IXBA 2HAXA 2CDTA 4C92B 4YRTA 3SDZA 1JU5C 2PMEA 3I56T 3CCVQ 1YFSA 4P75A 2ZT5A 2LC4A 1IL2A 1IB8A 5LJ5d 3CMQA 3X24B 2LCCA 4A4FA 1XOVA 2MMPA 3GIBA 2LQNA 1PWTA 2KBTA 4H2XA 1KIKA 4Z89A 3HXVA 5KYXB 1UE9A 3QJ6A 5LJ5g 3CMEQ 1HC7A 2ED0A 1YB3A 1RAIB 1AWXA 2HBWA 3MO8A 3HXWA 3RUXA 2CP2A 3M5AA 2QDYB 4QQGA 3AHUA 4BY6C 2ROLA 1K1ZA 2BUDA 1NYRA 1GRIA 3ERRA 4FM4B 3E9IA 1AZGB 2ECZA 3HHTB 5CKHA 2RJCA 3WXMB 5DLOA 2OTJQ 2ALYB 3V7CA 1WIEA 1TUDA 1YIJQ 4XU1A 11ASA 2A3LA 2MF2A 3VV0A 2PVDB 1WJQA 3PE0A 1EIYA 5IXFA 2MIOA 4FYYB 1NBEB 4LVKA 4AFZC 2LQ8A 2L2PA 2JJ9A 3S6WA 3QYGB 2MI6A 3MP6A 2J6KA 1CSKA 1ZLMA 4QW2A 3EGDA 1KQ2A 3L2RA 2ZAEA 3VQVA 2JS2A 4C8QF 2ATCB 1VQ8A 1W4SA 1B34B 4JRIA 1FMVA 2K3BA 1K4US 1D09B 2QEXQ 5A2QE 4M78F 1KJWA 3CCQT 1VQPA 4YRJA 1YFRA 2MK5A 3TUPA 2DJQA 1WHKA 4PNOA 4II1A 2OX7A 2VGNA 3QWXX 2MCNA 4AG1C 2DQ0A 4HVVA 1ABQA 2EGAA 1QVPA 4BE1A 1M90C 4M77B 3CCJA 2Q5IA 3TEGA 1AWJA 3PIPA 2AMCB 1PSEA 3CPWP 3ER0A 2CH4A 3REXA 2GGRA 1WHHA 2Y4YA 4B9WA 4EMKA 2E3HA 1NEBA 4BDZA 4L5GA 2L3QA 4PFOA 3RGLA 2X4XA 3M59A 2ZZGA 3CCRQ 4N4HA 1M8MA 1KQSA 2GCXA 2RI3A 3QWYA 3CCMQ 3MF2A 4M4ZA 4YCUA 2H8HA 3JCMh 2L89A 3HTZA 3BDUA 1ACMB 1BU1A 2V26A 1FMKA 4C92C 1VQ6Q 5GAMe 1X75C 2L8DA 2KGTA 1ARKA 1JJCB 1FX7A 1JO8A 3UGTA 2KVQG 2IVWA 4OGEA 2EL9A 4DQ2A 3MQZA 4HXJA 2RHXA 3IALA 5CKDA 5I21A 1M9SA 2DXBA 1X2KA 4QVCA 3G71A 4AH6A 2L3RA 2O4XA 1NYQA 4MZPA 4RCBA 3LH0A 4WF2A 2OTLQ 1E22A 3J80E 2DK3A 1EVLA 4OB1B 2GNCA 3L42A 4EMGA 5GMKh 1BBUA 3M4PA 5KYUB 1Q81R 2JMAA 1K8AR 3OYNA 12ASA 2EQKA 2K2VA 3P8YA 2EAYA 3REUA 2A8EA 4XAXB 4CS3A 3HTRA 3ZFJA 2JMCA 1UTIA 3OS5A 1R8OB 2CZ0B 3QKJA 1B76A 1K9MC 2YLBA 2PVOB 3I5RA 4JJDA 3JCMc 4FSSA 3PIOA 1OZ3A 1UGSB 3OMCA 2ARUA 4XTWA 2LZ6B 3NGPA 1KHCA 5GJVB 1VQOQ 1YHQQ 1H4VB 3EFOB 3O8VA 5DM7R 5FRNA 5D6WA 3RERA 2K7AA 1ZSZA 5C0MA 4K87A 1RAEB 1YCYA 4YDQA 4ZTZB 3L2UA 3JV3A 2CREA 8ATCB 3EHQA 1W70A 1IHVA 3QO7A 4IUQA 4RTVA 3HRTA 2ZT6A 4YREA 1VQ9T 2VGMA 5C6SA 1N9WA 3CD6T 2QQ9A 5ELOA 4E7JA 1NEGA 4ZNXA 2XIDA 4ORZA 4LVMA 3C95A 2X4YA 3ASKA 4M77C 2DU7A 4OVAA 4P72C 3DSQA 3UFGA 4C8QC 2E6NA 3QZ5B 4QVZA 2QTVA 1YJ9Q 1YJWA 2QGFB 3BJUA 2VXEA 4GY5A 1SETA 2MWOA 5GANg 3KUFA 5E3IA 5J39A 4LDWA 1EFNA 1VQ4Q 1SESA 4M7DF 4M78C 3CCSQ 4AMCA 3CPWS 2Q7EA 1G5HA 2CJ9A 5IHKA 4B9XA 2DL8A 4Q6GA 3G6ET 2YUOA 1OPLA 1QQJA 1UHCA 2RK2A 2XI9A 3CXCA 4JLIA 4DA4A 1VQKA 2CS7A 1MHNA 2K6DA 1QWFA 1VYUA 2D1XA 1RUWA 5CVIA 3UDCA 1KC8U 1YBYA 3CC4T 4M7DB 3RMSA 4YRIA 4A4KA 1E1OA 2OAUA 4TQDA 5LJ3d 2CUBA 4P73C 2B86A 4TQFA 3BW1A 1JRIA 3MEYA 4ANJA 2QK0A 3OBYA 4ESRA 2XDBA 1OV3A 4FSXA 2KMTA 3MP8A 3THKA 2O31A 2DTIA 3VYGA 3I7FA 1RAGB 2HKNA 5CO7A 2P0KA 1WYDA 1TWBA 4JZ3A 4AT1B 1MV3A 2XMFA 1SRMA 4AFQC 2YXYA 1M90R 1V1CA 1FMWA 4X9CA 3HL8A 2EYZA 1AWWA 4P74C 2LTOA 4X5OA 3EAEA 2BZ8A 2L3PA 2E10A 2MOXA 2NUPB 3LGFA 2X4WA 1EIYB 2GQIA 2GTOA 4HT8A 4J9FA 1Q82U 3OYMA 4OMLA 4YRFA 1M1GA 2I4MA 1QVFA 3JCMP 2DDZA 2X51A 2VASA 3EGDB 3HXZA 1YITA 1LVKA 3LSQA 1PRLC 2WSCE 4PJOG 2QXFA 3TSZA 2PTKA 4R55A 1RL2A 3HFVA 5GAMf 1AHJB 3ME9A 4H2WA 4TVAA 5LJ3j 3O5ZA 4DBQA 3X20B 1ZA2B 4KR3A 3EG0A 4E7HA 4E2FB 4YCWA 1YGBA 1W66A 1D3BB 5CKFA 1WU7A 4ZIBA 1V76A 5IAYA 1E6HA 2ZPGB 1SSHA 3RACA 2J06A 1UJ0A 1I5LA 3UT1A 4LUDA 2EGCA 2EJFA 2KXDA 3SB2A 1OYXA 2IPOB 3OS2A 4LNPA 4YRKA 4C92D 4RQEA 4EMKB 1K9MR 2J7IA 1X2QA 1WPYA 2F1LA 3I35A 4P3NA 3MPUB 1QKXA 1GGMA 2KT8A 2YUPA 3QIIA 1WX6A 2QQAA 1L0WA 2HDAA 4M7DC 5EG2A 1UFFA 3OSVA 3EG3A 4XTZA 4KQEA 4J9HA 4C5HA 2LDMA 4F14A 3TSWA 2JUFA 4WJ4A 1C6VX 1OX9A 2X35A 1VQPT 2HD0A 3CMEA 1AD5A 3RKWA 4KGXB 2AKKA 3CCEQ 1BBWA 1Y71A 3QO8A 1X6BA 2CT3A 2O4XB 4PFPA 3HRUA 4C5IA 1JEGA 1Q95G 1QVGA 2KSSA 2OTJA 2Q5HA 3V8LA 4JRQA 2QHUA 4E6RA 1SF9A 3UA7A 3WQZA 1T0HA 5FW9A 4J15A 5KYNA 4OMNA 3X25B 2J6OA 3A8HB 2GF7A 2I0NA 1PNJA 4C0GA 2DL7A 2F69A 4FT4A 3FJPA 2V1QA 2M0OA 3AT1B 3CCUQ 1X2HA 2P0PA 2G4CA 1LNXA 4PHCA 4J9BA 3GOXA 1D1BA 2CP0A 2E1HA 1YI2T 4M75E 2R5MA 4E51A 1X01A 1KC8C 2QEXA 2FPDA 1WHJA 1N6AA 1LYLA 4NL2A 2LVMA 1MMNA 5ECAA 3OA6A 1VQMQ 2MYSA 4C8QD 1N5ZA 1VQ9A 5ELNA 4M75G 2KAFA 1VQNQ 3CD6A 1TOVA 2KYBA 4O6JA 5LJ3e 4P3OA 3RF1A 4E7LA 1JBMA 2QGGA 2A7YA 4M78D 3KBGA 1G83A 2FL7A 3CPFA 4PLIA 3A8GB 4Y91A 1QF6A 2ZR3A 2E3IA 4UC4A 3VS7A 2DBKA 4C5EA 1S72T 4DOVA 2EFIA 4EMKC 3CCRA 4QKUA 4FCYA 1D0YA 3C12A 3HP9A 2KT1A 1SRLA 4PJOA 3VS1A 3JCMd 3A8MB 1X6OA 4BY6B 3JB9I 3VS3A 2DERA 2KI7A 3TQ7P 2FB7A 1VQ6A 3NELA 5C52B 4JJNK 3JCMQ 1KFZA 4G84A 4BI3A 2SRCA 4J7FA 3JCMg 2BIVA 4F7UE 2DXTA 2DF6A 3OYCA 3G6EA 4RTWA 4RTYA 1XJWB 1VIEA 1GFDA 2V1RA 1OPKA 2CP5A 4E7ZA 3OS1A 4OB2B 1PKTA 2K3XA 4F7UG 1GXIE 1MNDA 1ZBXA 4YYEA 3JCMV 3E9GA 4YPFA 1VOMA 1OQKA 1TSFA 1ZA1B 3JB9J 4Z8AA 5IHIA 2KXCA 3BY7A 2X9HA 3RKXA 2Y4XA 1YJWT 3GBQA 2E5AA 1SG5A 3PFSA 3V7SA 2VXFA 2CP7A 3EGXB 2DIQA 1YHQA 2K3YA 4L87A 1ZUYA 5K1PA 1NZ9A 2RA2A 3BE3A 3L2QA 2F2VA 1BCMA 3MHXA 4C0ZA 4DEXA 3OYLA 1VQKT 3TEHA 1ZSZC 1MUZA 4J9GA 4YRNA 1U5SA 1OX8A 3WVDB 4CC4B 1R0BG 1Y0MA 3QPHA 1YFTA 2KY9A 4DEYA 2DEQA 2NUTA 5FWCA 3OB9A 1S1NA 3JCMb 3MEVA 5GAN3 3JRZA 1VYVA 3M54A 4ZTJA 4X1VA 2VV5A 3QJYA 4X34A 2DJZA 2NS6A 3JB9F 2YHTA 4YCVA 3M53A 3G1JA 1YJ9A 3QZ9B 2NYSA 2X3WD 3M0RA 3J7AF 3QHSA 1G3YA 2W0ZA 5GMKl 1VQ4A 4M7AE 5GAN7 2YUNA 3RKYA 4ZTFA 4IUTA 2FG0A 5A0GA 1BCOA 3A8LB 1RLQC 1WHGA 4M7AG 4E7KA 3A7RA 4MMKA 3J81E 1UGRB 5A0DA 4M7DD 4M75A 1BIAA 2EGEA 1VQLT 1WGSA 4PG3A 2EQIA 3REAB 3URGA 3RESA 1YITT 2XKOC 4JLGA 2E12A 3V8JA 3S3NA 1BK2A 4PJLA 3A31A 1E24A 2DXCA 2QHVA 3CPWA 2RI2A 1KC8R 4TTVA 1Q7YU 2EYWA 1UGQB 3A7AA 2O2OA 5LJ5j 3JB9H 2KYMA 1VQ5T 4L6V5 2RQWA 3HXYA 4Y92A 4PL6A 4BDYA 1ASZA 4RMFA 4C0DB 2A28A 2PUOB 4RTXA 4J8OA 4KUIA 5LJ3f 1RABB 1LPLA 4C8QB 3OYKA 4F7UA 1A0NB 5FU7C 3LH5A 1Q86U 2DETA 4FYWB 2K4YA 4M78B 4HWRA 3VUBA 2LCLA 2XG8D 1HJDA 1AOJA 1HSQA 3CCVT 1OU9A 2LJ0A 4PJJA 3CC2Q 2DRMA 4E47A 3JCMW 1U1SA 3EH1A 4YRQA 1BBZA 4ZGDB 1YI2A 3PMIA 2DZCA 1Z7MA 3PMTA 4XTXA 3CMET 1Q82R 1VQ7Q 2JXBA 1HYOA 3H6ZA 5I22A 4H2UA 1OU8A 2YT6A 2ODRC 4VUBA 4PJOF 1UUEA 1VIFA 2RHZA 2DIGA 2HSPA 3RR6A 1RADB 3G4SQ 1DJ7B 2EQJA 1QCNA 1HD3A 2DL5A 2K5FA 2OJ2A 2OTJT 1G5IA 1H8KA 5GAMh 4XEMA 4HWPA 4RTTA 4CC7A 4BB7A 5DY9A 2ZIOA 1CKBA 1JB0E 1V29B 1NNHA 1I07A 4N4IA 3CMAQ 1PCXA 1Y07A 1S72A 1IO6A 2DO3A 2XU8A 4PFZA 1NJ2A 2RHQA 2E3CA 3FB9A 3LLRA 2G3RA 2VUBA 2YWWA 2FYKA 2WSEE 2ZNIA 2SEMA 1SSFA 3CBPA 1KMNA 3T9NA 5AT1B 3FDRA 2QTXA 2I4LA 2LMJA 3V8KA 2RHSA 2QEXT 2PQWA 2MAMA 1TXQA 5D6YA 1W1FA 1QP2A 3CC7Q 4RDXA 2F2XA 3A5ZB 3NFCA 1USYC 5GAN2 3CCEA 1X54A 2DQ3A 1WLEA 1YJNQ 3DB4A 3S3OA 4LVIA 1EX4A 2DBMA 3E9HA 4M7AA 1IGUA 4N4GA 3M0SA 4PJMA 2QA4Q 4C0DC 4OB3B 1RI9A 1QP3A 3NEMA 4UP8A 2GTJA 5LJ5e 1HXDA 3A5YA 4BUGA 5GANd 1M5Q1 2JN0A 3LGLA 3H0IA 3VS0A 1M2VA 1B3QA 2JW4A 2HKQB 1TS9A 2XDPA 1N8RU 2E41A 2KK4A 3CCRT 2L0AA 4Q15A 2RHUA 2JS0A 3EG9B 1UB4A 1WQ7A 1TG0A 2P0QA 1EQRA 1YN8A 4XQ3A 2ZCFB 3VS4A 1U8RA 3TEEA 2K57A 4LUEA 4ATOA 1K73U 4WI1A 2J05A 4DBHA 1VQ6T 2EPDA 1ZUKA 4HVUA
chains in the Genus database with same CATH topology
2XGTA 2DTHA 5CIUA 2RJFA 3E19A 4H2YA 2ZGWA 4KUDK 3OYFA 1Y96B 1NJ1A 5KCOA 2I4NA 2JVVA 3TEHB 2Y90A 1U1TA 4J6XA 3QSUA 3M57A 2MWPA 1VQMA 1N9RA 1FXXA 4XU3A 1VQNA 2VYTA 2OTLT 4CS4A 4EPCA 5I2SA 3HRKA 3QNEA 5HK0A 1Q7YC 4M77G 3QO5A 4ZGJB 3EFSA 4EX5A 4M75F 4A4GA 1LJOA 5LL6S 5GANj 4H2XB 3A8OB 4NS5A 1VQOT 1YHQT 3G1ZA 2R5AA 2NLUA 2E6ZA 4ELYC 3X28B 1WJSA 4Y28E 4P71A 1P92A 5CK9A 1Q86C 5KCHA 1TH7A 5C51B 4N0AA 1EVKA 5GMKi 5HKCA 4PJOE 4M75B 1G51A 2LQKA 4FU6A 2ZPHB 2V8IA 3QDRB 2AKWA 2RO0A 1VQLA 4V2SA 4TVRA 3C94A 3M4GA 3WVEB 4J6YA 1M4ZA 2CKKA 4BI4A 1O75A 1YJ9T 2B8AA 2P0LA 4F7UF 4FL6A 2LT4A 4YRPA 2ZT8A 3LSSA 1VQ4T 1ADJA 3CCST 2DAQA 1VQ5A 3FIFA 2QQRA 3RMQA 2O01E 5I2MA 3HFZA 5CR2A 1G3TA 4JDSA 3SD4A 1G3WA 3L2WA 3IG2A 4L59A 4F7UB 1JJ2A 2CYZB 5GAOn 5GMKm 5KE3A 3QTCA 5CKBA 2PVGB 2ODRD 3CCVA 1IZ6A 2CZ1B 3NTKA 3QUIA 3META 4OLFA 4P75C 3L2ZA 2DVEA 2CGHA 4YP0A 5GAN5 4K88A 1M1FA 2CJAA 3JB9D 3GNGA 5GAN8 3H8ZA 2DU5A 1N8RC 5GANe 1MGQA 1NJ8A 3JSCA 5FLXE 3PZCA 1IREB 1KD1U 1E1TA 3HFOA 4QVDA 1YIJA 2JNGA 5LJ5f 2JTFA 3LYIA 1K73C 4TVWA 3CXCS 4GLKA 4M75C 1HTTA 4A4EA 4M77A 5CKEA 4M7AF 1I4K1 4P72A 4K86A 1KOGA 3L1AA 5KE2A 4DPGA 4UPAA 2XHCA 3BDLA 2AMCA 5KNNA 4YRLA 2RHQB 2E65A 2D6FA 2EJGA 4JRPA 2ZTGA 2M9UA 2P4TA 1J5WA 4MDXA 2RHSB 5J3BA 3LX7A 4MZTA 4ZN3A 4HVCA 3NENA 4ZN1A 4TWAA 2RD1A 4CRIA 4CH6A 1I81A 3HY1A 4M7AB 1HK9A 3INZA 1BI1A 1BI0A 3OD1A 3P8VA 4XTYA 3UH0A 3OS0A 4EMHA 1ASYA 2V8JA 3M55A 2F5TX 2K5LA 1ZHIA 3C4SA 4NCXA 4RG2A 2EYQA 1B70A 3CCMA 3S3MA 1M1KU 3HXUA 4WJ3M 1NJIU 4YROA 3E1SA 3JAME 3HRIA 3OW2S 1LOJA 2LRQA 3OYGA 1Q82C 5J26A 3CCET 1BI3A 3FLGA 3HKSA 2C06A 5CQXA 1KMMA 1RIQA 3G4SA 2OTLA 4P74A 4YRMA 2DD4A 1H641 5GAMd 4A54A 3L4GA 1ZQ1A 3QXEB 3MF1A 5DLQE 1OZ2A 4PJOD 5GAMg 4ELZC 1QW1A 5C53B 5K1XA 2WACA 1ATIA 1W2BS 4BACA 2ZT7A 2X4JA 1N9SA 1VQOA 3CCUT 4RKUE 2Q7GA 5HGQA 1EFWA 4E7IA 3A7UA 4YTLA 1BIBA 4G85A 1SERA 4QQDA 3OSSC 5FU7B 2XDDA 5GAOm 1VQMT 1VQNT 4CS2A 4R56A 1KHIA 3NTHA 2ZPEB 2AKWB 2CJBA 2H3JA 3SWNA 3R07A 1H4SA 4OF1A 4M7AC 3G7ZA 4PLLA 4YRCA 4ZGEB 2KDSA 2E5QA 5CQYA 3PNWC 3KXTA 2EKOA 2ZPBB 5GMKj 2RHYA 3KFUA 3NTIA 4TVAB 1QVGS 3LWHA 2EQMA 2VC8A 2CZ6B 4A4HA 3CCSA 1NPPA 4IURA 3VU3C 2XTIA 1WQWA 1KD1C 3HPWA 1RI0A 4PKCC 1X55A 4BD3A 3EFRA 2EJ9A 3F70A 3HFZB 2WSFE 4YRSA 4LDVA 3HY0A 5GANf 4XU0A 1G3SA 1Y7XA 3OY9A 2JZ2A 2C7IA 4J5YA 5FU6C 1WNLA 4JRKA 3CCLA 3P8BB 3ZEHA 3HXXA 4H2VA 1BI2A 4Q5WA 3OYHA 4XK8E 4HWSA 1H3ZA 4YRRA 4BWAA 2M1HA 5GAN6 3IKMB 3BFMA 4M77F 4KT0E 3GP8A 1UEBA 4M75D 2QQSA 1EOVA 4P71C 3VBBA 1PYSA 3PTAA 4IUUA 1D3BA 2ZCEA 5FRMA 4RQFA 4N0AC 2L5QA 1M1KC 3JCMe 3CEYA 1NJIC 4LVLA 2J3LA 2DXUA 4H2TA 2DTOA 3VQWA 3TCJA 1KQ1A 1BYMA 4UP7A 4LDUA 3OBWA 4P5NA 3QG1A 5IT9E 4J83A 5KH6A 3P8DA 3IKLA 2ZIMA 2R58A 5GMKe 3UGQA 3P8HA 1B7YA 4RCCA 1YIJT 3L2VA 2IY5A 3V7RA 3PGGA 3OYBA 4C92E 4JS5A 3ICAA 4QQ6A 2RI5A 4EO4A 4LDXA 1NJ5A 1X2GA 3R6OA 2ZPFB 4PJOB 1B70B 4NOYA 3DKMA 5CCAA 4C92G 1VUBA 4IUVA 4H2SA 3A74A 2RB6A 4HCCA 3LW5E 2ARTA 2M16A 4ZTUB 4J7IA 2LX9A 4LD9K 1G5VA 2P5IA 3L4GB 4IUPA 2RJEA 3JB9G 1H4QA 4OP0A 5GAOl 1Z7NA 3LC0A 4UP9A 3MP1A 2PMFA 2F5KA 4D6WA 2LT1A 3CCMT 3P8TA 5L8RE 4KBMB 4O2DA 2ZNJA 3CC2T 3CCUA 2ZINA 4CH5A 2ZZDA 5LJ5h 1VQ7T 4LVJA 4M7AD 2AHJB 4NL3A 4M77E 4BW9A 1X56A 4XTUA 4HCZA 4C8QE 3RL6A 4FT2A 3G4ST 3VUZA 2BKDN 5F5WA 2EIFA 3OYYA 3SWNB 4M78E 4C8QG 3I55A 3UWNA 4CI0C 3CMAT 4ME7A 2Q7HA 3N5BB 4XTVA 1QE0A 2D0QB 3MEUA 1C0AA 5GAOp 4M78G 2JTMA 5IN1A 3M4QA 2E70A 3OYIA 3HSBA 4YRGA 4PJOC 3ZBDA 4CH4A 3I56A 2RM4A 1KQSS 5CAIA 5LJ3g 4P3PA 3CC7T 2KQWA 4JUVA 2HQXA 2XK0A 1YJNT 4KULA 5HY6A 3TREA 1O9SA 3PCOA 2QA4T 3JCMf 5FROA 1XQHA 2IG0A 4RMOA 2E64A 4MZMA 3VQXA 3DB3A 1N27A 2YRVA 2YLCA 2QI2A 4XEOA 4OB0B 1BKBA 4C92A 2DD5A 3OW2A 3HFNA 4BE0A 4RG8A 2CIMA 2EQUA 4HKEA 2FHDA 3MEWA 3OYDA 1Q81U 4J6WA 1K8AU 1PYSB 3CCQA 4A53A 2PU9B 2RK1A 4HT4A 3QO3A 4LDYA 3CCLT 3VYHB 4OGCA 3CBOA 2ALYA 1W2BA 2CZ7B 3SWNC 3OYJA 2RJDA 4FIBA 4CH3A 3VKIA 5HK3A 2JOYA 1FWZA 3E9FA 2ZXFA 4BI8B 1H4TA 2GFAA 3MCAB 3GPLA 4C0FA 4JS4A 1VQ8T 2ZZEA 1B34A 1NE8A 1FYFA 2XICA 1USYA 1B7YB 4XU2A 4M7DE 2HQEA 2IY5B 4HT9A 3VJPA 4DOWA 4TVYA 3OMGA 2QQBA 4C8QA 3CCJT 3PT9A 4M7DG 1NJ6A 3QYHB 2EWNA 3VQYA 3JCMX 5GANh 4HA8A 3FC3A 2HNIA 3CBMA 1OI1A 4M78A 4O5VA 4HWTA 4IKFA 2J3MA 2XD0A 5AYFA 3OYEA 1JJCA 3JCMJ 3Q1JA 5D6XA 2K5IA 4Z02A 1XTDA 3LWIA 4H02A 3M9QA 4M77D 1PSFA 3OQ5A 3G71T 2QHSA 2ZPIB 2ARSA 4MMLA 4P73A 2ZR2A 1NPRA 4EDUA 1SRYA 3W3SA 4X9DA 1KG1A 3FEOA 1UGPB 4LD6A 3CC2A 5LJ3h 2DPPB 5A0LA 3FRNA 1ADYA 3SFMA 2RHIA 3RIRA 2D9TA 4KR2A 1M90U 3GLXA 3TU4K 1QVFS 2V8KA 1EIFA 1VQ7A 2PUKB 5FU6B 4C5GA 2QHTA 1WJRA 2RH2A 2I2LA 2C8MA 2LNVA 1I8FA 3HRSA 4HCBA 3DLLA 5GAOr 4LNSA 3A5ZA 1VQZA 3DLMA 3M58A 3CMAA 4MDWA 3CC4A 3MEAA 2I4OA 4OMFB 3QBYA 1JJ2S 2DKGA 1Q81C 1K8AC 3NETA 4HWOA 3M56A 1B8AA 3OYAA 1M8VA 4BE2A 2GQVA 2GFUA 3UPUA 3CC7A 3GNFB 3M4YA 5M9OA 2R57A 4C92F 1YJNA 1K9MU 2FVUA 5GAOq 2QA4A 3PCOB 1Y96A 5GAN4 3I55T 2HBPA 5GAMj 1XNIA 3A32A 3X26B 4M7DA 2DZ9A 2ZZFA 3GF5A 2HAXA 4C92B 4YRTA 3SDZA 2PMEA 3I56T 1YFSA 4P75A 2ZT5A 2LC4A 1IL2A 5LJ5d 3CMQA 3X24B 2LCCA 4A4FA 1XOVA 2MMPA 3GIBA 4H2XA 3HXVA 3QJ6A 5LJ5g 1HC7A 1YB3A 3HXWA 3MO8A 3RUXA 3M5AA 2QDYB 4QQGA 3AHUA 4BY6C 2BUDA 1NYRA 3ERRA 4FM4B 3E9IA 3HHTB 5CKHA 3WXMB 2RJCA 5DLOA 2ALYB 3V7CA 4XU1A 11ASA 2A3LA 2MF2A 3VV0A 2PVDB 1WJQA 1EIYA 4LVKA 2LQ8A 3S6WA 3QYGB 2MI6A 3MP6A 4QW2A 1KQ2A 3L2RA 3VQVA 4C8QF 1VQ8A 1W4SA 1B34B 4JRIA 5A2QE 4M78F 3CCQT 1VQPA 4YRJA 1YFRA 3TUPA 4PNOA 4II1A 2VGNA 2DQ0A 1QVPA 4BE1A 1M90C 4M77B 3CCJA 2Q5IA 3TEGA 2AMCB 3PIPA 1PSEA 3ER0A 3REXA 2Y4YA 4EMKA 4B9WA 4BDZA 4L5GA 3RGLA 2X4XA 3M59A 2ZZGA 4N4HA 1KQSA 2GCXA 2RI3A 3MF2A 4YCUA 3JCMh 2L89A 3HTZA 3BDUA 4C92C 5GAMe 1X75C 2L8DA 1JJCB 1FX7A 3UGTA 2KVQG 2IVWA 4OGEA 2EL9A 4DQ2A 3MQZA 2RHXA 3IALA 5CKDA 5I21A 1M9SA 2DXBA 4QVCA 3G71A 4AH6A 2L3RA 2O4XA 1NYQA 4MZPA 4RCBA 3LH0A 4WF2A 1E22A 3J80E 2DK3A 1EVLA 4OB1B 3L42A 4EMGA 5GMKh 1BBUA 3M4PA 3OYNA 12ASA 2EQKA 2K2VA 3P8YA 2EAYA 3REUA 2A8EA 4XAXB 4CS3A 3ZFJA 3OS5A 1R8OB 2CZ0B 3QKJA 1B76A 1K9MC 2YLBA 2PVOB 3JCMc 3PIOA 1OZ3A 1UGSB 3OMCA 2ARUA 4XTWA 1KHCA 1H4VB 3O8VA 5DM7R 5FRNA 5D6WA 3RERA 5C0MA 4K87A 1YCYA 4ZTZB 4YDQA 3L2UA 3QO7A 4IUQA 3HRTA 2ZT6A 4YREA 1VQ9T 2VGMA 5C6SA 1N9WA 3CD6T 2QQ9A 5ELOA 4E7JA 2XIDA 4LVMA 3C95A 2X4YA 3ASKA 4M77C 2DU7A 4OVAA 4P72C 3DSQA 3UFGA 4C8QC 2E6NA 3QZ5B 4QVZA 1YJWA 3BJUA 2VXEA 4GY5A 1SETA 2MWOA 5GANg 3KUFA 5E3IA 5J39A 4LDWA 1SESA 4M7DF 4M78C 3CPWS 2Q7EA 1G5HA 2CJ9A 4B9XA 4Q6GA 3G6ET 2RK2A 2XI9A 3CXCA 4JLIA 4DA4A 1VQKA 2CS7A 1MHNA 5CVIA 3UDCA 1KC8U 1YBYA 3CC4T 4M7DB 3RMSA 4YRIA 4A4KA 1E1OA 2OAUA 4TQDA 5LJ3d 4P73C 4TQFA 3BW1A 1JRIA 3MEYA 3OBYA 2XDBA 2KMTA 4FSXA 3MP8A 2DTIA 3VYGA 3I7FA 5CO7A 2P0KA 1WYDA 4X9CA 3HL8A 4P74C 2LTOA 4X5OA 3EAEA 2E10A 3LGFA 2X4WA 1EIYB 4HT8A 1Q82U 3OYMA 4YRFA 1M1GA 2I4MA 1QVFA 3JCMP 2DDZA 3HXZA 1YITA 3LSQA 2WSCE 4PJOG 2QXFA 4R55A 1RL2A 3HFVA 5GAMf 1AHJB 3ME9A 4H2WA 4TVAA 5LJ3j 3X20B 4KR3A 4E7HA 4YCWA 1YGBA 1W66A 1D3BB 5CKFA 1WU7A 4ZIBA 5IAYA 2ZPGB 3RACA 1I5LA 3UT1A 2EJFA 3SB2A 1OYXA 3OS2A 4YRKA 4C92D 4RQEA 4EMKB 1WPYA 4P3NA 1GGMA 3QIIA 2QQAA 1L0WA 4M7DC 5EG2A 3OSVA 4XTZA 4KQEA 4C5HA 2LDMA 2JUFA 4WJ4A 2X35A 1VQPT 2HD0A 3CMEA 3RKWA 1BBWA 1Y71A 3QO8A 2O4XB 3HRUA 4C5IA 1QVGA 2KSSA 2OTJA 2Q5HA 3V8LA 4JRQA 2QHUA 3WQZA 4J15A 3X25B 3A8HB 2GF7A 4C0GA 2F69A 4FT4A 3FJPA 2M0OA 1X2HA 2P0PA 2G4CA 1LNXA 4PHCA 3GOXA 2E1HA 1YI2T 4M75E 2R5MA 4E51A 1X01A 1KC8C 2QEXA 1N6AA 1LYLA 4NL2A 2LVMA 3OA6A 4C8QD 1VQ9A 5ELNA 4M75G 2KAFA 3CD6A 4O6JA 5LJ3e 4P3OA 3RF1A 4E7LA 1JBMA 2A7YA 4M78D 3KBGA 2FL7A 3CPFA 4PLIA 3A8GB 4Y91A 1QF6A 2ZR3A 4UC4A 4C5EA 1S72T 4DOVA 2EFIA 4EMKC 3CCRA 3C12A 3HP9A 4PJOA 3JCMd 3A8MB 1X6OA 4BY6B 3JB9I 2FB7A 1VQ6A 3NELA 5C52B 4JJNK 3JCMQ 4G84A 4BI3A 4J7FA 3JCMg 2BIVA 4F7UE 2DXTA 3OYCA 3G6EA 1VIEA 3OS1A 4OB2B 2K3XA 4F7UG 1GXIE 1ZBXA 4YYEA 3JCMV 3E9GA 4YPFA 3JB9J 3BY7A 3RKXA 2Y4XA 1YJWT 2E5AA 3PFSA 3V7SA 2VXFA 2DIQA 1YHQA 2K3YA 4L87A 5K1PA 1NZ9A 2RA2A 3L2QA 3MHXA 4C0ZA 3OYLA 1VQKT 3TEHA 4YRNA 3WVDB 3QPHA 1YFTA 2KY9A 2DEQA 3OB9A 3JCMb 3MEVA 5GAN3 3JRZA 3M54A 4ZTJA 2VV5A 3QJYA 4X34A 2DJZA 2NS6A 3JB9F 2YHTA 4YCVA 3M53A 1YJ9A 3QZ9B 3J7AF 3QHSA 1G3YA 5GMKl 1VQ4A 4M7AE 5GAN7 3RKYA 4ZTFA 4IUTA 5A0GA 3A8LB 4M7AG 4E7KA 3A7RA 4MMKA 3J81E 1UGRB 5A0DA 4M7DD 4M75A 1BIAA 1VQLT 1WGSA 4PG3A 3URGA 3RESA 1YITT 2XKOC 4JLGA 2E12A 3V8JA 3S3NA 3A31A 1E24A 2DXCA 2QHVA 3CPWA 2RI2A 4TTVA 1Q7YU 1UGQB 3A7AA 5LJ5j 3JB9H 1VQ5T 4L6V5 3HXYA 4PL6A 4BDYA 1ASZA 4RMFA 4C0DB 2PUOB 4J8OA 4KUIA 5LJ3f 4C8QB 3OYKA 4F7UA 5FU7C 1Q86U 2K4YA 4M78B 4HWRA 3VUBA 2LCLA 2XG8D 3CCVT 4E47A 3JCMW 1U1SA 4YRQA 4ZGDB 1YI2A 3PMIA 2DZCA 1Z7MA 3PMTA 4XTXA 3CMET 3H6ZA 4H2UA 2ODRC 4VUBA 4PJOF 1VIFA 2RHZA 2DIGA 1DJ7B 2EQJA 2K5FA 2OTJT 1G5IA 5GAMh 4XEMA 4HWPA 4BB7A 5DY9A 2ZIOA 1JB0E 1V29B 1NNHA 4N4IA 1Y07A 1S72A 2DO3A 2XU8A 1NJ2A 2RHQA 2E3CA 3FB9A 3LLRA 2G3RA 2VUBA 2FYKA 2WSEE 2ZNIA 1SSFA 3CBPA 1KMNA 3T9NA 3FDRA 2QTXA 2I4LA 3V8KA 2RHSA 2QEXT 2PQWA 2MAMA 5D6YA 1QP2A 4RDXA 3A5ZB 3NFCA 1USYC 5GAN2 3CCEA 1X54A 2DQ3A 1WLEA 3DB4A 3S3OA 4LVIA 3E9HA 4M7AA 4N4GA 4C0DC 4OB3B 4UP8A 1QP3A 3NEMA 5LJ5e 1HXDA 3A5YA 4BUGA 5GANd 1M5Q1 2JN0A 3LGLA 2XDPA 1N8RU 2E41A 2KK4A 3CCRT 4Q15A 2RHUA 1UB4A 1WQ7A 2P0QA 1EQRA 4XQ3A 2ZCFB 1U8RA 3TEEA 2K57A 4ATOA 1K73U 4WI1A 1VQ6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P71 C;  1L0W A;  2XGT A;  2DTH A;  3VBB A;  1PYS A;  4M7D C;  4H2Y A;  2ZGW A;  2ZCE A;  1D3B A;  4RQF A;  4XTZ A;  1Y96 B;  4KQE A;  1NJ1 A;  4N0A C;  2I4N A;  3TEH B;  2I4O A;  3JCM e;  2Y90 A;  1U1T A;  4J6X A;  3QSU A;  2DKG A;  1N9R A;  3NET A;  4HWO A;  4XU3 A;  4WJ4 A;  1B8A A;  2J3L A;  3RKW A;  4CS4 A;  2DXU A;  1M8V A;  3HRK A;  1BBW A;  4H2T A;  3QNE A;  2DTO A;  3VQW A;  3QO8 A;  1KQ1 A;  4M77 G;  3QO5 A;  4UP7 A;  3EFS A;  4C92 F;  4EX5 A;  4M75 F;  2Q5H A;  3V8L A;  5GAO q;  2QHU A;  1LJO A;  5GAN j;  3IKL A;  4H2X B;  3WQZ A;  3PCO B;  1Y96 A;  2ZIM A;  5GMK e;  4J15 A;  3UGQ A;  3G1Z A;  5GAN 4;  5GAM j;  1B7Y A;  3A32 A;  4RCC A;  4P71 A;  2IY5 A;  3V7R A;  3FJP A;  2DZ9 A;  4M7D A;  3PGG A;  2ZZF A;  4C92 E;  1X2H A;  2G4C A;  1LNX A;  4PHC A;  1TH7 A;  5C51 B;  3ICA A;  2E1H A;  4N0A A;  4C92 B;  4YRT A;  4M75 E;  1EVK A;  2PME A;  5GMK i;  4EO4 A;  4E51 A;  1NJ5 A;  4PJO E;  1X2G A;  4M75 B;  1G51 A;  1YFS A;  2ZT5 A;  1X01 A;  4P75 A;  1IL2 A;  4PJO B;  5LJ5 d;  1B70 B;  2AKW A;  3CMQ A;  1LYL A;  4NL2 A;  4NOY A;  4V2S A;  4C92 G;  3GIB A;  4H2X A;  4C8Q D;  3M4G A;  3HXV A;  5ELN A;  4M75 G;  4H2S A;  4J6Y A;  5LJ5 g;  1HC7 A;  1YB3 A;  3A74 A;  2RB6 A;  5LJ3 e;  4P3O A;  3RF1 A;  3HXW A;  3RUX A;  1JBM A;  2P0L A;  3AHU A;  2ART A;  1NYR A;  4F7U F;  4M78 D;  3ERR A;  4YRP A;  2ZT8 A;  3E9I A;  4Y91 A;  4ZTU B;  3LSS A;  1QF6 A;  1ADJ A;  2ZR3 A;  2ALY B;  3V7C A;  4EMK C;  4XU1 A;  11AS A;  2P5I A;  3FIF A;  1EIY A;  3L4G B;  4PJO A;  3HFZ A;  3JCM d;  3JB9 I;  3JB9 G;  1H4Q A;  4OP0 A;  2FB7 A;  5GAO l;  3NEL A;  1Z7N A;  3LC0 A;  4UP9 A;  3JCM Q;  4G84 A;  5C52 B;  1KQ2 A;  3JCM g;  2PMF A;  3IG2 A;  4F7U E;  3VQV A;  2DXT A;  4C8Q F;  3P8T A;  4F7U B;  1B34 B;  4JRI A;  4O2D A;  2ZNJ A;  5GAO n;  5GMK m;  3QTC A;  2ZIN A;  4CH5 A;  4M78 F;  4F7U G;  5LJ5 h;  2ODR D;  4YRJ A;  4YYE A;  3JCM V;  3QUI A;  4YPF A;  1YFR A;  4OLF A;  3TUP A;  4PNO A;  4M7A D;  3JB9 J;  2DQ0 A;  4NL3 A;  4M77 E;  4P75 C;  3L2Z A;  2DVE A;  2CGH A;  3BY7 A;  1X56 A;  4YP0 A;  4XTU A;  3RKX A;  4BW9 A;  5GAN 5;  4K88 A;  4M77 B;  4C8Q E;  3RL6 A;  2E5A A;  2Q5I A;  3TEG A;  2AMC B;  2CJA A;  3JB9 D;  3V7S A;  5F5W A;  3REX A;  2VXF A;  4EMK A;  3SWN B;  5GAN 8;  4M78 E;  2DU5 A;  3RGL A;  2ZZG A;  4C8Q G;  5GAN e;  4L87 A;  1MGQ A;  5K1P A;  2RA2 A;  1NJ8 A;  3PZC A;  2Q7H A;  1E1T A;  3MF2 A;  4XTV A;  4YCU A;  1QE0 A;  3HFO A;  4QVD A;  3JCM h;  3HTZ A;  5LJ5 f;  3BDU A;  1C0A A;  5GAO p;  4C92 C;  5GAM e;  4M78 G;  3TEH A;  4TVW A;  1JJC B;  3M4Q A;  4YRN A;  4M75 C;  1HTT A;  3HSB A;  4YRG A;  3UGT A;  2EL9 A;  4M77 A;  4PJO C;  1YFT A;  4DQ2 A;  4CH4 A;  4M7A F;  2DEQ A;  1I4K 1;  2RM4 A;  3IAL A;  4K86 A;  4P72 A;  1KOG A;  3L1A A;  4DPG A;  4UPA A;  2AMC A;  5CAI A;  5I21 A;  3JCM b;  5KNN A;  5LJ3 g;  4YRL A;  2RHQ B;  2E65 A;  2EJG A;  2ZTG A;  5GAN 3;  4P3P A;  4QVC A;  4AH6 A;  1NYQ A;  2DJZ A;  4RCB A;  4JUV A;  4WF2 A;  3JB9 F;  1J5W A;  2YHT A;  2RHS B;  1E22 A;  4YCV A;  1EVL A;  4HVC A;  4EMG A;  5GMK h;  1BBU A;  3M4P A;  3NEN A;  12AS A;  3P8Y A;  3REU A;  3PCO A;  2EAY A;  4TWA A;  2RD1 A;  3JCM f;  4CH6 A;  3QHS A;  4CS3 A;  5GMK l;  4M7A E;  1I81 A;  5GAN 7;  1B76 A;  3HY1 A;  2YLB A;  3RKY A;  3JCM c;  4M7A B;  2E64 A;  1HK9 A;  3INZ A;  3VQX A;  2ARU A;  4XTW A;  2YLC A;  3OD1 A;  3P8V A;  4XEO A;  4XTY A;  3UH0 A;  4EMH A;  1ASY A;  1H4V B;  4M7A G;  3A7R A;  4C92 A;  4MMK A;  3RER A;  4K87 A;  1YCY A;  3HFN A;  4M7D D;  4YDQ A;  4ZTZ B;  4NCX A;  4M75 A;  1BIA A;  2CIM A;  1B70 A;  3QO7 A;  4PG3 A;  2ZT6 A;  4YRE A;  1N9W A;  3HXU A;  5ELO A;  4WJ3 M;  3RES A;  4YRO A;  4J6W A;  3V8J A;  3HRI A;  1PYS B;  4A53 A;  1LOJ A;  3QO3 A;  3A31 A;  1E24 A;  2QHV A;  4M77 C;  2DU7 A;  4P72 C;  3DSQ A;  4TTV A;  3UFG A;  4C8Q C;  2ALY A;  3A7A A;  1RIQ A;  1KMM A;  5LJ5 j;  3BJU A;  3JB9 H;  4P74 A;  2VXE A;  3SWN C;  4YRM A;  1SET A;  3HXY A;  5GAN g;  4CH3 A;  1H64 1;  5GAM d;  4A54 A;  3L4G A;  5E3I A;  1ASZ A;  4RMF A;  1SES A;  4M7D F;  4M78 C;  3MF1 A;  2ZXF A;  5LJ3 f;  4PJO D;  5GAM g;  1H4T A;  2Q7E A;  1G5H A;  2CJ9 A;  4C8Q B;  5C53 B;  5K1X A;  4Q6G A;  1ATI A;  4F7U A;  2ZZE A;  1B34 A;  4JLI A;  2ZT7 A;  1N9S A;  2Q7G A;  4M78 B;  5HGQ A;  1FYF A;  4HWR A;  1EFW A;  3A7U A;  1USY A;  1BIB A;  4G85 A;  1B7Y B;  1SER A;  4XU2 A;  4M7D E;  2IY5 B;  4HT9 A;  4M7D B;  3JCM W;  4YRI A;  1E1O A;  1U1S A;  4TQD A;  5LJ3 d;  4P73 C;  4TQF A;  4YRQ A;  3BW1 A;  1JRI A;  5GAO m;  3MEY A;  2DZC A;  1Z7M A;  4TVY A;  4XTX A;  4CS2 A;  4C8Q A;  4M7D G;  1NJ6 A;  4H2U A;  2ODR C;  2AKW B;  2CJB A;  2EWN A;  4PJO F;  3SWN A;  3R07 A;  3VQY A;  1H4S A;  3JCM X;  5GAN h;  2DTI A;  4HA8 A;  3I7F A;  4M7A C;  2HNI A;  4YRC A;  4M78 A;  1WYD A;  1G5I A;  4HWT A;  5GAM h;  5GMK j;  2J3M A;  3KFU A;  4XEM A;  4HWP A;  4TVA B;  5DY9 A;  4X9C A;  2ZIO A;  4P74 C;  1JJC A;  2VC8 A;  1NNH A;  4X5O A;  3JCM J;  3VU3 C;  2XTI A;  1WQW A;  2E10 A;  1EIY B;  1NJ2 A;  1X55 A;  3EFR A;  2RHQ A;  4H02 A;  2EJ9 A;  2E3C A;  3FB9 A;  3HFZ B;  4M77 D;  4YRS A;  4HT8 A;  2FYK A;  3HY0 A;  2QHS A;  2ZNI A;  5GAN f;  4XU0 A;  4YRF A;  2I4M A;  3JCM P;  2DDZ A;  1KMN A;  2ARS A;  4MML A;  2QTX A;  2I4L A;  3V8K A;  2RHS A;  3HXZ A;  2ZR2 A;  3LSQ A;  4PJO G;  4P73 A;  1SRY A;  2C7I A;  3W3S A;  3HFV A;  4X9D A;  5GAM f;  4RDX A;  4J5Y A;  4H2W A;  1WNL A;  4JRK A;  4TVA A;  5LJ3 j;  5LJ3 h;  1USY C;  5GAN 2;  1X54 A;  1ADY A;  2DQ3 A;  1WLE A;  3RIR A;  4KR2 A;  3E9H A;  4KR3 A;  3HXX A;  4M7A A;  4YCW A;  1YGB A;  4H2V A;  1W66 A;  1D3B B;  1WU7 A;  4ZIB A;  4UP8 A;  3NEM A;  5LJ5 e;  1HXD A;  3A5Y A;  5GAN d;  4HWS A;  1M5Q 1;  2JN0 A;  3RAC A;  4YRR A;  1I5L A;  4BWA A;  5GAN 6;  3IKM B;  2QHT A;  2EJF A;  3BFM A;  2I2L A;  3SB2 A;  2C8M A;  2E41 A;  4M77 F;  1I8F A;  4Q15 A;  1WQ7 A;  1EQR A;  4YRK A;  4C92 D;  4RQE A;  4XQ3 A;  4EMK B;  1WPY A;  5GAO r;  4LNS A;  2K57 A;  3A5Z A;  4M75 D;  4P3N A;  1VQZ A;  4WI1 A;  1GGM A;  1EOV A; 
#chains in the Genus database with same CATH topology
 2XGT A;  2DTH A;  5CIU A;  2RJF A;  1H92 A;  3E19 A;  4H2Y A;  2ZGW A;  4KUD K;  3OYF A;  1Y96 B;  1NJ1 A;  2AKL A;  5KCO A;  2I4N A;  2HZY A;  2JVV A;  3TEH B;  2RQV A;  2Y90 A;  1U1T A;  4J6X A;  2EW3 A;  3QSU A;  3M57 A;  2K2M A;  2MWP A;  1VQM A;  1N9R A;  1FXX A;  1RAA B;  4XU3 A;  1VQN A;  2NUT B;  2VYT A;  2OTL T;  4E7S A;  4CS4 A;  3CCL Q;  2VVK A;  4EPC A;  5I2S A;  3HRK A;  3QNE A;  5HK0 A;  1Q7Y C;  4M77 G;  3QO5 A;  4ZGJ B;  3EFS A;  2HSE B;  4EX5 A;  2AIR B;  4OMO A;  4M75 F;  4A4G A;  1LJO A;  5LL6 S;  5GAN j;  4H2X B;  3A8O B;  1JXO A;  4NS5 A;  1VQO T;  1YHQ T;  3G1Z A;  2R5A A;  2NLU A;  2CUD A;  2E6Z A;  4ELY C;  1X6G A;  3X28 B;  1VQ8 Q;  1WJS A;  4Y28 E;  3CXC P;  2QDL A;  2KRM A;  2FPE A;  4P71 A;  1P92 A;  5CK9 A;  1X69 A;  1Q86 C;  5KCH A;  1TH7 A;  5C51 B;  4N0A A;  1EVK A;  2P84 A;  3IQL A;  5GMK i;  7AT1 B;  5HKC A;  4PJO E;  4M75 B;  1G51 A;  2LQK A;  4FU6 A;  2ZPH B;  2X3X D;  2V8I A;  4GBQ A;  3QDR B;  2AKW A;  2RO0 A;  1VQL A;  4V2S A;  4TVR A;  3C94 A;  3M4G A;  3WVE B;  3I5S A;  2LP5 A;  4J6Y A;  1M4Z A;  2CKK A;  3CCJ Q;  4BI4 A;  5KYW A;  1O75 A;  2CSI A;  1YJ9 T;  2B8A A;  2P0L A;  1RAH B;  4F7U F;  1WYX A;  4FL6 A;  1IXD A;  2LT4 A;  2QG9 B;  4YRP A;  2ZT8 A;  3LSS A;  1VQ4 T;  1ADJ A;  3CCS T;  2C0T A;  2DAQ A;  3CQT A;  1VQ5 A;  2DNU A;  3FIF A;  2QQR A;  1B07 A;  3RMQ A;  2O01 E;  2JM9 A;  5I2M A;  3HFZ A;  3EG1 A;  5CR2 A;  4HVW A;  1F1B B;  1G3T A;  4JDS A;  3SD4 A;  1G3W A;  3QDF A;  3L2W A;  3IG2 A;  1UG1 A;  4L59 A;  1TU0 B;  2AT1 B;  4F7U B;  1YFN A;  3G71 Q;  1JJ2 A;  2CYZ B;  3OW2 P;  5GAO n;  1QVF P;  5GMK m;  5KE3 A;  3QTC A;  1WHL A;  4KRT A;  5CKB A;  2PVG B;  1U06 A;  2CT4 A;  2DM1 A;  2LQW A;  2ODR D;  1WI7 A;  2CP3 A;  3CCV A;  1IZ6 A;  2CZ1 B;  3NTK A;  3QUI A;  2C0O A;  3MET A;  4OLF A;  3I9Q A;  4P75 C;  3L2Z A;  2DMO A;  2CGH A;  2DVE A;  4YP0 A;  3SEM A;  5GAN 5;  4K88 A;  1M1F A;  2LJ3 A;  2VB6 A;  2CJA A;  3JB9 D;  3GNG A;  2NUZ A;  2DL4 A;  5GAN 8;  2AZV A;  3MKD A;  1PM3 A;  1NG2 A;  3H8Z A;  2DU5 A;  2NWM A;  1W2B P;  1N8R C;  5GAN e;  2RF0 A;  1MGQ A;  1NJ8 A;  3JSC A;  5FLX E;  3PZC A;  2FEI A;  1IRE B;  4FW1 A;  1KD1 U;  1E1T A;  2KRS A;  3HFO A;  4KGZ B;  4QVD A;  1YIJ A;  2JNG A;  5LJ5 f;  4D8K A;  2JTF A;  3LYI A;  3M0U A;  1K73 C;  4TVW A;  3CXC S;  4GLK A;  4M75 C;  2K79 A;  4A4E A;  1HTT A;  4IIM A;  4J9D A;  4M77 A;  5CKE A;  4M7A F;  1I4K 1;  1WXT A;  2LJ1 A;  4K86 A;  4P72 A;  1KOG A;  2EYX A;  2W10 A;  3L1A A;  5KE2 A;  4DPG A;  4UPA A;  2XHC A;  3BDL A;  2AMC A;  5KNN A;  4YRL A;  2RHQ B;  2E65 A;  2D6F A;  2EJG A;  4JRP A;  2ZTG A;  2M9U A;  2P4T A;  2COY A;  4OMQ A;  1ZSZ B;  1J5W A;  3EH2 A;  4MDX A;  2DX1 A;  2RHS B;  5J3B A;  3LX7 A;  4MZT A;  4ZN3 A;  1ZBJ A;  3EG2 A;  3FJ5 A;  1Z9Z A;  4HVC A;  3NEN A;  1UEC A;  3H9N A;  4ZN1 A;  4TWA A;  2RD1 A;  4CRI A;  4CH6 A;  5L23 A;  1JXM A;  1I81 A;  1X43 A;  1VA7 A;  1QVG P;  3HY1 A;  1MMD A;  3VRY A;  4M7A B;  1NM7 A;  1HK9 A;  5D7U A;  3INZ A;  1Q7Y R;  1BI1 A;  1BI0 A;  3OD1 A;  3P8V A;  1MNE A;  1NLO C;  4XTY A;  3UH0 A;  1U3O A;  4EMH A;  3OS0 A;  2QAS A;  1ASY A;  2V8J A;  5IH2 A;  3I55 Q;  4D8D A;  3M55 A;  2F5T X;  1VYT A;  2K5L A;  4LE9 A;  2A0F B;  1ZHI A;  3C4S A;  4NCX A;  4RG2 A;  1PRM C;  2EYQ A;  2D8J A;  1B70 A;  3CCM A;  3S3M A;  4B6M A;  1SHF A;  5KYU A;  1ZSG A;  2GBQ A;  1M1K U;  3I56 Q;  3TVT A;  4A63 B;  1AT1 B;  3HXU A;  4WJ3 M;  1WZO A;  1NJI U;  4YRO A;  1Q86 R;  3E1S A;  3JAM E;  3HRI A;  2BZY A;  2LX7 A;  3OW2 S;  1LOJ A;  1W6X A;  2LRQ A;  1YWO A;  3OYG A;  2RQR A;  1Q82 C;  1ABO A;  5J26 A;  3CCE T;  2DLP A;  1BI3 A;  2M02 A;  3FLG A;  3HKS A;  2C06 A;  2EBP A;  5CQX A;  1KMM A;  1RIQ A;  3G4S A;  2OTL A;  4P74 A;  4YRM A;  1GBQ A;  2DD4 A;  1H64 1;  5GAM d;  4A54 A;  3L4G A;  4PK4 A;  1ZQ1 A;  3QXE B;  3MF1 A;  3VS6 A;  5IHN A;  5DLQ E;  1OZ2 A;  1X27 A;  4PJO D;  5GAM g;  4ELZ C;  1QW1 A;  4FW2 A;  5C53 B;  4J9C A;  5K1X A;  2WAC A;  1IRX A;  2ED1 A;  4JPB W;  1B7T A;  5KYY A;  1T3L A;  1ATI A;  1W2B S;  4BAC A;  2YDL A;  2ZT7 A;  2X4J A;  1N9S A;  1VQO A;  3CCU T;  4RKU E;  2Q7G A;  5HGQ A;  1YIT Q;  1EFW A;  4E7I A;  3A7U A;  2BTT A;  4YTL A;  2JTE A;  1BIB A;  2EKH A;  4G85 A;  1SER A;  2E4H A;  1AZE A;  1QCF A;  1AVZ C;  4QQD A;  3OSS C;  5FU7 B;  6AT1 B;  2XDD A;  5GAO m;  3CCQ Q;  1VQM T;  1VQN T;  4CS2 A;  4R56 A;  1KHI A;  3NTH A;  2YUQ A;  2DYI A;  1PC0 A;  2H3E B;  4OMM A;  2ZPE B;  1YP5 A;  2AKW B;  2CJB A;  1GL5 A;  2H3J A;  3SWN A;  3R07 A;  1H4S A;  1QCO A;  4OF1 A;  4M7A C;  3G7Z A;  4PLL A;  4YRC A;  4ZGE B;  2KDS A;  2E5Q A;  5CQY A;  3PNW C;  3KXT A;  2O88 A;  2EKO A;  2ZPB B;  1MMA A;  3R6N A;  5GMK j;  1NLP C;  2P4R A;  2RHY A;  3KFU A;  3NTI A;  4TVA B;  1QVG S;  2FZG B;  3REB B;  1K0S A;  3LWH A;  2EQM A;  2VC8 A;  2CZ6 B;  4A4H A;  4AFU C;  3CCS A;  1NPP A;  1AEY A;  3E2U A;  4IUR A;  3VU3 C;  2XTI A;  1WQW A;  1KD1 C;  4KGV B;  3HPW A;  1RI0 A;  1G8X A;  4PKC C;  1X55 A;  1N8R R;  4WCI A;  4BD3 A;  3EFR A;  2EJ9 A;  3F70 A;  3HFZ B;  2WSF E;  4DBR A;  4YRS A;  1YCS B;  4LDV A;  2L3S A;  3SHW A;  3HY0 A;  5GAN f;  4XU0 A;  1C1A A;  1G3S A;  1GCQ A;  1Y7X A;  3OY9 A;  1K73 R;  1PHT A;  2JZ2 A;  2PNI A;  2RNA A;  2C7I A;  4J5Y A;  5FU6 C;  1WNL A;  4JRK A;  3M0P A;  3CCL A;  1IHW A;  1OOT A;  3P8B B;  4RTZ A;  3ZEH A;  3HXX A;  1WFW A;  1PD0 A;  3A1P A;  4H2V A;  1BI2 A;  2NUP A;  2RQU A;  4Q5W A;  3UF4 A;  3OYH A;  4XK8 E;  4HWS A;  2DIL A;  2RQT A;  1WLP B;  1PD1 A;  1H3Z A;  4YRR A;  4BWA A;  2M1H A;  5GAN 6;  3IKM B;  1OUL A;  3BFM A;  4M77 F;  2DA9 A;  1K9A A;  4KT0 E;  5HCK A;  3GP8 A;  1UEB A;  4M75 D;  2QQS A;  9ATC B;  2PZ1 A;  1Y57 A;  1EOV A;  1MV0 B;  4P71 C;  1RLP C;  4R0K A;  4HCK A;  3VBB A;  1PYS A;  3PTA A;  3M0Q A;  2HQH A;  2BE9 B;  4IUU A;  1D3B A;  2ZCE A;  5FRM A;  4RQF A;  4N0A C;  1VQ9 Q;  2L5Q A;  3CD6 Q;  1M1K C;  3JCM e;  1D0Z A;  3CEY A;  1NJI C;  4LVL A;  3EHR A;  2J3L A;  1G2B A;  3H41 A;  2RPN A;  2DXU A;  4H2T A;  2DVJ A;  2DTO A;  1M27 C;  3VQW A;  3TCJ A;  1KQ1 A;  1BYM A;  4UP7 A;  4LDU A;  3OBW A;  4P5N A;  3QG1 A;  1WDX A;  5IT9 E;  4J83 A;  5KH6 A;  3P8D A;  2DEU A;  3IKL A;  2ZIM A;  2R58 A;  1UGV A;  5GMK e;  3UGQ A;  1QMC A;  3P8H A;  3G6E Q;  1B7Y A;  1M2O A;  2YRD A;  1T3S A;  4RCC A;  1YIJ T;  3L2V A;  1PG5 B;  2KE9 A;  2IY5 A;  3V7R A;  2QAZ A;  1J3T A;  3PGG A;  3OYB A;  4C92 E;  1KQS P;  4JS5 A;  3ICA A;  4QQ6 A;  1BB9 A;  2RI5 A;  4EO4 A;  1SKU B;  4LDX A;  1NJ5 A;  1X2G A;  3R6O A;  3UAT A;  3CC4 Q;  2ZPF B;  1K76 A;  4PJO B;  1B70 B;  2KEA A;  4KH1 B;  4WTO B;  4NOY A;  3DKM A;  5CCA A;  4C92 G;  1VUB A;  4IUV A;  4H2S A;  4DBF A;  1R0C B;  4LN2 A;  3A74 A;  2RB6 A;  1OEB A;  4HCC A;  3LW5 E;  2ART A;  2M16 A;  2DE0 X;  4ZTU B;  4J7I A;  4Z88 A;  2LX9 A;  4LD9 K;  1D1A A;  1G5V A;  2LCS A;  2F2W A;  2P5I A;  3L4G B;  2C0I A;  2HL5 C;  4IUP A;  2RJE A;  3JB9 G;  1H4Q A;  4OP0 A;  5GAO l;  1Z7N A;  3LC0 A;  4UP9 A;  4PJN A;  3MP1 A;  2PMF A;  2F5K A;  4D6W A;  2LT1 A;  5KYY B;  3CCM T;  3P8T A;  5L8R E;  4KBM B;  2ROT A;  4O2D A;  2ZNJ A;  3KFV A;  1KD1 R;  3CC2 T;  3CCU A;  2FO0 A;  2RN8 A;  2ZIN A;  4CH5 A;  2ZZD A;  2EYY A;  2COZ A;  5LJ5 h;  2A08 A;  2OAW A;  1WA7 A;  1VQ7 T;  4LVJ A;  2A37 A;  4M7A D;  2AHJ B;  4NL3 A;  4M77 E;  4BW9 A;  1X56 A;  4XTU A;  1UJY A;  2IIM A;  4HCZ A;  4F04 B;  3EGU A;  4C8Q E;  3RL6 A;  1C0M A;  4FT2 A;  3G4S T;  3VUZ A;  2BKD N;  1I0C A;  5F5W A;  2EIF A;  3OYY A;  2DYB A;  3SWN B;  3VS5 A;  2D0N A;  4M78 E;  3H0H A;  4C8Q G;  2M0Y A;  3I55 A;  3UWN A;  4CI0 C;  3CMA T;  4ME7 A;  1H3H A;  2Q7H A;  3N5B B;  4XTV A;  1QE0 A;  3NMZ C;  2D0Q B;  1CKA A;  3MEU A;  1C0A A;  5GAO p;  2KNB B;  4M78 G;  2JTM A;  5IN1 A;  3M4Q A;  1K0X A;  2E70 A;  3OYI A;  3HSB A;  4YRG A;  1EZZ B;  3PVL A;  3ZBD A;  4PJO C;  4CH4 A;  2O9V A;  3I56 A;  2RM4 A;  1KQS S;  4F17 A;  5CAI A;  2RMO A;  1T0J A;  5LJ3 g;  1WHM A;  1SPK A;  4P3P A;  1UDL A;  3CC7 T;  1IGQ A;  3EGX A;  2KQW A;  4JUV A;  2HQX A;  2COW A;  1VQP Q;  2XK0 A;  1YJN T;  4KUL A;  5HY6 A;  1NYG A;  4CC2 A;  1M1K R;  3TRE A;  1O9S A;  4EIK A;  1NJI R;  2AZS A;  3PCO A;  2QA4 T;  3JCM f;  5FRO A;  1R77 A;  1XQH A;  2IG0 A;  4RMO A;  2E64 A;  4MZM A;  3VQX A;  3PVQ A;  3DB3 A;  1N27 A;  2YRV A;  2YLC A;  2QI2 A;  1FYN A;  4XEO A;  4OB0 B;  2FZC B;  4RUG A;  1BKB A;  1KSW A;  4C92 A;  2DD5 A;  3OW2 A;  2MPX C;  3HFN A;  5I11 A;  4BE0 A;  4RG8 A;  2CIM A;  1M3B A;  4CC3 A;  2EQU A;  3RNJ A;  4HKE A;  1M30 A;  1YI2 Q;  2E5K A;  2FHD A;  5KYX A;  3MEW A;  2VKN A;  5GJW B;  3OYD A;  1Q81 U;  4J6W A;  1K8A U;  1RAC B;  1WXU A;  1PYS B;  3CCQ A;  4A53 A;  2ESW A;  2PU9 B;  2RK1 A;  4HT4 A;  3QO3 A;  4LDY A;  5FWB A;  1GCP A;  3CCL T;  4JJB A;  3VYH B;  4IIO A;  5EC7 A;  4OGC A;  2AK5 A;  3CBO A;  2ALY A;  3ZL7 C;  1W2B A;  2CZ7 B;  3SWN C;  3OYJ A;  2RJD A;  4FIB A;  4CH3 A;  3VKI A;  2FRY A;  5HK3 A;  2JOY A;  1FWZ A;  4GLM A;  3E9F A;  2ZXF A;  4RTU A;  1S72 Q;  4BI8 B;  1H4T A;  2GFA A;  3MCA B;  2BE7 D;  2OI3 A;  3GPL A;  4C0F A;  4JS4 A;  2Z0W A;  1VQ8 T;  2ABL A;  1D0X A;  1B34 A;  2ZZE A;  1NE8 A;  3NHN A;  1FYF A;  1AWO A;  2XIC A;  1USY A;  1B7Y B;  4XU2 A;  1JJ2 P;  4M7D E;  1TTH B;  1ZX6 A;  2HQE A;  2IY5 B;  4HT9 A;  1Z9Q A;  1GCQ C;  3VJP A;  3M0T A;  1QWE A;  4DOW A;  2FPF A;  4TVY A;  2BZX A;  3OMG A;  3RBB B;  2QQB A;  4C8Q A;  3CCJ T;  3PT9 A;  4M7D G;  1NJ6 A;  2D8H A;  1M3C A;  2FRW A;  3QYH B;  1SEM A;  2ENM A;  1WXB A;  2EWN A;  3VQY A;  3JCM X;  5GAN h;  4HA8 A;  8AT1 B;  4FYV B;  3FC3 A;  1YJW Q;  2HNI A;  1SHG A;  1GBR A;  3CBM A;  1OI1 A;  4M78 A;  2M51 A;  2G6F X;  1LCK A;  4O5V A;  3VS2 A;  4HWT A;  2KRO A;  4IKF A;  2J3M A;  1UHF A;  1RAF B;  2XD0 A;  2DL3 A;  5AYF A;  3OYE A;  1JJC A;  3UA6 A;  3JCM J;  4FYX B;  3Q1J A;  4J9E A;  1TUG B;  5D6X A;  2K5I A;  1VQK Q;  4Z02 A;  1XTD A;  3LWI A;  4H02 A;  3M9Q A;  4M77 D;  1PSF A;  3OQ5 A;  3G71 T;  1M2V B;  2QHS A;  2DRK A;  2ZPI B;  2ARS A;  4MML A;  4P73 A;  3RDV A;  2ZR2 A;  1NPR A;  2YRC A;  4EDU A;  1SRY A;  4F16 A;  2HL3 A;  3W3S A;  4X9D A;  1KG1 A;  3FEO A;  1UGP B;  4LD6 A;  3A98 A;  2HMA A;  3CC2 A;  5LJ3 h;  3NPF A;  2DPP B;  5A0L A;  2KR3 A;  3FRN A;  1ADY A;  3SFM A;  2RHI A;  1QLY A;  3RIR A;  2D9T A;  4KR2 A;  1JQQ A;  1M90 U;  3GLX A;  3MJX A;  3TU4 K;  1QVF S;  2V8K A;  1EIF A;  2HEQ A;  2A36 A;  1VQ7 A;  2PUK B;  1KK7 A;  2DFU A;  5FU6 B;  4J9I A;  3C0C A;  3EFO A;  4C5G A;  2QHT A;  1WJR A;  2RH2 A;  2I2L A;  3ULR B;  2LNV A;  2C8M A;  1I8F A;  3HRS A;  1MMG A;  2LNH B;  4K11 A;  4HCB A;  3DLL A;  5GAO r;  3VRZ A;  4LNS A;  3A5Z A;  2CH4 W;  1VQZ A;  3H0F A;  4JZ4 A;  2VWF A;  3DLM A;  3M58 A;  3CMA A;  3U23 A;  1VQL Q;  1PKS A;  4MDW A;  2JT4 A;  1I1J A;  3CC4 A;  2EVR A;  4KH0 B;  2CP6 A;  3MEA A;  2HCK A;  2I4O A;  4OMF B;  3QBY A;  4AG2 C;  2O9S A;  1JJ2 S;  2J6F A;  2DKG A;  1Q81 C;  1K8A C;  2QYZ A;  3NET A;  4HWO A;  3M56 A;  1B8A A;  1E6G A;  2YSQ A;  3EG9 A;  3OYA A;  4AFS C;  1M8V A;  4BE2 A;  2GQV A;  2GFU A;  3UPU A;  3D7S B;  3CC7 A;  3GNF B;  1QKW A;  2FZK B;  3M4Y A;  5M9O A;  2R57 A;  1ZUU A;  4C92 F;  1VQ5 Q;  1YJN A;  2CSQ A;  1GFC A;  2JM8 A;  1K9M U;  1M3A A;  2FVU A;  5GAO q;  1TUC A;  4JJC A;  2QA4 A;  3PCO B;  4LXC A;  1Y96 A;  5GAN 4;  4OMP A;  3I55 T;  5KYW B;  1YNZ A;  2HBP A;  4QT7 A;  5GAM j;  1XNI A;  1D1C A;  3A32 A;  2KRN A;  1NYF A;  3X26 B;  1I5O B;  2K9G A;  1E7O A;  4M7D A;  2DZ9 A;  2ZZF A;  1YWP A;  3GF5 A;  5IXB A;  2HAX A;  2CDT A;  4C92 B;  4YRT A;  3SDZ A;  1JU5 C;  2PME A;  3I56 T;  3CCV Q;  1YFS A;  4P75 A;  2ZT5 A;  2LC4 A;  1IL2 A;  1IB8 A;  5LJ5 d;  3CMQ A;  3X24 B;  2LCC A;  4A4F A;  1XOV A;  2MMP A;  3GIB A;  2LQN A;  1PWT A;  2KBT A;  4H2X A;  1KIK A;  4Z89 A;  3HXV A;  5KYX B;  1UE9 A;  3QJ6 A;  5LJ5 g;  3CME Q;  1HC7 A;  2ED0 A;  1YB3 A;  1RAI B;  1AWX A;  2HBW A;  3MO8 A;  3HXW A;  3RUX A;  2CP2 A;  3M5A A;  2QDY B;  4QQG A;  3AHU A;  4BY6 C;  2ROL A;  1K1Z A;  2BUD A;  1NYR A;  1GRI A;  3ERR A;  4FM4 B;  3E9I A;  1AZG B;  2ECZ A;  3HHT B;  5CKH A;  2RJC A;  3WXM B;  5DLO A;  2OTJ Q;  2ALY B;  3V7C A;  1WIE A;  1TUD A;  1YIJ Q;  4XU1 A;  11AS A;  2A3L A;  2MF2 A;  3VV0 A;  2PVD B;  1WJQ A;  3PE0 A;  1EIY A;  5IXF A;  2MIO A;  4FYY B;  1NBE B;  4LVK A;  4AFZ C;  2LQ8 A;  2L2P A;  2JJ9 A;  3S6W A;  3QYG B;  2MI6 A;  3MP6 A;  2J6K A;  1CSK A;  1ZLM A;  4QW2 A;  3EGD A;  1KQ2 A;  3L2R A;  2ZAE A;  3VQV A;  2JS2 A;  4C8Q F;  2ATC B;  1VQ8 A;  1W4S A;  1B34 B;  4JRI A;  1FMV A;  2K3B A;  1K4U S;  1D09 B;  2QEX Q;  5A2Q E;  4M78 F;  1KJW A;  3CCQ T;  1VQP A;  4YRJ A;  1YFR A;  2MK5 A;  3TUP A;  2DJQ A;  1WHK A;  4PNO A;  4II1 A;  2OX7 A;  2VGN A;  3QWX X;  2MCN A;  4AG1 C;  2DQ0 A;  4HVV A;  1ABQ A;  2EGA A;  1QVP A;  4BE1 A;  1M90 C;  4M77 B;  3CCJ A;  2Q5I A;  3TEG A;  1AWJ A;  3PIP A;  2AMC B;  1PSE A;  3CPW P;  3ER0 A;  2CH4 A;  3REX A;  2GGR A;  1WHH A;  2Y4Y A;  4B9W A;  4EMK A;  2E3H A;  1NEB A;  4BDZ A;  4L5G A;  2L3Q A;  4PFO A;  3RGL A;  2X4X A;  3M59 A;  2ZZG A;  3CCR Q;  4N4H A;  1M8M A;  1KQS A;  2GCX A;  2RI3 A;  3QWY A;  3CCM Q;  3MF2 A;  4M4Z A;  4YCU A;  2H8H A;  3JCM h;  2L89 A;  3HTZ A;  3BDU A;  1ACM B;  1BU1 A;  2V26 A;  1FMK A;  4C92 C;  1VQ6 Q;  5GAM e;  1X75 C;  2L8D A;  2KGT A;  1ARK A;  1JJC B;  1FX7 A;  1JO8 A;  3UGT A;  2KVQ G;  2IVW A;  4OGE A;  2EL9 A;  4DQ2 A;  3MQZ A;  4HXJ A;  2RHX A;  3IAL A;  5CKD A;  5I21 A;  1M9S A;  2DXB A;  1X2K A;  4QVC A;  3G71 A;  4AH6 A;  2L3R A;  2O4X A;  1NYQ A;  4MZP A;  4RCB A;  3LH0 A;  4WF2 A;  2OTL Q;  1E22 A;  3J80 E;  2DK3 A;  1EVL A;  4OB1 B;  2GNC A;  3L42 A;  4EMG A;  5GMK h;  1BBU A;  3M4P A;  5KYU B;  1Q81 R;  2JMA A;  1K8A R;  3OYN A;  12AS A;  2EQK A;  2K2V A;  3P8Y A;  2EAY A;  3REU A;  2A8E A;  4XAX B;  4CS3 A;  3HTR A;  3ZFJ A;  2JMC A;  1UTI A;  3OS5 A;  1R8O B;  2CZ0 B;  3QKJ A;  1B76 A;  1K9M C;  2YLB A;  2PVO B;  3I5R A;  4JJD A;  3JCM c;  4FSS A;  3PIO A;  1OZ3 A;  1UGS B;  3OMC A;  2ARU A;  4XTW A;  2LZ6 B;  3NGP A;  1KHC A;  5GJV B;  1VQO Q;  1YHQ Q;  1H4V B;  3EFO B;  3O8V A;  5DM7 R;  5FRN A;  5D6W A;  3RER A;  2K7A A;  1ZSZ A;  5C0M A;  4K87 A;  1RAE B;  1YCY A;  4YDQ A;  4ZTZ B;  3L2U A;  3JV3 A;  2CRE A;  8ATC B;  3EHQ A;  1W70 A;  1IHV A;  3QO7 A;  4IUQ A;  4RTV A;  3HRT A;  2ZT6 A;  4YRE A;  1VQ9 T;  2VGM A;  5C6S A;  1N9W A;  3CD6 T;  2QQ9 A;  5ELO A;  4E7J A;  1NEG A;  4ZNX A;  2XID A;  4ORZ A;  4LVM A;  3C95 A;  2X4Y A;  3ASK A;  4M77 C;  2DU7 A;  4OVA A;  4P72 C;  3DSQ A;  3UFG A;  4C8Q C;  2E6N A;  3QZ5 B;  4QVZ A;  2QTV A;  1YJ9 Q;  1YJW A;  2QGF B;  3BJU A;  2VXE A;  4GY5 A;  1SET A;  2MWO A;  5GAN g;  3KUF A;  5E3I A;  5J39 A;  4LDW A;  1EFN A;  1VQ4 Q;  1SES A;  4M7D F;  4M78 C;  3CCS Q;  4AMC A;  3CPW S;  2Q7E A;  1G5H A;  2CJ9 A;  5IHK A;  4B9X A;  2DL8 A;  4Q6G A;  3G6E T;  2YUO A;  1OPL A;  1QQJ A;  1UHC A;  2RK2 A;  2XI9 A;  3CXC A;  4JLI A;  4DA4 A;  1VQK A;  2CS7 A;  1MHN A;  2K6D A;  1QWF A;  1VYU A;  2D1X A;  1RUW A;  5CVI A;  3UDC A;  1KC8 U;  1YBY A;  3CC4 T;  4M7D B;  3RMS A;  4YRI A;  4A4K A;  1E1O A;  2OAU A;  4TQD A;  5LJ3 d;  2CUB A;  4P73 C;  2B86 A;  4TQF A;  3BW1 A;  1JRI A;  3MEY A;  4ANJ A;  2QK0 A;  3OBY A;  4ESR A;  2XDB A;  1OV3 A;  4FSX A;  2KMT A;  3MP8 A;  3THK A;  2O31 A;  2DTI A;  3VYG A;  3I7F A;  1RAG B;  2HKN A;  5CO7 A;  2P0K A;  1WYD A;  1TWB A;  4JZ3 A;  4AT1 B;  1MV3 A;  2XMF A;  1SRM A;  4AFQ C;  2YXY A;  1M90 R;  1V1C A;  1FMW A;  4X9C A;  3HL8 A;  2EYZ A;  1AWW A;  4P74 C;  2LTO A;  4X5O A;  3EAE A;  2BZ8 A;  2L3P A;  2E10 A;  2MOX A;  2NUP B;  3LGF A;  2X4W A;  1EIY B;  2GQI A;  2GTO A;  4HT8 A;  4J9F A;  1Q82 U;  3OYM A;  4OML A;  4YRF A;  1M1G A;  2I4M A;  1QVF A;  3JCM P;  2DDZ A;  2X51 A;  2VAS A;  3EGD B;  3HXZ A;  1YIT A;  1LVK A;  3LSQ A;  1PRL C;  2WSC E;  4PJO G;  2QXF A;  3TSZ A;  2PTK A;  4R55 A;  1RL2 A;  3HFV A;  5GAM f;  1AHJ B;  3ME9 A;  4H2W A;  4TVA A;  5LJ3 j;  3O5Z A;  4DBQ A;  3X20 B;  1ZA2 B;  4KR3 A;  3EG0 A;  4E7H A;  4E2F B;  4YCW A;  1YGB A;  1W66 A;  1D3B B;  5CKF A;  1WU7 A;  4ZIB A;  1V76 A;  5IAY A;  1E6H A;  2ZPG B;  1SSH A;  3RAC A;  2J06 A;  1UJ0 A;  1I5L A;  3UT1 A;  4LUD A;  2EGC A;  2EJF A;  2KXD A;  3SB2 A;  1OYX A;  2IPO B;  3OS2 A;  4LNP A;  4YRK A;  4C92 D;  4RQE A;  4EMK B;  1K9M R;  2J7I A;  1X2Q A;  1WPY A;  2F1L A;  3I35 A;  4P3N A;  3MPU B;  1QKX A;  1GGM A;  2KT8 A;  2YUP A;  3QII A;  1WX6 A;  2QQA A;  1L0W A;  2HDA A;  4M7D C;  5EG2 A;  1UFF A;  3OSV A;  3EG3 A;  4XTZ A;  4KQE A;  4J9H A;  4C5H A;  2LDM A;  4F14 A;  3TSW A;  2JUF A;  4WJ4 A;  1C6V X;  1OX9 A;  2X35 A;  1VQP T;  2HD0 A;  3CME A;  1AD5 A;  3RKW A;  4KGX B;  2AKK A;  3CCE Q;  1BBW A;  1Y71 A;  3QO8 A;  1X6B A;  2CT3 A;  2O4X B;  4PFP A;  3HRU A;  4C5I A;  1JEG A;  1Q95 G;  1QVG A;  2KSS A;  2OTJ A;  2Q5H A;  3V8L A;  4JRQ A;  2QHU A;  4E6R A;  1SF9 A;  3UA7 A;  3WQZ A;  1T0H A;  5FW9 A;  4J15 A;  5KYN A;  4OMN A;  3X25 B;  2J6O A;  3A8H B;  2GF7 A;  2I0N A;  1PNJ A;  4C0G A;  2DL7 A;  2F69 A;  4FT4 A;  3FJP A;  2V1Q A;  2M0O A;  3AT1 B;  3CCU Q;  1X2H A;  2P0P A;  2G4C A;  1LNX A;  4PHC A;  4J9B A;  3GOX A;  1D1B A;  2CP0 A;  2E1H A;  1YI2 T;  4M75 E;  2R5M A;  4E51 A;  1X01 A;  1KC8 C;  2QEX A;  2FPD A;  1WHJ A;  1N6A A;  1LYL A;  4NL2 A;  2LVM A;  1MMN A;  5ECA A;  3OA6 A;  1VQM Q;  2MYS A;  4C8Q D;  1N5Z A;  1VQ9 A;  5ELN A;  4M75 G;  2KAF A;  1VQN Q;  3CD6 A;  1TOV A;  2KYB A;  4O6J A;  5LJ3 e;  4P3O A;  3RF1 A;  4E7L A;  1JBM A;  2QGG A;  2A7Y A;  4M78 D;  3KBG A;  1G83 A;  2FL7 A;  3CPF A;  4PLI A;  3A8G B;  4Y91 A;  1QF6 A;  2ZR3 A;  2E3I A;  4UC4 A;  3VS7 A;  2DBK A;  4C5E A;  1S72 T;  4DOV A;  2EFI A;  4EMK C;  3CCR A;  4QKU A;  4FCY A;  1D0Y A;  3C12 A;  3HP9 A;  2KT1 A;  1SRL A;  4PJO A;  3VS1 A;  3JCM d;  3A8M B;  1X6O A;  4BY6 B;  3JB9 I;  3VS3 A;  2DER A;  2KI7 A;  3TQ7 P;  2FB7 A;  1VQ6 A;  3NEL A;  5C52 B;  4JJN K;  3JCM Q;  1KFZ A;  4G84 A;  4BI3 A;  2SRC A;  4J7F A;  3JCM g;  2BIV A;  4F7U E;  2DXT A;  2DF6 A;  3OYC A;  3G6E A;  4RTW A;  4RTY A;  1XJW B;  1VIE A;  1GFD A;  2V1R A;  1OPK A;  2CP5 A;  4E7Z A;  3OS1 A;  4OB2 B;  1PKT A;  2K3X A;  4F7U G;  1GXI E;  1MND A;  1ZBX A;  4YYE A;  3JCM V;  3E9G A;  4YPF A;  1VOM A;  1OQK A;  1TSF A;  1ZA1 B;  3JB9 J;  4Z8A A;  5IHI A;  2KXC A;  3BY7 A;  2X9H A;  3RKX A;  2Y4X A;  1YJW T;  3GBQ A;  2E5A A;  1SG5 A;  3PFS A;  3V7S A;  2VXF A;  2CP7 A;  3EGX B;  2DIQ A;  1YHQ A;  2K3Y A;  4L87 A;  1ZUY A;  5K1P A;  1NZ9 A;  2RA2 A;  3BE3 A;  3L2Q A;  2F2V A;  1BCM A;  3MHX A;  4C0Z A;  4DEX A;  3OYL A;  1VQK T;  3TEH A;  1ZSZ C;  1MUZ A;  4J9G A;  4YRN A;  1U5S A;  1OX8 A;  3WVD B;  4CC4 B;  1R0B G;  1Y0M A;  3QPH A;  1YFT A;  2KY9 A;  4DEY A;  2DEQ A;  2NUT A;  5FWC A;  3OB9 A;  1S1N A;  3JCM b;  3MEV A;  5GAN 3;  3JRZ A;  1VYV A;  3M54 A;  4ZTJ A;  4X1V A;  2VV5 A;  3QJY A;  4X34 A;  2DJZ A;  2NS6 A;  3JB9 F;  2YHT A;  4YCV A;  3M53 A;  3G1J A;  1YJ9 A;  3QZ9 B;  2NYS A;  2X3W D;  3M0R A;  3J7A F;  3QHS A;  1G3Y A;  2W0Z A;  5GMK l;  1VQ4 A;  4M7A E;  5GAN 7;  2YUN A;  3RKY A;  4ZTF A;  4IUT A;  2FG0 A;  5A0G A;  1BCO A;  3A8L B;  1RLQ C;  1WHG A;  4M7A G;  4E7K A;  3A7R A;  4MMK A;  3J81 E;  1UGR B;  5A0D A;  4M7D D;  4M75 A;  1BIA A;  2EGE A;  1VQL T;  1WGS A;  4PG3 A;  2EQI A;  3REA B;  3URG A;  3RES A;  1YIT T;  2XKO C;  4JLG A;  2E12 A;  3V8J A;  3S3N A;  1BK2 A;  4PJL A;  3A31 A;  1E24 A;  2DXC A;  2QHV A;  3CPW A;  2RI2 A;  1KC8 R;  4TTV A;  1Q7Y U;  2EYW A;  1UGQ B;  3A7A A;  2O2O A;  5LJ5 j;  3JB9 H;  2KYM A;  1VQ5 T;  4L6V 5;  2RQW A;  3HXY A;  4Y92 A;  4PL6 A;  4BDY A;  1ASZ A;  4RMF A;  4C0D B;  2A28 A;  2PUO B;  4RTX A;  4J8O A;  4KUI A;  5LJ3 f;  1RAB B;  1LPL A;  4C8Q B;  3OYK A;  4F7U A;  1A0N B;  5FU7 C;  3LH5 A;  1Q86 U;  2DET A;  4FYW B;  2K4Y A;  4M78 B;  4HWR A;  3VUB A;  2LCL A;  2XG8 D;  1HJD A;  1AOJ A;  1HSQ A;  3CCV T;  1OU9 A;  2LJ0 A;  4PJJ A;  3CC2 Q;  2DRM A;  4E47 A;  3JCM W;  1U1S A;  3EH1 A;  4YRQ A;  1BBZ A;  4ZGD B;  1YI2 A;  3PMI A;  2DZC A;  1Z7M A;  3PMT A;  4XTX A;  3CME T;  1Q82 R;  1VQ7 Q;  2JXB A;  1HYO A;  3H6Z A;  5I22 A;  4H2U A;  1OU8 A;  2YT6 A;  2ODR C;  4VUB A;  4PJO F;  1UUE A;  1VIF A;  2RHZ A;  2DIG A;  2HSP A;  3RR6 A;  1RAD B;  3G4S Q;  1DJ7 B;  2EQJ A;  1QCN A;  1HD3 A;  2DL5 A;  2K5F A;  2OJ2 A;  2OTJ T;  1G5I A;  1H8K A;  5GAM h;  4XEM A;  4HWP A;  4RTT A;  4CC7 A;  4BB7 A;  5DY9 A;  2ZIO A;  1CKB A;  1JB0 E;  1V29 B;  1NNH A;  1I07 A;  4N4I A;  3CMA Q;  1PCX A;  1Y07 A;  1S72 A;  1IO6 A;  2DO3 A;  2XU8 A;  4PFZ A;  1NJ2 A;  2RHQ A;  2E3C A;  3FB9 A;  3LLR A;  2G3R A;  2VUB A;  2YWW A;  2FYK A;  2WSE E;  2ZNI A;  2SEM A;  1SSF A;  3CBP A;  1KMN A;  3T9N A;  5AT1 B;  3FDR A;  2QTX A;  2I4L A;  2LMJ A;  3V8K A;  2RHS A;  2QEX T;  2PQW A;  2MAM A;  1TXQ A;  5D6Y A;  1W1F A;  1QP2 A;  3CC7 Q;  4RDX A;  2F2X A;  3A5Z B;  3NFC A;  1USY C;  5GAN 2;  3CCE A;  1X54 A;  2DQ3 A;  1WLE A;  1YJN Q;  3DB4 A;  3S3O A;  4LVI A;  1EX4 A;  2DBM A;  3E9H A;  4M7A A;  1IGU A;  4N4G A;  3M0S A;  4PJM A;  2QA4 Q;  4C0D C;  4OB3 B;  1RI9 A;  1QP3 A;  3NEM A;  4UP8 A;  2GTJ A;  5LJ5 e;  1HXD A;  3A5Y A;  4BUG A;  5GAN d;  1M5Q 1;  2JN0 A;  3LGL A;  3H0I A;  3VS0 A;  1M2V A;  1B3Q A;  2JW4 A;  2HKQ B;  1TS9 A;  2XDP A;  1N8R U;  2E41 A;  2KK4 A;  3CCR T;  2L0A A;  4Q15 A;  2RHU A;  2JS0 A;  3EG9 B;  1UB4 A;  1WQ7 A;  1TG0 A;  2P0Q A;  1EQR A;  1YN8 A;  4XQ3 A;  2ZCF B;  3VS4 A;  1U8R A;  3TEE A;  2K57 A;  4LUE A;  4ATO A;  1K73 U;  4WI1 A;  2J05 A;  4DBH A;  1VQ6 T;  2EPD A;  1ZUK A;  4HVU A; 
#chains in the Genus database with same CATH homology
 2XGT A;  2DTH A;  5CIU A;  2RJF A;  3E19 A;  4H2Y A;  2ZGW A;  4KUD K;  3OYF A;  1Y96 B;  1NJ1 A;  5KCO A;  2I4N A;  2JVV A;  3TEH B;  2Y90 A;  1U1T A;  4J6X A;  3QSU A;  3M57 A;  2MWP A;  1VQM A;  1N9R A;  1FXX A;  4XU3 A;  1VQN A;  2VYT A;  2OTL T;  4CS4 A;  4EPC A;  5I2S A;  3HRK A;  3QNE A;  5HK0 A;  1Q7Y C;  4M77 G;  3QO5 A;  4ZGJ B;  3EFS A;  4EX5 A;  4M75 F;  4A4G A;  1LJO A;  5LL6 S;  5GAN j;  4H2X B;  3A8O B;  4NS5 A;  1VQO T;  1YHQ T;  3G1Z A;  2R5A A;  2NLU A;  2E6Z A;  4ELY C;  3X28 B;  1WJS A;  4Y28 E;  4P71 A;  1P92 A;  5CK9 A;  1Q86 C;  5KCH A;  1TH7 A;  5C51 B;  4N0A A;  1EVK A;  5GMK i;  5HKC A;  4PJO E;  4M75 B;  1G51 A;  2LQK A;  4FU6 A;  2ZPH B;  2V8I A;  3QDR B;  2AKW A;  2RO0 A;  1VQL A;  4V2S A;  4TVR A;  3C94 A;  3M4G A;  3WVE B;  4J6Y A;  1M4Z A;  2CKK A;  4BI4 A;  1O75 A;  1YJ9 T;  2B8A A;  2P0L A;  4F7U F;  4FL6 A;  2LT4 A;  4YRP A;  2ZT8 A;  3LSS A;  1VQ4 T;  1ADJ A;  3CCS T;  2DAQ A;  1VQ5 A;  3FIF A;  2QQR A;  3RMQ A;  2O01 E;  5I2M A;  3HFZ A;  5CR2 A;  1G3T A;  4JDS A;  3SD4 A;  1G3W A;  3L2W A;  3IG2 A;  4L59 A;  4F7U B;  1JJ2 A;  2CYZ B;  5GAO n;  5GMK m;  5KE3 A;  3QTC A;  5CKB A;  2PVG B;  2ODR D;  3CCV A;  1IZ6 A;  2CZ1 B;  3NTK A;  3QUI A;  3MET A;  4OLF A;  4P75 C;  3L2Z A;  2DVE A;  2CGH A;  4YP0 A;  5GAN 5;  4K88 A;  1M1F A;  2CJA A;  3JB9 D;  3GNG A;  5GAN 8;  3H8Z A;  2DU5 A;  1N8R C;  5GAN e;  1MGQ A;  1NJ8 A;  3JSC A;  5FLX E;  3PZC A;  1IRE B;  1KD1 U;  1E1T A;  3HFO A;  4QVD A;  1YIJ A;  2JNG A;  5LJ5 f;  2JTF A;  3LYI A;  1K73 C;  4TVW A;  3CXC S;  4GLK A;  4M75 C;  1HTT A;  4A4E A;  4M77 A;  5CKE A;  4M7A F;  1I4K 1;  4P72 A;  4K86 A;  1KOG A;  3L1A A;  5KE2 A;  4DPG A;  4UPA A;  2XHC A;  3BDL A;  2AMC A;  5KNN A;  4YRL A;  2RHQ B;  2E65 A;  2D6F A;  2EJG A;  4JRP A;  2ZTG A;  2M9U A;  2P4T A;  1J5W A;  4MDX A;  2RHS B;  5J3B A;  3LX7 A;  4MZT A;  4ZN3 A;  4HVC A;  3NEN A;  4ZN1 A;  4TWA A;  2RD1 A;  4CRI A;  4CH6 A;  1I81 A;  3HY1 A;  4M7A B;  1HK9 A;  3INZ A;  1BI1 A;  1BI0 A;  3OD1 A;  3P8V A;  4XTY A;  3UH0 A;  3OS0 A;  4EMH A;  1ASY A;  2V8J A;  3M55 A;  2F5T X;  2K5L A;  1ZHI A;  3C4S A;  4NCX A;  4RG2 A;  2EYQ A;  1B70 A;  3CCM A;  3S3M A;  1M1K U;  3HXU A;  4WJ3 M;  1NJI U;  4YRO A;  3E1S A;  3JAM E;  3HRI A;  3OW2 S;  1LOJ A;  2LRQ A;  3OYG A;  1Q82 C;  5J26 A;  3CCE T;  1BI3 A;  3FLG A;  3HKS A;  2C06 A;  5CQX A;  1KMM A;  1RIQ A;  3G4S A;  2OTL A;  4P74 A;  4YRM A;  2DD4 A;  1H64 1;  5GAM d;  4A54 A;  3L4G A;  1ZQ1 A;  3QXE B;  3MF1 A;  5DLQ E;  1OZ2 A;  4PJO D;  5GAM g;  4ELZ C;  1QW1 A;  5C53 B;  5K1X A;  2WAC A;  1ATI A;  1W2B S;  4BAC A;  2ZT7 A;  2X4J A;  1N9S A;  1VQO A;  3CCU T;  4RKU E;  2Q7G A;  5HGQ A;  1EFW A;  4E7I A;  3A7U A;  4YTL A;  1BIB A;  4G85 A;  1SER A;  4QQD A;  3OSS C;  5FU7 B;  2XDD A;  5GAO m;  1VQM T;  1VQN T;  4CS2 A;  4R56 A;  1KHI A;  3NTH A;  2ZPE B;  2AKW B;  2CJB A;  2H3J A;  3SWN A;  3R07 A;  1H4S A;  4OF1 A;  4M7A C;  3G7Z A;  4PLL A;  4YRC A;  4ZGE B;  2KDS A;  2E5Q A;  5CQY A;  3PNW C;  3KXT A;  2EKO A;  2ZPB B;  5GMK j;  2RHY A;  3KFU A;  3NTI A;  4TVA B;  1QVG S;  3LWH A;  2EQM A;  2VC8 A;  2CZ6 B;  4A4H A;  3CCS A;  1NPP A;  4IUR A;  3VU3 C;  2XTI A;  1WQW A;  1KD1 C;  3HPW A;  1RI0 A;  4PKC C;  1X55 A;  4BD3 A;  3EFR A;  2EJ9 A;  3F70 A;  3HFZ B;  2WSF E;  4YRS A;  4LDV A;  3HY0 A;  5GAN f;  4XU0 A;  1G3S A;  1Y7X A;  3OY9 A;  2JZ2 A;  2C7I A;  4J5Y A;  5FU6 C;  1WNL A;  4JRK A;  3CCL A;  3P8B B;  3ZEH A;  3HXX A;  4H2V A;  1BI2 A;  4Q5W A;  3OYH A;  4XK8 E;  4HWS A;  1H3Z A;  4YRR A;  4BWA A;  2M1H A;  5GAN 6;  3IKM B;  3BFM A;  4M77 F;  4KT0 E;  3GP8 A;  1UEB A;  4M75 D;  2QQS A;  1EOV A;  4P71 C;  3VBB A;  1PYS A;  3PTA A;  4IUU A;  1D3B A;  2ZCE A;  5FRM A;  4RQF A;  4N0A C;  2L5Q A;  1M1K C;  3JCM e;  3CEY A;  1NJI C;  4LVL A;  2J3L A;  2DXU A;  4H2T A;  2DTO A;  3VQW A;  3TCJ A;  1KQ1 A;  1BYM A;  4UP7 A;  4LDU A;  3OBW A;  4P5N A;  3QG1 A;  5IT9 E;  4J83 A;  5KH6 A;  3P8D A;  3IKL A;  2ZIM A;  2R58 A;  5GMK e;  3UGQ A;  3P8H A;  1B7Y A;  4RCC A;  1YIJ T;  3L2V A;  2IY5 A;  3V7R A;  3PGG A;  3OYB A;  4C92 E;  4JS5 A;  3ICA A;  4QQ6 A;  2RI5 A;  4EO4 A;  4LDX A;  1NJ5 A;  1X2G A;  3R6O A;  2ZPF B;  4PJO B;  1B70 B;  4NOY A;  3DKM A;  5CCA A;  4C92 G;  1VUB A;  4IUV A;  4H2S A;  3A74 A;  2RB6 A;  4HCC A;  3LW5 E;  2ART A;  2M16 A;  4ZTU B;  4J7I A;  2LX9 A;  4LD9 K;  1G5V A;  2P5I A;  3L4G B;  4IUP A;  2RJE A;  3JB9 G;  1H4Q A;  4OP0 A;  5GAO l;  1Z7N A;  3LC0 A;  4UP9 A;  3MP1 A;  2PMF A;  2F5K A;  4D6W A;  2LT1 A;  3CCM T;  3P8T A;  5L8R E;  4KBM B;  4O2D A;  2ZNJ A;  3CC2 T;  3CCU A;  2ZIN A;  4CH5 A;  2ZZD A;  5LJ5 h;  1VQ7 T;  4LVJ A;  4M7A D;  2AHJ B;  4NL3 A;  4M77 E;  4BW9 A;  1X56 A;  4XTU A;  4HCZ A;  4C8Q E;  3RL6 A;  4FT2 A;  3G4S T;  3VUZ A;  2BKD N;  5F5W A;  2EIF A;  3OYY A;  3SWN B;  4M78 E;  4C8Q G;  3I55 A;  3UWN A;  4CI0 C;  3CMA T;  4ME7 A;  2Q7H A;  3N5B B;  4XTV A;  1QE0 A;  2D0Q B;  3MEU A;  1C0A A;  5GAO p;  4M78 G;  2JTM A;  5IN1 A;  3M4Q A;  2E70 A;  3OYI A;  3HSB A;  4YRG A;  4PJO C;  3ZBD A;  4CH4 A;  3I56 A;  2RM4 A;  1KQS S;  5CAI A;  5LJ3 g;  4P3P A;  3CC7 T;  2KQW A;  4JUV A;  2HQX A;  2XK0 A;  1YJN T;  4KUL A;  5HY6 A;  3TRE A;  1O9S A;  3PCO A;  2QA4 T;  3JCM f;  5FRO A;  1XQH A;  2IG0 A;  4RMO A;  2E64 A;  4MZM A;  3VQX A;  3DB3 A;  1N27 A;  2YRV A;  2YLC A;  2QI2 A;  4XEO A;  4OB0 B;  1BKB A;  4C92 A;  2DD5 A;  3OW2 A;  3HFN A;  4BE0 A;  4RG8 A;  2CIM A;  2EQU A;  4HKE A;  2FHD A;  3MEW A;  3OYD A;  1Q81 U;  4J6W A;  1K8A U;  1PYS B;  3CCQ A;  4A53 A;  2PU9 B;  2RK1 A;  4HT4 A;  3QO3 A;  4LDY A;  3CCL T;  3VYH B;  4OGC A;  3CBO A;  2ALY A;  1W2B A;  2CZ7 B;  3SWN C;  3OYJ A;  2RJD A;  4FIB A;  4CH3 A;  3VKI A;  5HK3 A;  2JOY A;  1FWZ A;  3E9F A;  2ZXF A;  4BI8 B;  1H4T A;  2GFA A;  3MCA B;  3GPL A;  4C0F A;  4JS4 A;  1VQ8 T;  2ZZE A;  1B34 A;  1NE8 A;  1FYF A;  2XIC A;  1USY A;  1B7Y B;  4XU2 A;  4M7D E;  2HQE A;  2IY5 B;  4HT9 A;  3VJP A;  4DOW A;  4TVY A;  3OMG A;  2QQB A;  4C8Q A;  3CCJ T;  3PT9 A;  4M7D G;  1NJ6 A;  3QYH B;  2EWN A;  3VQY A;  3JCM X;  5GAN h;  4HA8 A;  3FC3 A;  2HNI A;  3CBM A;  1OI1 A;  4M78 A;  4O5V A;  4HWT A;  4IKF A;  2J3M A;  2XD0 A;  5AYF A;  3OYE A;  1JJC A;  3JCM J;  3Q1J A;  5D6X A;  2K5I A;  4Z02 A;  1XTD A;  3LWI A;  4H02 A;  3M9Q A;  4M77 D;  1PSF A;  3OQ5 A;  3G71 T;  2QHS A;  2ZPI B;  2ARS A;  4MML A;  4P73 A;  2ZR2 A;  1NPR A;  4EDU A;  1SRY A;  3W3S A;  4X9D A;  1KG1 A;  3FEO A;  1UGP B;  4LD6 A;  3CC2 A;  5LJ3 h;  2DPP B;  5A0L A;  3FRN A;  1ADY A;  3SFM A;  2RHI A;  3RIR A;  2D9T A;  4KR2 A;  1M90 U;  3GLX A;  3TU4 K;  1QVF S;  2V8K A;  1EIF A;  1VQ7 A;  2PUK B;  5FU6 B;  4C5G A;  2QHT A;  1WJR A;  2RH2 A;  2I2L A;  2C8M A;  2LNV A;  1I8F A;  3HRS A;  4HCB A;  3DLL A;  5GAO r;  4LNS A;  3A5Z A;  1VQZ A;  3DLM A;  3M58 A;  3CMA A;  4MDW A;  3CC4 A;  3MEA A;  2I4O A;  4OMF B;  3QBY A;  1JJ2 S;  2DKG A;  1Q81 C;  1K8A C;  3NET A;  4HWO A;  3M56 A;  1B8A A;  3OYA A;  1M8V A;  4BE2 A;  2GQV A;  2GFU A;  3UPU A;  3CC7 A;  3GNF B;  3M4Y A;  5M9O A;  2R57 A;  4C92 F;  1YJN A;  1K9M U;  2FVU A;  5GAO q;  2QA4 A;  3PCO B;  1Y96 A;  5GAN 4;  3I55 T;  2HBP A;  5GAM j;  1XNI A;  3A32 A;  3X26 B;  4M7D A;  2DZ9 A;  2ZZF A;  3GF5 A;  2HAX A;  4C92 B;  4YRT A;  3SDZ A;  2PME A;  3I56 T;  1YFS A;  4P75 A;  2ZT5 A;  2LC4 A;  1IL2 A;  5LJ5 d;  3CMQ A;  3X24 B;  2LCC A;  4A4F A;  1XOV A;  2MMP A;  3GIB A;  4H2X A;  3HXV A;  3QJ6 A;  5LJ5 g;  1HC7 A;  1YB3 A;  3HXW A;  3MO8 A;  3RUX A;  3M5A A;  2QDY B;  4QQG A;  3AHU A;  4BY6 C;  2BUD A;  1NYR A;  3ERR A;  4FM4 B;  3E9I A;  3HHT B;  5CKH A;  3WXM B;  2RJC A;  5DLO A;  2ALY B;  3V7C A;  4XU1 A;  11AS A;  2A3L A;  2MF2 A;  3VV0 A;  2PVD B;  1WJQ A;  1EIY A;  4LVK A;  2LQ8 A;  3S6W A;  3QYG B;  2MI6 A;  3MP6 A;  4QW2 A;  1KQ2 A;  3L2R A;  3VQV A;  4C8Q F;  1VQ8 A;  1W4S A;  1B34 B;  4JRI A;  5A2Q E;  4M78 F;  3CCQ T;  1VQP A;  4YRJ A;  1YFR A;  3TUP A;  4PNO A;  4II1 A;  2VGN A;  2DQ0 A;  1QVP A;  4BE1 A;  1M90 C;  4M77 B;  3CCJ A;  2Q5I A;  3TEG A;  2AMC B;  3PIP A;  1PSE A;  3ER0 A;  3REX A;  2Y4Y A;  4EMK A;  4B9W A;  4BDZ A;  4L5G A;  3RGL A;  2X4X A;  3M59 A;  2ZZG A;  4N4H A;  1KQS A;  2GCX A;  2RI3 A;  3MF2 A;  4YCU A;  3JCM h;  2L89 A;  3HTZ A;  3BDU A;  4C92 C;  5GAM e;  1X75 C;  2L8D A;  1JJC B;  1FX7 A;  3UGT A;  2KVQ G;  2IVW A;  4OGE A;  2EL9 A;  4DQ2 A;  3MQZ A;  2RHX A;  3IAL A;  5CKD A;  5I21 A;  1M9S A;  2DXB A;  4QVC A;  3G71 A;  4AH6 A;  2L3R A;  2O4X A;  1NYQ A;  4MZP A;  4RCB A;  3LH0 A;  4WF2 A;  1E22 A;  3J80 E;  2DK3 A;  1EVL A;  4OB1 B;  3L42 A;  4EMG A;  5GMK h;  1BBU A;  3M4P A;  3OYN A;  12AS A;  2EQK A;  2K2V A;  3P8Y A;  2EAY A;  3REU A;  2A8E A;  4XAX B;  4CS3 A;  3ZFJ A;  3OS5 A;  1R8O B;  2CZ0 B;  3QKJ A;  1B76 A;  1K9M C;  2YLB A;  2PVO B;  3JCM c;  3PIO A;  1OZ3 A;  1UGS B;  3OMC A;  2ARU A;  4XTW A;  1KHC A;  1H4V B;  3O8V A;  5DM7 R;  5FRN A;  5D6W A;  3RER A;  5C0M A;  4K87 A;  1YCY A;  4ZTZ B;  4YDQ A;  3L2U A;  3QO7 A;  4IUQ A;  3HRT A;  2ZT6 A;  4YRE A;  1VQ9 T;  2VGM A;  5C6S A;  1N9W A;  3CD6 T;  2QQ9 A;  5ELO A;  4E7J A;  2XID A;  4LVM A;  3C95 A;  2X4Y A;  3ASK A;  4M77 C;  2DU7 A;  4OVA A;  4P72 C;  3DSQ A;  3UFG A;  4C8Q C;  2E6N A;  3QZ5 B;  4QVZ A;  1YJW A;  3BJU A;  2VXE A;  4GY5 A;  1SET A;  2MWO A;  5GAN g;  3KUF A;  5E3I A;  5J39 A;  4LDW A;  1SES A;  4M7D F;  4M78 C;  3CPW S;  2Q7E A;  1G5H A;  2CJ9 A;  4B9X A;  4Q6G A;  3G6E T;  2RK2 A;  2XI9 A;  3CXC A;  4JLI A;  4DA4 A;  1VQK A;  2CS7 A;  1MHN A;  5CVI A;  3UDC A;  1KC8 U;  1YBY A;  3CC4 T;  4M7D B;  3RMS A;  4YRI A;  4A4K A;  1E1O A;  2OAU A;  4TQD A;  5LJ3 d;  4P73 C;  4TQF A;  3BW1 A;  1JRI A;  3MEY A;  3OBY A;  2XDB A;  2KMT A;  4FSX A;  3MP8 A;  2DTI A;  3VYG A;  3I7F A;  5CO7 A;  2P0K A;  1WYD A;  4X9C A;  3HL8 A;  4P74 C;  2LTO A;  4X5O A;  3EAE A;  2E10 A;  3LGF A;  2X4W A;  1EIY B;  4HT8 A;  1Q82 U;  3OYM A;  4YRF A;  1M1G A;  2I4M A;  1QVF A;  3JCM P;  2DDZ A;  3HXZ A;  1YIT A;  3LSQ A;  2WSC E;  4PJO G;  2QXF A;  4R55 A;  1RL2 A;  3HFV A;  5GAM f;  1AHJ B;  3ME9 A;  4H2W A;  4TVA A;  5LJ3 j;  3X20 B;  4KR3 A;  4E7H A;  4YCW A;  1YGB A;  1W66 A;  1D3B B;  5CKF A;  1WU7 A;  4ZIB A;  5IAY A;  2ZPG B;  3RAC A;  1I5L A;  3UT1 A;  2EJF A;  3SB2 A;  1OYX A;  3OS2 A;  4YRK A;  4C92 D;  4RQE A;  4EMK B;  1WPY A;  4P3N A;  1GGM A;  3QII A;  2QQA A;  1L0W A;  4M7D C;  5EG2 A;  3OSV A;  4XTZ A;  4KQE A;  4C5H A;  2LDM A;  2JUF A;  4WJ4 A;  2X35 A;  1VQP T;  2HD0 A;  3CME A;  3RKW A;  1BBW A;  1Y71 A;  3QO8 A;  2O4X B;  3HRU A;  4C5I A;  1QVG A;  2KSS A;  2OTJ A;  2Q5H A;  3V8L A;  4JRQ A;  2QHU A;  3WQZ A;  4J15 A;  3X25 B;  3A8H B;  2GF7 A;  4C0G A;  2F69 A;  4FT4 A;  3FJP A;  2M0O A;  1X2H A;  2P0P A;  2G4C A;  1LNX A;  4PHC A;  3GOX A;  2E1H A;  1YI2 T;  4M75 E;  2R5M A;  4E51 A;  1X01 A;  1KC8 C;  2QEX A;  1N6A A;  1LYL A;  4NL2 A;  2LVM A;  3OA6 A;  4C8Q D;  1VQ9 A;  5ELN A;  4M75 G;  2KAF A;  3CD6 A;  4O6J A;  5LJ3 e;  4P3O A;  3RF1 A;  4E7L A;  1JBM A;  2A7Y A;  4M78 D;  3KBG A;  2FL7 A;  3CPF A;  4PLI A;  3A8G B;  4Y91 A;  1QF6 A;  2ZR3 A;  4UC4 A;  4C5E A;  1S72 T;  4DOV A;  2EFI A;  4EMK C;  3CCR A;  3C12 A;  3HP9 A;  4PJO A;  3JCM d;  3A8M B;  1X6O A;  4BY6 B;  3JB9 I;  2FB7 A;  1VQ6 A;  3NEL A;  5C52 B;  4JJN K;  3JCM Q;  4G84 A;  4BI3 A;  4J7F A;  3JCM g;  2BIV A;  4F7U E;  2DXT A;  3OYC A;  3G6E A;  1VIE A;  3OS1 A;  4OB2 B;  2K3X A;  4F7U G;  1GXI E;  1ZBX A;  4YYE A;  3JCM V;  3E9G A;  4YPF A;  3JB9 J;  3BY7 A;  3RKX A;  2Y4X A;  1YJW T;  2E5A A;  3PFS A;  3V7S A;  2VXF A;  2DIQ A;  1YHQ A;  2K3Y A;  4L87 A;  5K1P A;  1NZ9 A;  2RA2 A;  3L2Q A;  3MHX A;  4C0Z A;  3OYL A;  1VQK T;  3TEH A;  4YRN A;  3WVD B;  3QPH A;  1YFT A;  2KY9 A;  2DEQ A;  3OB9 A;  3JCM b;  3MEV A;  5GAN 3;  3JRZ A;  3M54 A;  4ZTJ A;  2VV5 A;  3QJY A;  4X34 A;  2DJZ A;  2NS6 A;  3JB9 F;  2YHT A;  4YCV A;  3M53 A;  1YJ9 A;  3QZ9 B;  3J7A F;  3QHS A;  1G3Y A;  5GMK l;  1VQ4 A;  4M7A E;  5GAN 7;  3RKY A;  4ZTF A;  4IUT A;  5A0G A;  3A8L B;  4M7A G;  4E7K A;  3A7R A;  4MMK A;  3J81 E;  1UGR B;  5A0D A;  4M7D D;  4M75 A;  1BIA A;  1VQL T;  1WGS A;  4PG3 A;  3URG A;  3RES A;  1YIT T;  2XKO C;  4JLG A;  2E12 A;  3V8J A;  3S3N A;  3A31 A;  1E24 A;  2DXC A;  2QHV A;  3CPW A;  2RI2 A;  4TTV A;  1Q7Y U;  1UGQ B;  3A7A A;  5LJ5 j;  3JB9 H;  1VQ5 T;  4L6V 5;  3HXY A;  4PL6 A;  4BDY A;  1ASZ A;  4RMF A;  4C0D B;  2PUO B;  4J8O A;  4KUI A;  5LJ3 f;  4C8Q B;  3OYK A;  4F7U A;  5FU7 C;  1Q86 U;  2K4Y A;  4M78 B;  4HWR A;  3VUB A;  2LCL A;  2XG8 D;  3CCV T;  4E47 A;  3JCM W;  1U1S A;  4YRQ A;  4ZGD B;  1YI2 A;  3PMI A;  2DZC A;  1Z7M A;  3PMT A;  4XTX A;  3CME T;  3H6Z A;  4H2U A;  2ODR C;  4VUB A;  4PJO F;  1VIF A;  2RHZ A;  2DIG A;  1DJ7 B;  2EQJ A;  2K5F A;  2OTJ T;  1G5I A;  5GAM h;  4XEM A;  4HWP A;  4BB7 A;  5DY9 A;  2ZIO A;  1JB0 E;  1V29 B;  1NNH A;  4N4I A;  1Y07 A;  1S72 A;  2DO3 A;  2XU8 A;  1NJ2 A;  2RHQ A;  2E3C A;  3FB9 A;  3LLR A;  2G3R A;  2VUB A;  2FYK A;  2WSE E;  2ZNI A;  1SSF A;  3CBP A;  1KMN A;  3T9N A;  3FDR A;  2QTX A;  2I4L A;  3V8K A;  2RHS A;  2QEX T;  2PQW A;  2MAM A;  5D6Y A;  1QP2 A;  4RDX A;  3A5Z B;  3NFC A;  1USY C;  5GAN 2;  3CCE A;  1X54 A;  2DQ3 A;  1WLE A;  3DB4 A;  3S3O A;  4LVI A;  3E9H A;  4M7A A;  4N4G A;  4C0D C;  4OB3 B;  4UP8 A;  1QP3 A;  3NEM A;  5LJ5 e;  1HXD A;  3A5Y A;  4BUG A;  5GAN d;  1M5Q 1;  2JN0 A;  3LGL A;  2XDP A;  1N8R U;  2E41 A;  2KK4 A;  3CCR T;  4Q15 A;  2RHU A;  1UB4 A;  1WQ7 A;  2P0Q A;  1EQR A;  4XQ3 A;  2ZCF B;  1U8R A;  3TEE A;  2K57 A;  4ATO A;  1K73 U;  4WI1 A;  1VQ6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...