2HNTE

Crystallographic structure of human gamma-thrombin
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
67
structure length
67
Chain Sequence
EKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic structure of human gamma-thrombin.
pubmed rcsb
source organism Homo sapiens
molecule tags Serine protease
molecule keywords GAMMA-THROMBIN
total genus 1
structure length 67
sequence length 67
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 1994-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hntE00
1SGRE 2ZGBH 1K2I1 1NO9H 1BTZA 1QA0A 3AAUA 1VZQH 3PMBB 4CRBA 1MQ6A 1DE7H 3ZZCA 1AN1E 4OGXA 2WPHS 1G2LA 1KXAA 4DW2U 5AFZH 2FM2A 2PSYA 4MPVA 1MTUA 3A83A 3JZ1B 2JETC 4GPGA 4DVAU 5HGGA 2OC1A 2UUJB 4Y6DA 5E0HA 2D2DA 4B73A 2ZC9H 4BTTB 3RU4T 1Y3UA 1XUGA 2VVCA 2VGCC 2H1UA 1LVOA 1ANDA 3MI4A 2VIPA 2XTTB 4AFSA 1AIXH 1OP0A 2W7SA 2GCTC 4YLUA 1TNJA 2BDGA 2FYRA 1W14U 1PQ8A 2BY8X 3VFEA 2BD2A 1ZYOA 1GHAG 3BTWE 2HRVA 1FIWA 5EW1H 2FO9A 1IQKA 4BNRA 3U8TH 4BANB 2FI3E 1RTKA 2QV1A 2FTLE 2BMGB 1C5VA 1VITG 3MU4A 1C4U2 1YLDA 1V6DA 1KDQA 2ZFPH 2AEIH 1HV7A 1TNIA 1CT2E 3RC5A 9LPRA 1C5MD 2BVRH 2A5KA 1D3DB 3SV7A 1BBRE 1GMHG 2A4QA 2J9NA 1O3PB 2FOFA 4HZHA 4IMQA 1ZSLA 4NZLA 2ZGCA 3A8CA 5DP6A 1H8IH 1RJXB 2G5VA 3GICB 1GCTC 2CHAC 1GBTA 3KQCA 3SNEA 4GCHG 1WTGH 1ORFA 3E3TA 2V3OH 2ZHWH 1KXCA 1VITH 1HJ8A 4FVBA 3FVFB 4ZHAA 1ZOMA 1NRRH 5A0BA 1OPHB 3MU8A 2PLXA 3V13A 1H9IE 4KP0A 2ZU5A 3MHWU 1GJ4H 3LGYA 1QRZA 3PM3A 2GT7A 5IYTA 1G36A 2A5IA 1E38B 3PTBA 2F9VA 1ESBA 2C90B 4I8LA 3PLBA 4VGCC 2EI6A 3URCA 3UNQA 4CH8B 1Q3XA 3GCTF 1CO7E 1FIZA 1MZAA 2SNVA 2NU4E 1BTXA 3BIUH 4JYVH 4OS4A 1UTQA 3VB7A 1IQNA 3DUXH 1HAVA 1FDPA 1Y5UT 1TA2A 1P02A 4X2VA 5T6GA 3ZV9A 1NFYA 2AFQB 2P94A 5FPYA 1XUIA 4AB9A 1O37A 4JZ1A 5A8YA 2ZU4A 3FP8E 1LVMA 1T4VH 1WBGB 1S81A 2LNCA 4ZMAH 1YC0A 4CR5A 4MNVA 1Y59T 1TIOA 1XUKA 3RXSA 1EJMA 1DWEH 3GISB 4WMFA 4CRCA 8ESTE 1UCYK 1TLDA 3RLWH 4X6NA 5EPYA 1C5TA 4K1EA 4IC6A 2BVXH 4CHAC 2C8XB 4SGBE 2W26A 2PWXA 3E8LA 1OWEA 2GDDA 3A81A 1P3CA 6ESTA 3QN7A 5DP9A 3LPRA 1O2MA 1UHBB 3U8RH 1JRTA 1P2QA 6LPRA 1IQMA 2EC9H 3D49H 1FY8E 1AVWA 1SGPE 3PWBA 1Z7KA 2TIOA 4ZHMU 2Z9IA 2PKSC 1YCPM 1EB2A 4A5TS 3VGCC 3GCTG 2AH4X 2GCHF 2QN5T 1C1WH 1BMLA 3NCLA 3LGVA 5EQRA 1UVTH 3TNSA 1BQYA 4ABBA 4MG3A 2THFB 1QRXA 4KTSA 3V12A 1G3DA 3RXCA 3RP2A 3F1SB 1O3JA 1TPOA 5GWZA 4AN7A 1NFUA 1N6YA 4AZ2B 2DE9A 1MU6B 1J9CH 1SGEE 2CHAB 2QC2A 5JBTA 1LKAA 5J4SA 3MU5A 3SW2B 1KXDA 3K6YA 4LXBH 1TONA 5C67A 4BAHB 1V2RT 5CHAB 2SGQE 3TITA 1GBFA 1O2JA 3H7OA 1YCPH 4JK5A 2BXTH 4B2CA 2WPIS 3LU9B 3U8OH 2GCHG 1O2RA 1BRCE 4DOQA 4UFEH 1V2JT 2F9NA 1DWDH 1MTVA 3L33A 1T4UH 1QFKH 1O3LA 1Z8RA 1DUEA 1HIAA 3ZVBA 1F0UA 3RMMH 3H7TA 2ZU2A 3ZZ3A 4XSKU 4DJZB 2CV3A 1HJAC 1QGFA 3SNAA 1YBWA 1ABIH 2QGRA 1ETRH 1ZJDA 2Q6GA 1A5HA 3F68H 1W7XH 1RXPA 3P8OA 5C1XA 3ZZ8A 4IN1A 1BHXB 4R0IA 3LGWA 2BY9X 3ESTA 2FI4E 1Z6JH 2HLCA 2GGVB 4ZKRU 2Q1JA 1AFEH 1GL1A 1V2OT 1P04A 1EZSC 2BLOA 3SJ8A 2BD8A 4ISNA 1CA8B 2XC4A 4MNWA 2FS9A 2ZG0H 2BDIA 4BTUB 4Y71A 1DOJA 5LPEA 5EG4A 1GI3A 1S6HA 1DANH 3G01A 2PSXA 1SQTA 2FXRA 5AVDA 4O97A 4NSVA 1D3TB 4I7YH 1PPZA 2J92A 3AASA 2BVSH 2ZDNA 1EAXA 1YPJH 1BRBE 1DY8A 1ZR0A 1S5SA 3SU6A 1EP6A 3F9FA 1C5OH 1K1IA 5J4QA 1SGDE 2ZTZA 1LPZB 1O2LA 4GVUA 4X8UH 1W12U 4ZAEA 5CMXH 3UQOA 1EAIA 4A6LA 1N8OC 2EEKA 1ZLRA 1SQOA 5E2PA 3QLPH 1G2MA 2IJOB 1W10U 2GP9B 1WOFA 1AZ8A 3RU4D 1P2KA 1DWCH 1QBVH 1VCWA 3MU1A 3CS0A 1O3FA 3PYHA 1W0YH 1SLWB 4ABEA 1O2UA 3LGTA 1ELGA 2JETB 3NK8A 1S83A 2BY6X 3RXGA 1CBWB 4BAQB 2R2WU 1X7AC 2TBSA 1ELDE 3D62A 4ABJA 4AG1A 1MAXA 2J4IA 1HPGA 1O5GH 3HKJB 1H1BA 3SNDA 2G55A 1P2JA 2IN2A 1V2LT 1W11U 3MNSA 3EA8A 3MOCA 5A2MH 3ZZ5A 1PQ5A 2OXSA 2F9BH 1DPOA 2XBVA 1GWAA 3MTYA 3SUGA 4FUJA 3RXUA 2QXHA 1PQ7A 1TMBH 5SGAE 2ALVA 3O8RA 1GMCF 1HJAB 4FU9A 2SGEE 1C2IA 1TX7A 4Y8ZA 1O5AB 1UTPA 2PW8H 1GJ8B 1QB1A 1GBLA 2BY7X 2BDBA 1D3PB 3SBKA 2FODA 1A3BH 2PV9B 1N8OB 2G4TA 1HFDA 1XM1A 4ABAA 1YPMH 1PPFE 3LKWA 2EI8A 4ZH8A 2JH6D 1BRAA 1RIWC 3SUEA 1JIMA 7LPRA 1F5RA 1IQHA 3TLOA 3M35A 5PTPA 4DG4A 5EOKA 1P03A 1ZGVA 1V2KT 1AY6H 2QAAA 1DWBH 1BRUP 2FDAA 2GTBA 2O8UA 4ZHLU 3VB5A 2ZHEH 4JMYA 3MH7A 3O8BA 3SGQE 1J8AA 1CBWC 2ILNA 2ZEBA 3KQDA 3NKKA 1WCZA 4VGCB 5FBEA 1BMAA 3RM0H 1C1NA 1GI8B 1C5RA 2DUCA 4NWKA 3R0FA 1EQ9A 8LPRA 5T3HA 1O3BA 5EQQA 4ABIA 1D3QB 1OKXA 1UTMA 4NIYA 1NU7B 1PPGE 2CF9H 2ANYA 1P01A 1LCYA 1O35A 2QIQA 4NFEA 4INHA 3ZVAA 3ZYEA 1QR3E 1Z6EA 1N6XA 1RD3B 2ZPSA 3MO3A 2RCEA 5TJXA 4JCNA 3A7ZA 3M7UA 1QA7A 3ZZ6A 4UEHH 3GOVB 4AFZA 1MCVA 1UTJA 1Y3YA 1GJ5H 3BTFE 1AVXA 4D9RA 2J94A 3GCHB 2OCVB 5EU8A 1SC8U 3Q77A 1ZHPA 2XC5A 1TMTH 1UMAH 3HATH 3RXJA 1WTHD 2ULLA 4I8KA 2ZKSA 3B9FH 3C1KA 1TX8A 1G30B 2ZHQH 2V35A 5TCAA 3UUZA 2CGAA 2PGQB 3ATWA 4D7GA 2IPHA 1FN8A 1ZPCA 5DP8A 5JB9S 5A0CA 4RN6A 2ZCHP 1SBWA 1GJDB 2BXUH 4GAWA 3SV8A 4AFUA 1E37B 2J2UA 1L4ZA 3TU7H 2ZGHA 1ANCA 1V3XA 1GDUA 2ZU3A 3MH4A 3Q00A 3FP6E 1P05A 1SHYA 4LZ1H 1A4WH 1G3CA 3SU1A 5EXLA 4RKJB 1J15A 2XBWA 3D65E 3PWCA 4Y11E 1Y3VA 1AFQB 2G00A 4E7RG 1HXFH 3BEUA 3L3TA 1Z71A 2LPRA 1IQFA 5C1UA 1P0SH 1A1RA 4X6MA 3IWMA 3ZVDA 1VITF 1J14A 4XE4A 4X1NU 1MTWA 5HM9A 4ABFA 5JBCS 2M5TA 2ANKH 2OC8A 4IBLH 5LPRA 2GVFA 4WXVA 1GBKA 4PROA 3QK1A 3GY2A 1MMJN 3TK5A 1SGTA 3A86A 2VWOA 3NXPA 4ISLA 2BQWB 4TY6A 4Z6AH 2FOMB 3A87A 5F03A 2R0KA 1CVWH 2GD4B 1EUFA 1SGCA 4YZUA 1IQGA 3ZZBA 5AHGH 1NROH 2FTMA 3N7OA 5E8EH 3C27B 3MMGA 4K60A 5T6FA 1A5IA 1F0TA 3A80A 3U69H 4H4FA 1XKAC 2BLQA 2QYIA 3K9XB 1O5CB 4MVNA 1ZMNA 1O3MA 1T7CA 2BDCA 3M5MA 2PTCE 3BN9A 1XUFA 2AMQA 4WXIA 1WAYB 3MU0A 1P9UA 3UREA 5GCHG 3RMNH 1KXBA 2FOGA 2TGDA 1Y5BT 1GHBF 3QO6A 1TOMH 4TY7A 1INCA 3QGNB 3CENA 1V2ST 3U9AH 1THSH 4OS6A 2EA3A 1E34B 1XUJA 1C5YB 1LTOA 4FUFA 3SI3H 3MNCA 1O2VA 1FY5A 1AE8H 1ETTH 1GBJA 2HALA 1GBIA 3VB4A 1VR1H 2TRMA 1CA0C 4B2AA 4BAKB 1L1GA 2B9LA 2VIWA 4XOJA 1GI4A 2BYAX 2BD9A 3M5LA 2ZHFH 1C5ZB 1TRMA 2OBQA 3GYMA 1C2LA 1BT7A 3RXKA 3UWIA 1KTSB 7GCHF 3S7HB 3M5NA 1HBTH 1QRWA 3ODDA 2QXJA 4X6PA 3ZV8A 1P2OA 1SOZA 1TGSZ 3RXAA 1HAZB 1CGIE 1PYTC 3A8AA 1HAXB 4X2XA 4K1SA 1EOJA 2BLVA 2VIQA 2ZFFH 3HGPA 3VXEH 2F9PA 3SZNA 1ESAA 3KNXA 2W7UA 1C5SA 1EJAA 2HWLB 3MH6A 3ZVGA 2FI5E 3LJJA 1QTFA 3SORA 2OBOA 1UK3A 1MQ5A 4FUDA 2P8OB 1LPGB 4FUIA 1OOKB 2ALPA 4THNH 3H5CB 5DP4A 1C1QA 4YT7H 1W13U 3T26A 1F0SA 1C2EA 3ZYDA 1DXWA 3SNBA 1WSSH 2FOAA 1XVOA 2H6MA 3MNXA 2F9UA 4YO9A 4KGAA 1SLVB 2P93A 2A7HA 3UNSA 4NFFA 3ZZAA 3TK6A 4FU8A 4YOJA 2FX4A 2Y7XA 3F9EA 1ELEE 1NY22 4X1PU 4Q7ZA 1THRH 1O2TA 4D8NA 4BXWA 1YCPK 1BHXF 3OSYA 3EA7A 2HNTE 2ZPQA 1O33A 1AI8H 1HAVB 4IGDA 5HXFA 4O3UA 4ZKNU 1SHHB 1C2MA 2Z9JA 3VPKA 3K65B 1MUEB 4QT8C 1W2KH 5AFYH 1VGCB 3MNBA 2RA0A 2BY5X 1O2YA 1FV9A 3RXIA 2Y5FA 1XMNB 1SGFG 1O3AA 5L2YH 3M3TA 5DO4H 3NZIA 1T8NA 2OTVA 1DVAH 2A4OA 1G3BA 2BTCE 1KLTA 3OX7U 3E16B 1JWTA 1UTLM 4MLFB 1GI9B 4DURA 3KN2A 1GHXH 3E6PH 1QJ1B 3L6PA 1PPHE 1PJPA 2VWLA 1ZPZA 4FUEA 4JK6A 2O8LA 5I25A 3A89A 1NRPH 1QY6A 3EGKH 1AUTC 1FN6A 4WWYA 1GBAA 3GY4A 3BEFB 4H42U 3T25A 4CRFA 3UFAA 1ZGIA 1DX5M 1LVBA 2ZP0H 2Y5GA 3BTDE 2WPMS 2I6SA 1FI8A 2Y7ZA 4U01A 1JBUH 1ZJKA 1LDTT 2QA9E 2VJ1A 1KY9A 1ACBE 4UFDH 4U2WA 2GMTC 4DY7B 1S82A 2OQ5A 2R3YA 1TOCB 1GI1A 3PLPA 3TK9A 1MTSA 3SJIA 3LONA 4X1SU 4NG9H 2R9PA 2PKAA 1DDJA 1WV7H 4CHAB 1KDQB 1MH0A 2IOTA 1P8VC 3MWIU 1GJCB 1TX6A 3A7XA 3LDXH 5DJ7A 3SHCH 1RIWB 1GPZA 2P3TB 1F5KU 4I33A 1SB1H 4E05H 4NIWA 2ZDVH 1B0EA 3FFGA 4I32A 5ESBA 4XBCA 4ISHH 1AKSA 1SGQE 2BQ7B 1O3HA 2QF3A 1FPHH 1YKTA 1BA8B 1ELAA 1BCUH 4CH2B 1GI0A 3F9GA 3ZVEA 5JDUB 1FAXA 1ZMLA 1VGCC 2B7DH 1A5GH 1O5FH 5B6OA 1QB6A 5FHTA 2W3KA 4I8GA 2OQUA 1GMDG 1GCTB 1NRQH 2FX6A 2ZGJA 1H9LB 4WMDA 1EKBB 1SL3A 2VIDA 1BJUA 4INKA 1O2ZA 1PPBH 4JZIA 3CS7A 4NIXA 3E0NB 3RU4E 1TBZH 2P3FH 1E0FD 1GDQA 1EZUC 2PTNA 2ZGXH 3GDSA 3A8DA 3T29A 4JYTA 4HGCA 2F83A 1J16A 2Y82A 1WYKA 1OWIA 1TGCA 1TWXB 1GJAB 1CT0E 4X8VH 3DA9B 4Y0ZE 2VGCB 2OUAA 4ABHA 2SGAA 1C1TA 4K3JA 2FLBH 1CA0B 3AVZA 1CGHA 5JPMH 2AIQA 4B76A 1DSTA 1FJSA 3P17H 5EGMA 1DXPA 2PUQH 5F8TA 2Z9GA 2HNTF 2FESH 3MH5A 3GY6A 5E0GA 2ODYB 3BIVH 2Y81A 1S0QA 2BD7A 2ZDLA 1OX1A 3RXEA 2UUYA 2YNBA 2W3IA 1UHBA 4ZUHA 1C1SA 2FP7B 1IQIA 1NN6A 2FLRH 3SNCA 3EDXB 3DD2H 4X2WA 1NT1A 4CR9A 2SGFE 1GBEA 3LC5A 1GHZA 2XXLA 1DUAA 3KCGH 1C2GA 1ANBA 1LPKB 3BTEE 3BTQE 2G51A 6GCHF 2OD3B 3RXQA 1MKXK 4AORA 2VVUA 1DFPA 4TWYA 1BTWA 1K1JA 4HFPB 2XBYA 1O2QA 2Z94A 3A84A 5LH8A 3BF6H 3GDUA 4YM9A 1O2KA 1TNLA 3QTOH 6CHAB 2BD4A 3UTUH 4ZXXH 1O2NA 2HPQH 5FAHA 3VGCB 1QB9A 3M3VA 3A7TA 1FPCH 4XDEA 3ATIA 3UWJH 1HAOH 1UO6A 3LJOA 2ZIQH 1EX3A 5TCCA 3RXBA 4Z0KA 1C1PA 1NFWA 5GPIB 1O32A 1FY1A 4NGAH 5C5NA 2BOKA 1NS3A 2XNIA 3GY5A 2FOHA 1GJ9B 1K9OE 4K69A 1L2EA 1C9PA 1O2HA 3Q3YA 7ESTE 1C4V2 5BRRE 1MD7A 4UONA 4Y8YA 2V6NA 1SGNE 2J38A 3GYLB 3E0PB 1A0LA 4IN2A 2ODPA 3PTNA 1KYNA 2PKAB 2Z3EA 1CQQA 2C8ZB 2P59A 1QIXB 1YPGH 4ZXYH 4ESTE 1T8LA 1UTOA 2EI7A 3LC3A 3S7KB 3M7TA 1C1MA 1KSNA 2A45B 1AQ7A 4U30A 3SQEE 2VVVA 5A09A 1HNEE 1T31A 3U1JB 1UCYH 3RXTA 1C2JA 1UK4A 1O3OA 3GY8A 3BTTE 1GBDA 2OC7A 2PHBA 1EOLA 2HOBA 1LVYA 4UE7H 2YOLA 1O3CA 4GCHF 4CREA 4FXGH 1JMOH 2PKSB 3QZRA 1ELFA 2OLGA 2P16A 1LHFH 2P3UB 1A7SA 1ELVA 1OS8A 3ITIA 1BOQA 2ZPRA 2ZI2H 4ISOA 2Z6BD 2FWWA 1CHOG 1P09A 1C5WB 3HK3B 1OP8A 2VNTA 3KIDU 1GBCA 2ZTXA 1NU9A 1ZSJA 9ESTA 1SPJA 1OP2A 3KGPA 4TWWA 1WU1A 4H6TA 1O30A 3M36A 5GXPA 4MNYA 1BMMH 1SOTA 4WMEA 3LH3A 3PO1B 2P8OC 4LK4A 4TPIZ 2G5NA 1GHAF 2GCTB 1KLJH 3I77A 4XFQA 2O8WA 2FS8A 1ZSKA 4X0WU 3SU5A 4O03A 1QHRB 1AWFH 1HAPH 5DKMA 3U98H 1EATA 1MBQA 3PMHB 3BV9B 1UVSH 1B7XB 2AMPA 2STAE 1FONA 1THPB 4BXSA 1TQ7B 4X6OA 5FX5A 3SGAE 1GVLA 3M37A 1K22H 1L0ZA 4NZQA 1F0RA 3GY7A 1TALA 4ASHA 3MFJA 2GX4A 1SFIA 2BX3A 2ZCKP 3LGUA 3FZDA 1ELCA 1MD8A 3STJA 1ZRKA 3RXVA 2O8MA 5K0HA 4WF8A 1SR5C 1GVZA 3EE0B 1AWHB 2G52A 2ZECA 3BTKE 3W94A 1LHDH 1QJ7B 1H8DH 1LKBA 1XX9A 4DIIH 3DHKH 2B5TB 5DG6A 2BB4A 1O2WA 1C5PA 3SHAH 4FUGA 4GHQA 1HIAB 1Y3XA 3UR6A 3QX5H 1SGIB 2R2MB 3A82A 1DM4B 3TJOA 2SNWA 1M9UA 3ATKA 5ESTE 1AGJA 2WUCA 4WJG2 1S84A 1CGJE 1FUJA 4AGJA 1WQVH 2G81E 3SUDA 3E90B 3NPSA 7KMEH 1H9HE 3CP7A 1FMGA 2QCYA 3TJNA 1LQDB 3ELAH 1TFXA 4Y7AA 1IQJA 3PLKA 1UK2A 4X8SH 1O2OA 5LGOA 2VIVA 1ARCA 2WPLS 2WPKS 3M61U 1EJNA 2HGTH 2BDAA 2ZO3H 1C2HA 1KXEA 5E0JA 1HAGE 3UPEA 1NPMA 3RC6A 5FBIA 5FX6A 2XW9A 1VJ9U 1C5QA 4Y79A 2FMJA 3Q3KA 1QCPA 2ODQA 3QGJA 5DP7A 1S85A 2BOHB 1MKXH 1AMHA 1HCGA 2FOEA 3RXFA 1LHGH 2SGPE 3E91A 4B2BA 1SFQB 1CSOE 4YOGA 1O3IA 3ZVCA 4GHTA 2XWAA 1SMFE 4ZROA 4IW4E 3S9CA 2FEQH 1K21H 2WV5A 1T8MA 2BQ6B 2J34A 4GUXA 3GDVA 4A1TA 2FOCA 1RGQA 1C5NH 1W0ZU 1C9TA 2NWNA 2NU1E 2R0LA 3RXLA 2CJIA 3IG6B 1GHBG 1LHEH 4D9QA 1TABE 3A8BA 1ELTA 1PPEE 1GGDC 1DICA 1QBNA 3LH1A 1T32A 2BZ6H 2STBE 4Y7BA 4NA7A 6CHAC 4WH8A 4CBOA 3SV2H 2Z9KA 2VB0A 1C1UH 5DP5A 5HM2A 2GZ8A 2ZQ1A 2H9HA 1A61H 1NFXA 1YPHE 2XRCA 3AAVA 5F8XA 1JRSA 5C20A 3LOXA 4NSYA 1PPCE 1A0JA 3TIUA 5FXLA 1NRNH 3T62A 1Q2WA 2O8TA 1JIRA 2R3UA 5GDSH 2FZZA 1HAYB 1ZTLA 3IITA 4YTAA 5DGJA 4CRAA 1YPEH 2UWPA 5FPTA 3V3MA 3ZZ7A 1F92A 2O9QA 1AB9B 3QTVH 3M5OA 5EPNA 2HPPH 4WVPE 4IMZA 4FUCA 1MKWH 2TGPZ 1C5LH 1GMDF 4F49A 3RXOA 1GI7B 1QQUA 3ZZ4A 1T8OA 2GZ7A 2OP9A 2KAIA 1EB1H 1JXPA 5E2OA 1MTNC 2D8WA 1CT4E 3SO3A 3PMAB 3AW0A 4HI3A 2PUXB 3OU0A 1V2PT 1ZTJA 3A7YA 5JBBS 3S9AA 1YP9A 3GY3A 2BDHA 3P6ZB 1O2IA 5DPAA 4Y76A 1OWJA 2Z9LA 1BZXE 1CHGA 3OY6U 2ZA5A 2QF0A 3M7QA 3LT3A 2VU8E 1AVGH 2FIRH 2BX4A 1Q31A 2Z3DA 1W8BH 5DP3A 1O38A 1IQLA 1BTHH 2WINI 4Y8XA 4ISIH 3V7TA 3PROA 2ZFRH 4K2YA 5GIBA 1EAUA 1OWDA 3VXFH 4DCDA 1XXDA 2NU3E 4Y0YE 2GKVE 5DK1A 4X8TH 1WQSA 2BD5A 2Y6TA 4HTCH 3BG4C 3SJOA 1GI5A 3TVJB 1C1RA 1GMHF 5LPFA 1AE5A 1O39A 1GBBA 1K1LA 2J95A 2GMTB 2ESTE 1K1MA 3GCOA 5JBAS 1J17T 4IS5A 5ABWA 1P2MA 2A7CA 4O3TA 1TE0A 1A46H 1W3CA 1L1JA 5C2ZA 1TRYA 3LGIA 3T2NA 1Z1IA 2D1JA 1S6FA 2GZ9A 2A7JA 1TBQH 2ANMH 5HYOA 1MBMA 3S9BA 2Z3CA 1O36A 4OS1A 3STIA 2ZHDA 1F7ZA 2FPZA 2VWMA 3QWCH 2CN0H 3DFJA 4JZEH 1TNKA 1V2WT 2ZFQH 4J1YA 3RMLH 1IHTH 4A92A 1C1VH 1AUJA 1SQAA 2B8OH 2ZF0H 2CXVA 2AERH 4M7GA 4MQAA 1O5DH 4WH6A 1TA6A 3TGKE 2H2ZA 1IQEA 4KTCA 3P8GA 1C4Y2 1FQ3A 1SG8B 2GDEH 3ENSB 4Q80A 3RXHA 1H4WA 4O9VA 3R3GB 4XBDA 1DT2A 5BPEA 1SSXA 3BSQA 2AS9A 3K6ZA 2VIOA 1ELBA 1VCQA 4K8BA 3BTME 2A4RA 3TJUA 1RTLA 2VWNA 1D6WA 2NU0E 1GI2A 1Z8GA 3S69A 4AYYB 3QDZB 2ZZUH 3NUMA 1TPAE 1P57B 2JKHA 3KL6A 2A0QB 1O3EA 1G3EA 3O8DA 1FZZA 4Q2KA 1C2DA 3Q76A 3A7WA 1W7GH 1DS2E 4IC5A 1P06A 2B0FA 3EQ0H 3P92A 3RXPA 2JH0D 1FXYA 4GSOA 4D76A 1D4PB 3P8FA 2GV6A 3SU2A 3T5FH 1C2KA 4JZFH 2C8WB 1E35B 1FLEE 1GBHA 2WV4A 1FY4A 1UCYE 1O5EH 4I8JA 5GCHF 4NCYA 5G4BA 4UD9H 1EP5A 3PV4A 1OWHA 4A7IB 2W5EA 3HPTB 3LIWA 1BBRK 3BG8A 4E7NA 4RKOB 4UFFH 1K28D 1QL8A 1ID5H 1YGCH 4YOIA 3B23B 1ZHRA 5C5OA 1DY9A 4XBBA 8GCHF 4AGKA 1C5UA 3SJ9A 1B0FA 3SN8A 1EPTC 4A1XA 1AFQC 3KQBA 1RTFB 1HLTH 1UVPA 1BITA 1BMNH 3EA9A 3GCNA 3SU4A 1DITH 5EODA 3WY8A 5AF9H 2K1QA 1C5XB 2ZDAH 2TGAA 1Y5AT 2C4FH 6GCHG 1QJ6B 3RUOA 1KTTB 1OWKA 1LQEA 3T28A 3HGNA 1K1NA 4Q7XA 3TH3H 1EAWA 1V2UT 1LO6A 4K1TA 5T6DA 3RLYH 1MCTA 1V2VT 2A4GA 4OS7A 2A32A 2SGDE 4OS2A 1BTUA 1A3EH 4LOYH 1ESTA 4X1QU 1CE5A 2AMDA 2A2QH 1B5GH 4B71A 2H5CA 3S0NA 4J2YB 1Z8JB 1P2NA 1RFNA 1Z8IB 1AB9C 2BD3A 1GCDA 1DLKB 1UVOA 1YPHC 1ZZZA 1OYTH 5ETXA 1YF4A 5A8ZA 1V2NT 3E1XB 5JYIA 5HMAA 1P10A 1V2QT 8GCHG 4CRGA 1G32B 1P3EA 3UR9A 4A1VA 1P12E 1YM0A 4CBNA 3RXDA 3RC4A 1EPTA 4MPUA 4BTIB 3GCHC 1NC6A 1MU8B 3PO1C 5K7RA 2V3HH 7GCHG 3P95A 4H6SB 1HJ9A 4AFQA 1BUIA 5FPSA 1D9IA 2RA3A 1AZZA 3F9HA 2G8TA 1QL9A 4X2YA 1P11E 2BDYA 1AHTH 2VINA 1SLUB 2H5DA 3QUMP 4OS5A 5EXMA 4U32A 1GJ7B 4FUBA 2BM2A 1TB6H 1O2PA 3NWUA 4TYDA 3ODFA 5A8XA 4MPXA 2ZCLP 1K1OA 3TH4H 3TGIE 4INLA 2HVXA 3B8JA 1MKWK 1Y3WA 4B75A 1MTNB 4AX9H 2ZFSA 1BTPA 4WY3A 5L30H 1A0HB 1TGTA 2WYGA 1D6RA 2F3CE 2PR3A 2UWOA 2WYJA 1GJ6A 4JYUH 2Q6DA 1LMWB 3SGBE 1AD8H 2C3SA 4UFGH 1ZMJA 3Q3XA 3EAJA 3P8NA 3SJKA 1DLEA 2OINA 4RSPA 2QY0B 4MDSA 2GT8A 1L4DA 2Y80A 5CE1A 3I78A 4I8HA 3OYPA 3VB6A 4K5ZA 1RS0A 2F9OA 3JZ2B 4R8TB 3TH2H 3SUFA 4E06H 1OSSA 2AGEX 1SLXB 2H9TH 2A2XH 4NIVA 1GL0E 1DSUA 2I6QA 4B1TA 3SQHE 2AIPA 2Q6FA 3SOSA 5EW2H 3ZZ9A 4AG2A 4Y10E 1IHSH 5FCRA 4FUHA 5C3NA 4DIHH 1ZTKA 1O3KA 1LHCH 2ZTYA 5IDKA 1HDTH 1UTNA 4ZKSU 3AW1A 3ZVFA 3RM2H 4FVDA 2ZQ2A 1GVKB 1XVMA 2RDLA 2ANWA 4D7FA 1KIGH 3V0XA 2XCFA 2NU2E 4I31A 1AU8A 4DT7B 1QQ4A 1YYY1 3TJVA 1ETSH 2YNAA 2ZWLH 3FAOA 1GMCG 3KF2A 4AYVB 4K8YA 3TPIZ 1VCPA 3OY5U 4NA9H 1SI5H 4TPYA 4JZDH 2G4UA 3U1IB 3SV9A 3ZZDA 1OYQA 2ASUB 1N1LA 3BTHE 1ABJH 4LZ4B 3K2UA 2GV7A 3PMJA 1UJ1A 1XKBC 2A5AA 4KKDA 3A85A 2AGIX 1TMUH 1G9IE 2TGTA 1OXGA 1Y8TA 4KELA 5GJ4B 1IAUA 1GJBB 1NZQH 1U6QA 1FY3A 5F8ZA 1GHWH 3HK6B 1TNHA 4BAOB 5I46H 3A7VA 3O8CA 3VEQB 2A1DB 1AO5A 2KAIB 4X1RU 1HYLA 3BTGE 4CRDA 2ZDKA 1NTPA 1QURH 5A0AE 2P95A 3UOUA 2FOBA 1O34A 1FNIA 3BG4B 3A88A 1G37A 1JOUB 5H4IB 4GLYA 5C1YA 3F6UH 1Z1JA 2Y5HA 2F91A 1CHOF 3RMOH 3UY9A 4ABDA 4DGJA 2VH6A 2RG3A 2XWBI 3MO6A 4FU7A 1V2TT 4B74A 1O3GA 5FCKA 4YLQH 3UNRA 1TPPA 2WPJS 3UIRA 5L6NH 1MZDA 3DFLA 1O31A 2UUFB 1SVPA 4NA8A 1O5BB 4YT6H 1K1PA 1O2XA 1EPTB 1TYNA 3TGJE 1YPKH 5L2ZH 3FZZA 1WUNH 1IOEA 2BLWA 1FAKH 4OGYA 1MAYA 1BIOA 2H9EH 1GDNA 3HKIB 3MO9A 4MTBA 1BBRH 2UWLA 1TGNA 5EXNA 1ZRBA 3M3SA 1AKSB 3W95A 2JH5D 2UUKB 1NM6A 1C2FA 2OC0A 1EASA 1SGYE 1QBOA 3TNTA 2XCNA 1EXFA 1F5LA 3KEEA 4F4OC 1E36B 1RRKA 1EZQA 4AOQA 1S0RA 4ABGA 3KQEA 1HGTH 3RXMA 3UQVA 2WUBA 1KXFA 2C93B 3P70B 8KME2 3VB3A 4BOHA 4UDWH 2FYQA 2HNTC 4SGAE 5F6MA 1L1NA 3FANA 2QXGA 2ZNKH 2V0BA 1CU1A 2ZU1A 1HRTH 2BHGA 5CHAC 2XBXA 2CMYA 4AB8A 2SFAA 1UVUH 4YESB 1XXFA 1TGBA 1TNGA 1O0DH 3T27A 1GG6C 1TBRH 1ZPBA 3OTJE 1YPLH 1BJVA 1BDAA 3ATLA 1O3NA 1BB0B 3UOPA 3EYDA 3RDZA 3BEIB 1GGDB 2PFEA 1GHYH 1SGFA 1KLIH 1NRSH 2PGBB 1PYTD 4KTUA 3SU0A 3D23A 2A31A 2XC0A 3QZQA 4MPWA 3PB1E 2TPIZ 1HUTH 1A2CH 1HAHH 1QL7A 2QXIA 1P9SA 1YLCA 2AYWA 1BTYA 1PQAA 1GBMA 1TPSA 1V2MT 2D26C 3SI4H 1VJAU 3SU3A 2Z7FE 1NESE 3I29A 3ATMA 1P2IA 2DE8A 4MNXA 1O2GH 1HB0B 1GI6A 1O3DA 3RXRA 1ANEA 5JB8S 4BAMB 2VH0A 2ZDMA 3URDA 3DT0H 4NWLA 1O2SA 1TRNA 1GG6B 2AGGX 1PFXC 1TAWA 2ZFTA 3SV6A 1TQ0B 4Q7YA 1QNJA 4ZKOU 1F2SE 3MYWA 1ZHMA 1C1OA 1EZXC 1GHVH 1HAIH 3FP7E 1XUHA 1ARBA 3KHVA 1HXEH 2BZAA 5EQSA 2C8YB 2XYAA 2CF8H 1UTKA
chains in the Genus database with same CATH superfamily
1SGRE 2ZGBH 1K2I1 1NO9H 1BTZA 1QA0A 1BMFD 3AAUA 1VZQH 3PMBB 4CRBA 1MQ6A 1DE7H 3ZZCA 1AN1E 4OGXA 2WPHS 1G2LA 1YY3A 1KXAA 4DW2U 5AFZH 2FM2A 2PSYA 4MPVA 1MTUA 3A83A 3JZ1B 2JETC 4GPGA 4DVAU 5HGGA 2OC1A 2UUJB 4Y6DA 5E0HA 2D2DA 4B73A 2ZC9H 2CK3D 3W1EA 4BTTB 3RU4T 2LP6A 1Y3UA 2AHME 1XUGA 2VVCA 2VGCC 3DSPA 2H1UA 1LVOA 1ANDA 1W0KD 3MI4A 2VIPA 2XTTB 4AFSA 1AIXH 1OP0A 2W7SA 2GCTC 4YLUA 1TNJA 2BDGA 2FYRA 1W14U 1PQ8A 2XNDD 2BY8X 3VFEA 2BD2A 1ZYOA 1GHAG 3BTWE 2HRVA 1FIWA 5EW1H 2FO9A 1IQKA 4BNRA 3U8TH 4BANB 2FI3E 1RTKA 2QV1A 2FTLE 2BMGB 2LELA 1C5VA 1VITG 3MU4A 1C4U2 1YLDA 1V6DA 1KDQA 2ZFPH 2KCPA 2AEIH 1HV7A 1TNIA 1CT2E 3RC5A 9LPRA 1C5MD 2BVRH 2A5KA 1D3DB 3SV7A 1BBRE 1GMHG 2A4QA 2J9NA 1O3PB 2FOFA 4HZHA 4IMQA 1ZSLA 4NZLA 2ZGCA 3A8CA 3KYGA 5DP6A 1H8IH 1RJXB 2G5VA 3GICB 1GCTC 4B6EA 2CHAC 1GBTA 3KQCA 3SNEA 4GCHG 1WTGH 1ORFA 3E3TA 2V3OH 2ZHWH 2IPQX 1KXCA 1VITH 1HJ8A 4FVBA 3FVFB 4ZHAA 1ZOMA 1NRRH 5A0BA 1OPHB 3MU8A 2PLXA 3V13A 1H9IE 4KP0A 2ZU5A 3MHWU 1GJ4H 3LGYA 1QRZA 3PM3A 2OK5A 2GT7A 5IYTA 1G36A 2A5IA 1E38B 3PTBA 2F9VA 4F48B 1ESBA 2C90B 4I8LA 3PLBA 4VGCC 2EI6A 3URCA 3UNQA 4CH8B 1Q3XA 3GCTF 1CO7E 1FIZA 1MZAA 2SNVA 2NU4E 1BTXA 3BIUH 4JYVH 3F0OA 4OS4A 1UTQA 3VB7A 1IQNA 3DUXH 1HAVA 1FDPA 1Y5UT 1TA2A 1P02A 4X2VA 5T6GA 3ZV9A 1NFYA 2AFQB 2P94A 3OFND 5FPYA 1XUIA 4AB9A 1O37A 4JZ1A 5A8YA 2ZU4A 3FP8E 1LVMA 1T4VH 1WBGB 1S81A 2LNCA 3F2GA 4ZMAH 1YC0A 4CR5A 4MNVA 1Y59T 1TIOA 1XUKA 3RXSA 1EJMA 1DWEH 3GISB 4WMFA 4CRCA 8ESTE 1UCYK 1TLDA 3RLWH 4X6NA 5EPYA 1C5TA 4K1EA 4IC6A 2BVXH 4CHAC 2C8XB 4SGBE 2W26A 2PWXA 3E8LA 1OWEA 2GDDA 3A81A 1P3CA 6ESTA 3QN7A 2KZ4A 5DP9A 3F0PA 3LPRA 1O2MA 1UHBB 3U8RH 1JRTA 1P2QA 6LPRA 1IQMA 2EC9H 3D49H 1FY8E 1AVWA 1SGPE 3PWBA 1Z7KA 2TIOA 4ZHMU 2Z9IA 2PKSC 1YCPM 1EB2A 4A5TS 3VGCC 3GCTG 2AH4X 2GCHF 2QN5T 1C1WH 1BMLA 3NCLA 3LGVA 5EQRA 1UVTH 3TNSA 1BQYA 4ABBA 4MG3A 2THFB 1QRXA 4KTSA 3V12A 1G3DA 3RXCA 3RP2A 3F1SB 1O3JA 1TPOA 5GWZA 2K0QA 4AN7A 1NFUA 1N6YA 4AZ2B 2DE9A 2JDID 1MU6B 1J9CH 1SGEE 2CHAB 2QC2A 5JBTA 1LKAA 5J4SA 3MU5A 1KMHB 3SW2B 1KXDA 3K6YA 4LXBH 1TONA 5C67A 5EJ1A 4BAHB 1V2RT 5CHAB 2SGQE 3TITA 1GBFA 1O2JA 3DCLA 3H7OA 1YCPH 4JK5A 2BXTH 4B2CA 2WPIS 3LU9B 3U8OH 2K8IA 2GCHG 1O2RA 1BRCE 4DOQA 4UFEH 1V2JT 2F9NA 1DWDH 1MTVA 3L33A 1T4UH 1QFKH 1O3LA 1Z8RA 1DUEA 1HIAA 3ZVBA 1F0UA 3RMMH 3H7TA 2ZU2A 3ZZ3A 4XSKU 4DJZB 2CV3A 1HJAC 1QGFA 3SNAA 1YBWA 1ABIH 2QGRA 1ETRH 1ZJDA 2Q6GA 1A5HA 3F68H 1W7XH 1RXPA 3P8OA 5C1XA 3ZZ8A 4IN1A 1BHXB 4R0IA 3LGWA 2BY9X 3ESTA 2FI4E 1Z6JH 2HLCA 2GGVB 4ZKRU 2Q1JA 1AFEH 1GL1A 1V2OT 1P04A 1EZSC 3FO8D 2BLOA 3SJ8A 2YMSD 2BD8A 4ISNA 1CA8B 2XC4A 4MNWA 2FS9A 2ZG0H 2BDIA 4BTUB 4Y71A 1DOJA 5LPEA 5EG4A 1GI3A 1S6HA 1DANH 2YMSB 3G01A 4ACBA 2PSXA 1SQTA 2FXRA 5AVDA 4O97A 4NSVA 1D3TB 4I7YH 1PPZA 2J92A 3AASA 2BVSH 2ZDNA 1EAXA 1YPJH 1BRBE 1DY8A 1ZR0A 1S5SA 3SU6A 1EP6A 3F9FA 1C5OH 1K1IA 5J4QA 1SGDE 2ZTZA 1LPZB 1O2LA 4GVUA 4X8UH 1W12U 4ZAEA 5CMXH 3UQOA 1EAIA 4A6LA 1N8OC 2EEKA 1ZLRA 4Q63A 1SQOA 5E2PA 3QLPH 1G2MA 2IJOB 1W10U 2GP9B 1WOFA 1AZ8A 3RU4D 1P2KA 1DWCH 1QBVH 1VCWA 3MU1A 3CS0A 1O3FA 3PYHA 5T1VA 1W0YH 1SLWB 2WPDD 4ABEA 1O2UA 3LGTA 1ELGA 3N99A 2JETB 3NK8A 1S83A 2BY6X 3RXGA 1CBWB 4BAQB 2R2WU 1X7AC 2TBSA 1ELDE 3D62A 3OTPA 4ABJA 4AG1A 1MAXA 2J4IA 5IK2D 1HPGA 1O5GH 3HKJB 1H1BA 3SNDA 2G55A 1P2JA 2IN2A 1V2LT 1W11U 3MNSA 3EA8A 3MOCA 5A2MH 3ZZ5A 1PQ5A 2OXSA 2F9BH 1DPOA 2XBVA 1GWAA 3MTYA 3SUGA 4FUJA 3RXUA 2QXHA 1PQ7A 1TMBH 5SGAE 2ALVA 3O8RA 1GMCF 1HJAB 4FU9A 2SGEE 1C2IA 1TX7A 4Y8ZA 1O5AB 1UTPA 2PW8H 1GJ8B 1QB1A 1GBLA 2BY7X 2BDBA 1D3PB 3SBKA 2FODA 1A3BH 2PV9B 1N8OB 2G4TA 1HFDA 1XM1A 4ABAA 1YPMH 1PPFE 3LKWA 2EI8A 4ZH8A 2JH6D 3PV5A 1BRAA 1RIWC 3SUEA 1JIMA 5C0TA 7LPRA 1F5RA 1IQHA 3TLOA 3M35A 5PTPA 4DG4A 5EOKA 1P03A 1ZGVA 1V2KT 1AY6H 2QAAA 1DWBH 1BRUP 2FDAA 1QZ8A 2GTBA 2W6JD 2O8UA 4ZHLU 3VB5A 2ZHEH 4JMYA 3MH7A 3O8BA 3SGQE 1J8AA 1CBWC 2ILNA 2ZEBA 3KQDA 3NKKA 1WCZA 4VGCB 5FBEA 1BMAA 3RM0H 5CHBA 1C1NA 1GI8B 2QE7D 4Z1MD 1C5RA 2DUCA 4NWKA 5GNDA 3R0FA 1EQ9A 8LPRA 5T3HA 1O3BA 5EQQA 4ABIA 1D3QB 1OKXA 1UTMA 4NIYA 1NU7B 1PPGE 2CF9H 2WSSD 2ANYA 1P01A 1LCYA 1O35A 2QIQA 4NFEA 2JJ1D 4INHA 3ZVAA 3ZYEA 1QR3E 1Z6EA 1N6XA 1RD3B 2ZPSA 3MO3A 2RCEA 5TJXA 4JCNA 3A7ZA 3M7UA 1QA7A 3ZZ6A 4UEHH 3FKSD 3GOVB 1MCVA 1UTJA 4AFZA 1Y3YA 1GJ5H 3BTFE 1AVXA 4D9RA 2J94A 3GCHB 2OCVB 5EU8A 1SC8U 3Q77A 1ZHPA 1EFRD 2XC5A 1TMTH 1UMAH 3HATH 3RXJA 1WTHD 2ULLA 4I8KA 2ZKSA 3B9FH 3C1KA 1TX8A 1G30B 2ZHQH 2V35A 1OHHD 1UW7A 5TCAA 3UUZA 2CGAA 2PGQB 3ATWA 4D7GA 2IPHA 1FN8A 1ZPCA 5DP8A 5JB9S 5A0CA 4RN6A 1E79D 2KM0A 2ZCHP 1SBWA 1GJDB 2BXUH 4GAWA 3SV8A 4AFUA 1E37B 2J2UA 1L4ZA 3TU7H 2ZGHA 1ANCA 1V3XA 1GDUA 2ZU3A 3MH4A 3Q00A 4F55A 3FP6E 1P05A 1SHYA 4LZ1H 1A4WH 1G3CA 3SU1A 5EXLA 4RKJB 1J15A 2XBWA 3D65E 3PWCA 4Y11E 1Y3VA 1AFQB 2G00A 4E7RG 1HXFH 3BEUA 3L3TA 1Z71A 2LPRA 1IQFA 5C1UA 1P0SH 1A1RA 4X6MA 3IWMA 3ZVDA 1VITF 1J14A 4XE4A 4X1NU 1MTWA 5HM9A 4ABFA 5JBCS 2M5TA 2ANKH 2OC8A 4IBLH 5B6LA 5LPRA 2GVFA 4WXVA 1GBKA 4PROA 3QK1A 3GY2A 1MMJN 3TK5A 1SGTA 3A86A 2VWOA 3NXPA 4ISLA 2BQWB 4TY6A 4Z6AH 2FOMB 3A87A 5F03A 2R0KA 1CVWH 2GD4B 1EUFA 1SGCA 4YZUA 1IQGA 3ZZBA 5AHGH 1NROH 2FTMA 3N7OA 5E8EH 3C27B 3MMGA 4K60A 5T6FA 1A5IA 1F0TA 3A80A 3U69H 4H4FA 1XKAC 2BLQA 2QYIA 3K9XB 1O5CB 4MVNA 1ZMNA 1O3MA 3UB0A 1T7CA 2BDCA 3M5MA 2PTCE 3BN9A 1XUFA 2AMQA 4WXIA 1WAYB 3MU0A 1P9UA 3UREA 5GCHG 3RMNH 1KXBA 2FOGA 2TGDA 1Y5BT 1GHBF 3QO6A 1TOMH 4TY7A 1INCA 3QGNB 3CENA 1V2ST 3U9AH 1THSH 2VBCA 4OS6A 2EA3A 1E34B 1XUJA 1C5YB 3DSGA 4ZCNA 1LTOA 4FUFA 3SI3H 3MNCA 1O2VA 1FY5A 1AE8H 1ETTH 1GBJA 2HALA 3N7EA 1GBIA 3VB4A 1VR1H 2TRMA 1CA0C 4B2AA 4BAKB 1L1GA 2B9LA 2VIWA 4XOJA 1GI4A 2BYAX 2BD9A 3M5LA 2ZHFH 2OBQA 1C5ZB 1TRMA 3GYMA 1C2LA 1BT7A 3RXKA 3UWIA 1KTSB 7GCHF 3S7HB 3M5NA 1HBTH 1QRWA 3ODDA 2QXJA 4X6PA 3ZV8A 3FN8A 1P2OA 1SOZA 1TGSZ 3RXAA 1HAZB 1CGIE 1PYTC 3A8AA 1HAXB 4ACAA 2YMSC 4X2XA 3KYFA 4K1SA 1EOJA 2BLVA 2VIQA 2ZFFH 3HGPA 3VXEH 2F9PA 5F53A 3SZNA 1ESAA 3KNXA 1WDIA 2W7UA 3PRBA 1C5SA 1EJAA 2HWLB 3MH6A 3ZVGA 2FI5E 3LJJA 1SKYE 2WHXA 1QTFA 3SORA 2OBOA 1UK3A 1MQ5A 4FUDA 2P8OB 1LPGB 4FUIA 1OOKB 2ALPA 4THNH 3H5CB 5DP4A 1C1QA 4YT7H 1W13U 3T26A 1F0SA 1C2EA 3ZYDA 1DXWA 3SNBA 1WSSH 2FOAA 1XVOA 2H6MA 3MNXA 2F9UA 4YO9A 4KGAA 1SLVB 2P93A 2A7HA 3UNSA 4NFFA 3ZZAA 3TK6A 4FU8A 4YOJA 2FX4A 2Y7XA 3F9EA 1ELEE 1NY22 4X1PU 4Q7ZA 1THRH 1O2TA 4D8NA 4BXWA 1YCPK 1BHXF 3OSYA 3EA7A 2HNTE 2ZPQA 1O33A 1AI8H 1HAVB 4IGDA 5HXFA 4O3UA 4ZKNU 1SHHB 1C2MA 2Z9JA 3VPKA 3K65B 1MUEB 4QT8C 1W2KH 5AFYH 1VGCB 2KCYA 3MNBA 2RA0A 2BY5X 4RT1A 1O2YA 1FV9A 3RXIA 2Y5FA 1XMNB 1SGFG 1O3AA 5L2YH 1W0JD 3M3TA 5DO4H 3NZIA 1T8NA 2OTVA 1DVAH 2A4OA 1G3BA 2BTCE 1KLTA 3OX7U 3E16B 1JWTA 3OEHD 1UTLM 4MLFB 1GI9B 4ASUD 4DURA 3KN2A 1GHXH 5CDFE 3E6PH 1QJ1B 3L6PA 1PPHE 1PJPA 2VWLA 1ZPZA 1YLNA 1COWD 4FUEA 4JK6A 2O8LA 5I25A 3A89A 1NRPH 1QY6A 3EGKH 1AUTC 1FN6A 4WWYA 1GBAA 3GY4A 3BEFB 4H42U 3T25A 4CRFA 3UFAA 1ZGIA 1DX5M 1LVBA 2ZP0H 2Y5GA 3BTDE 2WPMS 2I6SA 1FI8A 2Y7ZA 4U01A 1JBUH 1ZJKA 3WW7A 1LDTT 2QA9E 2VJ1A 1KY9A 1ACBE 4UFDH 4U2WA 2GMTC 4DY7B 1S82A 2OQ5A 2R3YA 1TOCB 1GI1A 3PLPA 3TK9A 1MTSA 3SJIA 2J98B 3LONA 4X1SU 4NG9H 3F3BA 2R9PA 2PKAA 1DDJA 1WV7H 4CHAB 1KDQB 1MH0A 2IOTA 1P8VC 3MWIU 1GJCB 1TX6A 3A7XA 3LDXH 5DJ7A 3SHCH 1RIWB 1GPZA 2P3TB 1F5KU 4I33A 1SB1H 4E05H 4NIWA 2ZDVH 1B0EA 3FFGA 4I32A 5ESBA 4XBCA 4ISHH 1AKSA 1SGQE 2BQ7B 1O3HA 2QF3A 1FPHH 1YKTA 1BA8B 1ELAA 1BCUH 4CH2B 5C0UA 1GI0A 3F9GA 3ZVEA 5JDUB 1FAXA 2V7QD 1ZMLA 1VGCC 2B7DH 1A5GH 1O5FH 5B6OA 1QB6A 5FHTA 2W3KA 4I8GA 2OQUA 1GMDG 1GCTB 2FX6A 1NRQH 1E1RD 2ZGJA 1H9LB 4WMDA 1EKBB 1SL3A 1BJUA 2VIDA 4INKA 1O2ZA 1PPBH 4JZIA 3CS7A 4NIXA 1H8HD 2IJD1 3E0NB 3RU4E 1TBZH 2P3FH 1E0FD 1GDQA 1EZUC 2PTNA 2ZGXH 3GDSA 3A8DA 3T29A 4JYTA 4HGCA 2HLDD 2F83A 1J16A 2Y82A 1WYKA 1OWIA 1TGCA 1TWXB 1GJAB 1CT0E 4X8VH 3DA9B 4Y0ZE 2VGCB 2OUAA 4ABHA 2SGAA 1C1TA 4K3JA 2FLBH 1CA0B 3AVZA 1CGHA 5JPMH 2AIQA 4B76A 1DSTA 1FJSA 3P17H 5EGMA 1DXPA 2PUQH 5F8TA 2Z9GA 2HNTF 2FESH 3MH5A 3GY6A 5E0GA 2ODYB 3BIVH 2Y81A 1S0QA 2BD7A 3ZIAD 2ZDLA 1OX1A 3RXEA 2UUYA 2YNBA 2W3IA 1UHBA 4ZUHA 1C1SA 2FP7B 1IQIA 3PRDA 1NN6A 2FLRH 3SNCA 3EDXB 3DD2H 4X2WA 1NT1A 4CR9A 2SGFE 2EY4C 1GBEA 3LC5A 1GHZA 2XXLA 1DUAA 3KCGH 1C2GA 1ANBA 1LPKB 3BTEE 3BTQE 2G51A 6GCHF 2OD3B 4HG6A 3RXQA 1MKXK 4AORA 1DFPA 2VVUA 3H09A 4TWYA 1BTWA 1K1JA 4HFPB 2XBYA 1O2QA 2Z94A 3A84A 5LH8A 4P00A 3BF6H 3GDUA 3GS9A 4YM9A 1O2KA 1TNLA 3QTOH 6CHAB 2HVYB 2BD4A 3UTUH 4ZXXH 3NRLA 1O2NA 2HPQH 5FAHA 3VGCB 1QB9A 3M3VA 3A7TA 1FPCH 4XDEA 3ATIA 3UWJH 1HAOH 1UO6A 3LJOA 2ZIQH 1EX3A 5TCCA 3RXBA 4Z0KA 1C1PA 1NFWA 5GPIB 1O32A 1FY1A 4NGAH 5C5NA 2BOKA 1NS3A 2XNIA 3GY5A 2FOHA 1GJ9B 1K9OE 4K69A 3OAAD 1L2EA 1C9PA 1O2HA 3PV2A 3Q3YA 7ESTE 1C4V2 5BRRE 1MD7A 4UONA 4Y8YA 2V6NA 4AC9A 1SGNE 2J38A 3GYLB 3E0PB 2L74A 1A0LA 4IN2A 2ODPA 3PTNA 1KYNA 2PKAB 2Z3EA 1CQQA 2C8ZB 2P59A 1QIXB 1YPGH 4ZXYH 4ESTE 1T8LA 1UTOA 2KX4A 2EI7A 3LC3A 3S7KB 3M7TA 1C1MA 1KSNA 2A45B 1AQ7A 4U30A 3SQEE 2JJ2D 2VVVA 5A09A 1HNEE 1T31A 3U1JB 1UCYH 3OE7D 3RXTA 1C2JA 1VKYA 1UK4A 1O3OA 3GY8A 3BTTE 1GBDA 2OC7A 2PHBA 1EOLA 2HOBA 1LVYA 4UE7H 2YOLA 1O3CA 4GCHF 4CREA 4FXGH 1JMOH 2J5UA 2PKSB 3QZRA 1ELFA 2OLGA 2P16A 3WWBA 1LHFH 2P3UB 1A7SA 1ELVA 1OS8A 3ITIA 1BOQA 2ZPRA 2ZI2H 4ISOA 2Z6BD 2FWWA 3FOAA 1CHOG 1P09A 1C5WB 3HK3B 1OP8A 2VNTA 3KIDU 1GBCA 2ZTXA 1NU9A 1ZSJA 9ESTA 1WXRA 1SPJA 1OP2A 3KGPA 4TWWA 1WU1A 4H6TA 1O30A 3M36A 5GXPA 4MNYA 1BMMH 1SOTA 4WMEA 3LH3A 3PO1B 2P8OC 4LK4A 4TPIZ 2G5NA 1GHAF 5DN6D 2GCTB 1KLJH 3I77A 4XFQA 2O8WA 2FS8A 1ZSKA 4X0WU 3SU5A 4O03A 1QHRB 5EIYA 1AWFH 1HAPH 5DKMA 3U98H 1EATA 1MBQA 3PMHB 3BV9B 1UVSH 1B7XB 2AMPA 2STAE 5KGOA 1FONA 1THPB 4BXSA 1TQ7B 4X6OA 5FX5A 3SGAE 1GVLA 3M37A 1K22H 1L0ZA 4NZQA 1F0RA 3GY7A 1TALA 4ASHA 3MFJA 2GX4A 1SFIA 2BX3A 2ZCKP 3LGUA 3FZDA 1ELCA 1MD8A 3STJA 1ZRKA 3RXVA 2O8MA 5K0HA 1NBME 4WF8A 5KECA 1SR5C 1GVZA 3EE0B 1AWHB 2G52A 2ZECA 3BTKE 3W94A 1LHDH 1QJ7B 1H8DH 1LKBA 1XX9A 4DIIH 3DHKH 2B5TB 5DG6A 2BB4A 1O2WA 1C5PA 3SHAH 4FUGA 4GHQA 1HIAB 1Y3XA 3UR6A 3QX5H 1SGIB 2R2MB 3A82A 1DM4B 3TJOA 2SNWA 1M9UA 3ATKA 5ESTE 1AGJA 2WUCA 4WJG2 1S84A 1CGJE 1FUJA 4AGJA 1WQVH 2G81E 3SUDA 3E90B 3NPSA 7KMEH 1H9HE 3CP7A 1FMGA 2QCYA 3TJNA 1LQDB 3ELAH 1TFXA 4Y7AA 1IQJA 2M2AA 3PLKA 1UK2A 4X8SH 1O2OA 5LGOA 2VIVA 1ARCA 2WPLS 2WPKS 3M61U 1EJNA 2HGTH 2BDAA 2ZO3H 1C2HA 1KXEA 5E0JA 1HAGE 3UPEA 1NPMA 3RC6A 5FBIA 5FX6A 2XW9A 1VJ9U 1C5QA 4Y79A 2FMJA 3Q3KA 1QCPA 2ODQA 3QGJA 5DP7A 1S85A 2BOHB 1MKXH 1AMHA 1HCGA 2FOEA 2EQNA 3RXFA 1LHGH 2SGPE 3E91A 4B2BA 1SFQB 1CSOE 4B6FA 4YOGA 1O3IA 3ZVCA 4GHTA 2XWAA 1SMFE 4ZROA 4IW4E 3S9CA 2FEQH 1K21H 2WV5A 1T8MA 2BQ6B 2J34A 4GUXA 3GDVA 4A1TA 2FOCA 1RGQA 1C5NH 1W0ZU 1C9TA 2NWNA 2NU1E 2R0LA 3RXLA 2CJIA 3IG6B 1GHBG 1LHEH 4D9QA 1TABE 3A8BA 1ELTA 1PPEE 1GGDC 4P02A 1DICA 1QBNA 3LH1A 1T32A 2BZ6H 2STBE 4Y7BA 4NA7A 6CHAC 4WH8A 4CBOA 3SV2H 2Z9KA 2VB0A 1C1UH 5DP5A 5HM2A 2GZ8A 2ZQ1A 2H9HA 1A61H 1NFXA 1YPHE 2XRCA 3AAVA 5F8XA 1JRSA 5C20A 3LOXA 4NSYA 1PPCE 1A0JA 3TIUA 5FXLA 1NRNH 3T62A 1Q2WA 1H8ED 2O8TA 1JIRA 2R3UA 5GDSH 3AK5A 2FZZA 1HAYB 1ZTLA 3IITA 4YTAA 4XD7D 5DGJA 4CRAA 1YPEH 2UWPA 5FPTA 3V3MA 3ZZ7A 5C17A 1MABB 1F92A 2O9QA 1AB9B 3QTVH 3M5OA 5EPNA 2HPPH 4WVPE 4IMZA 4FUCA 1MKWH 2TGPZ 1C5LH 1GMDF 4F49A 3RXOA 1GI7B 1QQUA 3ZZ4A 1T8OA 2GZ7A 2OP9A 2KAIA 1EB1H 1JXPA 5E2OA 1MTNC 2D8WA 1CT4E 3SO3A 3WWFA 3PMAB 3AW0A 4HI3A 2PUXB 3OU0A 1V2PT 1ZTJA 3A7YA 5JBBS 3S9AA 1YP9A 3GY3A 2BDHA 3F2HA 3P6ZB 1O2IA 5DPAA 4Y76A 1OWJA 2Z9LA 1BZXE 1CHGA 3OY6U 3VG8A 2ZA5A 2QF0A 3MQKC 3M7QA 3LT3A 4RI0A 2VU8E 1AVGH 2FIRH 2BX4A 1Q31A 2Z3DA 1W8BH 5DP3A 1O38A 1IQLA 1BTHH 2WINI 4Y8XA 4ISIH 3V7TA 3PROA 2ZFRH 4K2YA 5GIBA 1EAUA 1OWDA 3VXFH 4DCDA 5C94A 1XXDA 2W6ID 2NU3E 4Y0YE 2GKVE 5HIYA 2GJGA 5DK1A 4X8TH 1WQSA 2BD5A 2Y6TA 4HTCH 3BG4C 3SJOA 1GI5A 3TVJB 1C1RA 1GMHF 5LPFA 1AE5A 1O39A 1GBBA 1K1LA 2J95A 4YXWD 2GMTB 5HIZA 2ESTE 1K1MA 4RT0A 3GCOA 5JBAS 1J17T 4IS5A 5ABWA 1P2MA 2A7CA 4O3TA 1TE0A 1A46H 1W3CA 1L1JA 2F4LA 5C2ZA 1TRYA 3LGIA 3T2NA 1Z1IA 2D1JA 1S6FA 2GZ9A 2A7JA 1TBQH 2ANMH 5HYOA 1MBMA 3S9BA 2Z3CA 1O36A 4OS1A 3STIA 2ZHDA 1F7ZA 2FPZA 2VWMA 3QWCH 2CN0H 3DFJA 4JZEH 1TNKA 1V2WT 2ZFQH 4J1YA 3RMLH 1IHTH 4A92A 1C1VH 1AUJA 1SQAA 2B8OH 2ZF0H 2CXVA 2AERH 4M7GA 4MQAA 1O5DH 2KR7A 4WH6A 1TA6A 3TGKE 2H2ZA 1IQEA 4KTCA 3P8GA 1C4Y2 1FQ3A 1SG8B 2GDEH 3ENSB 4Q80A 3RXHA 1H4WA 4O9VA 3R3GB 4XBDA 1DT2A 5BPEA 1SSXA 3BSQA 2AS9A 3K6ZA 2VIOA 1ELBA 1VCQA 4K8BA 3BTME 2A4RA 3TJUA 4TT3D 1RTLA 2VWNA 1D6WA 2NU0E 1GI2A 1Z8GA 3S69A 4AYYB 3QDZB 2ZZUH 3NUMA 1TPAE 1P57B 5EJZA 2JKHA 3KL6A 2A0QB 1O3EA 1G3EA 3O8DA 1FZZA 4Q2KA 1C2DA 3Q76A 3A7WA 1W7GH 1DS2E 4IC5A 1P06A 2B0FA 3EQ0H 3P92A 3RXPA 2JH0D 1FXYA 4GSOA 4D76A 1D4PB 3P8FA 2GV6A 3SU2A 3T5FH 1C2KA 4JZFH 2C8WB 2KFWA 1E35B 1FLEE 1GBHA 2WV4A 2XOKD 1FY4A 1UCYE 1O5EH 4I8JA 5GCHF 4NCYA 5G4BA 4UD9H 1EP5A 3PV4A 2QF5A 1OWHA 4A7IB 2W5EA 3HPTB 3LIWA 4TSFD 1BBRK 3BG8A 4E7NA 4RKOB 4UFFH 1K28D 1QL8A 1ID5H 1YGCH 4YOIA 5FL7D 3B23B 1ZHRA 5C5OA 1DY9A 4XBBA 8GCHF 4AGKA 1C5UA 3SJ9A 1B0FA 3SN8A 1EPTC 4A1XA 1AFQC 3KQBA 2L6OA 1RTFB 1HLTH 1UVPA 1BITA 1BMNH 3EA9A 3GCNA 3SU4A 1DITH 5EODA 3WY8A 5AF9H 2K1QA 3N7DA 1C5XB 2ZDAH 2TGAA 1Y5AT 2C4FH 6GCHG 1QJ6B 3RUOA 1KTTB 1OWKA 1LQEA 3T28A 3HGNA 2V3MA 1K1NA 4Q7XA 3TH3H 1EAWA 3DSOA 5EJLA 1V2UT 1LO6A 4K1TA 5T6DA 3RLYH 1MCTA 1V2VT 2A4GA 4OS7A 2A32A 2SGDE 4OS2A 1BTUA 3CNRA 1A3EH 4LOYH 1ESTA 4X1QU 1CE5A 2AMDA 2A2QH 1B5GH 4B71A 2H5CA 3S0NA 4J2YB 1Z8JB 1P2NA 1RFNA 1Z8IB 1AB9C 2BD3A 1GCDA 1DLKB 1UVOA 1YPHC 1ZZZA 1OYTH 5ETXA 1YF4A 5A8ZA 2WZQA 3F2FA 1V2NT 3E1XB 5JYIA 1S6LA 5HMAA 1P10A 1V2QT 8GCHG 4CRGA 1G32B 1P3EA 3UR9A 4A1VA 1P12E 1YM0A 1YWUA 4CBNA 3RXDA 3RC4A 1EPTA 4MPUA 4BTIB 3GCHC 1NC6A 1MU8B 3PO1C 3U28C 5K7RA 2V3HH 7GCHG 3P95A 4H6SB 3SYJA 1HJ9A 4AFQA 1BUIA 5FPSA 4XRNA 1D9IA 2RA3A 1AZZA 3F9HA 2G8TA 1QL9A 4X2YA 1P11E 2BDYA 3OEED 1AHTH 2VINA 1SLUB 2H5DA 3QUMP 4OS5A 5EXMA 4U32A 1GJ7B 4FUBA 2BM2A 1TB6H 1O2PA 3NWUA 4TYDA 5HKKD 3ODFA 5A8XA 4MPXA 2ZCLP 1K1OA 3TH4H 2F43B 3TGIE 4INLA 2HVXA 3B8JA 1MKWK 1Y3WA 4B75A 1MTNB 4AX9H 2ZFSA 1BTPA 4WY3A 5L30H 1A0HB 1TGTA 2WYGA 1D6RA 2F3CE 2PR3A 2UWOA 1GJ6A 2WYJA 4JYUH 2Q6DA 1LMWB 3SGBE 1AD8H 2C3SA 4UFGH 1ZMJA 3Q3XA 3EAJA 3P8NA 3SJKA 1DLEA 2OINA 4RSPA 2QY0B 4MDSA 2GT8A 1L4DA 2Y80A 2PP6A 5CE1A 4OM9A 3I78A 4I8HA 3OYPA 3VB6A 4K5ZA 1RS0A 2F9OA 3JZ2B 4R8TB 3TH2H 3SUFA 4E06H 1OSSA 2AGEX 1SLXB 2H9TH 2A2XH 4NIVA 1GL0E 1DSUA 2I6QA 4B1TA 3SQHE 2AIPA 2Q6FA 3SOSA 5EW2H 3ZZ9A 4AG2A 4Y10E 1IHSH 5FCRA 1FX0B 4FUHA 5C3NA 4DIHH 2J98A 1ZTKA 1O3KA 1LHCH 2ZTYA 5IDKA 3UAIC 1HDTH 1UTNA 4ZKSU 3AW1A 3ZVFA 3RM2H 4FVDA 2ZQ2A 1GVKB 1XVMA 2RDLA 2KCAA 2ANWA 4D7FA 1KIGH 1K0HA 3V0XA 2XCFA 2NU2E 4I31A 1AU8A 4DT7B 1QQ4A 1YYY1 3TJVA 1ETSH 2YNAA 2ZWLH 3FAOA 1GMCG 3KF2A 4AYVB 4K8YA 3TPIZ 1VCPA 3OY5U 4NA9H 1SI5H 4TPYA 4JZDH 2G4UA 3U1IB 3SV9A 3ZZDA 1OYQA 2ASUB 1N1LA 3BTHE 1ABJH 1SQRA 3K2UA 4LZ4B 2GV7A 3PMJA 3SZEA 1UJ1A 1XKBC 2A5AA 4KKDA 3A85A 2AGIX 1TMUH 1G9IE 2TGTA 1OXGA 1Y8TA 4KELA 5GJ4B 1IAUA 1GJBB 1NZQH 1U6QA 1FY3A 5F8ZA 1GHWH 3HK6B 1TNHA 4BAOB 5I46H 3A7VA 3O8CA 3VEQB 2A1DB 4M9FA 1AO5A 2KAIB 4X1RU 1HYLA 3BTGE 4CRDA 2ZDKA 1NTPA 1QURH 5A0AE 2P95A 3UOUA 2FOBA 1O34A 1FNIA 5DSFA 3BG4B 3A88A 2RDEA 1G37A 1JOUB 5H4IB 4GLYA 5C1YA 3F6UH 1Z1JA 2Y5HA 2F91A 1CHOF 3RMOH 3UY9A 4ABDA 4DGJA 2VH6A 2RG3A 2XWBI 3MO6A 4FU7A 1V2TT 4B74A 1O3GA 5FCKA 4YLQH 3UNRA 1TPPA 2WPJS 3UIRA 5L6NH 2WV9A 1MZDA 3DFLA 1O31A 2UUFB 1SVPA 4NA8A 1O5BB 4YT6H 1K1PA 1O2XA 1EPTB 1TYNA 3TGJE 1YPKH 5L2ZH 3FZZA 1WUNH 1IOEA 2BLWA 1FAKH 4OGYA 1MAYA 1BIOA 2H9EH 1GDNA 3HKIB 3MO9A 4MTBA 1BBRH 4I86A 2UWLA 1TGNA 5EXNA 1ZRBA 3M3SA 1AKSB 1NBMD 2JH5D 2UUKB 3W95A 1NM6A 1C2FA 2OC0A 2RFKC 1EASA 1SGYE 1QBOA 3TNTA 2XCNA 1EXFA 1F5LA 3KEEA 4F4OC 1E36B 1RRKA 1EZQA 4AOQA 1S0RA 4ABGA 3KQEA 1HGTH 3RXMA 3UQVA 2WUBA 1KXFA 2C93B 3P70B 8KME2 3VB3A 4BOHA 4UDWH 2FYQA 2HNTC 4SGAE 5F6MA 1L1NA 3FANA 2QXGA 2ZNKH 2V0BA 1CU1A 2ZU1A 1HRTH 2BHGA 5CHAC 2XBXA 2CMYA 4AB8A 2SFAA 1UVUH 4YESB 1XXFA 1TGBA 1TNGA 1O0DH 3T27A 1GG6C 1TBRH 1ZPBA 3OTJE 1YPLH 1BJVA 2JIZD 1BDAA 3ATLA 1O3NA 1BB0B 3UOPA 3EYDA 3RDZA 3BEIB 1GGDB 2PFEA 1GHYH 1SGFA 1KLIH 1NRSH 2PGBB 4DT4A 1PYTD 4KTUA 3SU0A 3D23A 2A31A 2XC0A 3QZQA 4MPWA 3PB1E 2TPIZ 1HUTH 1A2CH 1HAHH 1QL7A 2QXIA 1P9SA 2J97A 1YLCA 2AYWA 1BTYA 1PQAA 1GBMA 1TPSA 1V2MT 2D26C 3SI4H 1VJAU 3SU3A 2Z7FE 1NESE 4FOUC 3I29A 3EE7A 3ATMA 1P2IA 2DE8A 5KEDA 4MNXA 1O2GH 2KCOA 1HB0B 1GI6A 1O3DA 4Q4LA 3RXRA 1ANEA 5JB8S 2QF4A 4FETA 4BAMB 2VH0A 2ZDMA 3URDA 3DT0H 4NWLA 1O2SA 1TRNA 1GG6B 2AGGX 1PFXC 1E1QD 1TAWA 2ZFTA 3SV6A 1TQ0B 4Q7YA 1QNJA 4ZKOU 1F2SE 3MYWA 1ZHMA 1C1OA 1EZXC 1GHVH 1HAIH 3FP7E 1XUHA 3KQ5A 1ARBA 3KHVA 1HXEH 2BZAA 5EQSA 2C8YB 2XYAA 2CF8H 1UTKA
chains in the Genus database with same CATH topology
1SGRE 2ZGBH 1K2I1 1NO9H 1BTZA 1QA0A 3AAUA 1VZQH 3PMBB 4CRBA 1MQ6A 1DE7H 3ZZCA 1AN1E 4OGXA 2WPHS 1G2LA 1KXAA 4DW2U 5AFZH 2FM2A 2PSYA 4MPVA 1MTUA 3A83A 3JZ1B 2JETC 4GPGA 4DVAU 5HGGA 2OC1A 2UUJB 4Y6DA 5E0HA 2D2DA 4B73A 2ZC9H 4BTTB 3RU4T 1Y3UA 1XUGA 2VVCA 2VGCC 2H1UA 1LVOA 1ANDA 3MI4A 2VIPA 2XTTB 4AFSA 1AIXH 1OP0A 2W7SA 2GCTC 4YLUA 1TNJA 2BDGA 2FYRA 1W14U 1PQ8A 2BY8X 3VFEA 2BD2A 1ZYOA 1GHAG 3BTWE 2HRVA 1FIWA 5EW1H 2FO9A 1IQKA 4BNRA 3U8TH 4BANB 2FI3E 1RTKA 2QV1A 2FTLE 2BMGB 1C5VA 1VITG 3MU4A 1C4U2 1YLDA 1V6DA 1KDQA 2ZFPH 2AEIH 1HV7A 1TNIA 1CT2E 3RC5A 9LPRA 1C5MD 2BVRH 2A5KA 1D3DB 3SV7A 1BBRE 1GMHG 2A4QA 2J9NA 1O3PB 2FOFA 4HZHA 4IMQA 1ZSLA 4NZLA 2ZGCA 3A8CA 5DP6A 1H8IH 1RJXB 2G5VA 3GICB 1GCTC 2CHAC 1GBTA 3KQCA 3SNEA 4GCHG 1WTGH 1ORFA 3E3TA 2V3OH 2ZHWH 1KXCA 1VITH 1HJ8A 4FVBA 3FVFB 4ZHAA 1ZOMA 1NRRH 5A0BA 1OPHB 3MU8A 2PLXA 3V13A 1H9IE 4KP0A 2ZU5A 3MHWU 1GJ4H 3LGYA 1QRZA 3PM3A 2GT7A 5IYTA 1G36A 2A5IA 1E38B 3PTBA 2F9VA 1ESBA 2C90B 4I8LA 3PLBA 4VGCC 2EI6A 3URCA 3UNQA 4CH8B 1Q3XA 3GCTF 1CO7E 1FIZA 1MZAA 2SNVA 2NU4E 1BTXA 3BIUH 4JYVH 4OS4A 1UTQA 3VB7A 1IQNA 3DUXH 1HAVA 1FDPA 1Y5UT 1TA2A 1P02A 4X2VA 5T6GA 3ZV9A 1NFYA 2AFQB 2P94A 5FPYA 1XUIA 4AB9A 1O37A 4JZ1A 5A8YA 2ZU4A 3FP8E 1LVMA 1T4VH 1WBGB 1S81A 2LNCA 4ZMAH 1YC0A 4CR5A 4MNVA 1Y59T 1TIOA 1XUKA 3RXSA 1EJMA 1DWEH 3GISB 4WMFA 4CRCA 8ESTE 1UCYK 1TLDA 3RLWH 4X6NA 5EPYA 1C5TA 4K1EA 4IC6A 2BVXH 4CHAC 2C8XB 4SGBE 2W26A 2PWXA 3E8LA 1OWEA 2GDDA 3A81A 1P3CA 6ESTA 3QN7A 5DP9A 3LPRA 1O2MA 1UHBB 3U8RH 1JRTA 1P2QA 6LPRA 1IQMA 2EC9H 3D49H 1FY8E 1AVWA 1SGPE 3PWBA 1Z7KA 2TIOA 4ZHMU 2Z9IA 2PKSC 1YCPM 1EB2A 4A5TS 3VGCC 3GCTG 2AH4X 2GCHF 2QN5T 1C1WH 1BMLA 3NCLA 3LGVA 5EQRA 1UVTH 3TNSA 1BQYA 4ABBA 4MG3A 2THFB 1QRXA 4KTSA 3V12A 1G3DA 3RXCA 3RP2A 3F1SB 1O3JA 1TPOA 5GWZA 4AN7A 1NFUA 1N6YA 4AZ2B 2DE9A 1MU6B 1J9CH 1SGEE 2CHAB 2QC2A 5JBTA 1LKAA 5J4SA 3MU5A 3SW2B 1KXDA 3K6YA 4LXBH 1TONA 5C67A 4BAHB 1V2RT 5CHAB 2SGQE 3TITA 1GBFA 1O2JA 3H7OA 1YCPH 4JK5A 2BXTH 4B2CA 2WPIS 3LU9B 3U8OH 2GCHG 1O2RA 1BRCE 4DOQA 4UFEH 1V2JT 2F9NA 1DWDH 1MTVA 3L33A 1T4UH 1QFKH 1O3LA 1Z8RA 1DUEA 1HIAA 3ZVBA 1F0UA 3RMMH 3H7TA 2ZU2A 3ZZ3A 4XSKU 4DJZB 2CV3A 1HJAC 1QGFA 3SNAA 1YBWA 1ABIH 2QGRA 1ETRH 1ZJDA 2Q6GA 1A5HA 3F68H 1W7XH 1RXPA 3P8OA 5C1XA 3ZZ8A 4IN1A 1BHXB 4R0IA 3LGWA 2BY9X 3ESTA 2FI4E 1Z6JH 2HLCA 2GGVB 4ZKRU 2Q1JA 1AFEH 1GL1A 1V2OT 1P04A 1EZSC 2BLOA 3SJ8A 2BD8A 4ISNA 1CA8B 2XC4A 4MNWA 2FS9A 2ZG0H 2BDIA 4BTUB 4Y71A 1DOJA 5LPEA 5EG4A 1GI3A 1S6HA 1DANH 3G01A 2PSXA 1SQTA 2FXRA 5AVDA 4O97A 4NSVA 1D3TB 4I7YH 1PPZA 2J92A 3AASA 2BVSH 2ZDNA 1EAXA 1YPJH 1BRBE 1DY8A 1ZR0A 1S5SA 3SU6A 1EP6A 3F9FA 1C5OH 1K1IA 5J4QA 1SGDE 2ZTZA 1LPZB 1O2LA 4GVUA 4X8UH 1W12U 4ZAEA 5CMXH 3UQOA 1EAIA 4A6LA 1N8OC 2EEKA 1ZLRA 1SQOA 5E2PA 3QLPH 1G2MA 2IJOB 1W10U 2GP9B 1WOFA 1AZ8A 3RU4D 1P2KA 1DWCH 1QBVH 1VCWA 3MU1A 3CS0A 1O3FA 3PYHA 1W0YH 1SLWB 4ABEA 1O2UA 3LGTA 1ELGA 2JETB 3NK8A 1S83A 2BY6X 3RXGA 1CBWB 4BAQB 2R2WU 1X7AC 2TBSA 1ELDE 3D62A 4ABJA 4AG1A 1MAXA 2J4IA 1HPGA 1O5GH 3HKJB 1H1BA 3SNDA 2G55A 1P2JA 2IN2A 1V2LT 1W11U 3MNSA 3EA8A 3MOCA 5A2MH 3ZZ5A 1PQ5A 2OXSA 2F9BH 1DPOA 2XBVA 1GWAA 3MTYA 3SUGA 4FUJA 3RXUA 2QXHA 1PQ7A 1TMBH 5SGAE 2ALVA 3O8RA 1GMCF 1HJAB 4FU9A 2SGEE 1C2IA 1TX7A 4Y8ZA 1O5AB 1UTPA 2PW8H 1GJ8B 1QB1A 1GBLA 2BY7X 2BDBA 1D3PB 3SBKA 2FODA 1A3BH 2PV9B 1N8OB 2G4TA 1HFDA 1XM1A 4ABAA 1YPMH 1PPFE 3LKWA 2EI8A 4ZH8A 2JH6D 1BRAA 1RIWC 3SUEA 1JIMA 7LPRA 1F5RA 1IQHA 3TLOA 3M35A 5PTPA 4DG4A 5EOKA 1P03A 1ZGVA 1V2KT 1AY6H 2QAAA 1DWBH 1BRUP 2FDAA 2GTBA 2O8UA 4ZHLU 3VB5A 2ZHEH 4JMYA 3MH7A 3O8BA 3SGQE 1J8AA 1CBWC 2ILNA 2ZEBA 3KQDA 3NKKA 1WCZA 4VGCB 5FBEA 1BMAA 3RM0H 1C1NA 1GI8B 1C5RA 2DUCA 4NWKA 3R0FA 1EQ9A 8LPRA 5T3HA 1O3BA 5EQQA 4ABIA 1D3QB 1OKXA 1UTMA 4NIYA 1NU7B 1PPGE 2CF9H 2ANYA 1P01A 1LCYA 1O35A 2QIQA 4NFEA 4INHA 3ZVAA 3ZYEA 1QR3E 1Z6EA 1N6XA 1RD3B 2ZPSA 3MO3A 2RCEA 5TJXA 4JCNA 3A7ZA 3M7UA 1QA7A 3ZZ6A 4UEHH 3GOVB 4AFZA 1MCVA 1UTJA 1Y3YA 1GJ5H 3BTFE 1AVXA 4D9RA 2J94A 3GCHB 2OCVB 5EU8A 1SC8U 3Q77A 1ZHPA 2XC5A 1TMTH 1UMAH 3HATH 3RXJA 1WTHD 2ULLA 4I8KA 2ZKSA 3B9FH 3C1KA 1TX8A 1G30B 2ZHQH 2V35A 5TCAA 3UUZA 2CGAA 2PGQB 3ATWA 4D7GA 2IPHA 1FN8A 1ZPCA 5DP8A 5JB9S 5A0CA 4RN6A 2ZCHP 1SBWA 1GJDB 2BXUH 4GAWA 3SV8A 4AFUA 1E37B 2J2UA 1L4ZA 3TU7H 2ZGHA 1ANCA 1V3XA 1GDUA 2ZU3A 3MH4A 3Q00A 3FP6E 1P05A 1SHYA 4LZ1H 1A4WH 1G3CA 3SU1A 5EXLA 4RKJB 1J15A 2XBWA 3D65E 3PWCA 4Y11E 1Y3VA 1AFQB 2G00A 4E7RG 1HXFH 3BEUA 3L3TA 1Z71A 2LPRA 1IQFA 5C1UA 1P0SH 1A1RA 4X6MA 3IWMA 3ZVDA 1VITF 1J14A 4XE4A 4X1NU 1MTWA 5HM9A 4ABFA 5JBCS 2M5TA 2ANKH 2OC8A 4IBLH 5LPRA 2GVFA 4WXVA 1GBKA 4PROA 3QK1A 3GY2A 1MMJN 3TK5A 1SGTA 3A86A 2VWOA 3NXPA 4ISLA 2BQWB 4TY6A 4Z6AH 2FOMB 3A87A 5F03A 2R0KA 1CVWH 2GD4B 1EUFA 1SGCA 4YZUA 1IQGA 3ZZBA 5AHGH 1NROH 2FTMA 3N7OA 5E8EH 3C27B 3MMGA 4K60A 5T6FA 1A5IA 1F0TA 3A80A 3U69H 4H4FA 1XKAC 2BLQA 2QYIA 3K9XB 1O5CB 4MVNA 1ZMNA 1O3MA 1T7CA 2BDCA 3M5MA 2PTCE 3BN9A 1XUFA 2AMQA 4WXIA 1WAYB 3MU0A 1P9UA 3UREA 5GCHG 3RMNH 1KXBA 2FOGA 2TGDA 1Y5BT 1GHBF 3QO6A 1TOMH 4TY7A 1INCA 3QGNB 3CENA 1V2ST 3U9AH 1THSH 4OS6A 2EA3A 1E34B 1XUJA 1C5YB 1LTOA 4FUFA 3SI3H 3MNCA 1O2VA 1FY5A 1AE8H 1ETTH 1GBJA 2HALA 1GBIA 3VB4A 1VR1H 2TRMA 1CA0C 4B2AA 4BAKB 1L1GA 2B9LA 2VIWA 4XOJA 1GI4A 2BYAX 2BD9A 3M5LA 2ZHFH 1C5ZB 1TRMA 2OBQA 3GYMA 1C2LA 1BT7A 3RXKA 3UWIA 1KTSB 7GCHF 3S7HB 3M5NA 1HBTH 1QRWA 3ODDA 2QXJA 4X6PA 3ZV8A 1P2OA 1SOZA 1TGSZ 3RXAA 1HAZB 1CGIE 1PYTC 3A8AA 1HAXB 4X2XA 4K1SA 1EOJA 2BLVA 2VIQA 2ZFFH 3HGPA 3VXEH 2F9PA 3SZNA 1ESAA 3KNXA 2W7UA 1C5SA 1EJAA 2HWLB 3MH6A 3ZVGA 2FI5E 3LJJA 1QTFA 3SORA 2OBOA 1UK3A 1MQ5A 4FUDA 2P8OB 1LPGB 4FUIA 1OOKB 2ALPA 4THNH 3H5CB 5DP4A 1C1QA 4YT7H 1W13U 3T26A 1F0SA 1C2EA 3ZYDA 1DXWA 3SNBA 1WSSH 2FOAA 1XVOA 2H6MA 3MNXA 2F9UA 4YO9A 4KGAA 1SLVB 2P93A 2A7HA 3UNSA 4NFFA 3ZZAA 3TK6A 4FU8A 4YOJA 2FX4A 2Y7XA 3F9EA 1ELEE 1NY22 4X1PU 4Q7ZA 1THRH 1O2TA 4D8NA 4BXWA 1YCPK 1BHXF 3OSYA 3EA7A 2HNTE 2ZPQA 1O33A 1AI8H 1HAVB 4IGDA 5HXFA 4O3UA 4ZKNU 1SHHB 1C2MA 2Z9JA 3VPKA 3K65B 1MUEB 4QT8C 1W2KH 5AFYH 1VGCB 3MNBA 2RA0A 2BY5X 1O2YA 1FV9A 3RXIA 2Y5FA 1XMNB 1SGFG 1O3AA 5L2YH 3M3TA 5DO4H 3NZIA 1T8NA 2OTVA 1DVAH 2A4OA 1G3BA 2BTCE 1KLTA 3OX7U 3E16B 1JWTA 1UTLM 4MLFB 1GI9B 4DURA 3KN2A 1GHXH 3E6PH 1QJ1B 3L6PA 1PPHE 1PJPA 2VWLA 1ZPZA 4FUEA 4JK6A 2O8LA 5I25A 3A89A 1NRPH 1QY6A 3EGKH 1AUTC 1FN6A 4WWYA 1GBAA 3GY4A 3BEFB 4H42U 3T25A 4CRFA 3UFAA 1ZGIA 1DX5M 1LVBA 2ZP0H 2Y5GA 3BTDE 2WPMS 2I6SA 1FI8A 2Y7ZA 4U01A 1JBUH 1ZJKA 1LDTT 2QA9E 2VJ1A 1KY9A 1ACBE 4UFDH 4U2WA 2GMTC 4DY7B 1S82A 2OQ5A 2R3YA 1TOCB 1GI1A 3PLPA 3TK9A 1MTSA 3SJIA 3LONA 4X1SU 4NG9H 2R9PA 2PKAA 1DDJA 1WV7H 4CHAB 1KDQB 1MH0A 2IOTA 1P8VC 3MWIU 1GJCB 1TX6A 3A7XA 3LDXH 5DJ7A 3SHCH 1RIWB 1GPZA 2P3TB 1F5KU 4I33A 1SB1H 4E05H 4NIWA 2ZDVH 1B0EA 3FFGA 4I32A 5ESBA 4XBCA 4ISHH 1AKSA 1SGQE 2BQ7B 1O3HA 2QF3A 1FPHH 1YKTA 1BA8B 1ELAA 1BCUH 4CH2B 1GI0A 3F9GA 3ZVEA 5JDUB 1FAXA 1ZMLA 1VGCC 2B7DH 1A5GH 1O5FH 5B6OA 1QB6A 5FHTA 2W3KA 4I8GA 2OQUA 1GMDG 1GCTB 1NRQH 2FX6A 2ZGJA 1H9LB 4WMDA 1EKBB 1SL3A 2VIDA 1BJUA 4INKA 1O2ZA 1PPBH 4JZIA 3CS7A 4NIXA 3E0NB 3RU4E 1TBZH 2P3FH 1E0FD 1GDQA 1EZUC 2PTNA 2ZGXH 3GDSA 3A8DA 3T29A 4JYTA 4HGCA 2F83A 1J16A 2Y82A 1WYKA 1OWIA 1TGCA 1TWXB 1GJAB 1CT0E 4X8VH 3DA9B 4Y0ZE 2VGCB 2OUAA 4ABHA 2SGAA 1C1TA 4K3JA 2FLBH 1CA0B 3AVZA 1CGHA 5JPMH 2AIQA 4B76A 1DSTA 1FJSA 3P17H 5EGMA 1DXPA 2PUQH 5F8TA 2Z9GA 2HNTF 2FESH 3MH5A 3GY6A 5E0GA 2ODYB 3BIVH 2Y81A 1S0QA 2BD7A 2ZDLA 1OX1A 3RXEA 2UUYA 2YNBA 2W3IA 1UHBA 4ZUHA 1C1SA 2FP7B 1IQIA 1NN6A 2FLRH 3SNCA 3EDXB 3DD2H 4X2WA 1NT1A 4CR9A 2SGFE 1GBEA 3LC5A 1GHZA 2XXLA 1DUAA 3KCGH 1C2GA 1ANBA 1LPKB 3BTEE 3BTQE 2G51A 6GCHF 2OD3B 3RXQA 1MKXK 4AORA 2VVUA 1DFPA 4TWYA 1BTWA 1K1JA 4HFPB 2XBYA 1O2QA 2Z94A 3A84A 5LH8A 3BF6H 3GDUA 4YM9A 1O2KA 1TNLA 3QTOH 6CHAB 2BD4A 3UTUH 4ZXXH 1O2NA 2HPQH 5FAHA 3VGCB 1QB9A 3M3VA 3A7TA 1FPCH 4XDEA 3ATIA 3UWJH 1HAOH 1UO6A 3LJOA 2ZIQH 1EX3A 5TCCA 3RXBA 4Z0KA 1C1PA 1NFWA 5GPIB 1O32A 1FY1A 4NGAH 5C5NA 2BOKA 1NS3A 2XNIA 3GY5A 2FOHA 1GJ9B 1K9OE 4K69A 1L2EA 1C9PA 1O2HA 3Q3YA