2HNIA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, k111a mutation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
230
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 67
structure length 230
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2hniA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2hniA01
3BW1A 1NJ8A 3HFZA 3JCMb 5LJ3f 5GAOn 1BBWA 4YRRA 3HXUA 3UFGA 3V8KA 4LNSA 4RCBA 4YRTA 4XQ3A 1SRYA 4PNOA 4UP9A 2Q5IA 2AKWB 2ZZGA 1I4K1 4PJOC 5GANe 1QE0A 2YHTA 4BWAA 4M7DE 3A32A 4YRJA 3HFVA 4YRMA 3QO3A 4J6WA 1SESA 1D3BB 4M75C 11ASA 2JN0A 2CGHA 3L4GB 1B34B 3L2ZA 4Q6GA 3PCOB 3UGQA 2E3CA 3WQZA 1Z7NA 2ZZFA 5E3IA 4A54A 5LJ3g 2P0LA 3QO7A 3RERA 3JCMf 3P8VA 2E10A 3RACA 3BFMA 4C8QA 4EO4A 5GANh 3A7UA 2AMCB 5GMKm 5GAOp 4UP8A 3VU3C 5I21A 2ZXFA 4J15A 4PJOF 2I4MA 2EL9A 2Y90A 2ZCEA 3JB9F 4P75A 3V8LA 3JCMc 2I4OA 5LJ5d 3RKWA 1YB3A 4EMKC 4C92C 1W66A 3E9HA 1QF6A 4M75F 4YRFA 4OP0A 4YPFA 1BBUA 4DQ2A 3EFRA 5GAN2 2AKWA 3UH0A 5HGQA 3INZA 4HT8A 4M78G 4YP0A 4EMHA 4M77C 4PHCA 4P3NA 4Y91A 1HC7A 1H4SA 5GAOl 4PJOE 4G84A 5GAN3 5DY9A 5GAMd 1E1TA 3JCMg 4HWTA 3TUPA 1D3BA 3JCMV 5LJ3j 1ASYA 4HVCA 3JCMW 4A53A 1YGBA 3L4GA 1B34A 2RA2A 4XU1A 5GMKj 2DTIA 4M75E 3PCOA 4ZIBA 3JB9H 3QO8A 3G1ZA 3R07A 1WQWA 2RD1A 3PZCA 5GAN7 4P72A 3HXZA 4C8QC 4PJOD 3HSBA 3M4GA 4EMGA 1LOJA 3JB9D 5GAN8 4F7UG 2AMCA 1I8FA 2EJFA 3IKMB 1TH7A 5CAIA 2ODRC 2ZT6A 1C0AA 4TWAA 2PMEA 4YCVA 3NEMA 3W3SA 4M75D 4M78B 1JBMA 1U1SA 3ICAA 2VXFA 4H2XA 4RDXA 1YCYA 1NNHA 2DEQA 1Z7MA 5ELOA 1E1OA 1KOGA 4MMLA 4P71A 4UP7A 2E1HA 4XTYA 3DSQA 1E22A 4C92E 4YRCA 5C53B 2RHSA 4J6YA 1X2HA 4P74A 1WQ7A 3PGGA 4H2WA 1KQ2A 3FIFA 2QHSA 4M7AB 4YRGA 3HXVA 4C8QF 4M77E 4CS4A 4H2SA 5LJ5e 3RESA 4YCWA 3M4QA 1ATIA 1ASZA 4F7UE 4DPGA 2DQ3A 4YRNA 4C92D 1USYA 3BDUA 5ELNA 1FYFA 3TEHB 2ALYB 4WI1A 3MF1A 4Q15A 1HTTA 4XU2A 5GAOm 4XEOA 3QTCA 2EJ9A 2FYKA 1M5Q1 2ZGWA 4L87A 4XU0A 2QTXA 4M77D 1JJCB 5GAMe 4M7DB 1KMNA 3UGTA 1X01A 3RUXA 4YRLA 4M78A 3A74A 4XU3A 2E5AA 4J6XA 5LJ5h 5K1XA 2E65A 2ZT8A 1EFWA 3QSUA 4UPAA 1PYSB 4YDQA 4PJOG 5GANf 2ZIOA 2E64A 4CH5A 2DJZA 3LC0A 4C8QD 3JB9G 5GAN4 1EVKA 3P8TA 4X5OA 3E9IA 3HRKA 3V7CA 3ERRA 2PMFA 4J5YA 3M4PA 4M7AA 4M75G 2ODRD 5GAMh 3A5YA 1NJ2A 3RKYA 4N0AA 2ZNIA 3GIBA 1B76A 4TVYA 1E24A 4YREA 4HWPA 3VQVA 3CMQA 4H2XB 3MF2A 1NJ1A 4H2VA 2Q7EA 4CH6A 3HFOA 3TEHA 2I4LA 2ALYA 3FJPA 1IL2A 1G51A 4NL2A 5LJ3d 3SWNA 2J3MA 2Q5HA 1ADJA 2RHSB 3L1AA 1JJCA 1YFSA 4JLIA 4M7DA 2ARSA 4TTVA 3LSQA 2EWNA 2CIMA 3JCMJ 1EQRA 3A7RA 1SERA 1JRIA 4P3OA 1NJ6A 4C92G 1EIYB 2DXUA 4YRSA 4M75B 1G5IA 2EJGA 5GAOr 2DVEA 1PYSA 1X54A 1HK9A 2ZR2A 3A5ZA 4M77G 4WF2A 3HXXA 1WLEA 4EX5A 4P73A 4M7AC 4NOYA 3JB9I 1N9RA 2DQ0A 5LJ5j 4N0AC 4RCCA 3A7AA 3HY0A 4XEMA 5F5WA 2ZNJA 3VBBA 4P3PA 4P75C 4RQEA 2DKGA 1H4VB 1J5WA 3JCMd 4YRQA 1B7YB 1H4TA 3VQXA 3REUA 4X9DA 4XTXA 3HXWA 4H2YA 4C8QG 1MGQA 4ZTUB 4JRKA 4NL3A 5GANj 4KR3A 3SB2A 4EMKB 4C92B 4XTWA 3KFUA 1I5LA 4E51A 4YRKA 4XTUA 1I81A 4PJOA 2ZT7A 4HWRA 4M77B 4JUVA 4M7AF 3AHUA 3MEYA 4QVCA 2ZR3A 5GMKl 1Y96B 1EIYA 12ASA 2QHVA 4F7UB 3HY1A 4M75A 2VXEA 2XGTA 4P72C 2HNIA 5LJ3e 2VC8A 4HA8A 1KMMA 3JB9J 2DTHA 2DXTA 5GMKe 3HRIA 4YRIA 5K1PA 3BY7A 1HXDA 3SWNB 4RMFA 3IKLA 2ZZEA 1LYLA 4OLFA 4C8QE 2ZINA 5LJ5f 4M7DF 3HXYA 5GMKi 1ADYA 1X55A 3FB9A 4CS2A 1H4QA 1B7YA 3V7RA 4X9CA 4KR2A 2IY5B 4P71C 4XTVA 2YLBA 3RF1A 2E41A 5GAMf 5LJ3h 4EMKA 3TEGA 4P74C 4C92A 4RQFA 4JRIA 4M7AD 2CJAA 1LJOA 5GMKh 1B8AA 1EVLA 2DZCA 4M77A 5GAN5 3JCMe 3QO5A 4YCUA 4O2DA 4XTZA 2Q7HA 4KQEA 4TQFA 3V7SA 2C8MA 1BIBA 1Y96A 4H2UA 2YLCA 5LJ5g 1USYC 1YFTA 4F7UA 1NYRA 3QUIA 4YYEA 2K57A 1BIAA 3QNEA 5C52B 2J3LA 4WJ4A 4M7DD 2I2LA 1H641 3OD1A 2G4CA 4WJ3M 1YFRA 4CH4A 5GANg 4V2SA 4PJOB 5GAMg 2DTOA 3JCMQ 4M78C 1N9WA 2RHQB 3JCMh 3VQWA 1KQ1A 3BJUA 2EAYA 1NJ5A 3RIRA 1LNXA 4ZTZB 2Q7GA 2CJ9A 3RKXA 3IG2A 2IY5A 3NENA 2ZTGA 3HTZA 3P8YA 1EOVA 4TVAB 3IALA 1B70B 4K87A 2DU5A 1SETA 4QVDA 1NYQA 4MMKA 2DU7A 1WNLA 4H02A 2ZIMA 5GANd 2P5IA 1WU7A 4YRPA 4PG3A 3VQYA 3A31A 3NETA 2I4NA 1X2GA 3HFZB 2DDZA 2RB6A 2CJBA 4TQDA 4M78F 1L0WA 4HWSA 2ZT5A 3QHSA 4M7AG 1G5HA 3SWNC 3JCMP 1X56A 1WYDA 5GAMj 1U1TA 5GAN6 4M7DC 4K88A 2C7IA 1RIQA 4CH3A 3EFSA 1N9SA 4C92F 3V8JA 1M8VA 2ARUA 4HT9A 4NCXA 5GAOq 3JCMX 4HWOA 4YROA 4M77F 1GGMA 2RHQA 1VQZA 2FB7A 3NELA 4G85A 4BW9A 5KNNA 4M78E 4H2TA 4K86A 4AH6A 4M7DG 2XTIA 1WPYA 3HFNA 4F7UF 3REXA 4TVAA 3LSSA 4P73C 2RM4A 1B70A 2QHTA 2QHUA 4CS3A 2ARTA 5C51B 4C8QB 3RL6A 4TVWA 3I7FA 3RGLA 4M78D 4M7AE 2DZ9A
chains in the Genus database with same CATH superfamily
1X6OA 3O8VA 3BDLA 2RJFA 1NJ8A 3HFZA 2XK0A 5LJ3f 1ZX6A 1BBWA 1NM7A 1OULA 4YRRA 4AG1C 2JUFA 2X4XA 2JXBA 1NJIR 2CSQA 4O6JA 4BI3A 3THKA 3CC7Q 3CCJQ 2L8DA 3J80E 3C0CA 1AHJB 1I4K1 2YRDA 2OJ2A 2X3WD 1YNZA 2YHTA 4BWAA 4YRJA 3M5AA 4IIMA 4D6WA 3I55A 2LP5A 1NEBA 4GY5A 1SESA 5IHIA 3VS7A 4YTLA 1PSEA 2CGHA 1K8AC 3L4GB 3L2ZA 2IVWA 4Q6GA 4ELYC 2GBQA 2FZKB 3LWHA 2E3CA 4QQ6A 2CZ7B 1WHMA 3QO7A 2ZPIB 1P92A 4EO4A 2XHCA 3OYEA 1MV0B 4GLKA 3VU3C 2QA4Q 3OYJA 5J3BA 1Y57A 2EL9A 3M0UA 1JEGA 3RBBB 2QK0A 2F5TX 1Z9QA 2X4YA 3OMCA 4JZ4A 2DEUA 3JB9F 2ZCEA 4E47A 1W6XA 4L59A 3V8LA 1VQ7Q 1ACMB 1BU1A 1PNJA 3GOXA 3OBWA 3VS2A 2I4OA 4EMKC 1VQ4Q 4OP0A 4J83A 4DQ2A 2COYA 2XD0A 5GAN2 3OYCA 2AKWA 5HGQA 2XDDA 4C0ZA 1VQOA 1KC8R 4E7IA 4YP0A 4J9GA 4EMHA 4C5IA 4Y91A 2MPXC 2LQNA 1JU5C 1VQNT 2EGEA 4JJCA 3JCMV 2A36A 3JCMW 5I11A 3QPHA 2DF6A 4ZIBA 3QO8A 3CCUQ 3M59A 1D1CA 4C8QC 4PJOD 4X34A 1BCOA 2AMCA 1PCXA 1GRIA 2C0OA 1TH7A 3H0FA 4KT0E 1BB9A 4FYYB 1VA7A 4M75D 2VXFA 5CCAA 4RDXA 1YI2A 1Z7MA 5KYXB 2DNUA 2R57A 4FT2A 4MMLA 3DB4A 1TTHB 2L2PA 4AMCA 4VUBA 2RJDA 1E22A 4C92E 4PFOA 1TUCA 8AT1B 1AWJA 1X2HA 4P74A 4H2WA 1LVKA 1KG1A 1CKBA 3HXVA 1ZUKA 1QKWA 1NYFA 3I56T 3QBYA 2K3YA 2FEIA 3DLLA 4DEXA 1WHHA 2DMOA 3QJYA 1ATIA 4F7UE 3CCST 2DQ3A 4YRNA 1WJRA 2F2VA 3BDUA 5DLQE 1KQSS 5D7UA 1PWTA 1HTTA 5GAOm 5CQXA 2V8JA 3QTCA 2EJ9A 2ZGWA 3GBQA 4XU0A 2QTXA 4MDWA 1VQLQ 3WXMB 1ZSZC 3PFSA 3LGLA 2NLUA 1IREB 3JSCA 1O9SA 4J6XA 4JRPA 5K1XA 1VIEA 1EFWA 2LCCA 2LJ0A 2E5KA 2K2MA 5KYWA 5CKBA 1WJQA 1M3BA 4J9IA 3U23A 5GAN4 3P8TA 4X5OA 4HKEA 2RNAA 3E9IA 1PD0A 1IHWA 1K0XA 1NBEB 1E6GA 2MK5A 4BE2A 1N8RU 3CC4Q 1VQ5Q 2P0PA 4OB2B 5A2QE 3GIBA 1B76A 1SPKA 4TVYA 3CQTA 3OYHA 4YREA 2LX9A 3GNFB 1E6HA 2LJ1A 1EIFA 3CMQA 3MF2A 2Q7EA 5FU6C 4N4IA 1SKUB 4CH6A 3TEHA 2I4LA 4F14A 2YUPA 5LJ3d 2RH2A 3SWNA 3L42A 2M16A 2JMAA 2RQUA 3PT9A 2EWNA 2L89A 1WZOA 3L2RA 3GF5A 1EIYB 2IIMA 2RMOA 3OS0A 1RABB 4A4HA 1X54A 3E9FA 2ZR2A 4KGZB 1U8RA 1QW1A 1Q86U 2J06A 3TSZA 2KXCA 4NOYA 4PJJA 3CCVA 3JB9I 2C06A 1N9RA 1S72A 1UGSB 1OI1A 2DQ0A 1QWFA 4AT1B 4ZN3A 4XEMA 1UFFA 2KQWA 1T3SA 1J5WA 3LH0A 2ZAEA 3GPLA 1YIJT 3A8GB 3META 1YJWT 3VQXA 1NPPA 4BDZA 2HDAA 3REUA 4X9DA 3CCLQ 4XTXA 3HXWA 4C8QG 1MGQA 2NWMA 3QZ9B 4ZTUB 3TEEA 4JRKA 4NL3A 3QXEB 5GANj 2V1QA 2M02A 5IXBA 1QP2A 2DL7A 4RTTA 2DRMA 4C92B 3OW2S 2NUPB 2JM9A 3FC3A 4YRKA 1SRLA 4XTUA 3VS6A 4PJOA 3G6ET 5IHKA 3VS5A 4RTVA 2O31A 2LZ6B 4M7AF 1ZUUA 2FPDA 1Q82R 1AWWA 3TCJA 1WHLA 1Y96B 4RTYA 1PG5B 3EFOB 4F7UB 4HCCA 4M75A 1KIKA 4ZGDB 1ABOA 3H6ZA 1QCNA 3CCJT 1OPKA 2EVRA 2HBWA 4Z88A 5K1PA 4RMFA 1YHQQ 4OMLA 4KUDK 4MZTA 4PJMA 3QKJA 2ZINA 3G1JA 1GFDA 4KRTA 4CS2A 2K4YA 5IHNA 2CS7A 3LX7A 4KR2A 1H8KA 2DILA 2NS6A 5GAMf 2V8IA 4RQFA 4JRIA 1YBYA 1RADB 3E2UA 1D0XA 2KDSA 1M2VA 1W2BA 5KYUA 3CCQT 4LD6A 1WFWA 3MKDA 2L3QA 3JCMe 1OZ2A 2KVQG 2Q7HA 3PTAA 4KQEA 2A3LA 5CO7A 1VQ7T 2C8MA 4H2UA 3NMZC 5LJ5g 2KAFA 1VOMA 2K57A 2DD4A 4EIKA 4M7DD 2DIQA 2EW3A 3QZ5B 3M9QA 4EPCA 4CH4A 2FVUA 4M78C 5J39A 3JCMh 3CEYA 2EAYA 1PSFA 4IUTA 2FZGB 4AFSC 3ZL7C 1YN8A 3CCUT 2ZTGA 3P8YA 2RHXA 4R0KA 3IALA 3PIPA 1D1BA 3CXCS 2DU5A 3G7ZA 1NYQA 4PLIA 3LW5E 3I35A 3ME9A 4HVVA 4MMKA 4H02A 1WU7A 3CCRT 1Q81U 1Q81C 3VQYA 3NETA 3NTKA 3HFZB 2RB6A 2GQVA 2CYZB 2F2WA 1XJWB 3NGPA 3CPWA 1K1ZA 1VQNQ 4HWSA 4LVJA 4OB0B 3QHSA 1XOVA 4AG2C 3G4SQ 3JCMP 5GAN6 1OX8A 4M7DC 4Z02A 1M27C 1QP3A 3VYGA 4F17A 1IO6A 1U5SA 4QVZA 1YIJA 1YJWA 2ARUA 2CZ1B 5GAOq 3HTRA 3QWYA 3CMAT 2CZ6B 2RHQA 3ZEHA 4OMOA 3S3OA 1IZ6A 3AT1B 3VRZA 1VYVA 5HY6A 2AK5A 3RR6A 1RLQC 1G2BA 2YSQA 4OB3B 3LSSA 3QIIA 3G6EA 2RM4A 4A4EA 1AOJA 2QHTA 4BB7A 5C0MA 3OB9A 3C4SA 2FPFA 2HBPA 5C51B 3LH5A 3RNJA 4TVWA 2DRKA 1QVGP 3RGLA 2DZ9A 2V1RA 3CC7A 2OTLA 3BW1A 3CCJA 2D0QB 1XQHA 1CKAA 2B86A 3HKSA 4B9WA 4J8OA 2A37A 3OYMA 1MV3A 1VQ6Q 2A0FB 3CCSQ 2BE7D 4PNOA 2EKOA 1GL5A 3MP8A 2AKWB 2ZZGA 5GANe 5HKCA 1M2OA 3A32A 5A0DA 2GCXA 1NYGA 1VQ5T 4RUGA 3PVQA 4C5HA 2EQKA 2M9UA 2MI6A 11ASA 4OB1B 2SEMA 3UGQA 3OSVA 1D09B 3WQZA 1UGRB 2QA4A 1Z7NA 2ZZFA 5E3IA 4L5GA 1UGVA 2DBMA 1WHGA 2JT4A 1JQQA 3RACA 3BFMA 2QQAA 1M90R 4B6MA 5GANh 1VQ7A 2AMCB 3A7UA 5GMKm 5GAOp 2M1HA 2QTVA 2ZXFA 4PJOF 2I4MA 5IAYA 2GTOA 2YUNA 1VQ4A 5KYYA 1K4US 4P75A 3JCMc 2YT6A 1FMKA 3EH1A 2JOYA 3RKWA 1YB3A 2BKDN 3ZBDA 1QF6A 4M75F 4LXCA 1BBUA 4LUDA 2XG8D 3UH0A 1H3HA 2OAWA 4HT8A 4M78G 5IH2A 3EHQA 4M77C 4KGVB 2PQWA 4MZPA 4PJOE 4EDUA 4OMNA 1OU9A 5GAN3 5GAMd 3CCUA 1E1TA 2KYBA 2ECZA 1UECA 5LJ3j 3CCLT 2O9VA 1YGBA 1B34A 2RA2A 5GMKj 1AWOA 1SG5A 4ZTJA 4M75E 4ELZC 1WQWA 2RD1A 4RG2A 4DOVA 3PZCA 1X2QA 2JS0A 4JRQA 4EMGA 2E6NA 6AT1B 3OS1A 4F7UG 2H3EB 2EJFA 1WA7A 4X1VA 5CAIA 2ODRC 2DA9A 4YCVA 3W3SA 3OYAA 2LQWA 3OYKA 3ICAA 3UATA 3P8HA 5KE3A 4H2XA 2COWA 1UDLA 2EGCA 2RQWA 5KYWB 3KXTA 4P71A 2D9TA 2RHYA 4QQGA 1YHQT 3ZFJA 1WQ7A 2B8AA 1KQ2A 2PUOB 1ZHIA 2QHSA 4YRGA 1IHVA 1SF9A 2P4RA 2F2XA 3MO8A 1NLPC 3QWXX 3M4QA 3M55A 2VASA 4DPGA 4JJDA 1USYA 5ELNA 3TEHB 1K9MU 1RAIB 1VQLA 4WI1A 4FM4B 1K9MC 4FYVB 1ZA1B 4XEOA 4LN2A 2FYKA 3UPUA 4L87A 1AVZC 2RQTA 5KCOA 4R56A 1KD1R 1TU0B 2VGMA 1X01A 2GNCA 2EGAA 5CR2A 2YRVA 4HVWA 1PRLC 5CKEA 4XU3A 1B3QA 2E65A 4YDQA 1NE8A 1W1FA 1MUZA 3QG1A 2ZPEB 1Y07A 4C8QD 2I0NA 2ABLA 3MP6A 3CC4A 1I07A 1EVKA 1Y71A 3V7CA 2CH4W 2KBTA 3EGDB 1H3ZA 3RDVA 4M7AA 5L8RE 1NJ2A 3CCQQ 4N0AA 4LUEA 1YCSB 5J26A 2EQUA 4DEYA 5L23A 2ZPBB 1GCQA 2CKKA 2HSEB 1X69A 4P5NA 3EG3A 2ALYA 4KUIA 1FXXA 1SSHA 1G51A 4F04B 1BI0A 4IUUA 1XTDA 2J3MA 1UUEA 1JXOA 1C0MA 3UA7A 1ADJA 2RPNA 2RHSB 1KHIA 4JLIA 2GFUA 2ARSA 4TTVA 1VQ9Q 2LCSA 3WVDB 2HD0A 4BE0A 3TSWA 2XIDA 2A28A 4MZMA 4JZ3A 2KSSA 2KI7A 4YRSA 4M75B 1MMNA 1Y0MA 2DVEA 3G4ST 3M54A 4BUGA 3GLXA 4M77G 2PVDB 4WF2A 1C6VX 1VQKQ 3DKMA 4P73A 2RK1A 1K73U 4TVRA 1VQPT 3LLRA 1K73C 4FYWB 2MIOA 5LJ5j 2RHUA 3CCLA 4RCCA 5F5WA 3SFMA 3VBBA 3OYFA 1ABQA 3CCRQ 4RQEA 2DKGA 4C5EA 1C1AA 4YRQA 1M3CA 5D6XA 2JM8A 1MNDA 3GP8A 2KXDA 4PJLA 5I2MA 1RAEB 1KJWA 2DL4A 4KR3A 3M4YA 4II1A 3KFUA 4E51A 1MMDA 1I81A 1JJ2S 1M2VB 2ZT7A 5CK9A 5KYUB 2HL5C 4C5GA 3MEYA 5LL6S 3CMAQ 2D0NA 2RHZA 3CMET 3OW2A 3PE0A 3HY1A 5CIUA 2E3HA 3OYGA 1OX9A 1VQ6T 2XGTA 4P72C 5LJ3e 2VC8A 1AZEA 2EYZA 2GTJA 2D6FA 4FSSA 4A4FA 5GMKe 1D0ZA 4YRIA 2L3SA 1ZBJA 1G5VA 3VUZA 5EC7A 1BI1A 2ZZEA 4DOWA 1GBQA 5LJ5f 4M7DF 3HXYA 1M90U 5GMKi 4OMMA 3BE3A 1ADYA 1YP5A 4ZNXA 4GLMA 1X55A 3FB9A 2OI3A 1B7YA 1W4SA 3H0HA 3R6NA 1HJDA 2J6KA 1K0SA 2LDMA 2M51A 1SRMA 3RF1A 1Y7XA 5LJ3h 4EMKA 2CJAA 2LT4A 5GMKh 1E7OA 5A0LA 3X20B 1RAHB 3HHTB 4ESRA 1Q7YR 2H8HA 3QO5A 3EG9A 4DBRA 3CCMQ 2KT8A 1N8RC 1T0JA 2IG0A 3OW2P 2A8EA 3CBMA 1NYRA 4YYEA 2L3RA 3FDRA 2PVOB 4A4KA 4CC2A 4WJ4A 1OPLA 4BY6B 1RL2A 3SD4A 2L5QA 3MCAB 3X25B 1OZ3A 3HRTA 2J05A 3PVLA 5HK0A 4V2SA 3HRSA 2DTOA 3A98A 2KGTA 1T3LA 4LDWA 2XMFA 3SEMA 5C6SA 2RHQB 2JJ9A 4FW1A 1WHKA 4AFQC 1LNXA 3RKXA 3ULRB 3NENA 3LGFA 3GNGA 4LVKA 2CDTA 1SETA 2WSFE 4QVDA 2KEAA 2D8HA 1Q86C 2MF2A 3VS0A 1VQNA 2EBPA 2ZIMA 4RMOA 4PG3A 2O4XA 3A31A 2RI5A 3G4SA 2I4NA 2Y4YA 2JNGA 3L2UA 3CXCA 1BYMA 4TQDA 3CD6T 1ARKA 3IQLA 2GF7A 2KT1A 1X56A 5GAMj 1NJIU 3ASKA 3URGA 1NJIC 2C7IA 1RIQA 3EFSA 1VQ8T 1RAAB 2E70A 2KNBB 3V8JA 4J7FA 2MCNA 4HT9A 3JCMX 1KD1U 2NUTA 2DL3A 4ATOA 4LDYA 4A4GA 4M77F 1MNEA 1YITT 2FB7A 1ZSZA 2FL7A 2E3IA 1M1KR 3HFNA 2MAMA 2NUZA 2QQBA 2K9GA 4CS3A 4M4ZA 3VRYA 3C95A 3I56A 3NTIA 1PKTA 3I7FA 1ZSGA 4M78D 4M7AE 1TUDA 5D6YA 3CCSA 3P8BB 2CT3A 4ME7A 5KYYB 3CXCP 2CH4A 3JCMb 4FL6A 3QDFA 5GAOn 3EAEA 1OU8A 1M1FA 4FSXA 1G3TA 4BY6C 3HXUA 3UFGA 3V8KA 4LNSA 2QEXT 1U3OA 4YRTA 4XQ3A 1SRYA 2K3BA 2MYSA 3MJXA 1XNIA 3A8LB 1QE0A 3E19A 1X75C 1KC8U 2HQEA 3UA6A 5CKHA 1KC8C 2QDYB 3F70A 1AD5A 2DD5A 4YRMA 3QO3A 5CKDA 2QI2A 5DM7R 1WHJA 2CUBA 2JN0A 3C12A 1GXIE 2LQ8A 3OYLA 5KYXA 1B34B 3HL8A 1YJNT 2A7YA 2FRYA 3MEUA 3MHXA 3E9GA 4L6V5 1QKXA 2M0OA 2DJQA 4D8KA 3X24B 3P8VA 3OYBA 2KK4A 1OQKA 1VQ9T 5IXFA 5FU7B 2AHJB 2J7IA 3FJ5A 1UB4A 1UEBA 4J15A 5HCKA 1D1AA 1QVFS 3KFVA 3RMSA 4LVLA 4HCKA 4LDXA 2BUDA 5LJ5d 3VUBA 8ATCB 5FWCA 4C92C 3OS5A 3E9HA 1SHFA 4YRFA 4YPFA 1VQKT 2P0QA 3EFRA 4LDUA 4ZGEB 3OA6A 3INZA 3A8MB 4NS5A 4PHCA 4P3NA 1HC7A 1OEBA 4IUVA 1H4SA 1W2BP 4G84A 2JTMA 1PD1A 1K8AR 4JS5A 3JCMg 2DERA 3OBYA 5FWBA 4J7IA 4HWTA 3TUPA 1D3BA 4QQDA 1ASYA 4HVCA 4A53A 4XU1A 2EKHA 1PM3A 4PJNA 1V1CA 2DM1A 3PCOA 2ZPGB 1FMWA 4Z8AA 3JB9H 1G8XA 4E7SA 3G1ZA 2DFUA 3R07A 2CT4A 3HXZA 3HSBA 3M4GA 1HD3A 1LOJA 1V29B 4XAXB 2RJEA 5GAN8 3G71Q 1I8FA 1QCOA 1VQPQ 3IKMB 2GFAA 1IB8A 1C0AA 4IUQA 4TWAA 5KCHA 2PMEA 3NEMA 1U1SA 4K11A 2CP3A 1VUBA 2O01E 5ELOA 1E1OA 3TVTA 4UP7A 3DSQA 4OVAA 3CC2Q 1I0CA 5C53B 2C0TA 3JV3A 2LQKA 3PGGA 1X6GA 3FIFA 4QW2A 4M7AB 3CBOA 4C8QF 4OGEA 2FG0A 4BDYA 1A0NB 3MP1A 4F16A 3UT1A 1SHGA 1N6AA 2X35A 3OQ5A 3RESA 4YCWA 1S1NA 2JTEA 2VKNA 3CPWP 2ZPFB 4LVIA 3KBGA 3CMEQ 1ASZA 4IIOA 1WGSA 2E4HA 2ALYB 3MF1A 4XU2A 3HPWA 3WVEB 3J7AF 4M77D 2YRCA 2HKNA 5GAMe 1KMNA 3UGTA 3D7SB 1R0BG 4PFZA 3CCMT 2VGNA 4M78A 4OF1A 3A74A 2BIVA 2DLPA 4ZGJB 2ZT8A 3HRUA 4JS4A 2F69A 3QSUA 2JVVA 2ZIOA 2DJZA 2CSIA 3JB9G 1CSKA 3CCQA 2ED1A 2VUBA 2ZCFB 3H9NA 3KUFA 1IGUA 1UG1A 3MEWA 3VYHB 2ZZDA 3M4PA 3OMGA 4FIBA 2ODRD 1FYNA 5GAMh 3A5YA 3RKYA 2EQIA 2ZNIA 1HSQA 3PNWC 3A1PA 3LWIA 4HWPA 4B9XA 2DETA 1NJ1A 4H2VA 4C0DB 3RMQA 2VVKA 3FJPA 1IL2A 3OYDA 1UE9A 4NL2A 2QG9B 1X27A 2JMCA 2DO3A 2JTFA 1IRXA 3L1AA 1JJCA 1RI9A 4M7DA 2J6OA 3LSQA 2A08A 2COZA 3P8DA 1UTIA 3L2WA 2CIMA 1PRMC 2DXBA 1UHFA 2LJ3A 1EQRA 1VIFA 3PIOA 4P3OA 1NJ6A 4C92G 1VQKA 4BD3A 1QVGS 1Q82U 1FMVA 3FLGA 5AT1B 1M1KU 2EJGA 1Q82C 2ESWA 3J81E 4E7KA 1PYSA 2G6FX 2LNVA 5HK3A 3A5ZA 3HXXA 1MHNA 1WLEA 3CCRA 2VB6A 4M7AC 3MEVA 4N0AC 2VWFA 3A7AA 2R5MA 1VYUA 3CCEQ 3HY0A 4P3PA 1G83A 4E6RA 1SSFA 1H4VB 1GCQC 1JO8A 1VQMQ 3PMTA 1B7YB 1H4TA 3I5RA 1YWOA 3NFCA 1WYXA 1LPLA 2W10A 1YJ9Q 2H3JA 3CD6Q 2HQHA 2RO0A 1WXTA 1WJSA 4AFUC 1YI2T 2CP5A 3SB2A 4EMKB 3M0QA 3SDZA 3CMAA 1I5LA 1G3WA 1VQ8Q 1WXUA 5ECAA 1UGQB 3EG9B 4QVCA 3M0TA 2ZR3A 2DAQA 5GMKl 1IGQA 4IUPA 1YITQ 12ASA 2K79A 2RN8A 1O75A 2HNIA 1HYOA 4HA8A 1JJ2A 1KMMA 1X43A 1RI0A 2GGRA 2DTHA 1M3AA 2EYXA 3HRIA 2YXYA 1HXDA 3SWNB 1YFNA 3IKLA 1QWEA 2K5LA 1M1GA 1KQSA 4C0DC 1H4QA 3V7RA 2RK2A 2OTJQ 2DYBA 3REAB 2QAZA 2X4WA 3DB3A 2VV5A 2OTLQ 2MWPA 3OYYA 4J9EA 4Z89A 2QEXQ 3TEGA 4WCIA 5FROA 4P74C 4CI0C 3CCMA 1LJOA 1VQ5A 1B8AA 2HKQB 2YUOA 4QKUA 1EVLA 2LNHB 1X6BA 4M77A 3JRZA 2MOXA 4BACA 1U06A 4O2DA 2O4XB 2AZVA 3QYHB 4XTZA 3EGUA 5AYFA 1K8AU 3V7SA 4CC3A 5FRMA 4OMFB 3L2QA 1FX7A 2HQXA 1T0HA 5C52B 1JJ2P 5CQYA 1R0CB 3E1SA 1YJNQ 2PNIA 3OD1A 3EGXA 3EG1A 4WJ3M 2K5FA 4PJOB 1QCFA 2NUTB 3X28B 2D8JA 3VQWA 1KQSP 1ZSZB 1BI2A 1G3SA 1KQ1A 3BJUA 5I2SA 2KMTA 1NJ5A 3SHWA 2Q7GA 3IG2A 3VS4A 2HCKA 2IY5A 3HTZA 1EOVA 2CP0A 2DPPB 4JPBW 1M9SA 1TOVA 3A8OB 3G71T 1TWBA 4ANJA 1WNLA 2EYWA 4YRPA 4FW2A 2LC4A 3CCVT 2K2VA 2P0KA 3NPFA 1S72T 1X2GA 4PKCC 4LNPA 4HCBA 3MPUB 4PL6A 2CJBA 4M78F 2LVMA 1L0WA 2ZPHB 3TU4K 3OS2A 2OX7A 2G3RA 4GBQA 1GCPA 4E7ZA 4M7AG 3SWNC 3MEAA 1WYDA 2FO0A 5EG2A 5FU6B 3CC2T 1U1TA 2K7AA 4LDVA 5CKFA 3M56A 1N9SA 4C92F 4UC4A 4ZN1A 2ROTA 2EFIA 2AZSA 1M4ZA 4DA4A 4YROA 4FYXB 1GGMA 3NELA 4MDXA 4G85A 1NLOC 5KNNA 4Y92A 4M78E 1RAFB 4K86A 1R77A 4AH6A 3VJPA 1B7TA 4DBHA 1YHQA 2XTIA 1NZ9A 4F7UF 2RI3A 3NHNA 2LMJA 4TVAA 1B70A 1OOTA 4HCZA 2QHUA 2L0AA 2FHDA 2BE9B 2ARTA 1Q81R 1KFZA 2PUKB 1AT1B 1D0YA 3S3NA 3CPFA 1BK2A 3M0SA 4PK4A 2AT1B 1M90C 1BKBA 3MQZA 4CC7A 1PHTA 7AT1B 2LCLA 3M0RA 4RCBA 2KYMA 3C94A 2DK3A 4UP9A 1N5ZA 2Q5IA 3QDRB 2EYQA 4PJOC 4J9HA 2DVJA 4R55A 2BTTA 4M7DE 4JDSA 4O5VA 2W0ZA 4FT4A 3HFVA 4Y28E 1ZUYA 4J6WA 4KULA 1D3BB 2FRWA 4M75C 4D8DA 2EYYA 4KH1B 3PCOB 1PKSA 4E7JA 3I55Q 2LT1A 4IURA 1R8OB 2QYZA 2K3XA 4A54A 5LJ3g 2P0LA 1J3TA 1LCKA 3OY9A 3RERA 2MWOA 4A63B 3JCMf 2E10A 4C8QA 2AIRB 4UP8A 5I21A 4OMPA 2Y90A 1NPRA 3UF4A 4KGXB 2X9HA 4C0GA 1N27A 4HXJA 1W66A 1QVFA 5FLXE 2HSPA 3S6WA 5GAOl 3CCET 2DBKA 3FEOA 5DY9A 4ORZA 1VQMT 1VQOQ 4LE9A 2R58A 4E7HA 4KBMB 2HL3A 3L4GA 4RTUA 1YJ9T 2DTIA 1G3YA 3G71A 1VQPA 5D6WA 1AEYA 2D1XA 2FPEA 5GAN7 4P72A 5GJWB 3EGDA 3JB9D 2P4TA 1VYTA 2ZT6A 2NYSA 2QASA 1KD1C 4M78B 3JAME 1JBMA 3EH2A 3CC2A 1YCYA 1NNHA 2DEQA 2F1LA 1KOGA 2X51A 4RTWA 1B07A 2E1HA 3QJ6A 4XTYA 2BZ8A 3OYNA 1QVFP 3CBPA 4YRCA 2RHSA 1YI2Q 1M8MA 4J6YA 3TREA 3X26B 1MMGA 5GJVB 3CMEA 3A8HB 3H8ZA 1TXQA 2GQIA 4M77E 4CS4A 3FRNA 4H2SA 1VQ6A 2X3XD 5KH6A 4RTZA 2ENMA 3M57A 2OTJT 5LJ5e 2DIGA 1RAGB 3DLMA 3NTHA 1F1BB 4WTOB 3CC7T 2OTLT 2CUDA 3QYGB 4C92D 2RQVA 1FYFA 4Q15A 1M5Q1 2RF0A 1JJCB 4M7DB 3PMIA 2PVGB 3RUXA 3O5ZA 4YRLA 2E12A 1ZQ1A 1ZA2B 1SEMA 3UWNA 1RACB 2E5AA 1QQJA 2C0IA 5LJ5h 1GFCA 4HVUA 4UPAA 1PYSB 1WXBA 2DXCA 4PJOG 5GANf 2E64A 4CH5A 3A5ZB 3N5BB 4ZTFA 3LC0A 2DYIA 1UJYA 2O9SA 2VYTA 4LVMA 2RQRA 2ED0A 5IT9E 1TG0A 2JS2A 3HRKA 4BI4A 2O2OA 2DL8A 2QA4T 3ERRA 3OSSC 2X4JA 2PMFA 4J5YA 4KH0B 4M75G 2QQRA 1Q95G 2YWWA 2XICA 1E24A 1KK7A 2KRMA 2R5AA 2WSEE 3VQVA 1K9MR 4H2XB 1VQ4T 1ZBXA 1AWXA 4LD9K 3HFOA 2CZ0B 2OAUA 2Q5HA 4OMQA 4PFPA 1BI3A 1IXDA 1YFSA 3M53A 1NEGA 2PTKA 1KHCA 3JCMJ 1I5OB 2XDBA 3A7RA 1SERA 1JRIA 3H41A 2LRQA 4BE1A 2DXUA 4RG8A 3L2VA 5KE2A 1G5IA 5GAOr 4J9FA 3EG0A 1RUWA 1HK9A 2HMAA 4FU6A 3CCEA 3S3MA 2WACA 2O88A 2K5IA 3Q1JA 4EX5A 1VQMA 2CP6A 5DLOA 2E6ZA 1QLYA 1Z9ZA 4DBFA 1QVGA 2EQJA 1YJ9A 2ZNJA 1WIEA 4CC4B 4OGCA 3CD6A 2KE9A 4P75C 3CCVQ 2RHIA 3JCMd 2DE0X 1AZGB 2CP7A 1S72Q 5IN1A 2RI2A 1M30A 2HZYA 4H2YA 2V26A 2K6DA 5FRNA 1VQ8A 4IKFA 2CP2A 2QQ9A 4XTWA 2V8KA 2YDLA 3VV0A 2LTOA 3I9QA 1YITA 2IPOB 4HWRA 4M77B 3M58A 3REBB 2QDLA 2DX1A 4JUVA 3AHUA 1YWPA 1QVPA 5M9OA 1Q7YU 4DBQA 1Q7YC 1EIYA 3R6OA 2QHVA 1QMCA 1GBRA 2VXEA 2KROA 3JB9J 1K73R 2DXTA 4AFZC 2YUQA 3BY7A 2EQMA 2PU9B 2XDPA 5FU7C 2F5KA 1JB0E 1DJ7B 3EGXB 1VQLT 2OTJA 1TSFA 4PLLA 1LYLA 4C8QE 4OLFA 2MMPA 1V76A 4HT4A 3T9NA 1I1JA 3HP9A 3I56Q 2QEXA 2DL5A 4BI8B 4JLGA 1MMAA 2E5QA 1W2BS 4X9CA 2IY5B 3I55T 1BBZA 4P71C 2EIFA 4XTVA 2HAXA 2YLBA 1OV3A 2ROLA 1TS9A 2E41A 4C92A 1UGPB 2KRNA 2NUPA 4M7AD 2AKLA 4RKUE 4J9CA 2DZCA 5KYNA 2LX7A 3CC4T 5GAN5 4N4GA 4YCUA 4JJBA 4TQFA 1YJNA 1BIBA 1Y96A 2QGGA 2YLCA 1USYC 1YFTA 3EFOA 2KR3A 1WX6A 3QUIA 4J9BA 4F7UA 4XK8E 1BIAA 1UJ0A 3QNEA 2J3LA 2EPDA 2Z0WA 5I22A 1VQ9A 1K9AA 4C0FA 3UDCA 3VS3A 1JXMA 1H641 2FZCB 2I2LA 2XKOC 2G4CA 5CVIA 1EFNA 2JZ2A 1YFRA 5GANg 1X2KA 5GAMg 3JCMQ 1VQOT 2KRSA 1N9WA 1WDXA 4JJNK 2HEQA 3RIRA 4ZTZB 2CJ9A 9ATCB 1M1KC 2Y4XA 3TQ7P 4TVAB 2P84A 1B70B 4K87A 4J9DA 1PC0A 3LYIA 2ATCB 4E2FB 2L3PA 3CPWS 1K76A 1W70A 2QGFB 3EG2A 1RLPC 2DU7A 3OYIA 1N8RR 5GANd 2P5IA 3ER0A 2M0YA 1WLPB 4QT7A 2BZXA 1WI7A 2PZ1A 2JW4A 1H92A 2DDZA 3EHRA 2SRCA 1TUGB 2XU8A 2ZT5A 1G5HA 3H0IA 3M0PA 2BZYA 4RTXA 2RJCA 5FW9A 4K88A 2XI9A 4CH3A 1NG2A 2KY9A 1M8VA 4NCXA 1FWZA 4E7LA 1ZLMA 4HWOA 5A0GA 1VQZA 4BW9A 1EX4A 1KSWA 2CREA 4H2TA 2WSCE 1YIJQ 1YJWQ 3VS1A 4N4HA 4M7DG 1UHCA 1WPYA 3REXA 3VKIA 1Q86R 2AKKA 4P73C 4CRIA 1BCMA 1OYXA 2J6FA 4Q5WA 3I5SA 4C8QB 4FCYA 3RL6A 1EZZB 2QXFA 3G6EQ 2QQSA
chains in the Genus database with same CATH topology
1X6OA 3O8VA 3BDLA 2RJFA 1NJ8A 3HFZA 2XK0A 5LJ3f 1BBWA 4YRRA 2JUFA 2X4XA 4O6JA 4BI3A 2L8DA 3J80E 1AHJB 1I4K1 2YHTA 4BWAA 4YRJA 3M5AA 4D6WA 3I55A 4GY5A 1SESA 4YTLA 1PSEA 2CGHA 1K8AC 3L4GB 3L2ZA 2IVWA 4Q6GA 4ELYC 3LWHA 2E3CA 4QQ6A 2CZ7B 3QO7A 2ZPIB 1P92A 4EO4A 2XHCA 3OYEA 4GLKA 3VU3C 3OYJA 5J3BA 2EL9A 2F5TX 2X4YA 3OMCA 2ZCEA 3JB9F 4E47A 4L59A 3V8LA 3GOXA 2I4OA 3OBWA 4EMKC 4OP0A 4J83A 4DQ2A 2XD0A 2AKWA 5GAN2 3OYCA 5HGQA 2XDDA 4C0ZA 1VQOA 4E7IA 4YP0A 4EMHA 4C5IA 4Y91A 1VQNT 3JCMV 3JCMW 3QPHA 4ZIBA 3QO8A 3M59A 4C8QC 4PJOD 4X34A 2AMCA 1TH7A 4KT0E 4M75D 2VXFA 5CCAA 4RDXA 1YI2A 1Z7MA 2R57A 4FT2A 4MMLA 3DB4A 4VUBA 2RJDA 1E22A 4C92E 1X2HA 4P74A 4H2WA 1KG1A 3HXVA 3I56T 3QBYA 2K3YA 3DLLA 1ATIA 3QJYA 4F7UE 3CCST 2DQ3A 4YRNA 1WJRA 3BDUA 5DLQE 1KQSS 1HTTA 5GAOm 5CQXA 2V8JA 3QTCA 2EJ9A 2ZGWA 4XU0A 2QTXA 4MDWA 3WXMB 3PFSA 3LGLA 2NLUA 1IREB 3JSCA 1O9SA 4J6XA 4JRPA 5K1XA 1VIEA 1EFWA 2LCCA 5CKBA 1WJQA 5GAN4 3P8TA 4X5OA 4HKEA 3E9IA 4BE2A 1N8RU 2P0PA 4OB2B 5A2QE 3GIBA 1B76A 4TVYA 3OYHA 4YREA 2LX9A 3GNFB 3CMQA 1EIFA 3MF2A 2Q7EA 5FU6C 4N4IA 4CH6A 3TEHA 2I4LA 5LJ3d 2RH2A 3SWNA 3L42A 2M16A 3PT9A 2EWNA 2L89A 3L2RA 3GF5A 1EIYB 3OS0A 4A4HA 1X54A 3E9FA 2ZR2A 1U8RA 1QW1A 1Q86U 4NOYA 3CCVA 3JB9I 2C06A 1N9RA 1S72A 1UGSB 1OI1A 2DQ0A 4ZN3A 4XEMA 2KQWA 1J5WA 3LH0A 3GPLA 1YIJT 3A8GB 3META 1YJWT 3VQXA 1NPPA 4BDZA 3REUA 4X9DA 4XTXA 3HXWA 4C8QG 1MGQA 3QZ9B 4ZTUB 3TEEA 4JRKA 4NL3A 3QXEB 5GANj 1QP2A 4C92B 3OW2S 3FC3A 4YRKA 4XTUA 4PJOA 3G6ET 4M7AF 3TCJA 1Y96B 4F7UB 4HCCA 4M75A 4ZGDB 3CCJT 3H6ZA 5K1PA 4RMFA 4KUDK 4MZTA 3QKJA 2ZINA 4CS2A 2K4YA 2CS7A 3LX7A 4KR2A 2NS6A 5GAMf 2V8IA 4RQFA 4JRIA 1YBYA 2KDSA 1W2BA 3CCQT 4LD6A 3JCMe 1OZ2A 2KVQG 2Q7HA 3PTAA 4KQEA 2A3LA 5CO7A 1VQ7T 2C8MA 4H2UA 5LJ5g 2KAFA 2K57A 2DD4A 4M7DD 2DIQA 3QZ5B 3M9QA 4EPCA 4CH4A 2FVUA 4M78C 5J39A 3JCMh 3CEYA 2EAYA 1PSFA 4IUTA 3CCUT 2ZTGA 3P8YA 2RHXA 3IALA 3PIPA 3CXCS 2DU5A 3G7ZA 1NYQA 4PLIA 3LW5E 3ME9A 4MMKA 4H02A 1WU7A 3CCRT 1Q81U 1Q81C 3VQYA 3NETA 3NTKA 3HFZB 2RB6A 2GQVA 2CYZB 3CPWA 4HWSA 4LVJA 4OB0B 3QHSA 1XOVA 3JCMP 5GAN6 4M7DC 4Z02A 1QP3A 3VYGA 4QVZA 1YIJA 1YJWA 2ARUA 2CZ1B 5GAOq 3CMAT 2CZ6B 2RHQA 3ZEHA 3S3OA 1IZ6A 5HY6A 3LSSA 4OB3B 3QIIA 3G6EA 2RM4A 4A4EA 2QHTA 4BB7A 5C0MA 3OB9A 3C4SA 2HBPA 5C51B 4TVWA 3RGLA 2DZ9A 3CC7A 2OTLA 3BW1A 3CCJA 2D0QB 1XQHA 3HKSA 4B9WA 4J8OA 3OYMA 4PNOA 2EKOA 3MP8A 2AKWB 2ZZGA 5GANe 5HKCA 3A32A 5A0DA 2GCXA 1VQ5T 4C5HA 2EQKA 2M9UA 2MI6A 11ASA 4OB1B 3UGQA 3OSVA 3WQZA 1UGRB 2QA4A 1Z7NA 2ZZFA 5E3IA 4L5GA 3RACA 3BFMA 2QQAA 5GANh 1VQ7A 2AMCB 3A7UA 5GMKm 5GAOp 2M1HA 2ZXFA 4PJOF 2I4MA 5IAYA 1VQ4A 4P75A 3JCMc 2JOYA 3RKWA 1YB3A 2BKDN 3ZBDA 1QF6A 4M75F 1BBUA 2XG8D 3UH0A 4HT8A 4M78G 4M77C 2PQWA 4MZPA 4PJOE 4EDUA 5GAN3 5GAMd 3CCUA 1E1TA 5LJ3j 3CCLT 1YGBA 1B34A 2RA2A 5GMKj 4ZTJA 4M75E 4ELZC 1WQWA 2RD1A 4RG2A 4DOVA 3PZCA 4JRQA 4EMGA 2E6NA 3OS1A 4F7UG 2EJFA 5CAIA 2ODRC 4YCVA 3W3SA 3OYAA 3OYKA 3ICAA 3P8HA 5KE3A 4H2XA 3KXTA 4P71A 2D9TA 2RHYA 4QQGA 1YHQT 3ZFJA 1WQ7A 2B8AA 1KQ2A 2PUOB 1ZHIA 2QHSA 4YRGA 3MO8A 3M4QA 3M55A 4DPGA 1USYA 5ELNA 3TEHB 1K9MU 1VQLA 4WI1A 4FM4B 1K9MC 4XEOA 2FYKA 3UPUA 4L87A 5KCOA 4R56A 2VGMA 1X01A 5CR2A 2YRVA 5CKEA 4XU3A 2E65A 4YDQA 1NE8A 3QG1A 2ZPEB 1Y07A 4C8QD 3MP6A 3CC4A 1EVKA 1Y71A 3V7CA 1H3ZA 4M7AA 5L8RE 1NJ2A 4N0AA 5J26A 2EQUA 2ZPBB 2CKKA 4P5NA 2ALYA 4KUIA 1FXXA 1G51A 1BI0A 4IUUA 1XTDA 2J3MA 1ADJA 2RHSB 1KHIA 4JLIA 2GFUA 2ARSA 4TTVA 3WVDB 2HD0A 4BE0A 2XIDA 4MZMA 2KSSA 4YRSA 4M75B 2DVEA 3G4ST 3M54A 4BUGA 3GLXA 4M77G 2PVDB 4WF2A 3DKMA 4P73A 2RK1A 1K73U 4TVRA 1VQPT 3LLRA 1K73C 5LJ5j 2RHUA 3CCLA 4RCCA 5F5WA 3SFMA 3VBBA 3OYFA 4RQEA 2DKGA 4C5EA 4YRQA 5D6XA 3GP8A 5I2MA 4KR3A 3M4YA 4II1A 3KFUA 4E51A 1I81A 1JJ2S 2ZT7A 5CK9A 4C5GA 3MEYA 5LL6S 2RHZA 3CMET 3OW2A 3HY1A 5CIUA 3OYGA 1VQ6T 2XGTA 4P72C 5LJ3e 2VC8A 2D6FA 4A4FA 5GMKe 4YRIA 1G5VA 3VUZA 1BI1A 2ZZEA 4DOWA 5LJ5f 4M7DF 3HXYA 1M90U 5GMKi 1ADYA 1X55A 3FB9A 1B7YA 1W4SA 2LDMA 3RF1A 1Y7XA 5LJ3h 4EMKA 2CJAA 2LT4A 5GMKh 5A0LA 3HHTB 3QO5A 1N8RC 2IG0A 2A8EA 3CBMA 1NYRA 4YYEA 2L3RA 3FDRA 2PVOB 4A4KA 4WJ4A 4BY6B 1RL2A 3SD4A 2L5QA 3MCAB 3X25B 1OZ3A 3HRTA 5HK0A 4V2SA 3HRSA 2DTOA 4LDWA 5C6SA 2RHQB 1LNXA 3RKXA 3NENA 3LGFA 3GNGA 4LVKA 1SETA 2WSFE 4QVDA 1Q86C 2MF2A 1VQNA 2ZIMA 4RMOA 4PG3A 2O4XA 3A31A 2RI5A 3G4SA 2I4NA 2Y4YA 2JNGA 3L2UA 3CXCA 1BYMA 4TQDA 3CD6T 2GF7A 1X56A 5GAMj 1NJIU 3ASKA 3URGA 1NJIC 2C7IA 1RIQA 3EFSA 1VQ8T 2E70A 3V8JA 4J7FA 4HT9A 3JCMX 1KD1U 4ATOA 4LDYA 4A4GA 4M77F 1YITT 2FB7A 2FL7A 3HFNA 2MAMA 2QQBA 4CS3A 3C95A 3I56A 3NTIA 3I7FA 4M78D 4M7AE 5D6YA 3CCSA 3P8BB 4ME7A 3JCMb 4FL6A 5GAOn 3EAEA 1M1FA 4FSXA 1G3TA 4BY6C 3HXUA 3UFGA 3V8KA 4LNSA 2QEXT 4YRTA 4XQ3A 1SRYA 1XNIA 3A8LB 1QE0A 3E19A 1X75C 1KC8U 2HQEA 5CKHA 1KC8C 2QDYB 3F70A 2DD5A 4YRMA 3QO3A 5CKDA 2QI2A 5DM7R 2JN0A 3C12A 1GXIE 2LQ8A 3OYLA 1B34B 3HL8A 1YJNT 2A7YA 3MEUA 3MHXA 3E9GA 4L6V5 2M0OA 3X24B 3P8VA 3OYBA 2KK4A 1VQ9T 5FU7B 2AHJB 1UB4A 1UEBA 4J15A 1QVFS 3RMSA 4LVLA 4LDXA 2BUDA 5LJ5d 3VUBA 4C92C 3OS5A 3E9HA 4YRFA 4YPFA 1VQKT 2P0QA 3EFRA 4LDUA 4ZGEB 3OA6A 3INZA 3A8MB 4NS5A 4PHCA 4P3NA 1HC7A 4IUVA 1H4SA 4G84A 2JTMA 4JS5A 3JCMg 3OBYA 4HWTA 4J7IA 3TUPA 1D3BA 4QQDA 1ASYA 4HVCA 4A53A 4XU1A 3PCOA 2ZPGB 3JB9H 3G1ZA 3R07A 3HXZA 3HSBA 3M4GA 1LOJA 1V29B 4XAXB 2RJEA 5GAN8 1I8FA 3IKMB 2GFAA 1C0AA 4IUQA 4TWAA 5KCHA 2PMEA 3NEMA 1U1SA 1VUBA 2O01E 5ELOA 1E1OA 4UP7A 3DSQA 4OVAA 5C53B 2LQKA 3PGGA 3FIFA 4QW2A 4M7AB 3CBOA 4C8QF 4OGEA 4BDYA 3MP1A 3UT1A 1N6AA 2X35A 3OQ5A 3RESA 4YCWA 2ZPFB 4LVIA 3KBGA 1ASZA 1WGSA 2ALYB 3MF1A 4XU2A 3HPWA 3WVEB 3J7AF 4M77D 5GAMe 1KMNA 3UGTA 3CCMT 2VGNA 4M78A 4OF1A 3A74A 2BIVA 4ZGJB 2ZT8A 3HRUA 4JS4A 2F69A 3QSUA 2JVVA 2ZIOA 2DJZA 3JB9G 3CCQA 2VUBA 2ZCFB 3KUFA 3MEWA 3VYHB 3M4PA 2ZZDA 3OMGA 4FIBA 2ODRD 5GAMh 3A5YA 3RKYA 2ZNIA 3PNWC 3LWIA 4HWPA 4B9XA 1NJ1A 4H2VA 4C0DB 3RMQA 3FJPA 1IL2A 3OYDA 4NL2A 2DO3A 2JTFA 3L1AA 1JJCA 4M7DA 3LSQA 3P8DA 3L2WA 2CIMA 2DXBA 1EQRA 1VIFA 3PIOA 4P3OA 1NJ6A 4C92G 1VQKA 4BD3A 1QVGS 1Q82U 3FLGA 1M1KU 2EJGA 1Q82C 4E7KA 3J81E 1PYSA 2LNVA 5HK3A 3A5ZA 3HXXA 1MHNA 1WLEA 3CCRA 4M7AC 3MEVA 4N0AC 3A7AA 2R5MA 3HY0A 4P3PA 1SSFA 1H4VB 3PMTA 1B7YB 1H4TA 3NFCA 2H3JA 2RO0A 1WJSA 1YI2T 3SB2A 4EMKB 3SDZA 3CMAA 1I5LA 1G3WA 1UGQB 4QVCA 2ZR3A 2DAQA 5GMKl 4IUPA 12ASA 1O75A 2HNIA 1KMMA 4HA8A 1JJ2A 1RI0A 2DTHA 3HRIA 1HXDA 3SWNB 3IKLA 2K5LA 1M1GA 1KQSA 4C0DC 1H4QA 3V7RA 2RK2A 2X4WA 3DB3A 2VV5A 2MWPA 3OYYA 3TEGA 5FROA 4P74C 4CI0C 3CCMA 1LJOA 1VQ5A 1B8AA 1EVLA 4M77A 3JRZA 4BACA 4O2DA 2O4XB 4XTZA 3QYHB 5AYFA 1K8AU 3V7SA 5FRMA 4OMFB 3L2QA 1FX7A 2HQXA 5C52B 5CQYA 3E1SA 3OD1A 4WJ3M 2K5FA 4PJOB 3X28B 3VQWA 1BI2A 1G3SA 1KQ1A 3BJUA 5I2SA 2KMTA 1NJ5A 2Q7GA 3IG2A 2IY5A 3HTZA 1EOVA 2DPPB 1M9SA 3A8OB 3G71T 1WNLA 4YRPA 2LC4A 3CCVT 2K2VA 2P0KA 1S72T 1X2GA 4PKCC 4HCBA 4PL6A 2CJBA 4M78F 2LVMA 1L0WA 2ZPHB 3TU4K 3OS2A 4M7AG 2G3RA 3SWNC 3MEAA 1WYDA 5EG2A 5FU6B 3CC2T 1U1TA 4LDVA 5CKFA 3M56A 1N9SA 4C92F 4UC4A 4ZN1A 2EFIA 1M4ZA 4DA4A 4YROA 1GGMA 3NELA 4MDXA 4G85A 5KNNA 4M78E 4K86A 4AH6A 3VJPA 1YHQA 2XTIA 1NZ9A 4F7UF 2RI3A 4TVAA 1B70A 4HCZA 2QHUA 2FHDA 2ARTA 2PUKB 3S3NA 3CPFA 1M90C 1BKBA 3MQZA 2LCLA 4RCBA 3C94A 2DK3A 4UP9A 2Q5IA 3QDRB 2EYQA 4PJOC 4R55A 4M7DE 4JDSA 4O5VA 4FT4A 3HFVA 4Y28E 4J6WA 4KULA 1D3BB 4M75C 3PCOB 4E7JA 2LT1A 4IURA 1R8OB 2K3XA 4A54A 5LJ3g 2P0LA 3OY9A 3RERA 2MWOA 3JCMf 2E10A 4C8QA 4UP8A 5I21A 2Y90A 1NPRA 4C0GA 1N27A 1W66A 1QVFA 5FLXE 3S6WA 5GAOl 3CCET 3FEOA 5DY9A 1VQMT 2R58A 4E7HA 4KBMB 3L4GA 1YJ9T 2DTIA 1G3YA 3G71A 1VQPA 5D6WA 5GAN7 4P72A 3JB9D 2QQSA 2P4TA 2ZT6A 1KD1C 4M78B 3JAME 1JBMA 3CC2A 1YCYA 1NNHA 2DEQA 1KOGA 2E1HA 3QJ6A 4XTYA 3OYNA 3CBPA 4YRCA 2RHSA 4J6YA 3TREA 3X26B 3CMEA 3A8HB 3H8ZA 4M77E 4CS4A 3FRNA 4H2SA 1VQ6A 5KH6A 3M57A 2OTJT 5LJ5e 2DIGA 3DLMA 3NTHA 3CC7T 2OTLT 3QYGB 4C92D 1FYFA 4Q15A 1M5Q1 1JJCB 4M7DB 3PMIA 2PVGB 3RUXA 4YRLA 2E12A 1ZQ1A 3UWNA 2E5AA 5LJ5h 4UPAA 1PYSB 2DXCA 4PJOG 5GANf 2E64A 4CH5A 3A5ZB 3N5BB 4ZTFA 3LC0A 2VYTA 4LVMA 5IT9E 3HRKA 4BI4A 2QA4T 3ERRA 3OSSC 2X4JA 2PMFA 4J5YA 4M75G 2QQRA 2XICA 1E24A 2WSEE 2R5AA 3VQVA 4H2XB 1VQ4T 1ZBXA 4LD9K 3HFOA 2CZ0B 2OAUA 2Q5HA 1BI3A 1YFSA 3M53A 1KHCA 3JCMJ 2XDBA 3A7RA 1SERA 1JRIA 2LRQA 4BE1A 2DXUA 4RG8A 3L2VA 5KE2A 1G5IA 5GAOr 1HK9A 4FU6A 3CCEA 3S3MA 2WACA 2K5IA 3Q1JA 4EX5A 1VQMA 5DLOA 2E6ZA 1QVGA 2EQJA 1YJ9A 2ZNJA 4OGCA 3CD6A 4P75C 2RHIA 3JCMd 5IN1A 2RI2A 4H2YA 5FRNA 1VQ8A 4IKFA 2QQ9A 4XTWA 2V8KA 3VV0A 2LTOA 1YITA 4HWRA 4M77B 3M58A 4JUVA 3AHUA 5M9OA 1QVPA 1Q7YU 1Q7YC 1EIYA 3R6OA 2QHVA 2VXEA 3JB9J 2DXTA 3BY7A 2EQMA 2PU9B 2XDPA 5FU7C 2F5KA 1JB0E 1DJ7B 1VQLT 2OTJA 4PLLA 1LYLA 4C8QE 4OLFA 2MMPA 4HT4A 3T9NA 3HP9A 2QEXA 4BI8B 4JLGA 2E5QA 1W2BS 4X9CA 2IY5B 3I55T 4P71C 2EIFA 4XTVA 2HAXA 2YLBA 2E41A 4C92A 1UGPB 4M7AD 4RKUE 2DZCA 3CC4T 5GAN5 4N4GA 4YCUA 4TQFA 1YJNA 1BIBA 1Y96A 2YLCA 1USYC 1YFTA 4F7UA 3QUIA 4XK8E 1BIAA 3QNEA 2J3LA 1VQ9A 4C0FA 3UDCA 2I2LA 1H641 2XKOC 2G4CA 5CVIA 2JZ2A 1YFRA 5GANg 5GAMg 3JCMQ 1VQOT 1N9WA 4JJNK 3RIRA 4ZTZB 2CJ9A 1M1KC 2Y4XA 4TVAB 1B70B 4K87A 3LYIA 3CPWS 2DU7A 3OYIA 5GANd 2P5IA 3ER0A 2DDZA 2XU8A 2ZT5A 1G5HA 2RJCA 4K88A 2XI9A 4CH3A 2KY9A 1M8VA 4NCXA 1FWZA 4E7LA 4HWOA 5A0GA 1VQZA 4BW9A 4H2TA 2WSCE 4N4HA 4M7DG 1WPYA 3REXA 3VKIA 4P73C 4CRIA 1OYXA 4Q5WA 4C8QB 3RL6A 2QXFA 3X20B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BW1 A;  1NJ8 A;  3HFZ A;  3JCM b;  5LJ3 f;  5GAO n;  1BBW A;  4YRR A;  3HXU A;  3UFG A;  3V8K A;  4LNS A;  4RCB A;  4YRT A;  4XQ3 A;  1SRY A;  4PNO A;  4UP9 A;  2Q5I A;  2AKW B;  2ZZG A;  1I4K 1;  4PJO C;  5GAN e;  1QE0 A;  2YHT A;  4BWA A;  4M7D E;  3A32 A;  4YRJ A;  3HFV A;  4YRM A;  3QO3 A;  4J6W A;  1SES A;  1D3B B;  4M75 C;  11AS A;  2JN0 A;  2CGH A;  3L4G B;  1B34 B;  3L2Z A;  4Q6G A;  3PCO B;  3UGQ A;  2E3C A;  3WQZ A;  1Z7N A;  2ZZF A;  5E3I A;  4A54 A;  5LJ3 g;  2P0L A;  3QO7 A;  3RER A;  3JCM f;  3P8V A;  2E10 A;  3RAC A;  3BFM A;  4C8Q A;  4EO4 A;  5GAN h;  3A7U A;  2AMC B;  5GMK m;  5GAO p;  4UP8 A;  3VU3 C;  5I21 A;  2ZXF A;  4J15 A;  4PJO F;  2I4M A;  2EL9 A;  2Y90 A;  2ZCE A;  3JB9 F;  4P75 A;  3V8L A;  3JCM c;  2I4O A;  5LJ5 d;  3RKW A;  1YB3 A;  4EMK C;  4C92 C;  1W66 A;  3E9H A;  1QF6 A;  4M75 F;  4YRF A;  4OP0 A;  4YPF A;  1BBU A;  4DQ2 A;  3EFR A;  5GAN 2;  2AKW A;  3UH0 A;  5HGQ A;  3INZ A;  4HT8 A;  4M78 G;  4YP0 A;  4EMH A;  4M77 C;  4PHC A;  4P3N A;  4Y91 A;  1HC7 A;  1H4S A;  5GAO l;  4PJO E;  4G84 A;  5GAN 3;  5DY9 A;  5GAM d;  1E1T A;  3JCM g;  4HWT A;  3TUP A;  1D3B A;  3JCM V;  5LJ3 j;  1ASY A;  4HVC A;  3JCM W;  4A53 A;  1YGB A;  3L4G A;  1B34 A;  2RA2 A;  4XU1 A;  5GMK j;  2DTI A;  4M75 E;  3PCO A;  4ZIB A;  3JB9 H;  3QO8 A;  3G1Z A;  3R07 A;  1WQW A;  2RD1 A;  3PZC A;  5GAN 7;  4P72 A;  3HXZ A;  4C8Q C;  4PJO D;  3HSB A;  3M4G A;  4EMG A;  1LOJ A;  3JB9 D;  5GAN 8;  4F7U G;  2AMC A;  1I8F A;  2EJF A;  3IKM B;  1TH7 A;  5CAI A;  2ODR C;  2ZT6 A;  1C0A A;  4TWA A;  2PME A;  4YCV A;  3NEM A;  3W3S A;  4M75 D;  4M78 B;  1JBM A;  1U1S A;  3ICA A;  2VXF A;  4H2X A;  4RDX A;  1YCY A;  1NNH A;  2DEQ A;  1Z7M A;  5ELO A;  1E1O A;  1KOG A;  4MML A;  4P71 A;  4UP7 A;  2E1H A;  4XTY A;  3DSQ A;  1E22 A;  4C92 E;  4YRC A;  5C53 B;  2RHS A;  4J6Y A;  1X2H A;  4P74 A;  1WQ7 A;  3PGG A;  4H2W A;  1KQ2 A;  3FIF A;  2QHS A;  4M7A B;  4YRG A;  3HXV A;  4C8Q F;  4M77 E;  4CS4 A;  4H2S A;  5LJ5 e;  3RES A;  4YCW A;  3M4Q A;  1ATI A;  1ASZ A;  4F7U E;  4DPG A;  2DQ3 A;  4YRN A;  4C92 D;  1USY A;  3BDU A;  5ELN A;  1FYF A;  3TEH B;  2ALY B;  4WI1 A;  3MF1 A;  4Q15 A;  1HTT A;  4XU2 A;  5GAO m;  4XEO A;  3QTC A;  2EJ9 A;  2FYK A;  1M5Q 1;  2ZGW A;  4L87 A;  4XU0 A;  2QTX A;  4M77 D;  1JJC B;  5GAM e;  4M7D B;  1KMN A;  3UGT A;  1X01 A;  3RUX A;  4YRL A;  4M78 A;  3A74 A;  4XU3 A;  2E5A A;  4J6X A;  5LJ5 h;  5K1X A;  2E65 A;  2ZT8 A;  1EFW A;  3QSU A;  4UPA A;  1PYS B;  4YDQ A;  4PJO G;  5GAN f;  2ZIO A;  2E64 A;  4CH5 A;  2DJZ A;  3LC0 A;  4C8Q D;  3JB9 G;  5GAN 4;  1EVK A;  3P8T A;  4X5O A;  3E9I A;  3HRK A;  3V7C A;  3ERR A;  2PMF A;  4J5Y A;  3M4P A;  4M7A A;  4M75 G;  2ODR D;  5GAM h;  3A5Y A;  1NJ2 A;  3RKY A;  4N0A A;  2ZNI A;  3GIB A;  1B76 A;  4TVY A;  1E24 A;  4YRE A;  4HWP A;  3VQV A;  3CMQ A;  4H2X B;  3MF2 A;  1NJ1 A;  4H2V A;  2Q7E A;  4CH6 A;  3HFO A;  3TEH A;  2I4L A;  2ALY A;  3FJP A;  1IL2 A;  1G51 A;  4NL2 A;  5LJ3 d;  3SWN A;  2J3M A;  2Q5H A;  1ADJ A;  2RHS B;  3L1A A;  1JJC A;  1YFS A;  4JLI A;  4M7D A;  2ARS A;  4TTV A;  3LSQ A;  2EWN A;  2CIM A;  3JCM J;  1EQR A;  3A7R A;  1SER A;  1JRI A;  4P3O A;  1NJ6 A;  4C92 G;  1EIY B;  2DXU A;  4YRS A;  4M75 B;  1G5I A;  2EJG A;  5GAO r;  2DVE A;  1PYS A;  1X54 A;  1HK9 A;  2ZR2 A;  3A5Z A;  4M77 G;  4WF2 A;  3HXX A;  1WLE A;  4EX5 A;  4P73 A;  4M7A C;  4NOY A;  3JB9 I;  1N9R A;  2DQ0 A;  5LJ5 j;  4N0A C;  4RCC A;  3A7A A;  3HY0 A;  4XEM A;  5F5W A;  2ZNJ A;  3VBB A;  4P3P A;  4P75 C;  4RQE A;  2DKG A;  1H4V B;  1J5W A;  3JCM d;  4YRQ A;  1B7Y B;  1H4T A;  3VQX A;  3REU A;  4X9D A;  4XTX A;  3HXW A;  4H2Y A;  4C8Q G;  1MGQ A;  4ZTU B;  4JRK A;  4NL3 A;  5GAN j;  4KR3 A;  3SB2 A;  4EMK B;  4C92 B;  4XTW A;  3KFU A;  1I5L A;  4E51 A;  4YRK A;  4XTU A;  1I81 A;  4PJO A;  2ZT7 A;  4HWR A;  4M77 B;  4JUV A;  4M7A F;  3AHU A;  3MEY A;  4QVC A;  2ZR3 A;  5GMK l;  1Y96 B;  1EIY A;  12AS A;  2QHV A;  4F7U B;  3HY1 A;  4M75 A;  2VXE A;  2XGT A;  4P72 C;  2HNI A;  5LJ3 e;  2VC8 A;  4HA8 A;  1KMM A;  3JB9 J;  2DTH A;  2DXT A;  5GMK e;  3HRI A;  4YRI A;  5K1P A;  3BY7 A;  1HXD A;  3SWN B;  4RMF A;  3IKL A;  2ZZE A;  1LYL A;  4OLF A;  4C8Q E;  2ZIN A;  5LJ5 f;  4M7D F;  3HXY A;  5GMK i;  1ADY A;  1X55 A;  3FB9 A;  4CS2 A;  1H4Q A;  1B7Y A;  3V7R A;  4X9C A;  4KR2 A;  2IY5 B;  4P71 C;  4XTV A;  2YLB A;  3RF1 A;  2E41 A;  5GAM f;  5LJ3 h;  4EMK A;  3TEG A;  4P74 C;  4C92 A;  4RQF A;  4JRI A;  4M7A D;  2CJA A;  1LJO A;  5GMK h;  1B8A A;  1EVL A;  2DZC A;  4M77 A;  5GAN 5;  3JCM e;  3QO5 A;  4YCU A;  4O2D A;  4XTZ A;  2Q7H A;  4KQE A;  4TQF A;  3V7S A;  2C8M A;  1BIB A;  1Y96 A;  4H2U A;  2YLC A;  5LJ5 g;  1USY C;  1YFT A;  4F7U A;  1NYR A;  3QUI A;  4YYE A;  2K57 A;  1BIA A;  3QNE A;  5C52 B;  2J3L A;  4WJ4 A;  4M7D D;  2I2L A;  1H64 1;  3OD1 A;  2G4C A;  4WJ3 M;  1YFR A;  4CH4 A;  5GAN g;  4V2S A;  4PJO B;  5GAM g;  2DTO A;  3JCM Q;  4M78 C;  1N9W A;  2RHQ B;  3JCM h;  3VQW A;  1KQ1 A;  3BJU A;  2EAY A;  1NJ5 A;  3RIR A;  1LNX A;  4ZTZ B;  2Q7G A;  2CJ9 A;  3RKX A;  3IG2 A;  2IY5 A;  3NEN A;  2ZTG A;  3HTZ A;  3P8Y A;  1EOV A;  4TVA B;  3IAL A;  1B70 B;  4K87 A;  2DU5 A;  1SET A;  4QVD A;  1NYQ A;  4MMK A;  2DU7 A;  1WNL A;  4H02 A;  2ZIM A;  5GAN d;  2P5I A;  1WU7 A;  4YRP A;  4PG3 A;  3VQY A;  3A31 A;  3NET A;  2I4N A;  1X2G A;  3HFZ B;  2DDZ A;  2RB6 A;  2CJB A;  4TQD A;  4M78 F;  1L0W A;  4HWS A;  2ZT5 A;  3QHS A;  4M7A G;  1G5H A;  3SWN C;  3JCM P;  1X56 A;  1WYD A;  5GAM j;  1U1T A;  5GAN 6;  4M7D C;  4K88 A;  2C7I A;  1RIQ A;  4CH3 A;  3EFS A;  1N9S A;  4C92 F;  3V8J A;  1M8V A;  2ARU A;  4HT9 A;  4NCX A;  5GAO q;  3JCM X;  4HWO A;  4YRO A;  4M77 F;  1GGM A;  2RHQ A;  1VQZ A;  2FB7 A;  3NEL A;  4G85 A;  4BW9 A;  5KNN A;  4M78 E;  4H2T A;  4K86 A;  4AH6 A;  4M7D G;  2XTI A;  1WPY A;  3HFN A;  4F7U F;  3REX A;  4TVA A;  3LSS A;  4P73 C;  2RM4 A;  1B70 A;  2QHT A;  2QHU A;  4CS3 A;  2ART A;  5C51 B;  4C8Q B;  3RL6 A;  4TVW A;  3I7F A;  3RGL A;  4M78 D;  4M7A E;  2DZ9 A; 
#chains in the Genus database with same CATH topology
 1X6O A;  3O8V A;  3BDL A;  2RJF A;  1NJ8 A;  3HFZ A;  2XK0 A;  5LJ3 f;  1ZX6 A;  1BBW A;  1NM7 A;  1OUL A;  4YRR A;  4AG1 C;  2JUF A;  2X4X A;  2JXB A;  1NJI R;  2CSQ A;  4O6J A;  4BI3 A;  3THK A;  3CC7 Q;  3CCJ Q;  2L8D A;  3J80 E;  3C0C A;  1AHJ B;  1I4K 1;  2YRD A;  2OJ2 A;  2X3W D;  1YNZ A;  2YHT A;  4BWA A;  4YRJ A;  3M5A A;  4IIM A;  4D6W A;  3I55 A;  2LP5 A;  1NEB A;  4GY5 A;  1SES A;  5IHI A;  3VS7 A;  4YTL A;  1PSE A;  2CGH A;  1K8A C;  3L4G B;  3L2Z A;  2IVW A;  4Q6G A;  4ELY C;  2GBQ A;  2FZK B;  3LWH A;  2E3C A;  4QQ6 A;  2CZ7 B;  1WHM A;  3QO7 A;  2ZPI B;  1P92 A;  4EO4 A;  2XHC A;  3OYE A;  1MV0 B;  4GLK A;  3VU3 C;  2QA4 Q;  3OYJ A;  5J3B A;  1Y57 A;  2EL9 A;  3M0U A;  1JEG A;  3RBB B;  2QK0 A;  2F5T X;  1Z9Q A;  2X4Y A;  3OMC A;  4JZ4 A;  2DEU A;  3JB9 F;  2ZCE A;  4E47 A;  1W6X A;  4L59 A;  3V8L A;  1VQ7 Q;  1ACM B;  1BU1 A;  1PNJ A;  3GOX A;  3OBW A;  3VS2 A;  2I4O A;  4EMK C;  1VQ4 Q;  4OP0 A;  4J83 A;  4DQ2 A;  2COY A;  2XD0 A;  5GAN 2;  3OYC A;  2AKW A;  5HGQ A;  2XDD A;  4C0Z A;  1VQO A;  1KC8 R;  4E7I A;  4YP0 A;  4J9G A;  4EMH A;  4C5I A;  4Y91 A;  2MPX C;  2LQN A;  1JU5 C;  1VQN T;  2EGE A;  4JJC A;  3JCM V;  2A36 A;  3JCM W;  5I11 A;  3QPH A;  2DF6 A;  4ZIB A;  3QO8 A;  3CCU Q;  3M59 A;  1D1C A;  4C8Q C;  4PJO D;  4X34 A;  1BCO A;  2AMC A;  1PCX A;  1GRI A;  2C0O A;  1TH7 A;  3H0F A;  4KT0 E;  1BB9 A;  4FYY B;  1VA7 A;  4M75 D;  2VXF A;  5CCA A;  4RDX A;  1YI2 A;  1Z7M A;  5KYX B;  2DNU A;  2R57 A;  4FT2 A;  4MML A;  3DB4 A;  1TTH B;  2L2P A;  4AMC A;  4VUB A;  2RJD A;  1E22 A;  4C92 E;  4PFO A;  1TUC A;  8AT1 B;  1AWJ A;  1X2H A;  4P74 A;  4H2W A;  1LVK A;  1KG1 A;  1CKB A;  3HXV A;  1ZUK A;  1QKW A;  1NYF A;  3I56 T;  3QBY A;  2K3Y A;  2FEI A;  3DLL A;  4DEX A;  1WHH A;  2DMO A;  3QJY A;  1ATI A;  4F7U E;  3CCS T;  2DQ3 A;  4YRN A;  1WJR A;  2F2V A;  3BDU A;  5DLQ E;  1KQS S;  5D7U A;  1PWT A;  1HTT A;  5GAO m;  5CQX A;  2V8J A;  3QTC A;  2EJ9 A;  2ZGW A;  3GBQ A;  4XU0 A;  2QTX A;  4MDW A;  1VQL Q;  3WXM B;  1ZSZ C;  3PFS A;  3LGL A;  2NLU A;  1IRE B;  3JSC A;  1O9S A;  4J6X A;  4JRP A;  5K1X A;  1VIE A;  1EFW A;  2LCC A;  2LJ0 A;  2E5K A;  2K2M A;  5KYW A;  5CKB A;  1WJQ A;  1M3B A;  4J9I A;  3U23 A;  5GAN 4;  3P8T A;  4X5O A;  4HKE A;  2RNA A;  3E9I A;  1PD0 A;  1IHW A;  1K0X A;  1NBE B;  1E6G A;  2MK5 A;  4BE2 A;  1N8R U;  3CC4 Q;  1VQ5 Q;  2P0P A;  4OB2 B;  5A2Q E;  3GIB A;  1B76 A;  1SPK A;  4TVY A;  3CQT A;  3OYH A;  4YRE A;  2LX9 A;  3GNF B;  1E6H A;  2LJ1 A;  1EIF A;  3CMQ A;  3MF2 A;  2Q7E A;  5FU6 C;  4N4I A;  1SKU B;  4CH6 A;  3TEH A;  2I4L A;  4F14 A;  2YUP A;  5LJ3 d;  2RH2 A;  3SWN A;  3L42 A;  2M16 A;  2JMA A;  2RQU A;  3PT9 A;  2EWN A;  2L89 A;  1WZO A;  3L2R A;  3GF5 A;  1EIY B;  2IIM A;  2RMO A;  3OS0 A;  1RAB B;  4A4H A;  1X54 A;  3E9F A;  2ZR2 A;  4KGZ B;  1U8R A;  1QW1 A;  1Q86 U;  2J06 A;  3TSZ A;  2KXC A;  4NOY A;  4PJJ A;  3CCV A;  3JB9 I;  2C06 A;  1N9R A;  1S72 A;  1UGS B;  1OI1 A;  2DQ0 A;  1QWF A;  4AT1 B;  4ZN3 A;  4XEM A;  1UFF A;  2KQW A;  1T3S A;  1J5W A;  3LH0 A;  2ZAE A;  3GPL A;  1YIJ T;  3A8G B;  3MET A;  1YJW T;  3VQX A;  1NPP A;  4BDZ A;  2HDA A;  3REU A;  4X9D A;  3CCL Q;  4XTX A;  3HXW A;  4C8Q G;  1MGQ A;  2NWM A;  3QZ9 B;  4ZTU B;  3TEE A;  4JRK A;  4NL3 A;  3QXE B;  5GAN j;  2V1Q A;  2M02 A;  5IXB A;  1QP2 A;  2DL7 A;  4RTT A;  2DRM A;  4C92 B;  3OW2 S;  2NUP B;  2JM9 A;  3FC3 A;  4YRK A;  1SRL A;  4XTU A;  3VS6 A;  4PJO A;  3G6E T;  5IHK A;  3VS5 A;  4RTV A;  2O31 A;  2LZ6 B;  4M7A F;  1ZUU A;  2FPD A;  1Q82 R;  1AWW A;  3TCJ A;  1WHL A;  1Y96 B;  4RTY A;  1PG5 B;  3EFO B;  4F7U B;  4HCC A;  4M75 A;  1KIK A;  4ZGD B;  1ABO A;  3H6Z A;  1QCN A;  3CCJ T;  1OPK A;  2EVR A;  2HBW A;  4Z88 A;  5K1P A;  4RMF A;  1YHQ Q;  4OML A;  4KUD K;  4MZT A;  4PJM A;  3QKJ A;  2ZIN A;  3G1J A;  1GFD A;  4KRT A;  4CS2 A;  2K4Y A;  5IHN A;  2CS7 A;  3LX7 A;  4KR2 A;  1H8K A;  2DIL A;  2NS6 A;  5GAM f;  2V8I A;  4RQF A;  4JRI A;  1YBY A;  1RAD B;  3E2U A;  1D0X A;  2KDS A;  1M2V A;  1W2B A;  5KYU A;  3CCQ T;  4LD6 A;  1WFW A;  3MKD A;  2L3Q A;  3JCM e;  1OZ2 A;  2KVQ G;  2Q7H A;  3PTA A;  4KQE A;  2A3L A;  5CO7 A;  1VQ7 T;  2C8M A;  4H2U A;  3NMZ C;  5LJ5 g;  2KAF A;  1VOM A;  2K57 A;  2DD4 A;  4EIK A;  4M7D D;  2DIQ A;  2EW3 A;  3QZ5 B;  3M9Q A;  4EPC A;  4CH4 A;  2FVU A;  4M78 C;  5J39 A;  3JCM h;  3CEY A;  2EAY A;  1PSF A;  4IUT A;  2FZG B;  4AFS C;  3ZL7 C;  1YN8 A;  3CCU T;  2ZTG A;  3P8Y A;  2RHX A;  4R0K A;  3IAL A;  3PIP A;  1D1B A;  3CXC S;  2DU5 A;  3G7Z A;  1NYQ A;  4PLI A;  3LW5 E;  3I35 A;  3ME9 A;  4HVV A;  4MMK A;  4H02 A;  1WU7 A;  3CCR T;  1Q81 U;  1Q81 C;  3VQY A;  3NET A;  3NTK A;  3HFZ B;  2RB6 A;  2GQV A;  2CYZ B;  2F2W A;  1XJW B;  3NGP A;  3CPW A;  1K1Z A;  1VQN Q;  4HWS A;  4LVJ A;  4OB0 B;  3QHS A;  1XOV A;  4AG2 C;  3G4S Q;  3JCM P;  5GAN 6;  1OX8 A;  4M7D C;  4Z02 A;  1M27 C;  1QP3 A;  3VYG A;  4F17 A;  1IO6 A;  1U5S A;  4QVZ A;  1YIJ A;  1YJW A;  2ARU A;  2CZ1 B;  5GAO q;  3HTR A;  3QWY A;  3CMA T;  2CZ6 B;  2RHQ A;  3ZEH A;  4OMO A;  3S3O A;  1IZ6 A;  3AT1 B;  3VRZ A;  1VYV A;  5HY6 A;  2AK5 A;  3RR6 A;  1RLQ C;  1G2B A;  2YSQ A;  4OB3 B;  3LSS A;  3QII A;  3G6E A;  2RM4 A;  4A4E A;  1AOJ A;  2QHT A;  4BB7 A;  5C0M A;  3OB9 A;  3C4S A;  2FPF A;  2HBP A;  5C51 B;  3LH5 A;  3RNJ A;  4TVW A;  2DRK A;  1QVG P;  3RGL A;  2DZ9 A;  2V1R A;  3CC7 A;  2OTL A;  3BW1 A;  3CCJ A;  2D0Q B;  1XQH A;  1CKA A;  2B86 A;  3HKS A;  4B9W A;  4J8O A;  2A37 A;  3OYM A;  1MV3 A;  1VQ6 Q;  2A0F B;  3CCS Q;  2BE7 D;  4PNO A;  2EKO A;  1GL5 A;  3MP8 A;  2AKW B;  2ZZG A;  5GAN e;  5HKC A;  1M2O A;  3A32 A;  5A0D A;  2GCX A;  1NYG A;  1VQ5 T;  4RUG A;  3PVQ A;  4C5H A;  2EQK A;  2M9U A;  2MI6 A;  11AS A;  4OB1 B;  2SEM A;  3UGQ A;  3OSV A;  1D09 B;  3WQZ A;  1UGR B;  2QA4 A;  1Z7N A;  2ZZF A;  5E3I A;  4L5G A;  1UGV A;  2DBM A;  1WHG A;  2JT4 A;  1JQQ A;  3RAC A;  3BFM A;  2QQA A;  1M90 R;  4B6M A;  5GAN h;  1VQ7 A;  2AMC B;  3A7U A;  5GMK m;  5GAO p;  2M1H A;  2QTV A;  2ZXF A;  4PJO F;  2I4M A;  5IAY A;  2GTO A;  2YUN A;  1VQ4 A;  5KYY A;  1K4U S;  4P75 A;  3JCM c;  2YT6 A;  1FMK A;  3EH1 A;  2JOY A;  3RKW A;  1YB3 A;  2BKD N;  3ZBD A;  1QF6 A;  4M75 F;  4LXC A;  1BBU A;  4LUD A;  2XG8 D;  3UH0 A;  1H3H A;  2OAW A;  4HT8 A;  4M78 G;  5IH2 A;  3EHQ A;  4M77 C;  4KGV B;  2PQW A;  4MZP A;  4PJO E;  4EDU A;  4OMN A;  1OU9 A;  5GAN 3;  5GAM d;  3CCU A;  1E1T A;  2KYB A;  2ECZ A;  1UEC A;  5LJ3 j;  3CCL T;  2O9V A;  1YGB A;  1B34 A;  2RA2 A;  5GMK j;  1AWO A;  1SG5 A;  4ZTJ A;  4M75 E;  4ELZ C;  1WQW A;  2RD1 A;  4RG2 A;  4DOV A;  3PZC A;  1X2Q A;  2JS0 A;  4JRQ A;  4EMG A;  2E6N A;  6AT1 B;  3OS1 A;  4F7U G;  2H3E B;  2EJF A;  1WA7 A;  4X1V A;  5CAI A;  2ODR C;  2DA9 A;  4YCV A;  3W3S A;  3OYA A;  2LQW A;  3OYK A;  3ICA A;  3UAT A;  3P8H A;  5KE3 A;  4H2X A;  2COW A;  1UDL A;  2EGC A;  2RQW A;  5KYW B;  3KXT A;  4P71 A;  2D9T A;  2RHY A;  4QQG A;  1YHQ T;  3ZFJ A;  1WQ7 A;  2B8A A;  1KQ2 A;  2PUO B;  1ZHI A;  2QHS A;  4YRG A;  1IHV A;  1SF9 A;  2P4R A;  2F2X A;  3MO8 A;  1NLP C;  3QWX X;  3M4Q A;  3M55 A;  2VAS A;  4DPG A;  4JJD A;  1USY A;  5ELN A;  3TEH B;  1K9M U;  1RAI B;  1VQL A;  4WI1 A;  4FM4 B;  1K9M C;  4FYV B;  1ZA1 B;  4XEO A;  4LN2 A;  2FYK A;  3UPU A;  4L87 A;  1AVZ C;  2RQT A;  5KCO A;  4R56 A;  1KD1 R;  1TU0 B;  2VGM A;  1X01 A;  2GNC A;  2EGA A;  5CR2 A;  2YRV A;  4HVW A;  1PRL C;  5CKE A;  4XU3 A;  1B3Q A;  2E65 A;  4YDQ A;  1NE8 A;  1W1F A;  1MUZ A;  3QG1 A;  2ZPE B;  1Y07 A;  4C8Q D;  2I0N A;  2ABL A;  3MP6 A;  3CC4 A;  1I07 A;  1EVK A;  1Y71 A;  3V7C A;  2CH4 W;  2KBT A;  3EGD B;  1H3Z A;  3RDV A;  4M7A A;  5L8R E;  1NJ2 A;  3CCQ Q;  4N0A A;  4LUE A;  1YCS B;  5J26 A;  2EQU A;  4DEY A;  5L23 A;  2ZPB B;  1GCQ A;  2CKK A;  2HSE B;  1X69 A;  4P5N A;  3EG3 A;  2ALY A;  4KUI A;  1FXX A;  1SSH A;  1G51 A;  4F04 B;  1BI0 A;  4IUU A;  1XTD A;  2J3M A;  1UUE A;  1JXO A;  1C0M A;  3UA7 A;  1ADJ A;  2RPN A;  2RHS B;  1KHI A;  4JLI A;  2GFU A;  2ARS A;  4TTV A;  1VQ9 Q;  2LCS A;  3WVD B;  2HD0 A;  4BE0 A;  3TSW A;  2XID A;  2A28 A;  4MZM A;  4JZ3 A;  2KSS A;  2KI7 A;  4YRS A;  4M75 B;  1MMN A;  1Y0M A;  2DVE A;  3G4S T;  3M54 A;  4BUG A;  3GLX A;  4M77 G;  2PVD B;  4WF2 A;  1C6V X;  1VQK Q;  3DKM A;  4P73 A;  2RK1 A;  1K73 U;  4TVR A;  1VQP T;  3LLR A;  1K73 C;  4FYW B;  2MIO A;  5LJ5 j;  2RHU A;  3CCL A;  4RCC A;  5F5W A;  3SFM A;  3VBB A;  3OYF A;  1ABQ A;  3CCR Q;  4RQE A;  2DKG A;  4C5E A;  1C1A A;  4YRQ A;  1M3C A;  5D6X A;  2JM8 A;  1MND A;  3GP8 A;  2KXD A;  4PJL A;  5I2M A;  1RAE B;  1KJW A;  2DL4 A;  4KR3 A;  3M4Y A;  4II1 A;  3KFU A;  4E51 A;  1MMD A;  1I81 A;  1JJ2 S;  1M2V B;  2ZT7 A;  5CK9 A;  5KYU B;  2HL5 C;  4C5G A;  3MEY A;  5LL6 S;  3CMA Q;  2D0N A;  2RHZ A;  3CME T;  3OW2 A;  3PE0 A;  3HY1 A;  5CIU A;  2E3H A;  3OYG A;  1OX9 A;  1VQ6 T;  2XGT A;  4P72 C;  5LJ3 e;  2VC8 A;  1AZE A;  2EYZ A;  2GTJ A;  2D6F A;  4FSS A;  4A4F A;  5GMK e;  1D0Z A;  4YRI A;  2L3S A;  1ZBJ A;  1G5V A;  3VUZ A;  5EC7 A;  1BI1 A;  2ZZE A;  4DOW A;  1GBQ A;  5LJ5 f;  4M7D F;  3HXY A;  1M90 U;  5GMK i;  4OMM A;  3BE3 A;  1ADY A;  1YP5 A;  4ZNX A;  4GLM A;  1X55 A;  3FB9 A;  2OI3 A;  1B7Y A;  1W4S A;  3H0H A;  3R6N A;  1HJD A;  2J6K A;  1K0S A;  2LDM A;  2M51 A;  1SRM A;  3RF1 A;  1Y7X A;  5LJ3 h;  4EMK A;  2CJA A;  2LT4 A;  5GMK h;  1E7O A;  5A0L A;  3X20 B;  1RAH B;  3HHT B;  4ESR A;  1Q7Y R;  2H8H A;  3QO5 A;  3EG9 A;  4DBR A;  3CCM Q;  2KT8 A;  1N8R C;  1T0J A;  2IG0 A;  3OW2 P;  2A8E A;  3CBM A;  1NYR A;  4YYE A;  2L3R A;  3FDR A;  2PVO B;  4A4K A;  4CC2 A;  4WJ4 A;  1OPL A;  4BY6 B;  1RL2 A;  3SD4 A;  2L5Q A;  3MCA B;  3X25 B;  1OZ3 A;  3HRT A;  2J05 A;  3PVL A;  5HK0 A;  4V2S A;  3HRS A;  2DTO A;  3A98 A;  2KGT A;  1T3L A;  4LDW A;  2XMF A;  3SEM A;  5C6S A;  2RHQ B;  2JJ9 A;  4FW1 A;  1WHK A;  4AFQ C;  1LNX A;  3RKX A;  3ULR B;  3NEN A;  3LGF A;  3GNG A;  4LVK A;  2CDT A;  1SET A;  2WSF E;  4QVD A;  2KEA A;  2D8H A;  1Q86 C;  2MF2 A;  3VS0 A;  1VQN A;  2EBP A;  2ZIM A;  4RMO A;  4PG3 A;  2O4X A;  3A31 A;  2RI5 A;  3G4S A;  2I4N A;  2Y4Y A;  2JNG A;  3L2U A;  3CXC A;  1BYM A;  4TQD A;  3CD6 T;  1ARK A;  3IQL A;  2GF7 A;  2KT1 A;  1X56 A;  5GAM j;  1NJI U;  3ASK A;  3URG A;  1NJI C;  2C7I A;  1RIQ A;  3EFS A;  1VQ8 T;  1RAA B;  2E70 A;  2KNB B;  3V8J A;  4J7F A;  2MCN A;  4HT9 A;  3JCM X;  1KD1 U;  2NUT A;  2DL3 A;  4ATO A;  4LDY A;  4A4G A;  4M77 F;  1MNE A;  1YIT T;  2FB7 A;  1ZSZ A;  2FL7 A;  2E3I A;  1M1K R;  3HFN A;  2MAM A;  2NUZ A;  2QQB A;  2K9G A;  4CS3 A;  4M4Z A;  3VRY A;  3C95 A;  3I56 A;  3NTI A;  1PKT A;  3I7F A;  1ZSG A;  4M78 D;  4M7A E;  1TUD A;  5D6Y A;  3CCS A;  3P8B B;  2CT3 A;  4ME7 A;  5KYY B;  3CXC P;  2CH4 A;  3JCM b;  4FL6 A;  3QDF A;  5GAO n;  3EAE A;  1OU8 A;  1M1F A;  4FSX A;  1G3T A;  4BY6 C;  3HXU A;  3UFG A;  3V8K A;  4LNS A;  2QEX T;  1U3O A;  4YRT A;  4XQ3 A;  1SRY A;  2K3B A;  2MYS A;  3MJX A;  1XNI A;  3A8L B;  1QE0 A;  3E19 A;  1X75 C;  1KC8 U;  2HQE A;  3UA6 A;  5CKH A;  1KC8 C;  2QDY B;  3F70 A;  1AD5 A;  2DD5 A;  4YRM A;  3QO3 A;  5CKD A;  2QI2 A;  5DM7 R;  1WHJ A;  2CUB A;  2JN0 A;  3C12 A;  1GXI E;  2LQ8 A;  3OYL A;  5KYX A;  1B34 B;  3HL8 A;  1YJN T;  2A7Y A;  2FRY A;  3MEU A;  3MHX A;  3E9G A;  4L6V 5;  1QKX A;  2M0O A;  2DJQ A;  4D8K A;  3X24 B;  3P8V A;  3OYB A;  2KK4 A;  1OQK A;  1VQ9 T;  5IXF A;  5FU7 B;  2AHJ B;  2J7I A;  3FJ5 A;  1UB4 A;  1UEB A;  4J15 A;  5HCK A;  1D1A A;  1QVF S;  3KFV A;  3RMS A;  4LVL A;  4HCK A;  4LDX A;  2BUD A;  5LJ5 d;  3VUB A;  8ATC B;  5FWC A;  4C92 C;  3OS5 A;  3E9H A;  1SHF A;  4YRF A;  4YPF A;  1VQK T;  2P0Q A;  3EFR A;  4LDU A;  4ZGE B;  3OA6 A;  3INZ A;  3A8M B;  4NS5 A;  4PHC A;  4P3N A;  1HC7 A;  1OEB A;  4IUV A;  1H4S A;  1W2B P;  4G84 A;  2JTM A;  1PD1 A;  1K8A R;  4JS5 A;  3JCM g;  2DER A;  3OBY A;  5FWB A;  4J7I A;  4HWT A;  3TUP A;  1D3B A;  4QQD A;  1ASY A;  4HVC A;  4A53 A;  4XU1 A;  2EKH A;  1PM3 A;  4PJN A;  1V1C A;  2DM1 A;  3PCO A;  2ZPG B;  1FMW A;  4Z8A A;  3JB9 H;  1G8X A;  4E7S A;  3G1Z A;  2DFU A;  3R07 A;  2CT4 A;  3HXZ A;  3HSB A;  3M4G A;  1HD3 A;  1LOJ A;  1V29 B;  4XAX B;  2RJE A;  5GAN 8;  3G71 Q;  1I8F A;  1QCO A;  1VQP Q;  3IKM B;  2GFA A;  1IB8 A;  1C0A A;  4IUQ A;  4TWA A;  5KCH A;  2PME A;  3NEM A;  1U1S A;  4K11 A;  2CP3 A;  1VUB A;  2O01 E;  5ELO A;  1E1O A;  3TVT A;  4UP7 A;  3DSQ A;  4OVA A;  3CC2 Q;  1I0C A;  5C53 B;  2C0T A;  3JV3 A;  2LQK A;  3PGG A;  1X6G A;  3FIF A;  4QW2 A;  4M7A B;  3CBO A;  4C8Q F;  4OGE A;  2FG0 A;  4BDY A;  1A0N B;  3MP1 A;  4F16 A;  3UT1 A;  1SHG A;  1N6A A;  2X35 A;  3OQ5 A;  3RES A;  4YCW A;  1S1N A;  2JTE A;  2VKN A;  3CPW P;  2ZPF B;  4LVI A;  3KBG A;  3CME Q;  1ASZ A;  4IIO A;  1WGS A;  2E4H A;  2ALY B;  3MF1 A;  4XU2 A;  3HPW A;  3WVE B;  3J7A F;  4M77 D;  2YRC A;  2HKN A;  5GAM e;  1KMN A;  3UGT A;  3D7S B;  1R0B G;  4PFZ A;  3CCM T;  2VGN A;  4M78 A;  4OF1 A;  3A74 A;  2BIV A;  2DLP A;  4ZGJ B;  2ZT8 A;  3HRU A;  4JS4 A;  2F69 A;  3QSU A;  2JVV A;  2ZIO A;  2DJZ A;  2CSI A;  3JB9 G;  1CSK A;  3CCQ A;  2ED1 A;  2VUB A;  2ZCF B;  3H9N A;  3KUF A;  1IGU A;  1UG1 A;  3MEW A;  3VYH B;  2ZZD A;  3M4P A;  3OMG A;  4FIB A;  2ODR D;  1FYN A;  5GAM h;  3A5Y A;  3RKY A;  2EQI A;  2ZNI A;  1HSQ A;  3PNW C;  3A1P A;  3LWI A;  4HWP A;  4B9X A;  2DET A;  1NJ1 A;  4H2V A;  4C0D B;  3RMQ A;  2VVK A;  3FJP A;  1IL2 A;  3OYD A;  1UE9 A;  4NL2 A;  2QG9 B;  1X27 A;  2JMC A;  2DO3 A;  2JTF A;  1IRX A;  3L1A A;  1JJC A;  1RI9 A;  4M7D A;  2J6O A;  3LSQ A;  2A08 A;  2COZ A;  3P8D A;  1UTI A;  3L2W A;  2CIM A;  1PRM C;  2DXB A;  1UHF A;  2LJ3 A;  1EQR A;  1VIF A;  3PIO A;  4P3O A;  1NJ6 A;  4C92 G;  1VQK A;  4BD3 A;  1QVG S;  1Q82 U;  1FMV A;  3FLG A;  5AT1 B;  1M1K U;  2EJG A;  1Q82 C;  2ESW A;  3J81 E;  4E7K A;  1PYS A;  2G6F X;  2LNV A;  5HK3 A;  3A5Z A;  3HXX A;  1MHN A;  1WLE A;  3CCR A;  2VB6 A;  4M7A C;  3MEV A;  4N0A C;  2VWF A;  3A7A A;  2R5M A;  1VYU A;  3CCE Q;  3HY0 A;  4P3P A;  1G83 A;  4E6R A;  1SSF A;  1H4V B;  1GCQ C;  1JO8 A;  1VQM Q;  3PMT A;  1B7Y B;  1H4T A;  3I5R A;  1YWO A;  3NFC A;  1WYX A;  1LPL A;  2W10 A;  1YJ9 Q;  2H3J A;  3CD6 Q;  2HQH A;  2RO0 A;  1WXT A;  1WJS A;  4AFU C;  1YI2 T;  2CP5 A;  3SB2 A;  4EMK B;  3M0Q A;  3SDZ A;  3CMA A;  1I5L A;  1G3W A;  1VQ8 Q;  1WXU A;  5ECA A;  1UGQ B;  3EG9 B;  4QVC A;  3M0T A;  2ZR3 A;  2DAQ A;  5GMK l;  1IGQ A;  4IUP A;  1YIT Q;  12AS A;  2K79 A;  2RN8 A;  1O75 A;  2HNI A;  1HYO A;  4HA8 A;  1JJ2 A;  1KMM A;  1X43 A;  1RI0 A;  2GGR A;  2DTH A;  1M3A A;  2EYX A;  3HRI A;  2YXY A;  1HXD A;  3SWN B;  1YFN A;  3IKL A;  1QWE A;  2K5L A;  1M1G A;  1KQS A;  4C0D C;  1H4Q A;  3V7R A;  2RK2 A;  2OTJ Q;  2DYB A;  3REA B;  2QAZ A;  2X4W A;  3DB3 A;  2VV5 A;  2OTL Q;  2MWP A;  3OYY A;  4J9E A;  4Z89 A;  2QEX Q;  3TEG A;  4WCI A;  5FRO A;  4P74 C;  4CI0 C;  3CCM A;  1LJO A;  1VQ5 A;  1B8A A;  2HKQ B;  2YUO A;  4QKU A;  1EVL A;  2LNH B;  1X6B A;  4M77 A;  3JRZ A;  2MOX A;  4BAC A;  1U06 A;  4O2D A;  2O4X B;  2AZV A;  3QYH B;  4XTZ A;  3EGU A;  5AYF A;  1K8A U;  3V7S A;  4CC3 A;  5FRM A;  4OMF B;  3L2Q A;  1FX7 A;  2HQX A;  1T0H A;  5C52 B;  1JJ2 P;  5CQY A;  1R0C B;  3E1S A;  1YJN Q;  2PNI A;  3OD1 A;  3EGX A;  3EG1 A;  4WJ3 M;  2K5F A;  4PJO B;  1QCF A;  2NUT B;  3X28 B;  2D8J A;  3VQW A;  1KQS P;  1ZSZ B;  1BI2 A;  1G3S A;  1KQ1 A;  3BJU A;  5I2S A;  2KMT A;  1NJ5 A;  3SHW A;  2Q7G A;  3IG2 A;  3VS4 A;  2HCK A;  2IY5 A;  3HTZ A;  1EOV A;  2CP0 A;  2DPP B;  4JPB W;  1M9S A;  1TOV A;  3A8O B;  3G71 T;  1TWB A;  4ANJ A;  1WNL A;  2EYW A;  4YRP A;  4FW2 A;  2LC4 A;  3CCV T;  2K2V A;  2P0K A;  3NPF A;  1S72 T;  1X2G A;  4PKC C;  4LNP A;  4HCB A;  3MPU B;  4PL6 A;  2CJB A;  4M78 F;  2LVM A;  1L0W A;  2ZPH B;  3TU4 K;  3OS2 A;  2OX7 A;  2G3R A;  4GBQ A;  1GCP A;  4E7Z A;  4M7A G;  3SWN C;  3MEA A;  1WYD A;  2FO0 A;  5EG2 A;  5FU6 B;  3CC2 T;  1U1T A;  2K7A A;  4LDV A;  5CKF A;  3M56 A;  1N9S A;  4C92 F;  4UC4 A;  4ZN1 A;  2ROT A;  2EFI A;  2AZS A;  1M4Z A;  4DA4 A;  4YRO A;  4FYX B;  1GGM A;  3NEL A;  4MDX A;  4G85 A;  1NLO C;  5KNN A;  4Y92 A;  4M78 E;  1RAF B;  4K86 A;  1R77 A;  4AH6 A;  3VJP A;  1B7T A;  4DBH A;  1YHQ A;  2XTI A;  1NZ9 A;  4F7U F;  2RI3 A;  3NHN A;  2LMJ A;  4TVA A;  1B70 A;  1OOT A;  4HCZ A;  2QHU A;  2L0A A;  2FHD A;  2BE9 B;  2ART A;  1Q81 R;  1KFZ A;  2PUK B;  1AT1 B;  1D0Y A;  3S3N A;  3CPF A;  1BK2 A;  3M0S A;  4PK4 A;  2AT1 B;  1M90 C;  1BKB A;  3MQZ A;  4CC7 A;  1PHT A;  7AT1 B;  2LCL A;  3M0R A;  4RCB A;  2KYM A;  3C94 A;  2DK3 A;  4UP9 A;  1N5Z A;  2Q5I A;  3QDR B;  2EYQ A;  4PJO C;  4J9H A;  2DVJ A;  4R55 A;  2BTT A;  4M7D E;  4JDS A;  4O5V A;  2W0Z A;  4FT4 A;  3HFV A;  4Y28 E;  1ZUY A;  4J6W A;  4KUL A;  1D3B B;  2FRW A;  4M75 C;  4D8D A;  2EYY A;  4KH1 B;  3PCO B;  1PKS A;  4E7J A;  3I55 Q;  2LT1 A;  4IUR A;  1R8O B;  2QYZ A;  2K3X A;  4A54 A;  5LJ3 g;  2P0L A;  1J3T A;  1LCK A;  3OY9 A;  3RER A;  2MWO A;  4A63 B;  3JCM f;  2E10 A;  4C8Q A;  2AIR B;  4UP8 A;  5I21 A;  4OMP A;  2Y90 A;  1NPR A;  3UF4 A;  4KGX B;  2X9H A;  4C0G A;  1N27 A;  4HXJ A;  1W66 A;  1QVF A;  5FLX E;  2HSP A;  3S6W A;  5GAO l;  3CCE T;  2DBK A;  3FEO A;  5DY9 A;  4ORZ A;  1VQM T;  1VQO Q;  4LE9 A;  2R58 A;  4E7H A;  4KBM B;  2HL3 A;  3L4G A;  4RTU A;  1YJ9 T;  2DTI A;  1G3Y A;  3G71 A;  1VQP A;  5D6W A;  1AEY A;  2D1X A;  2FPE A;  5GAN 7;  4P72 A;  5GJW B;  3EGD A;  3JB9 D;  2P4T A;  1VYT A;  2ZT6 A;  2NYS A;  2QAS A;  1KD1 C;  4M78 B;  3JAM E;  1JBM A;  3EH2 A;  3CC2 A;  1YCY A;  1NNH A;  2DEQ A;  2F1L A;  1KOG A;  2X51 A;  4RTW A;  1B07 A;  2E1H A;  3QJ6 A;  4XTY A;  2BZ8 A;  3OYN A;  1QVF P;  3CBP A;  4YRC A;  2RHS A;  1YI2 Q;  1M8M A;  4J6Y A;  3TRE A;  3X26 B;  1MMG A;  5GJV B;  3CME A;  3A8H B;  3H8Z A;  1TXQ A;  2GQI A;  4M77 E;  4CS4 A;  3FRN A;  4H2S A;  1VQ6 A;  2X3X D;  5KH6 A;  4RTZ A;  2ENM A;  3M57 A;  2OTJ T;  5LJ5 e;  2DIG A;  1RAG B;  3DLM A;  3NTH A;  1F1B B;  4WTO B;  3CC7 T;  2OTL T;  2CUD A;  3QYG B;  4C92 D;  2RQV A;  1FYF A;  4Q15 A;  1M5Q 1;  2RF0 A;  1JJC B;  4M7D B;  3PMI A;  2PVG B;  3RUX A;  3O5Z A;  4YRL A;  2E12 A;  1ZQ1 A;  1ZA2 B;  1SEM A;  3UWN A;  1RAC B;  2E5A A;  1QQJ A;  2C0I A;  5LJ5 h;  1GFC A;  4HVU A;  4UPA A;  1PYS B;  1WXB A;  2DXC A;  4PJO G;  5GAN f;  2E64 A;  4CH5 A;  3A5Z B;  3N5B B;  4ZTF A;  3LC0 A;  2DYI A;  1UJY A;  2O9S A;  2VYT A;  4LVM A;  2RQR A;  2ED0 A;  5IT9 E;  1TG0 A;  2JS2 A;  3HRK A;  4BI4 A;  2O2O A;  2DL8 A;  2QA4 T;  3ERR A;  3OSS C;  2X4J A;  2PMF A;  4J5Y A;  4KH0 B;  4M75 G;  2QQR A;  1Q95 G;  2YWW A;  2XIC A;  1E24 A;  1KK7 A;  2KRM A;  2R5A A;  2WSE E;  3VQV A;  1K9M R;  4H2X B;  1VQ4 T;  1ZBX A;  1AWX A;  4LD9 K;  3HFO A;  2CZ0 B;  2OAU A;  2Q5H A;  4OMQ A;  4PFP A;  1BI3 A;  1IXD A;  1YFS A;  3M53 A;  1NEG A;  2PTK A;  1KHC A;  3JCM J;  1I5O B;  2XDB A;  3A7R A;  1SER A;  1JRI A;  3H41 A;  2LRQ A;  4BE1 A;  2DXU A;  4RG8 A;  3L2V A;  5KE2 A;  1G5I A;  5GAO r;  4J9F A;  3EG0 A;  1RUW A;  1HK9 A;  2HMA A;  4FU6 A;  3CCE A;  3S3M A;  2WAC A;  2O88 A;  2K5I A;  3Q1J A;  4EX5 A;  1VQM A;  2CP6 A;  5DLO A;  2E6Z A;  1QLY A;  1Z9Z A;  4DBF A;  1QVG A;  2EQJ A;  1YJ9 A;  2ZNJ A;  1WIE A;  4CC4 B;  4OGC A;  3CD6 A;  2KE9 A;  4P75 C;  3CCV Q;  2RHI A;  3JCM d;  2DE0 X;  1AZG B;  2CP7 A;  1S72 Q;  5IN1 A;  2RI2 A;  1M30 A;  2HZY A;  4H2Y A;  2V26 A;  2K6D A;  5FRN A;  1VQ8 A;  4IKF A;  2CP2 A;  2QQ9 A;  4XTW A;  2V8K A;  2YDL A;  3VV0 A;  2LTO A;  3I9Q A;  1YIT A;  2IPO B;  4HWR A;  4M77 B;  3M58 A;  3REB B;  2QDL A;  2DX1 A;  4JUV A;  3AHU A;  1YWP A;  1QVP A;  5M9O A;  1Q7Y U;  4DBQ A;  1Q7Y C;  1EIY A;  3R6O A;  2QHV A;  1QMC A;  1GBR A;  2VXE A;  2KRO A;  3JB9 J;  1K73 R;  2DXT A;  4AFZ C;  2YUQ A;  3BY7 A;  2EQM A;  2PU9 B;  2XDP A;  5FU7 C;  2F5K A;  1JB0 E;  1DJ7 B;  3EGX B;  1VQL T;  2OTJ A;  1TSF A;  4PLL A;  1LYL A;  4C8Q E;  4OLF A;  2MMP A;  1V76 A;  4HT4 A;  3T9N A;  1I1J A;  3HP9 A;  3I56 Q;  2QEX A;  2DL5 A;  4BI8 B;  4JLG A;  1MMA A;  2E5Q A;  1W2B S;  4X9C A;  2IY5 B;  3I55 T;  1BBZ A;  4P71 C;  2EIF A;  4XTV A;  2HAX A;  2YLB A;  1OV3 A;  2ROL A;  1TS9 A;  2E41 A;  4C92 A;  1UGP B;  2KRN A;  2NUP A;  4M7A D;  2AKL A;  4RKU E;  4J9C A;  2DZC A;  5KYN A;  2LX7 A;  3CC4 T;  5GAN 5;  4N4G A;  4YCU A;  4JJB A;  4TQF A;  1YJN A;  1BIB A;  1Y96 A;  2QGG A;  2YLC A;  1USY C;  1YFT A;  3EFO A;  2KR3 A;  1WX6 A;  3QUI A;  4J9B A;  4F7U A;  4XK8 E;  1BIA A;  1UJ0 A;  3QNE A;  2J3L A;  2EPD A;  2Z0W A;  5I22 A;  1VQ9 A;  1K9A A;  4C0F A;  3UDC A;  3VS3 A;  1JXM A;  1H64 1;  2FZC B;  2I2L A;  2XKO C;  2G4C A;  5CVI A;  1EFN A;  2JZ2 A;  1YFR A;  5GAN g;  1X2K A;  5GAM g;  3JCM Q;  1VQO T;  2KRS A;  1N9W A;  1WDX A;  4JJN K;  2HEQ A;  3RIR A;  4ZTZ B;  2CJ9 A;  9ATC B;  1M1K C;  2Y4X A;  3TQ7 P;  4TVA B;  2P84 A;  1B70 B;  4K87 A;  4J9D A;  1PC0 A;  3LYI A;  2ATC B;  4E2F B;  2L3P A;  3CPW S;  1K76 A;  1W70 A;  2QGF B;  3EG2 A;  1RLP C;  2DU7 A;  3OYI A;  1N8R R;  5GAN d;  2P5I A;  3ER0 A;  2M0Y A;  1WLP B;  4QT7 A;  2BZX A;  1WI7 A;  2PZ1 A;  2JW4 A;  1H92 A;  2DDZ A;  3EHR A;  2SRC A;  1TUG B;  2XU8 A;  2ZT5 A;  1G5H A;  3H0I A;  3M0P A;  2BZY A;  4RTX A;  2RJC A;  5FW9 A;  4K88 A;  2XI9 A;  4CH3 A;  1NG2 A;  2KY9 A;  1M8V A;  4NCX A;  1FWZ A;  4E7L A;  1ZLM A;  4HWO A;  5A0G A;  1VQZ A;  4BW9 A;  1EX4 A;  1KSW A;  2CRE A;  4H2T A;  2WSC E;  1YIJ Q;  1YJW Q;  3VS1 A;  4N4H A;  4M7D G;  1UHC A;  1WPY A;  3REX A;  3VKI A;  1Q86 R;  2AKK A;  4P73 C;  4CRI A;  1BCM A;  1OYX A;  2J6F A;  4Q5W A;  3I5S A;  4C8Q B;  4FCY A;  3RL6 A;  1EZZ B;  2QXF A;  3G6E Q;  2QQS A; 
#chains in the Genus database with same CATH homology
 1X6O A;  3O8V A;  3BDL A;  2RJF A;  1NJ8 A;  3HFZ A;  2XK0 A;  5LJ3 f;  1BBW A;  4YRR A;  2JUF A;  2X4X A;  4O6J A;  4BI3 A;  2L8D A;  3J80 E;  1AHJ B;  1I4K 1;  2YHT A;  4BWA A;  4YRJ A;  3M5A A;  4D6W A;  3I55 A;  4GY5 A;  1SES A;  4YTL A;  1PSE A;  2CGH A;  1K8A C;  3L4G B;  3L2Z A;  2IVW A;  4Q6G A;  4ELY C;  3LWH A;  2E3C A;  4QQ6 A;  2CZ7 B;  3QO7 A;  2ZPI B;  1P92 A;  4EO4 A;  2XHC A;  3OYE A;  4GLK A;  3VU3 C;  3OYJ A;  5J3B A;  2EL9 A;  2F5T X;  2X4Y A;  3OMC A;  2ZCE A;  3JB9 F;  4E47 A;  4L59 A;  3V8L A;  3GOX A;  2I4O A;  3OBW A;  4EMK C;  4OP0 A;  4J83 A;  4DQ2 A;  2XD0 A;  2AKW A;  5GAN 2;  3OYC A;  5HGQ A;  2XDD A;  4C0Z A;  1VQO A;  4E7I A;  4YP0 A;  4EMH A;  4C5I A;  4Y91 A;  1VQN T;  3JCM V;  3JCM W;  3QPH A;  4ZIB A;  3QO8 A;  3M59 A;  4C8Q C;  4PJO D;  4X34 A;  2AMC A;  1TH7 A;  4KT0 E;  4M75 D;  2VXF A;  5CCA A;  4RDX A;  1YI2 A;  1Z7M A;  2R57 A;  4FT2 A;  4MML A;  3DB4 A;  4VUB A;  2RJD A;  1E22 A;  4C92 E;  1X2H A;  4P74 A;  4H2W A;  1KG1 A;  3HXV A;  3I56 T;  3QBY A;  2K3Y A;  3DLL A;  1ATI A;  3QJY A;  4F7U E;  3CCS T;  2DQ3 A;  4YRN A;  1WJR A;  3BDU A;  5DLQ E;  1KQS S;  1HTT A;  5GAO m;  5CQX A;  2V8J A;  3QTC A;  2EJ9 A;  2ZGW A;  4XU0 A;  2QTX A;  4MDW A;  3WXM B;  3PFS A;  3LGL A;  2NLU A;  1IRE B;  3JSC A;  1O9S A;  4J6X A;  4JRP A;  5K1X A;  1VIE A;  1EFW A;  2LCC A;  5CKB A;  1WJQ A;  5GAN 4;  3P8T A;  4X5O A;  4HKE A;  3E9I A;  4BE2 A;  1N8R U;  2P0P A;  4OB2 B;  5A2Q E;  3GIB A;  1B76 A;  4TVY A;  3OYH A;  4YRE A;  2LX9 A;  3GNF B;  3CMQ A;  1EIF A;  3MF2 A;  2Q7E A;  5FU6 C;  4N4I A;  4CH6 A;  3TEH A;  2I4L A;  5LJ3 d;  2RH2 A;  3SWN A;  3L42 A;  2M16 A;  3PT9 A;  2EWN A;  2L89 A;  3L2R A;  3GF5 A;  1EIY B;  3OS0 A;  4A4H A;  1X54 A;  3E9F A;  2ZR2 A;  1U8R A;  1QW1 A;  1Q86 U;  4NOY A;  3CCV A;  3JB9 I;  2C06 A;  1N9R A;  1S72 A;  1UGS B;  1OI1 A;  2DQ0 A;  4ZN3 A;  4XEM A;  2KQW A;  1J5W A;  3LH0 A;  3GPL A;  1YIJ T;  3A8G B;  3MET A;  1YJW T;  3VQX A;  1NPP A;  4BDZ A;  3REU A;  4X9D A;  4XTX A;  3HXW A;  4C8Q G;  1MGQ A;  3QZ9 B;  4ZTU B;  3TEE A;  4JRK A;  4NL3 A;  3QXE B;  5GAN j;  1QP2 A;  4C92 B;  3OW2 S;  3FC3 A;  4YRK A;  4XTU A;  4PJO A;  3G6E T;  4M7A F;  3TCJ A;  1Y96 B;  4F7U B;  4HCC A;  4M75 A;  4ZGD B;  3CCJ T;  3H6Z A;  5K1P A;  4RMF A;  4KUD K;  4MZT A;  3QKJ A;  2ZIN A;  4CS2 A;  2K4Y A;  2CS7 A;  3LX7 A;  4KR2 A;  2NS6 A;  5GAM f;  2V8I A;  4RQF A;  4JRI A;  1YBY A;  2KDS A;  1W2B A;  3CCQ T;  4LD6 A;  3JCM e;  1OZ2 A;  2KVQ G;  2Q7H A;  3PTA A;  4KQE A;  2A3L A;  5CO7 A;  1VQ7 T;  2C8M A;  4H2U A;  5LJ5 g;  2KAF A;  2K57 A;  2DD4 A;  4M7D D;  2DIQ A;  3QZ5 B;  3M9Q A;  4EPC A;  4CH4 A;  2FVU A;  4M78 C;  5J39 A;  3JCM h;  3CEY A;  2EAY A;  1PSF A;  4IUT A;  3CCU T;  2ZTG A;  3P8Y A;  2RHX A;  3IAL A;  3PIP A;  3CXC S;  2DU5 A;  3G7Z A;  1NYQ A;  4PLI A;  3LW5 E;  3ME9 A;  4MMK A;  4H02 A;  1WU7 A;  3CCR T;  1Q81 U;  1Q81 C;  3VQY A;  3NET A;  3NTK A;  3HFZ B;  2RB6 A;  2GQV A;  2CYZ B;  3CPW A;  4HWS A;  4LVJ A;  4OB0 B;  3QHS A;  1XOV A;  3JCM P;  5GAN 6;  4M7D C;  4Z02 A;  1QP3 A;  3VYG A;  4QVZ A;  1YIJ A;  1YJW A;  2ARU A;  2CZ1 B;  5GAO q;  3CMA T;  2CZ6 B;  2RHQ A;  3ZEH A;  3S3O A;  1IZ6 A;  5HY6 A;  3LSS A;  4OB3 B;  3QII A;  3G6E A;  2RM4 A;  4A4E A;  2QHT A;  4BB7 A;  5C0M A;  3OB9 A;  3C4S A;  2HBP A;  5C51 B;  4TVW A;  3RGL A;  2DZ9 A;  3CC7 A;  2OTL A;  3BW1 A;  3CCJ A;  2D0Q B;  1XQH A;  3HKS A;  4B9W A;  4J8O A;  3OYM A;  4PNO A;  2EKO A;  3MP8 A;  2AKW B;  2ZZG A;  5GAN e;  5HKC A;  3A32 A;  5A0D A;  2GCX A;  1VQ5 T;  4C5H A;  2EQK A;  2M9U A;  2MI6 A;  11AS A;  4OB1 B;  3UGQ A;  3OSV A;  3WQZ A;  1UGR B;  2QA4 A;  1Z7N A;  2ZZF A;  5E3I A;  4L5G A;  3RAC A;  3BFM A;  2QQA A;  5GAN h;  1VQ7 A;  2AMC B;  3A7U A;  5GMK m;  5GAO p;  2M1H A;  2ZXF A;  4PJO F;  2I4M A;  5IAY A;  1VQ4 A;  4P75 A;  3JCM c;  2JOY A;  3RKW A;  1YB3 A;  2BKD N;  3ZBD A;  1QF6 A;  4M75 F;  1BBU A;  2XG8 D;  3UH0 A;  4HT8 A;  4M78 G;  4M77 C;  2PQW A;  4MZP A;  4PJO E;  4EDU A;  5GAN 3;  5GAM d;  3CCU A;  1E1T A;  5LJ3 j;  3CCL T;  1YGB A;  1B34 A;  2RA2 A;  5GMK j;  4ZTJ A;  4M75 E;  4ELZ C;  1WQW A;  2RD1 A;  4RG2 A;  4DOV A;  3PZC A;  4JRQ A;  4EMG A;  2E6N A;  3OS1 A;  4F7U G;  2EJF A;  5CAI A;  2ODR C;  4YCV A;  3W3S A;  3OYA A;  3OYK A;  3ICA A;  3P8H A;  5KE3 A;  4H2X A;  3KXT A;  4P71 A;  2D9T A;  2RHY A;  4QQG A;  1YHQ T;  3ZFJ A;  1WQ7 A;  2B8A A;  1KQ2 A;  2PUO B;  1ZHI A;  2QHS A;  4YRG A;  3MO8 A;  3M4Q A;  3M55 A;  4DPG A;  1USY A;  5ELN A;  3TEH B;  1K9M U;  1VQL A;  4WI1 A;  4FM4 B;  1K9M C;  4XEO A;  2FYK A;  3UPU A;  4L87 A;  5KCO A;  4R56 A;  2VGM A;  1X01 A;  5CR2 A;  2YRV A;  5CKE A;  4XU3 A;  2E65 A;  4YDQ A;  1NE8 A;  3QG1 A;  2ZPE B;  1Y07 A;  4C8Q D;  3MP6 A;  3CC4 A;  1EVK A;  1Y71 A;  3V7C A;  1H3Z A;  4M7A A;  5L8R E;  1NJ2 A;  4N0A A;  5J26 A;  2EQU A;  2ZPB B;  2CKK A;  4P5N A;  2ALY A;  4KUI A;  1FXX A;  1G51 A;  1BI0 A;  4IUU A;  1XTD A;  2J3M A;  1ADJ A;  2RHS B;  1KHI A;  4JLI A;  2GFU A;  2ARS A;  4TTV A;  3WVD B;  2HD0 A;  4BE0 A;  2XID A;  4MZM A;  2KSS A;  4YRS A;  4M75 B;  2DVE A;  3G4S T;  3M54 A;  4BUG A;  3GLX A;  4M77 G;  2PVD B;  4WF2 A;  3DKM A;  4P73 A;  2RK1 A;  1K73 U;  4TVR A;  1VQP T;  3LLR A;  1K73 C;  5LJ5 j;  2RHU A;  3CCL A;  4RCC A;  5F5W A;  3SFM A;  3VBB A;  3OYF A;  4RQE A;  2DKG A;  4C5E A;  4YRQ A;  5D6X A;  3GP8 A;  5I2M A;  4KR3 A;  3M4Y A;  4II1 A;  3KFU A;  4E51 A;  1I81 A;  1JJ2 S;  2ZT7 A;  5CK9 A;  4C5G A;  3MEY A;  5LL6 S;  2RHZ A;  3CME T;  3OW2 A;  3HY1 A;  5CIU A;  3OYG A;  1VQ6 T;  2XGT A;  4P72 C;  5LJ3 e;  2VC8 A;  2D6F A;  4A4F A;  5GMK e;  4YRI A;  1G5V A;  3VUZ A;  1BI1 A;  2ZZE A;  4DOW A;  5LJ5 f;  4M7D F;  3HXY A;  1M90 U;  5GMK i;  1ADY A;  1X55 A;  3FB9 A;  1B7Y A;  1W4S A;  2LDM A;  3RF1 A;  1Y7X A;  5LJ3 h;  4EMK A;  2CJA A;  2LT4 A;  5GMK h;  5A0L A;  3HHT B;  3QO5 A;  1N8R C;  2IG0 A;  2A8E A;  3CBM A;  1NYR A;  4YYE A;  2L3R A;  3FDR A;  2PVO B;  4A4K A;  4WJ4 A;  4BY6 B;  1RL2 A;  3SD4 A;  2L5Q A;  3MCA B;  3X25 B;  1OZ3 A;  3HRT A;  5HK0 A;  4V2S A;  3HRS A;  2DTO A;  4LDW A;  5C6S A;  2RHQ B;  1LNX A;  3RKX A;  3NEN A;  3LGF A;  3GNG A;  4LVK A;  1SET A;  2WSF E;  4QVD A;  1Q86 C;  2MF2 A;  1VQN A;  2ZIM A;  4RMO A;  4PG3 A;  2O4X A;  3A31 A;  2RI5 A;  3G4S A;  2I4N A;  2Y4Y A;  2JNG A;  3L2U A;  3CXC A;  1BYM A;  4TQD A;  3CD6 T;  2GF7 A;  1X56 A;  5GAM j;  1NJI U;  3ASK A;  3URG A;  1NJI C;  2C7I A;  1RIQ A;  3EFS A;  1VQ8 T;  2E70 A;  3V8J A;  4J7F A;  4HT9 A;  3JCM X;  1KD1 U;  4ATO A;  4LDY A;  4A4G A;  4M77 F;  1YIT T;  2FB7 A;  2FL7 A;  3HFN A;  2MAM A;  2QQB A;  4CS3 A;  3C95 A;  3I56 A;  3NTI A;  3I7F A;  4M78 D;  4M7A E;  5D6Y A;  3CCS A;  3P8B B;  4ME7 A;  3JCM b;  4FL6 A;  5GAO n;  3EAE A;  1M1F A;  4FSX A;  1G3T A;  4BY6 C;  3HXU A;  3UFG A;  3V8K A;  4LNS A;  2QEX T;  4YRT A;  4XQ3 A;  1SRY A;  1XNI A;  3A8L B;  1QE0 A;  3E19 A;  1X75 C;  1KC8 U;  2HQE A;  5CKH A;  1KC8 C;  2QDY B;  3F70 A;  2DD5 A;  4YRM A;  3QO3 A;  5CKD A;  2QI2 A;  5DM7 R;  2JN0 A;  3C12 A;  1GXI E;  2LQ8 A;  3OYL A;  1B34 B;  3HL8 A;  1YJN T;  2A7Y A;  3MEU A;  3MHX A;  3E9G A;  4L6V 5;  2M0O A;  3X24 B;  3P8V A;  3OYB A;  2KK4 A;  1VQ9 T;  5FU7 B;  2AHJ B;  1UB4 A;  1UEB A;  4J15 A;  1QVF S;  3RMS A;  4LVL A;  4LDX A;  2BUD A;  5LJ5 d;  3VUB A;  4C92 C;  3OS5 A;  3E9H A;  4YRF A;  4YPF A;  1VQK T;  2P0Q A;  3EFR A;  4LDU A;  4ZGE B;  3OA6 A;  3INZ A;  3A8M B;  4NS5 A;  4PHC A;  4P3N A;  1HC7 A;  4IUV A;  1H4S A;  4G84 A;  2JTM A;  4JS5 A;  3JCM g;  3OBY A;  4HWT A;  4J7I A;  3TUP A;  1D3B A;  4QQD A;  1ASY A;  4HVC A;  4A53 A;  4XU1 A;  3PCO A;  2ZPG B;  3JB9 H;  3G1Z A;  3R07 A;  3HXZ A;  3HSB A;  3M4G A;  1LOJ A;  1V29 B;  4XAX B;  2RJE A;  5GAN 8;  1I8F A;  3IKM B;  2GFA A;  1C0A A;  4IUQ A;  4TWA A;  5KCH A;  2PME A;  3NEM A;  1U1S A;  1VUB A;  2O01 E;  5ELO A;  1E1O A;  4UP7 A;  3DSQ A;  4OVA A;  5C53 B;  2LQK A;  3PGG A;  3FIF A;  4QW2 A;  4M7A B;  3CBO A;  4C8Q F;  4OGE A;  4BDY A;  3MP1 A;  3UT1 A;  1N6A A;  2X35 A;  3OQ5 A;  3RES A;  4YCW A;  2ZPF B;  4LVI A;  3KBG A;  1ASZ A;  1WGS A;  2ALY B;  3MF1 A;  4XU2 A;  3HPW A;  3WVE B;  3J7A F;  4M77 D;  5GAM e;  1KMN A;  3UGT A;  3CCM T;  2VGN A;  4M78 A;  4OF1 A;  3A74 A;  2BIV A;  4ZGJ B;  2ZT8 A;  3HRU A;  4JS4 A;  2F69 A;  3QSU A;  2JVV A;  2ZIO A;  2DJZ A;  3JB9 G;  3CCQ A;  2VUB A;  2ZCF B;  3KUF A;  3MEW A;  3VYH B;  3M4P A;  2ZZD A;  3OMG A;  4FIB A;  2ODR D;  5GAM h;  3A5Y A;  3RKY A;  2ZNI A;  3PNW C;  3LWI A;  4HWP A;  4B9X A;  1NJ1 A;  4H2V A;  4C0D B;  3RMQ A;  3FJP A;  1IL2 A;  3OYD A;  4NL2 A;  2DO3 A;  2JTF A;  3L1A A;  1JJC A;  4M7D A;  3LSQ A;  3P8D A;  3L2W A;  2CIM A;  2DXB A;  1EQR A;  1VIF A;  3PIO A;  4P3O A;  1NJ6 A;  4C92 G;  1VQK A;  4BD3 A;  1QVG S;  1Q82 U;  3FLG A;  1M1K U;  2EJG A;  1Q82 C;  4E7K A;  3J81 E;  1PYS A;  2LNV A;  5HK3 A;  3A5Z A;  3HXX A;  1MHN A;  1WLE A;  3CCR A;  4M7A C;  3MEV A;  4N0A C;  3A7A A;  2R5M A;  3HY0 A;  4P3P A;  1SSF A;  1H4V B;  3PMT A;  1B7Y B;  1H4T A;  3NFC A;  2H3J A;  2RO0 A;  1WJS A;  1YI2 T;  3SB2 A;  4EMK B;  3SDZ A;  3CMA A;  1I5L A;  1G3W A;  1UGQ B;  4QVC A;  2ZR3 A;  2DAQ A;  5GMK l;  4IUP A;  12AS A;  1O75 A;  2HNI A;  1KMM A;  4HA8 A;  1JJ2 A;  1RI0 A;  2DTH A;  3HRI A;  1HXD A;  3SWN B;  3IKL A;  2K5L A;  1M1G A;  1KQS A;  4C0D C;  1H4Q A;  3V7R A;  2RK2 A;  2X4W A;  3DB3 A;  2VV5 A;  2MWP A;  3OYY A;  3TEG A;  5FRO A;  4P74 C;  4CI0 C;  3CCM A;  1LJO A;  1VQ5 A;  1B8A A;  1EVL A;  4M77 A;  3JRZ A;  4BAC A;  4O2D A;  2O4X B;  4XTZ A;  3QYH B;  5AYF A;  1K8A U;  3V7S A;  5FRM A;  4OMF B;  3L2Q A;  1FX7 A;  2HQX A;  5C52 B;  5CQY A;  3E1S A;  3OD1 A;  4WJ3 M;  2K5F A;  4PJO B;  3X28 B;  3VQW A;  1BI2 A;  1G3S A;  1KQ1 A;  3BJU A;  5I2S A;  2KMT A;  1NJ5 A;  2Q7G A;  3IG2 A;  2IY5 A;  3HTZ A;  1EOV A;  2DPP B;  1M9S A;  3A8O B;  3G71 T;  1WNL A;  4YRP A;  2LC4 A;  3CCV T;  2K2V A;  2P0K A;  1S72 T;  1X2G A;  4PKC C;  4HCB A;  4PL6 A;  2CJB A;  4M78 F;  2LVM A;  1L0W A;  2ZPH B;  3TU4 K;  3OS2 A;  4M7A G;  2G3R A;  3SWN C;  3MEA A;  1WYD A;  5EG2 A;  5FU6 B;  3CC2 T;  1U1T A;  4LDV A;  5CKF A;  3M56 A;  1N9S A;  4C92 F;  4UC4 A;  4ZN1 A;  2EFI A;  1M4Z A;  4DA4 A;  4YRO A;  1GGM A;  3NEL A;  4MDX A;  4G85 A;  5KNN A;  4M78 E;  4K86 A;  4AH6 A;  3VJP A;  1YHQ A;  2XTI A;  1NZ9 A;  4F7U F;  2RI3 A;  4TVA A;  1B70 A;  4HCZ A;  2QHU A;  2FHD A;  2ART A;  2PUK B;  3S3N A;  3CPF A;  1M90 C;  1BKB A;  3MQZ A;  2LCL A;  4RCB A;  3C94 A;  2DK3 A;  4UP9 A;  2Q5I A;  3QDR B;  2EYQ A;  4PJO C;  4R55 A;  4M7D E;  4JDS A;  4O5V A;  4FT4 A;  3HFV A;  4Y28 E;  4J6W A;  4KUL A;  1D3B B;  4M75 C;  3PCO B;  4E7J A;  2LT1 A;  4IUR A;  1R8O B;  2K3X A;  4A54 A;  5LJ3 g;  2P0L A;  3OY9 A;  3RER A;  2MWO A;  3JCM f;  2E10 A;  4C8Q A;  4UP8 A;  5I21 A;  2Y90 A;  1NPR A;  4C0G A;  1N27 A;  1W66 A;  1QVF A;  5FLX E;  3S6W A;  5GAO l;  3CCE T;  3FEO A;  5DY9 A;  1VQM T;  2R58 A;  4E7H A;  4KBM B;  3L4G A;  1YJ9 T;  2DTI A;  1G3Y A;  3G71 A;  1VQP A;  5D6W A;  5GAN 7;  4P72 A;  3JB9 D;  2QQS A;  2P4T A;  2ZT6 A;  1KD1 C;  4M78 B;  3JAM E;  1JBM A;  3CC2 A;  1YCY A;  1NNH A;  2DEQ A;  1KOG A;  2E1H A;  3QJ6 A;  4XTY A;  3OYN A;  3CBP A;  4YRC A;  2RHS A;  4J6Y A;  3TRE A;  3X26 B;  3CME A;  3A8H B;  3H8Z A;  4M77 E;  4CS4 A;  3FRN A;  4H2S A;  1VQ6 A;  5KH6 A;  3M57 A;  2OTJ T;  5LJ5 e;  2DIG A;  3DLM A;  3NTH A;  3CC7 T;  2OTL T;  3QYG B;  4C92 D;  1FYF A;  4Q15 A;  1M5Q 1;  1JJC B;  4M7D B;  3PMI A;  2PVG B;  3RUX A;  4YRL A;  2E12 A;  1ZQ1 A;  3UWN A;  2E5A A;  5LJ5 h;  4UPA A;  1PYS B;  2DXC A;  4PJO G;  5GAN f;  2E64 A;  4CH5 A;  3A5Z B;  3N5B B;  4ZTF A;  3LC0 A;  2VYT A;  4LVM A;  5IT9 E;  3HRK A;  4BI4 A;  2QA4 T;  3ERR A;  3OSS C;  2X4J A;  2PMF A;  4J5Y A;  4M75 G;  2QQR A;  2XIC A;  1E24 A;  2WSE E;  2R5A A;  3VQV A;  4H2X B;  1VQ4 T;  1ZBX A;  4LD9 K;  3HFO A;  2CZ0 B;  2OAU A;  2Q5H A;  1BI3 A;  1YFS A;  3M53 A;  1KHC A;  3JCM J;  2XDB A;  3A7R A;  1SER A;  1JRI A;  2LRQ A;  4BE1 A;  2DXU A;  4RG8 A;  3L2V A;  5KE2 A;  1G5I A;  5GAO r;  1HK9 A;  4FU6 A;  3CCE A;  3S3M A;  2WAC A;  2K5I A;  3Q1J A;  4EX5 A;  1VQM A;  5DLO A;  2E6Z A;  1QVG A;  2EQJ A;  1YJ9 A;  2ZNJ A;  4OGC A;  3CD6 A;  4P75 C;  2RHI A;  3JCM d;  5IN1 A;  2RI2 A;  4H2Y A;  5FRN A;  1VQ8 A;  4IKF A;  2QQ9 A;  4XTW A;  2V8K A;  3VV0 A;  2LTO A;  1YIT A;  4HWR A;  4M77 B;  3M58 A;  4JUV A;  3AHU A;  5M9O A;  1QVP A;  1Q7Y U;  1Q7Y C;  1EIY A;  3R6O A;  2QHV A;  2VXE A;  3JB9 J;  2DXT A;  3BY7 A;  2EQM A;  2PU9 B;  2XDP A;  5FU7 C;  2F5K A;  1JB0 E;  1DJ7 B;  1VQL T;  2OTJ A;  4PLL A;  1LYL A;  4C8Q E;  4OLF A;  2MMP A;  4HT4 A;  3T9N A;  3HP9 A;  2QEX A;  4BI8 B;  4JLG A;  2E5Q A;  1W2B S;  4X9C A;  2IY5 B;  3I55 T;  4P71 C;  2EIF A;  4XTV A;  2HAX A;  2YLB A;  2E41 A;  4C92 A;  1UGP B;  4M7A D;  4RKU E;  2DZC A;  3CC4 T;  5GAN 5;  4N4G A;  4YCU A;  4TQF A;  1YJN A;  1BIB A;  1Y96 A;  2YLC A;  1USY C;  1YFT A;  4F7U A;  3QUI A;  4XK8 E;  1BIA A;  3QNE A;  2J3L A;  1VQ9 A;  4C0F A;  3UDC A;  2I2L A;  1H64 1;  2XKO C;  2G4C A;  5CVI A;  2JZ2 A;  1YFR A;  5GAN g;  5GAM g;  3JCM Q;  1VQO T;  1N9W A;  4JJN K;  3RIR A;  4ZTZ B;  2CJ9 A;  1M1K C;  2Y4X A;  4TVA B;  1B70 B;  4K87 A;  3LYI A;  3CPW S;  2DU7 A;  3OYI A;  5GAN d;  2P5I A;  3ER0 A;  2DDZ A;  2XU8 A;  2ZT5 A;  1G5H A;  2RJC A;  4K88 A;  2XI9 A;  4CH3 A;  2KY9 A;  1M8V A;  4NCX A;  1FWZ A;  4E7L A;  4HWO A;  5A0G A;  1VQZ A;  4BW9 A;  4H2T A;  2WSC E;  4N4H A;  4M7D G;  1WPY A;  3REX A;  3VKI A;  4P73 C;  4CRI A;  1OYX A;  4Q5W A;  4C8Q B;  3RL6 A;  2QXF A;  3X20 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...