2HNYA

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
534
structure length
522
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 140
structure length 522
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnyA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnyA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnyA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnyA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hnyA05
1EKEA 1KFSA 4Z4IA 4RNMA 3EZUA 1WNSA 5C42A 3OVNA 1SH2A 3NGDA 2B5JA 3BQ2A 1RTHA 4J9KA 1S9GA 1SKRA 1C1AA 4E1NA 3NL0A 3QGHA 3M8PA 5KFZA 4IDKA 5KFYA 4ZHRA 4GW6A 4NCGB 3SCXA 2O4IA 4XO0A 3BR9A 4IH6A 1RTJA 3IAYA 3N6NA 2BQUA 4CJUA 2D3ZA 3LPTA 5F8HA 4RNOA 4OKEA 3DOLB 3AO1A 4IFVB 4DSFA 2XY5A 1TL1A 4CFBA 2F8TA 1DTQB 2QV6A 4TY9A 4KV8B 4M3ZA 4B9SA 4CEQA 1Z25A 3TARA 4IG3A 4URQU 2Q3SA 4R5PB 4IOBA 3AV9A 4K4UA 3H59A 3QGIA 4DL4A 4EYHB 1WNEA 3DLEB 4ZVFA 4RNHA 4W5QA 5KFBA 4JUZA 3QLHB 3MEEB 3VA3A 3PO4A 2ZD1B 4Y2AA 1XR5A 4R8UB 1KVBA 3OYGA 4Z4HA 3NH0A 1X1PA 3V4IB 1JLQB 4B9TA 1FKOB 4DTNA 3CFRA 4NCGA 3ALYA 2XY6A 4WE1B 4FYDA 2YNHB 3KLFA 3NGZA 3DOLA 4IFVA 3SQ4A 3I0SB 1TGOA 4NYFA 1DTQA 4ZVGA 4KV8A 3AVLA 1QAIA 5F8NA 3GYNA 3VQSA 3DI6B 3CDEA 5EUHA 5DGBA 5DK5A 4Z4CA 2BR0A 5DG8A 5HP1B 4R5PA 3S3NA 3WNFA 3PW7A 4RW6B 2A1SA 3MR2A 3DLEA 5KG5A 3HHKA 5FRMA 4O3QA 2YKMB 4GC6A 3QLHA 1LWCB 3MEEA 4KAIA 2ZD1A 4R8UA 1ASVA 2P5GA 4NLXA 2KW4A 1DLOA 4Q43A 3CJ4A 2OZMA 2I5JB 1W9HA 1QSLA 2VWJA 4K4WA 1JXBA 4LSNB 2RDIA 4WE1A 1CZBA 4KO0B 4JV1A 1TP7A 3PVXA 2YNHA 1RCHA 1I6JA 2IA6A 4ECTA 4DS4A 2FVCA 2XRIA 3HM9A 4AILC 3DI6A 3NF6A 1VSLA 2GBZA 3DLRA 2FVPA 3NH1A 4F8RA 3BSAA 2QXFA 3V9ZA 1WAJA 1JLCB 2YKMA 2IJNA 1LWCA 4CK2A 3K5OA 2HVIA 3DMJB 4ED8A 1NOYA 1U47A 4X2BA 1RBRA 5KG1A 5F9LA 2D5RA 3AO3A 5I42B 2BRKA 2I5JA 4O3RA 1B9DA 4LSNA 4JV0A 2ETJA 1C0TA 3CQ8A 3NHGA 3PX4A 3RTVA 4DLGA 3SQ2A 1S9FA 4BDYA 4KTWA 3TVKA 3AA4A 3KLGB 4URSA 4RW7B 5KFOA 3BSNA 1RT4A 2ILZA 2J6UA 3DRSB 2V9WA 2KFZA 3D5MA 4IR9A 2E9ZA 5DLGA 1A5VA 1QAJA 2AX1A 1C0MA 3PO5A 5F9NA 1ZETA 3V1RA 2QKBA 3RR7A 2AJQA 3UIQA 1U09A 3DMJA 3UPFA 4CCHA 4KREA 1TL3A 3QEPA 1QHTA 3RBDA 4YR3A 5I42A 1MMLA 4FJIA 1REVB 3B6PA 4N5SA 3OJSA 1NK8A 4W5RA 2YKNB 2R8IA 4B3OB 5KGWA 1VRTB 3PX6A 4DQPA 1KSPA 3HPHA 1EP4A 4TYAA 2OYQA 3VQPA 4BDZA 1GOAA 3BSOA 1J5OA 4KRFA 1C2PA 1Z26A 3SNNA 2HW3A 3KLGA 4WFYA 4RW7A 2OH2A 2IC3B 4FJ5A 3H5SA 3DRSA 2YNIB 3PHEA 1ZBLA 3K58A 4DTJA 3RMBA 5KRSA 4FLYA 1UAXA 2OPQB 2CJQA 2C2RA 3T5KA 3K5LA 4DSIA 3ZSOA 5L1IA 1KLMB 4FXDA 1HQEB 5KG6A 1QSSA 1IKYB 3G6XA 2D0BA 3TANA 2D3UA 4W5NA 3QNOA 3IRXB 2VA3A 3NBPB 4FM0A 3HP9A 4QCLA 3LP0B 1REVA 4CJKA 4RW8A 4B9NA 4FJGA 2YKNA 4AHCA 4B3OA 1VRTA 3H40A 1NK0A 2PYLA 1IH7A 1RBVA 4O3OA 1RDAA 4ED1A 3KIOA 2FBVA 3AVAA 1VSHA 4CJPA 1O1WA 4Q44A 1TK5A 2FVQA 2P5OA 2XO7A 2IC3A 3I0RA 3DOKB 4N76A 1RT6B 4PY5A 4C8KA 1S10A 4FJ7A 4DMNA 4CHNA 2E6MA 3AVJA 4FS2A 1JKHB 1KLMA 4AHSA 1TKTB 1HQEA 2BQ3A 1NKEA 3HXMA 5HRRA 3PR5B 4RU9A 3RRHA 3VQ7A 3RR8A 4M3TA 3T1AA 2UVRA 2E9TA 4FJ8A 1SH3A 2JC0A 3QZ8A 4K4VA 3P5JA 3OJUA 4CEEA 2G8UA 3LP0A 3KMSA 2JEIA 3LALA 4KB1A 1I39A 2KQ2A 4E0DA 4CE9A 3GIJA 4TN2A 3OYNA 4MFBB 3G10A 4ED2A 4U6PA 3QIDA 4TQRA 4AH9A 3DOKA 4CHYA 2GIRA 5KTQA 3HVRA 1RT6A 1S4FA 4NLVA 3K57A 2OZSA 4K8XA 3MTKA 2W8LA 4CJ4A 2D41A 3V6DB 2VG5B 4LQ9A 4ELUA 3SQ1A 1JKHA 3HL8A 4YQWA 1TKTA 4FLTA 3V9WA 4WZMA 2V4RA 2R8HA 1BQNB 1X9MA 2WHOA 2X74A 1NKCA 2BE2B 3TI0A 5KFPA 4TLRA 4GVMA 3CM5A 3OS1A 2BANA 3M8RA 3H4DA 2HVHA 3RB4A 1XR7A 3CJ5A 3TAEA 1TVRB 1FXXA 3PX0A 2IM3A 4B9LA 1ZBHA 3LAKA 2OPSB 4J9QA 3OHAA 4MFBA 1JLEB 3K2PA 4QWAA 4TY8B 2O4GA 2W9AA 3I5CA 5J1EB 4DG1B 4CFDA 3DRPB 3ZCMA 3NF7A 4E7JA 2VG6B 1N4LA 2WB4A 3SPZA 4OPKA 4DS5A 2VG5A 1U04A 4JRPA 3E01B 3GIMA 3ZSZA 3CO9A 3KLHB 4DTMA 2RN2A 4KHSA 1BQNA 4EP5A 3LAMA 1RTIB 2BE2A 1QSYA 4O3NA 3KD1E 4EO8A 4J2AA 4RNFA 3QESA 4ELTA 1S1XB 3KHGA 1L3UA 4DWIA 4ZVHA 2HHSA 4E7LA 1UOCA 3S3MA 1TVRA 3SI6A 1XWLA 3IGNA 4DL6A 2KZZA 2W9BB 3EYZA 1T94A 4FBTA 3H5XA 5J2QA 1S0OA 2ALZA 1U4BA 1IKWB 2OPSA 1SL1A 4N41A 5C42B 5KFWA 3A2FA 3TAGA 1L3TA 1JLEA 4FCYA 4TY8A 5T7BA 3MR3A 5HRPA 4DU3A 1TV6B 2C2EA 3KD5E 5J1EA 3O4QA 5L1KA 4CK3A 1ZYQA 3DRPA 4QWEA 2IAJB 3VQCA 4CF9A 3FQKA 3KK2B 1S6PB 1Y97A 4EP4A 3OYBA 1RYRA 3OLAA 3NF8A 4C8MA 1RTJB 3MXMA 4M94A 2G8FA 5KG7A 3AVMA 1RTIA 4DFMA 3VQBA 4CEFA 3K5NA 4DLEA 1S1XA 1NJWA 3CIZA 4ECYA 3WNGA 3PW2A 4CJVA 3V1OA 2I1RA 4DTXA 4CGIA 3OYCA 1UA0A 1BQMB 2W9BA 3GV5B 4Y34A 4M3RA 1IKWA 4I2PA 4JRQA 3F9KA 2PZSA 4KHQA 2D0AA 3D28A 2R8GA 3U3YA 3WNHA 3CFPA 3OL9A 3BDPA 4AHUA 2JEFA 3SPYA 3M9NB 1TV6A 4YFUA 3LP2B 3TQ1A 4Y1CA 1RT2B 4B9UA 2IAJA 3OYFA 3KK2A 1S6PA 3ZT1A 4KHWA 2UVWA 5D3GA 4Z4EA 4ED0A 1WLJA 3RWUA 5JXSA 4I9LA 3I8DA 4DU4A 3KLFB 1N48A 3KK3B 1FK9B 5F8GA 4R0EA 4OL8A 3OL8A 4H8KA 2E6LA 5HRSA 2J6TA 1B9FA 2E4LA 2HHUA 4F3TA 4FJKA 3Q8SB 1OS5A 4F4XA 4BE1A 5KFNA 1BQMA 2AGOA 4WXWA 4HUGA 1KTQA 1XI1A 1VSDA 3T3FA 4JS5A 1UA1A 3KKSA 3KTQA 3OYKA 2HWHA 5KFKA 4FK4A 2RPIA 3SQ0A 3H98A 3CFOA 5T14A 4KSEB 4FBUA 3LP2A 4NRTA 5EWEA 1RT2A 1BIUA 1DLOB 1RT7B 1ZTWA 3LDSA 4BACA 2E9RX 3SV4A 3VQAA 4CHOA 4CGFA 4DSEA 2XC9A 3MR5A 2HNYB 4F4KA 3KK3A 1FK9A 2Z1GA 4NLDA 5F8JA 4TQSA 5HRNA 5FROA 4OJRA 3HVTA 3KMQA 3F73A 1R0AB 1RBUA 4IBNA 4Z4GA 5KT7A 3KHHA 2XHBA 4EO6A 2FJVA 2FVRA 3LWLA 2FVSA 4G3IA 3OYEA 4F4ZA 4DL2A 3U3GA 1RT7A 1TQLA 4MK7A 3KJVA 3VN5A 1ASWA 3HVAA 2XI3A 2HMIB 4QWBA 5KI6A 2FBYA 1T05B 1C0TB 4F2SA 4HTUA 2HNYA 3QIPA 2PY5A 5KFRA 3QETA 1VSMA 4M3UA 4WXOA 4PQUA 4YR2A 3AVIA 2HWIA 4W5OA 4GC7A 1LAWA 4E89A 1NHVA 2G8KA 3NAHA 5F8MA 2XY7A 4RUCA 4M42A 1RT4B 3DLHA 5SWMA 1TKZA 2P51A 2DFHA 1R0AA 1A5WA 5HBMB 4OGCA 3SZ2A 4KHMA 1CXQA 3QERA 1VK0A 4NLQA 4QWCA 1C6VA 3AVBA 4CESA 4CJ3A 3FFIB 2DFFA 2BRLA 3NAIA 3CYMA 1ZTTA 2RDJA 3L2RA 4DF4A 1TL3B 1KVAA 5J2PB 3KK1B 4RNNA 5KG3A 4YNQA 3CDWA 3QINA 3ZSXA 2HMIA 2CKWA 1S49A 1T05A 4EZ6A 4TYBA 2FLNA 4WFZA 2XGPA 2JEGA 4NLWA 3SUQA 1EP4B 3AA3A 4F50A 1J5OB 5L1JA 3NFAA 4QW9A 4CGDA 1N5YB 1JIHA 4DL5A 2G8HA 4H4MB 2XWYA 5HBMA 3AA2A 1BI4B 2HB5A 5KG4A 1RNHA 4ZPBA 5KFXA 1KRPA 2ZE2A 3AO2A 1NK9A 3FFIA 4FVMA 3SV3A 3Q8PB 4KHNA 2P1JA 1IM4A 4L8RB 1ZBIA 2R8JA 4ZP9A 2FJWA 4YP3A 2R2RA 2HHQA 3HPOA 2D7SA 2Y1IA 3KK1A 5J2PA 3HVWA 3V6KA 3ZSYA 2VG7B 5KFEA 1RILA 5KG0A 1BIZA 3S9HA 4O4GB 2W7PA 5KFFA 3HSTB 4C8NA 4RW8B 3BGRA 3L2QA 2Y1JA 1WSGA 3L2WA 1JLGA 2AU0A 1KHWA 2ASDA 4DF8A 3PUFA 1QTMA 2ATQA 2FJXA 4J2BA 4Q0BB 4URGA 1N5YA 2GUIA 3DDKA 3I0RB 4H4MA 4F3OA 4QOZB 4NLGA 1BI4A 3C6TB 4ECRA 4DL3A 3MECB 2ASLA 3JYTB 1C1BB 5F8IA 3B6OA 2XCPA 3HKWA 3HP6A 3NH2A 3CM6A 3QEVA 4O4RA 1IKXB 3PV8A 2VG7A 5KFQA 3ICLA 4O4GA 1XHZA 4CEOA 4KPYA 4DU1A 4NLPA 4DTSA 4K4YA 1S1UB 4DFPA 4IRCA 2Z1IA 3O3HA 2KTQA 3L8BA 2X6SA 5E41A 2RKIA 4IQXA 1JLFA 4Q0BA 1Q9XA 2IDOA 3DLGB 1GX6A 4ECSA 3Q8QB 2Z1HA 3T5LA 2G8IA 2C2DA 3C6TA 2V4QA 1T7PA 2C28A 1GX5A 3LWMA 3MECA 3BQ1A 1D0EA 3VQ6A 5KFGA 3JYTA 4JS4A 1C1BA 3BQ0A 2IM0A 4ID5B 4B9MA 4CIEA 4OLBA 3EY1A 3KLIB 4DEZA 2WOMB 3BSCA 5FDLB 1IKXA 1NHUA 3G0ZA 3VQ9A 4J9NA 3LZIA 4O0IA 3ISND 2C22A 2BANB 3KLVA 4KBIA 2HHXA 3PW4A 3O4NA 1S1UA 3OYMA 4NLYA 1YTUA 3S3OA 4ZTJA 3N6MA 4CF8A 3HT3A 3TAMB 4J9SA 4FJNA 3H5YA 3NGIA 3DLGA 3ITHB 4CIFA 4FJJA 3AVFA 4CJSA 3H5UA 5DLFA 5C24B 2IBKA 2QE5A 3N6LA 4HVJA 3SUPA 4PWDB 4ID5A 4IG0A 3GV8B 4KHUA 3DLBA 4AHRA 3KLIA 4FJHA 4HUFA 4PUOB 4MIBA 2WOMA 2WRMA 3QNNA 5FDLA 4CJTA 2IM2A 5DQIA 4KB7A 3VQDA 3FSIA 1S48A 3SI8A 1S6QB 3KOAA 4DSKA 1RA7A 4CGHA 3IN5A 4ID1A 4ZP7A 2YHBA 4RUAA 4B9VA 5KT4A 3KHLA 3KNAA 4ZP6A 4Q45A 3NGYA 5J2QB 1KFDA 3EZ5A 3OS2A 3TAMA 4BDPA 1RDCA 2HHTA 3MFHA 2UUTA 1J9AA 2BDPA 4NLOA 4FK0A 3ITHA 4CJEA 5KG2A 3KLEB 5C24A 2J6SA 2DPJA 5DMRA 3QO9B 4WZQA 4KE5A 2WCXA 4CJ5A 2B4JA 1Q8IA 3M8QB 4J2DA 4PWDA 3OLBA 5KGXA 3OY9A 2W9CB 3NCIA 4QWDA 4FJMA 1XHXA 4JV2A 4PUOA 4FJXA 3AO4A 1K1QA 3OYAA 3GQCA 3AVGA 4CEZA 1NK6A 1C0UB 4IH7A 3NDKA 3RMAA 1S6QA 2R7YA 2R2TA 1RBTA 4ELVA 4Y3CA 1S0NA 2PYJA 1EX4A 1HYSA 4FZXC 3P1GA 1S5JA 3NMAA 2G8WA 3D0PA 4I2PB 3K5MA 1RT5B 5C5JA 1IG9A 3M9MB 4J9MA 4E7IA 3QGGA 1GOBA 3TAPA 4FZYA 3PW5A 3KLEA 3PJXA 1Q9YA 3GIIA 1WSEA 3QO9A 4J9RA 4E3SA 3CG7A 3M8QA 5CYMB 2ILYA 3T5JA 5D3GB 2W9CA 3KKRA 4DQQA 3RMCA 1W25A 2AX0A 2JGUA 5FRNA 4LSLB 4IR1A 3CJ3A 1BL3A 2X6NA 1C0UA 1BHLA 3VQ5A 4ICLB 3CJ0A 3I5AA 4OGEA 4ZPCA 5J2NA 2YV0X 1RBSA 2YHAA 4HUEA 1D1UA 1RT5A 3UDLA 3IG1A 3NKYA 4ECXA 4CK1A 1EETB 3LP3A 2IS3A 4ZPAA 3SYZA 4LH5A 1RA6A 1BGXT 3SFGA 4FW2A 3V9XA 3CJ2A 4BWJA 2UUWA 1N56A 4M3WA 4LY7A 1JXLA 4E1MA 4M3YA 4CJRA 1LWFB 4WFXA 2ASJA 3QIOA 4DTRA 2LSNA 2IOCA 5CYMA 3OYDA 3GIKA 3P83D 3OYLA 4C8OA 4O55A 1BCMA 1U49A 3CWJA 1QE1B 1I3AA 3ZSRA 3SJJA 5J2MB 4LSLA 3FRZA 2EX3A 4FJLA 1T8EA 3HVTB 4EZ9A 4ICLA 2NUBA 5EWFA 1IKVB 3SUOA 3L3UA 4WYLA 4ECZA 2WK4A 5L9XA 4M45A 4AHTA 1S1WB 1RT1B 4O5BA 1NKBA 4ZMMA 1EETA 1KCFA 2KZMA 2F96A 4DQSA 4NZ0A 4KFBB 4CIGA 5KT6A 2FBTA 4CERA 3SFUA 3Q8RB 1T03A 4ECUA 4Q8FA 3RBEA 4I9QA 2UVVA 4OVLA 1ASUA 3C95A 1HYZA 4FK2A 4FLVA 1LWFA 3HK2A 3KJVB 3AVCA 1VSIA 5CZ1A 4EBDA 4RG8A 3L3VA 4EBEA 4OLAA 4GMJB 4NLRA 3QIPB 1MU2B 2GC8A 3PJWA 4CJWA 4ZPDA 1QE1A 4PQUB 5K14B 4KHRA 3K59A 5J2MA 4Q8EA 1N6QB 1HNIB 1HPZB 2HNDB 1RAJA 1JL1A 1KVCA 1J54A 4Y2CA 1IKVA 1TKZB 4U7CA 2DPIA 3ZSQA 1S1WA 1RT1A 4N56A 4RW9B 4NYNA 4ECWA 4RZRA 3VQ4A 4N47A 1NJYA 4J9PA 1FKPB 4KFBA 2VA2A 5KFUA 1L3VA 3DYAB 4IRKA 4CEBA 1NNDA 1TK8A 4FS1A 3PR4A 1SUQB 2EC0A 2W7OA 3JSMB 3G6YA 3RAXA 4OKJA 5KFVA 1SL0A 4Z4FA 4J9OA 4NLTA 2OPPB 1NJZA 1K1SA 3LZJA 3OHBA 4K50A 2B6AB 1MU2A 3H4BA 3O3GA 5K14A 3V4IA 1JLQA 4O0JA 1N6QA 5EWGA 1HNIA 1FKOA 1HPZA 2HNDA 4KTZA 4KTQA 3HO1A 1D9FA 2YNGB 3AA5X 4RW9A 4EEYA 2ZE2B 2BQRA 4LH4A 3I0SA 3ZSVA 4FM2A 1LAVA 1FKPA 4FLXA 3OL6A 1TAQA 1D8YA 3OSNA 4KI6A 1VSFA 3AVHA 3DYAA 2G8VA 3V6JA 1JX4A 1U48A 5DG9A 1D9DA 2EHGA 3DM2B 1SUQA 3L2UA 3MXJA 3JSMA 3L2VA 5HP1A 4CJQA 4O3PA 4O44B 3QYYA 4RW6A 2OPPA 3ZT3A 3BGRB 2R2UA 4B08A 3UQSA 3EPIA 1RTDB 2B6AA 3H2LA 1YVFA 4UQGA 3QEIA 1JLGB 2D0CA 2QK9A 4FW1A 4F2RA 4I7FB 3D45A 2W42A 2VWKA 2FLLA 4I2QB 4CFCA 4K4XA 4Z0UA 4NRUA 1WSIA 1RYSA 5KFCA 1X9WA 3VQ8A 4H54A 4KO0A 3V81B 2FC0A 1SV5B 4AHVA 2YNGA 4MKBA 3OYHA 3C94A 4CEDA 1KHVA 4MKAA 1RDBA 4FZZA 3V9SA 1D5AA 4NYZA 3THVA 2AGQA 1G15A 1T3NA 4CHPA 4Q5VA 1WAFA 1YT3A 2KFNA 3GV7B 3DM2A 2ZQBA 1KLNA 4KAZA 2AWZA 1LW2B 3FQLA 1YTAA 4O44A 5JS2A 4ECVA 2HHWA 1GOCA 4DSLA 4E19A 4CF2A 1TKDA 4K8ZA 1JLCA 1BISA 1RTDA 4W5TA 1TK0A 1EXQA 3AVKA 4CJFA 3CVKA 4CGGA 4I7FA 3MEGB 1WSFA 4I2QA 2RKIB 1SH0A 1S9EB 1JLFB 4CJLA 4TSXA 1SL2A 3OL7A 2QKKA 3TAFA 4NLSA 4CEAA 3V81A 1SV5A 3IS9B 1XR6A 5DG7A 1HYVA 1JLAB 2FBXA 1VRUB 3E51A 2R2SA 5KFDA 4FM1A 1S97A 2JEJA 2WONB 5CYQB 5KFSA 3T5HA 3TWHA 4DSJA 1ITGA 3G86A 3PY8A 3FDSA 4MK9A 5KRTA 4H4OB 4YMEA 4J2EA 1LW2A 1J53A 2GV9A 4B8AB 3ASMA 4HKQA 4ED7A 3LP1B 4ZTFA 1Z4UA 1XC9A 1QUVA 1DTTB 2W8KA 2IMWP 2OA8A 3H08A 3MEGA 1C1CB 4DTUA 1X9SA 5SZTA 1S9EA 2X78A 3V1QA 3QEXA 2IM1A 4CECA 4IKAA 2BGGA 4EYIB 2YNFB 3IS9A 4HCCA 4NCBA 4MIAA 1JLAA 4XIUA 1VRUA 2DY4A 4HYKA 4PA1A 1LWEB 2AGPA 2XGQA 4F4WA 5KT5A 3ZT0A 4IG0B 2DFEA 2XY8A 4B8CA 2WONA 5CYQA 1F21A 3OYJA 1WSHA 5JUMA 4IH5A 2ATLA 1VSEA 4FLUA 4FLWA 1JLBB 1NK5A 4H4OA 4MK8A 2YNIA 5KFTA 1L3SA 4OKKA 4WYWA 2OPQA 3MR6A 3ZT2A 4K4ZA 3LP1A 5L1LA 3G6VA 1CSJA 3OYIA 1DTTA 1IKYA 2Z1JA 3IRXA 3NBPA 1C1CA 3MEDB 4F4YA 1S0MA 4EBCA 5HROB 3RB0A 3V9UA 4XPEA 4IKFA 3UR0A 4M3XA 3BJYA 3GILA 4MH8A 1UWBB 3M9OB 1CXUA 1S1TB 3I5BA 5KFHA 2YNFA 5KFIA 4ED6A 1CZ9A 4DQIA 1LWEA 1RT3B 3RB3A 4G1QB 1U45A 5DQGA 3MXIA 3OS0A 4LQ3A 1JL2A 3IGVA 3TAQA 5CY4A 4CF0A 3ULDA 1NJXA 4DTPA 4FLZA 3M8SA 5CZ2A 3TABA 3C6UB 1TKXB 3NAEA 1K6YA 4QW8A 1JLBA 3MAQA 1HMVB 2O5DA 4DFJA 4K4SA 1SKSA 1LW0B 4E7KA 2ZKUA 1NK7A 1S1VB 2GIQA 3ZSWA 5C25B 1ZBUA 4IFYB 1HYSB 1YVUA 4K4TA 3AO5A 1HQUB 2A1RA 1TAUA 1HNVB 4CFAA 1WN7A 4DFKA 3PW0A 3MFIA 4ED3A 3ISNC 3MEDA 5HROA 4BWMA 4HCBA 3DLKB 2JLEA 4KKOB 4DTOA 2OPRB 1UWBA 4J9LA 1S1TA 1L5UA 5I3UB 4BE0A 3O3FA 1VSJA 1RT3A 5HLFB 3V6HA 4G1QA 2RF2B 2XCAA 2DTUA 3U6FA 4FJ9A 4MQ3A 3DRRB 4O3SA 1W0HA 4LD0A 4DQRA 3C6UA 3AVNA 1TKXA 3VQEA 2WTFA 2FLPA 3KHRA 1HMVA 1CLQA 3WNEA 1LV5A 1HJRA 3OSPA 3ZT4A 4KI4A 1LW0A 2F8SA 3V6DA 4KHYA 3EPGA 4JLHA 1S1VA 1NOZA 5C25A 4IFYA 5F8LA 1HQUA 1VSKA 1HNVA 2HNZB 3HPGA 5J2NB 2UVUA 4QPXA 1QQCA 2V0NA 5KFAA 3IG1B 5KFMA 3VA0A 2JC1A 3CDUA 4OPJA 3NE6A 4CHZA 5JS1A 3DLKA 4KKOA 4BE2A 4RW4B 2OPRA 2B43A 3HJFA 1NK4A 5DQHA 1RDRA 1QS4A 1A5XA 4ECQA 5I3UA 5KFJA 3RMDA 1SKWA 1BCOA 4TXSA 3HYFA 5HLFA 1HRHA 2RF2A 4KB0A 4E7HA 3VQQA 3DRRA 5KT2A 2B5JB 1RTHB 5KT3A 3BREA 4YR0A 3MF5A 1RDDA 4M41A 1S9GB 2F8EX 3RAQA 2R8KA 3TR8A 2HHVA 3M8PB 4DG1A 4QAGA 4NCAA 2AQ4A 5EU7A 3RB6A 4IDKB 1HARA 4NLUA 2VG6A 4CGJA 4ZHRB 3QEWA 3QZ7A 2HAIA 4IRDA 3E01A 3LPUA 3RRGA 3KLHA 2HNZA 3SUNA 4C8LA 5DGAA 2XI2A 5EDWA 4CF1A 1TL1B 1JXEA 4M95A 4XPCA 2ITGA 1WSJA 5KFLA 1B92A 3T19A 3NF9A 4Y1DA 4CHQA 1ZBFA 2IGIA 4HHTA 3PZPA 1IO2A 1T03B 4RW4A 4ZVEA 4ZP8A 4IG3B 2IJFA 4DL7A 3LANA
chains in the Genus database with same CATH superfamily
2HF4A 1KFSA 1S7IA 3CJKB 1U1QA 1SH2A 4K41A 1JCEA 2B5JA 4J9KA 3KNGA 1C1AA 1BWVA 2YHWA 3UVJA 1KR4A 4YOTA 3T7ZA 2VDHA 4FWQA 4DCHA 4NCGB 2XMVA 4Q2MA 5L8RC 3BN7A 2ZH7A 3IAYA 1XTZA 3LPTA 4EUVA 4DSFA 1VQLS 1TL1A 2QV6A 3C15B 4M3ZA 2DXDA 4B9SA 1NMNA 1Q95G 3MM6B 1H72C 3JTNA 4FWSA 3QGIA 1WNEA 4RNHA 5BR8J 2ASMA 4W5QA 5EN1A 3DOMB 5D0EA 5KFBA 3MEEB 2M3DA 3PO4A 4OLPA 4QQBA 4Z4HA 4B9TA 2QLFB 4NMLA 3CCJN 1SB6A 3V5RA 2W24A 2OEKA 4P7TA 3CQYA 4ZKAA 4JYAJ 4P72A 2VB6A 3KLFA 1VYAA 3ISZA 1IUJA 3DOLA 4IFVA 2H5IB 3VV2B 1TGOA 2D0OA 4ZVGA 1I94K 2K1RA 3CCWA 1N33F 5DGBA 4DKWA 3KWMA 4XEIA 1MWKA 4R5PA 3M7VA 4ZLLA 2DNNA 3MR2A 3DLEA 3BF3A 2HBYB 4DV3J 4FYVB 1NNEA 3MM5B 2KW4A 4Q43A 5CHIA 2OFHX 2I5JB 4KHPJ 3WBZA 3ZETA 4LSNB 1OH7A 2V69A 2MGZB 3Q2TC 4CJ7A 1LFPA 2QA2A 2NYIA 5BREA 5F0XA 4CLPA 4DS4A 1XEZA 2DKOB 3I8BA 2C2NA 2RRNA 4M7XA 9RUBA 2LEPA 5E3PA 2A0FB 1VOMA 4JAXA 4ZCIA 4RBTA 3DLRA 1NGGA 4F8RA 2RRBA 4CZEA 4KR0B 3A12A 3LW5C 1WAJA 5B09A 4JI7J 1JJCB 3SCKE 1M5SA 4DR1J 1V3ZA 3UKUB 1LWCA 4YORA 3A5OC 1NOYA 1U6BA 1HWLA 1JJHA 5HJXA 1VBYA 1AYEA 1NH8A 5HL7Q 4Y6IA 2P9UB 3I87A 1B9DA 2ETJA 4X62K 4BG8A 1C0TA 5HOOA 1Q0NA 3PX4A 3NHGA 2FGCA 4QU6A 4DLGA 3SQ2A 4BDYA 1U2VB 1WHWA 4DX6A 4X4PA 1ZBTA 3C46A 1IWGA 3GG1A 2QWRA 4RW7B 5KFOA 4FWPA 3BSNA 2M2BA 3OUYB 3NCPA 1RT4A 5DDRC 3IWLA 2KFZA 5DLGA 3E66A 2C1EB 2ZH6A 3PSIA 2AX1A 3Q0AA 4CTAA 3V1RA 4F02A 2FZGB 4DR5F 1OMSA 1A7GE 3DMJA 4CCHA 1TL3A 4OZLA 3QFWA 1UVNA 4BC4A 2KLAA 4E1JA 3BUZB 5I42A 2RMLA 3VAJA 1REVB 3GB0A 1RAIB 4PEOA 2QLBB 2DGTA 3MD3A 1W7WA 2YWHA 3HPHA 4ERDA 2OYQA 2D74B 2QL5B 3AOAA 1C2PA 3KLGA 4LVNP 4WFYA 1LXJA 1YIJN 3JB9k 3ZLJA 5DDOC 3DRSA 3ETMA 4OX9F 1ZBLA 1EZZB 2VD3A 3K58A 3RMBA 4ZN1A 1KOOA 5C2GA 4OYIA 1UW4A 5E7OB 2J9CA 4DSIA 5BPLA 2JOQA 1KLMB 4FXDA 1KDNA 2YXLA 3PTWA 4W5NA 2D3UA 1CJUB 4OI4A 1H98A 3NBPB 4XTTA 2VHGA 2UXDK 4QCLA 2EFPA 5CYJA 4RW8A 2L41A 1K73O 4B9NA 3DWLA 4AHCA 3FBCA 3NLCA 2EFVA 4BG9A 4B3TK 2JVOA 5L39A 4YDDB 5GADU 1KTVA 4ED1A 1VSHA 1NJIO 2FVQA 2P5OA 4CZJA 1XMBA 1W2IA 2KM8C 4H5VA 1SQEA 3TW0A 3RYLA 4YY3J 4CBWA 1S10A 4FJ7A 4CHNA 1R7IA 3L4QA 2MZQA 3NP5A 4AHSA 1TUGB 1HQEA 5HMWA 3HXMA 3ILOA 4RU9A 2HZCA 1MA9B 4NLCA 1X0FA 1BWEA 4NXNK 4FJ8A 2OP5A 1SH3A 2FIUA 4K4VA 3IFEA 4CEEA 3LP0A 1NM2A 3KMSA 4M5KA 2XS7A 3ETOA 1FO1A 2PA3A 2BUPA 1X4AA 3QT7A 4TN2A 4MFBB 4GKJJ 3TX0A 3RVCA 1KBRA 1D9AA 3M1FA 4U6PA 3MXHP 3DOKA 2OTJS 2YJFA 3RSEB 1FDBA 2OZSA 4NLBA 1W2BM 2W8LA 4CJ4A 2D41A 3BO4A 3M8WA 2OSRA 4OX6A 4ELUA 3ENQA 1JKHA 2Z8QA 4YQWA 2XMKA 3NXZA 4WZMA 4CT8A 1GXLA 1HNWK 1ZA2B 3D7EO 2M8DB 3ET6B 3IM9A 2AYBA 2HHHK 4WCEQ 1UW9A 3H45C 3PCOB 3VVUA 3JXUA 3PKMA 3UWTA 2BJDA 3PX0A 1J2VA 1XNQJ 2R7OA 5L38A 2XMTA 2Z4PA 4DV3F 4J9QA 3M6UA 3VGMA 3OFHA 1JLEB 4QWAA 1Q82T 4W4MA 1S7HA 3FZBA 2NR0A 4B1XB 3NF7A 3CCMN 3O9SA 3M5RA 2F9WA 1N4LA 2LU2A 3OTOF 4DS5A 4F9OA 3CD6N 5GAHI 1U04A 1I3OB 4JHDB 1VQMS 3O8MA 4KHSA 2LQ8A 4C3KA 3DGPB 5LMUK 1RTIB 2BE2A 2VFVA 1N34J 1YWXA 1QSYA 2IRXA 4EO8A 2XMWA 2GW8A 2W01A 4LF4J 4ZVHA 2HHSA 3M1VA 3PIOQ 4E7LA 4JI8K 3FSYA 3UB5A 3SI6A 1XN9A 1XWLA 4JI2J 4YB7A 3EYZA 4ETXA 3QT6A 1S0OA 1SL1A 4U67L 2C2ZB 5KFWA 3P4IA 3NGTA 2KN4A 3GOIA 2VGNA 5T7BA 3MR3A 3VAMA 3CC2S 3G4SN 2ATCB 2BE9B 4GKKK 5L1KA 4YOXA 4RCHA 1VQNS 3NS7B 2NRRA 3BEXA 4CF9A 4PZVA 1GMWD 3MCOA 4H5NA 5AQNA 1BD6A 4ID8A 4DZDA 5CCLA 1N0UA 1FX2A 4MKVA 2YWGA 2CNOB 1HPMA 3D1QA 4MDBA 5BPNA 2C42A 2RS8A 4CLZA 3PFEA 4GMKA 4A48A 1YHQS 2W9BA 4Y34A 4M3RA 4BRIA 1F5CA 4JRQA 2PZSA 2R8GA 2VYPA 3I4PA 5FLXU 2HQCA 1FEHA 3W7BA 3OL9A 4OHYA 1TV6A 8RUCA 1BMQB 4QS8A 2OKQA 3TQ1A 2YX1A 2EKNA 3OYFA 4DHVA 5E26A 3KK2A 1S6PA 3ZT1A 1QQNA 4DR6J 2UVWA 1TUWA 4Z4EA 4ED0A 4QR2A 3IXQA 5F8GA 4M5LA 1I94F 1OYDA 3CF5Q 4OL8A 4DV4J 4H8KA 2P9NA 2Z2MA 1B9FA 2E4LA 2HHUA 4F3TA 4FJKA 4BE1A 2XSJB 1BQMA 5IT9U 2M4MA 3E3XA 4WXWA 3BEGB 1CQNA 5GAHP 4FPIA 1KTQA 1XI1A 3T3FA 1AFIA 5IOLA 3KKSA 3DXMA 1M5VC 5KFKA 4FK4A 2OO4A 3E9OA 2MQMA 1HBNA 4J91A 5EWEA 4PPDA 1BIUA 1DLOB 3VAFA 4ZVSB 4EI2A 4M5JA 1ACMB 2YPYA 2HK2A 2JX2A 1FK9A 1VQ4N 1WKLA 4BRFA 5HRNA 5KAKA 3LM9A 5GAEI 5F1XA 3M8ZA 3UN2A 3LA0A 3D7SB 2CNNB 5AZIB 2K3IA 4Z4GA 1DY3A 3FBBA 1NLKL 1S5ZA 3KHHA 1E3MA 3SAHA 4A8SA 1PJ6A 4G6VB 1SZ2A 3LWLA 3CI5A 3R7BB 3QB0A 3POTB 3B54A 4LF5K 3D0GE 3OYEA 1RT7A 1TQLA 4MK7A 3ZZ0A 4X62F 3VN5A 2O8EB 3CC4N 3HHNB 1UVLA 3HVAA 2XI3A 4OPHA 1SIZA 2FBYA 3BGLA 4F2SA 3SLCA 2YKQA 3QIPA 4CP5A 3VF4A 2M5YA 3PEHA 1WORA 2FDNA 1FD8A 4YS2A 1IN0A 2HWIA 2KM8B 3NAHA 4H5RA 3FLCO 3H25A 2FF6A 3EJMA 4PR6A 5HBMB 1A5WA 2WVEA 4CLWA 1HLWA 3OHRA 1C6VA 4CESA 3ZEUA 2Z0GA 2DPNA 4H0OA 3EZWA 3NAIA 3CYMA 4FWNA 2RDJA 2B8PA 1KVAA 3GR1A 1HWIA 2VOPA 3EVMA 3CDWA 3LO3A 1V4TA 4OYAA 1GLCG 3IBFB 3ZSXA 2FQQB 3N28A 2HMIA 1FERA 3R97A 1KVIA 1S49A 4TYBA 3VGTA 2XGPA 2WBRA 3SUQA 4I64A 3MN7A 2VFRA 4H4KA 1VHIA 3TR5A 3UI3A 4UOGA 1R3NA 4CGDA 2EK6A 2CQ3A 2R7XA 4BRKA 4ZPBA 3SBMA 5KFXA 2XLKA 3AO2A 3FFIA 3I33A 3SV3A 4YHHK 1ZBIA 2E5LK 2R8JA 3CO0P 5HN0A 4RBVA 2HHQA 2D7SA 5GAEP 3KK1A 1Y5LB 1ZZFA 3V6KA 4WIQA 5KG0A 4O4GB 4OYWA 1BDGA 4DV7J 2W7PA 2UXCK 4C8NA 3SAFA 1ZBSA 4B3TF 1Z05A 1ITPA 2Y1JA 1WC1A 1RAAB 3EXCX 5K5MA 3L2WA 3OW2M 1R6VA 3PUFA 1QTMA 2ATQA 4ZPVR 3R1HA 4ZCMA 3HX9A 4J2BA 1RJJA 3SQOP 1RABB 4A59A 3GJQB 1P6TA 4F3OA 3MURP 4EIAA 5ADZA 1TL7B 2AJFE 3K2YA 3MECB 2Q3PA 1CJVB 2CGKA 3CM6A 5GIPA 4A2BA 4NXNF 1FKAF 1QVFR 4RTFD 3AQOA 2Z2YB 1YSJA 4PKGA 3TVYA 1BXNA 1K44A 3VZHA 3EXYA 4K4YA 5E84A 3L8BA 1RWVB 5E41A 1KS2A 2RKIA 3CD0A 1N5SA 3D0HE 1Z2LA 4IQXA 5A0YA 1Q9XA 4ECSA 2R7VA 1F9EB 3Q8QB 3T5LA 3C3LA 2VOOA 5HI7A 5G4DA 1Y10A 1T7PA 3O08A 1RHMB 5C2DA 1D0EA 4JS4A 4OLBA 1HNWF 5I9EB 3EY1A 1DT9A 2LXIA 4C4WA 2KH9A 3VQ9A 2HHHF 4RX6A 4J9NA 3WT0A 3LZIA 2ZH3A 2BANB 1N8RO 4KBIA 2HHXA 3PW4A 2ZH4A 5LL6Z 4HACB 4ZTJA 1PYTA 1BA1A 2KFYA 1EKSA 3ITHB 4CIFA 4DCPB 4LF1A 4FJJA 4DX5A 5DLFA 3J7A1 2BZ2A 3TTDA 3Q8VA 2BJ8A 3N6LA 4YB1P 3GV8B 4EFHA 3LQVA 1H74A 3IA0A 2GHWA 4AHRA 3D9BA 5LMUF 4MIBA 2WRMA 5FDLA 4CJTA 2ZNYA 4IYQA 4FNHA 2VKZG 2IM2A 1O5JA 3T1YJ 5DQIA 4KB7A 4JI8F 4AUKA 3SI8A 5D0GA 1NGBA 4CGHA 4JV5J 2YHBA 5KT4A 3KHLA 3KNAA 3UO0A 1FCAA 5J2QB 2FC9A 2E1AA 3EZ5A 5D6GA 3TAMA 1AZSB 4X4NA 2EI5A 1J9AA 4GKKF 4CDIA 3MUTP 4QR0A 4ZOSA 3S8SA 3NMRA 5BYRA 2J6SA 4WZQA 4BRPA 2WCXA 4CJ5A 1VQ8N 1Q8IA 3M8QB 3J80O 4PWDA 5KGXA 4B1VA 2FZKB 4QWDA 4FJMA 3FMBA 2XULA 1K1QA 3OYAA 3ZZUA 1RACB 2W6KA 1VAZA 4E98A 4X64K 2V2VA 4YEAA 2PN6A 2WUSA 1NEEA 1C0UB 4IH7A 4J90A 1S6QA 1UVIA 4OPAA 2XNRA 4J37A 1V3SA 3VF6A 4B3RJ 3H1QA 4GO7X 1EX4A 3UE5A 3MCMA 4DU7A 4X65J 1IBLJ 3K5MA 2QEXN 1Q4RA 2FGOA 2MLZA 3VGSA 3M9MB 1WEZA 1RGVA 1S6UA 4C0HA 4BC2A 3CCQN 3B4MA 4HLBA 4DV2J 5A2QU 3PW5A 2FHJD 1G1XA 1UJ5A 1H73A 4A8KA 3PJXA 3QO9A 1Y64A 4J9RA 2XQCA 2V8HA 1UP1A 4Z94A 3T5JA 1UVMA 5D3GB 2DISA 4DPWA 3D66A 4LF9K 4U95A 4BQLA 5C2FA 1UEVA 5FRNA 1BL3A 3K9JA 4GVBA 1BHLA 2HG4A 3VQ5A 2J9DE 2HVDA 1KOHA 5J2NA 2D3OR 2YHAA 4ECXA 1EETB 4ZPAA 2J7WA 3PIPQ 4DV1K 4NXMJ 2CG8A 2A2CA 2HIQA 2FJAB 4CLTA 1SJQA 5T41A 2Y0SD 1JXLA 4BRDA 4NZ6A 4CJRA 3EMTA 1BG3A 2F9DA 2BW2A 2ASJA 3QIOA 4WQ4C 3TUZC 4BY9C 2PA8D 2BVZA 3IC1A 2QWLA 2E7XA 3GIKA 2JWLA 3D2FA 4C8OA 3UW1A 4EU0A 1QE1B 3BB5A 5J2MB 3L4BC 4ICLA 4CO4A 2NUBA 4OHWA 1U1MA 4X4VA 4CI6A 3SUOA 2GX8A 3MMBA 3MMVA 1S1WB 5A8RB 1SC1B 5M2PA 1KD1O 2NSBA 2F96A 2PMZD 2GA7A 2VBWA 2FBTA 4LF5F 4CERA 4FP9A 3L09A 2EVZA 1T03A 2CGJA 3L3CA 1WHXA 2UVVA 3T1HK 1P9YA 1LWFA 3J7ZT 1RWWB 1XIQA 5CZ1A 3ZTPA 2BBEA 2BKOA 2EPIA 4OLAA 3C14B 1WI6A 2RDDA 2KKZA 2KHDA 3CCZA 3KG0A 1U0HB 5K14B 4KHRA 4GVLA 1N6QB 1HNIB 4YN3B 1HPZB 4A8FA 2EG1A 3JAMU 1KVCA 5C2CA 2QT7A 1IKVA 2DPIA 3H2VE 5AT1B 2MKKA 1SPBP 2X3DA 4NYNA 3W9IA 3OVAA 4RZRA 3VQ4A 4J9PA 2QC3A 3C15A 1T3VA 4WCEL 2I38A 3HHEA 1HBUB 1K8AO 4EMDA 3MM7B 4XDCA 2GVZB 5CR4A 3RAXA 1SL0A 2ZZNA 3FZFA 2JSXA 2AD9A 4HTIA 2GUPA 4OZNA 4CZIA 4K50A 3PRBA 3VAIA 1OYEA 2B6AB 3M2RA 4PG4A 2HNDA 2B3TB 1J5EJ 1RUSA 1QM9A 4DR2K 4HDHA 4RW9A 3I56S 4EEYA 4YHHF 3GJRB 4PG5A 2E5LF 1FKPA 2POKA 4FLXA 2RQMA 3OL6A 2P9PB 3AVHA 3DYAA 3V6JA 2IHR1 1J6ZA 1VQ9N 3DM2B 3JTPA 4CJQA 4LF7K 4O3PA 2UXCF 4C3MA 3W5YA 2LKZA 2PEHA 3UQSA 3EPIA 1RTDB 4I6MA 2UUBK 4UQGA 3THWA 5IXUA 1O8BA 1YDLA 3AY0A 1RFQA 3B6BA 1SC3B 1RXOB 2Q1LA 2FLLA 3DGVA 2IVNA 4K4XA 4NRUA 1WSIA 1IWAA 5LJ5Y 2Y8YA 2MGZA 2VCPA 4QS7A 5BN8A 4CEDA 1KHVA 3H90A 2XBPA 3THVA 4E2FB 2UXBK 2IYGA 2HQDA 5BRDA 4ZPTR 2ZQBA 1JNZB 1XJWB 4KQZA 4O44A 4ECVA 3F9MA 2YX4A 3PG9A 2CH5A 4E19A 4CF2A 1NGJA 2F3JA 1BHNA 3HZ6A 1B0PA 1TK0A 5ADXH 1EXQA 2HFVA 3AVKA 3WX8A 1GXTA 2IA0A 2DNOA 1WSFA 4I2QA 4CJLA 1SL2A 2QO3A 3OL7A 4IWVA 2HRTA 1MWMA 4NLSA 3CCLS 4BQZA 3MN9A 2DR6A 3BZCA 1U2VA 3Q7BA 3BY5A 3OR1A 4KGZB 4NASA 4N8OA 5IC4B 5KFSA 3DXKA 3OUYA 3FDSA 5KRTA 3CMQA 3IP0A 3QRQA 2A2DA 4JK7A 2JVRA 3CCES 4DJBA 4CZKA 2HMPA 4ZJQA 1FD2A 3O5BA 2V94A 4LBHA 3H08A 3TA0A 2FZCB 1X9SA 5SZTA 1WHVA 2DGSA 1T6DA 2X78A 2N4CA 2VJVA 2XZTB 3ONQA 4MIAA 1VRUA 4PYDA 2DY4A 1LWEB 2XGQA 2V34A 4RWWA 3NNCA 4OZ0A 1FHTA 4B8CA 2WONA 4FPBA 1F21A 3E2EA 4OZ2A 4V19X 5JUMA 2Z2ZA 4PABA 4XH5A 1NK5A 4MK8A 4PPZA 1HD0A 5K9FA 4A4JA 4RJVA 1L3SA 4OKKA 4WYWA 2MZTA 3MR6A 4OYPA 4C11A 2E2OA 4OYOA 1NZAA 1HBOB 4KH6A 4ANDA 3NBPA 1C1CA 5JLHA 4KGKA 1CJKA 4F4YA 4JKCA 5HROB 4IKFA 3M32B 4BHQA 3U1MA 4MH8A 1XK8A 1UWBB 4NYOA 5KFHA 2DY9A 5BPMA 1K0TA 2NRXA 4DQIA 3RB3A 2N7YA 5DQGA 2XO6A 1JL2A 1V5VA 5CY4A 3B4DA 4CF0A 1NJXA 4FLZA 1SXLA 5CZ2A 4AFFA 3C6UB 4X64F 1PJ5A 2YJEA 2AHOB 1JLBA 2CQ4A 3VZIA 4K4SA 5LJWA 1OQ3A 3OT9A 1GFWB 3HD2A 2GWKA 4Y2IA 4M1KA 1FXDA 1YVUA 4CQ1A 4JI4K 1HNVB 4DFKA 2RHSB 3PW0A 1HHQA 2E5IA 1T9WA 3MMAB 1K73T 3ISNC 2DR7A 1KXPA 2F8MA 2I6WA 2QXLA 2KRBA 3I6PA 1WOPA 4HCBA 2CWKA 1X4DA 2ZBQA 2HRYA 4CH7A 4BE0A 3O3FA 1NJIT 2B4VA 2DTUA 4G1QA 1G6BA 4M5DA 4NEYA 3PLAA 1W0HA 1YJVA 4LF9F 2ZKTA 3IMQJ 4PWWA 4BREA 3QAUA 3AVNA 3KHRA 1QZ6A 4KI4A 3UCUP 1LW0A 3SJHA 4KHYA 1MG7A 4IFYA 1TYQA 4WFBL 1HQUA 2ACMA 4DV1F 4ILJA 4Y65A 5AQHA 3O44A 1O13A 2CJXB 5JS1A 4WTOB 4RW4B 5BRHA 5DQHA 2QA1A 5I3UA 5KFJA 4LR8A 2QRRA 2L48A 4TXSA 1HRHA 1Q81O 5AQQA 4A47A 2B5JB 5SUHA 1ATRA 3MF5A 4H0PA 1C0FA 5JJBA 4NCAA 3UVJB 3RB6A 3ENOA 4NB4A 4NLUA 4CGJA 3GCXP 2U1AA 1TTHB 5LMNK 1KQKA 3QEWA 1QVGM 2HAIA 1MLAA 2R7TA 3LPUA 2J8SA 1VDHA 4ES2A 3M05A 3DGPA 5EDWA 4IO1A 1TL1B 1JXEA 1BY9A 1P8GA 4M95A 5KPTA 4XPCA 1FTCA 3PZPA 1IO2A 4DPXA 1M1HA 5GAGU 3T1HF 5EOYA 5LXRA 1EKEA 4PRFA 3MCNA 2OEMA 3BPSP 1WNSA 5IT9O 2F4FA 1GLFO 3NGDA 1FRXA 1ATNA 1JMTA 4E1NA 3EN9A 1YK9A 2Q66A 1VQKS 1BOTO 4WU2A 4B1UB 4JB8B 1RI7A 4LVOP 3SCXA 3BR9A 4C2MA 4OX7A 1U6FA 4QYZJ 2D3ZA 2W40A 2OMLA 5F8HA 3DOLB 4IFVB 4NX9A 3FFKB 1WEXA 4CFBA 3QRPA 4IO9Q 5ETSA 2K1RB 4PXCA 1WTBA 3TYTA 1VFJA 1QAYA 2KB2A 3MGJA 4R5PB 3ATUA 3AV9A 1FE0A 3H59A 3ZX3A 4KGXB 3DLEB 4ZVFA 1P9QC 3I96A 2F63A 2VQFJ 4OYZA 2CPHA 3MN5A 3VA3A 4JI1J 2Q0UA 1M5HA 3NH0A 2DHAA 3V4IB 4A5AA 2XZDB 4DR2F 2ZM6J 2BM1A 2ZH8A 2B9WA 5HATA 3ZETB 1X8DA 3CEDA 3P5BP 5JVHQ 1TL4A 2QA4S 3HM8A 3NGZA 2MSTA 2DGUA 5H9FK 3U9DA 2JJ4D 1DTQA 5HO4A 3D6MB 3LDLA 5A6PA 4KV8A 3GYNA 1OVYA 1NGHA 4NI2A 4LF7F 1S99A 5DK5A 5DG8A 3S3NA 4CVNE 3LDOA 4HH1A 4M5NA 1WF1A 1B70B 3M2VA 4I56A 3GE9A 2UUBF 4BRCA 2K7KA 5AJ3J 2C2KB 1LWCB 4KAIA 1P1TA 2ZD1A 4R8UA 4ILMA 4NLXA 2P9EA 1DLOA 5GMKa 2OZMA 1NRKA 2VWJA 1S76D 1JXBA 4HI1A 4WE1A 4KO0B 3HMJG 4JV1A 1TP7A 2J76E 4AF1A 2YNHA 2PE8A 1RCHA 2IA6A 3BH6B 1VJWA 2B51A 2DY1A 2COLA 3DI6A 3HHLD 1VSLA 3FRYA 3R9PA 2RSQA 5B0CA 3CCSS 4UY85 2YKMA 2IJNA 3IBWA 3EGWB 2HVIA 3DMJB 1NZ8A 1XMQK 3A5NC 4LF8J 5F9LA 2AJ4A 2MZRA 2D5RA 5I42B 2I7NA 5GINA 1EQYA 1ELOA 1ZS6A 3FGUA 3G82A 4DZ6A 1GLLO 3RTVA 3N9UC 3ID6A 4H0XB 4KTWA 3TVKA 1GLDG 3OFGA 3AA4A 3KLGB 1FWPA 3BV8A 2E5HA 3DRSB 1FT8A 4IR9A 2P9LA 3HKZD 3SCIE 1P1LA 3MD1A 2HBKA 1UEUA 1HNXJ 3PIPL 1FRJA 3X1LB 1KEKA 3QJLA 2E88A 3UPFA 2RJZA 2U2FA 4X4OA 3G71N 2YH0A 3QEPA 3EWGA 4UZBA 4FVUA 1QHTA 1FWKA 1NDPA 4ZLPA 2YWKA 1UZHA 1XUPO 2ZOGA 1Y5NB 3ILIA 4FJIA 1JXVA 4C9DA 4BRMA 1OQ6A 3OJSA 1NK8A 4DR4J 4LRCA 1EWRA 1RAOA 3HULA 4HH0A 4H5TA 1M1GA 3GSIA 3BSOA 3TUIC 1HLUA 5D77A 4B3MJ 3SNNA 3ENHA 4IO8A 2DXFA 2OH2A 4L75A 1TL5A 3NGUA 4DV0K 2YNIB 4NEZA 3R3TA 2BABA 4CD1A 4DTJA 2OANA 5CD4A 1UAXA 2GTDA 4KH4A 2OPQB 4DR3K 2C2RA 3K5LA 3ZSOA 1HQEB 1IKYB 3EL2A 2BJ7A 3TANA 2IJRA 4P2XA 1G7CB 2CQ2A 2DR9A 2RHKA 1RBAA 4FM0A 2IPOB 5IV4A 3LP0B 4O8KA 3R6LB 2YKNA 1VRTA 3ENWA 2G1DA 2PYLA 4UF4A 1FW6A 1RBVA 4O3OA 3MPWA 3K17A 4J5OA 4HTLA 4CJPA 5BXIA 3G6ES 1KNZA 3G25A 2OLWA 1O1WA 1WACA 4Q44A 1NU0A 1TK5A 4U96A 4H4KC 2XM3A 3VEVA 3DOKB 1GK8A 4ZVOB 2DEIA 4C8KA 2WW8A 2NLWA 3UDCA 5AXKA 3FUYA 3UCZP 3AVJA 2KJWA 3OXLA 4K59A 4JI4F 3D6FB 1JKHB 1F0XA 5E3RA 2DO0A 3PR5B 2P9IA 3AODA 3W8GA 2PAVA 4F04B 1RHRB 2HFSA 3CW2C 5B0AA 3RR8A 3T1AA 1RWXB 1HIYA 2UVRA 1ZA1B 3P5JA 2NZ4A 3K8WA 4N7TA 2UUCK 3CULA 4LIWA 4M63A 3LALA 3ATVA 1E6VA 4IDHA 5FD1A 4DX7A 2YWEA 3B8AX 4CE9A 2WVBA 1F9FA 1HHSA 3G10A 4ED2A 4DUYK 1G3OA 3W3SA 3QIDA 3BF1A 1DQ9A 1MN7A 4LFAK 2GIRA 3HVRA 4IUFA 1RWNB 3GCWP 1RT6A 4C97A 2LA4A 3P39A 3WXIA 2UU9K 2O3DA 1YJTA 4LQ9A 2DITA 1UFKA 3SQ1A 3HL8A 1TKTA 3R2DJ 2JH3A 2V4RA 3GDQA 2BE2B 5KFPA 1FVQA 1FRMA 4BVPA 4XAKA 4GVMA 2BANA 3P8BB 4CM0A 3H4DA 2HVHA 3CTRA 3RB4A 3M1VB 2HHPA 3VETA 3TAEA 3C2PA 3J8AA 2DCLA 3OTCA 1OIAA 3OHAA 3UD4P 3K2PA 1HFEL 3AAWB 2W9AA 3I5CA 3CJ7A 3TSPA 4A2AA 4KH5A 4M5MA 2V9KA 2R7RA 1R89A 3ZCMA 1HNZK 3W65A 5LMNF 4TU7A 3VF2A 2VG6B 2PMHA 2FJEB 4DR3J 2QG9B 3P31A 4ISFA 2VG5A 4Y0FA 2GJ2A 4JI0K 4JD2A 3E01B 2FSJA 1QHAA 2DVIA 4DPOA 3MWBA 3CCUN 1BQNA 4EP5A 3LH2S 1YZ6A 2ERRA 1NPKA 1ZXOA 1R0BG 3D6TB 3KHGA 1L3UA 1XMOJ 1UOCA 1TVRA 4DUZJ 3C16B 2RRAA 3IGNA 1VLOA 2W9BB 4LRDA 5J2QA 2ALZA 1U4BA 2OPSA 3R5GA 3A8YA 2AJ2A 3BPDA 4TY8A 5HRPA 1RDWX 1TV6B 3AOCA 2C2EA 1ULRA 4Z2XA 1FFWB 2PFUA 4NMXA 3P4UB 2YVSA 4Y0WA 3FQKA 3KK2B 2AJ0A 1S6PB 1C4AA 3OYBA 1RYRA 2XG8A 3NEKA 3OLAA 4OJ1A 4C8MA 1RCOB 4YDUC 1HW9A 2G8FA 5KG7A 1FNMA 2F7TA 3UN3A 4BCAA 4DFMA 1HKCA 2P9NB 1G4CA 1RHJB 3W8PA 1S1XA 4HTJA 1AUDA 2LDYA 4FVCA 2QZ8A 4CJVA 4YOYA 4NA1A 2JLFA 3BM7A 4CGIA 1WKKA 4RL1A 1BQMB 5B0GA 3A5MC 1IKWA 1U2CA 3F9KA 3Q2SC 1QZ5A 3MAHA 2QA4G 4ANCA 3DXMB 3CMAN 3WNHA 3CFPA 2JEFA 1N0VC 1HBNB 5DETA 1U02A 4Y1CA 4BC5A 2IAJA 1SQKA 2LEAA 2IBOA 4OI2A 4KHWA 4GV6A 3GR0A 4FDFA 4OLOA 1IXKA 5D3GA 3L0QA 4B9QA 2CJYB 3L7PA 1WLJA 4CNZA 3I8DA 2M8HA 1FK9B 2KT5A 4DOZA 2ZBCA 4DCOB 3DCAA 2E6LA 5HRSA 3N4WA 4L3KA 2PSZA 1YJNS 4DR7J 4F4XA 5KFNA 3F5TA 1E4GT 4HUGA 3H0PA 3KTQA 3OYKA 4LUBA 2OGUA 3H98A 3QDKA 3LP2A 1F3VA 2MLXA 3NGKA 3WIVA 1A9NB 4DI6A 4K5SA 1RT7B 4BACA 3LDSA 3G8SA 2E9RX 3FCWA 3HI0A 4JI3J 1CZAN 3VQAA 1VQPN 4CHOA 5KPZA 4CGFA 4J9UE 2XC9A 5M1KA 3MR5A 2NRTA 2DIVA 2QMXA 2OIHA 5F2RA 1RCXB 4BRLA 1R8AA 5HSPA 1UJ4A 2XYHB 4P75A 2ADBA 1K0VA 4L6V3 2ROPA 1WELA 5E3QA 4M7YA 3ZEUB 4UTGA 2GIFA 4LFCJ 1XMQF 1F60B 2FVRA 4FYYB 1VQ7N 1RBOB 1WWHA 2IY5B 4G3IA 5GADI 4F4ZA 4DL2A 1NU4A 2Q2RA 1WG4A 3U3GA 1VLYA 2DD8S 3D0IE 4KGVB 2DHHA 1WSVA 4WBFA 2HMIB 4QWBA 5KI6A 1RLDA 4MAKA 3TTCA 2HNYA 4P10A 2PY5A 5KFRA 3QETA 4M3UA 1U0HA 4YR2A 1RHUB 2IFXA 4W5OA 2GVDA 1NHVA 2RUGA 4CT9A 4RUCA 1FVSA 1KD1T 3FEYB 2P51A 3MUVP 1R0AA 1U1PA 1NXIA 3HJVA 5LT5A 4DX8H 4NLQA 3W2WA 3FFIB 2DFFA 2YQ3A 1OJ4A 3ILJA 2QL7B 3O1WA 1M5OC 1X3NA 3L2RA 4GV9A 4RWXA 1VQOS 3KK1B 2GVZA 3WC2A 5LM7E 2B9XA 2PFDA 2PC6A 4BR4A 2NUHA 2CKWA 4EZ6A 4WFZA 2VBYA 4OJGA 1W97L 8AT1B 1EP4B 1CBKA 4EWTA 2CPDA 4MKYA 1VMBA 1FI4A 3KJQB 3NFAA 2BH1A 4FWMA 3UR3C 3KXDA 4DV0F 3DDIA 1JIHA 3NOGA 1ICEB 4KIAA 1YAGA 2CNKB 4B3SJ 1JCGA 2MY7A 3AXMA 2HB5A 4DR3F 3OTBA 1LQ9A 1IBMJ 1RNHA 1K8AT 1KRPA 3P38A 1NK9A 2RIJA 2YKOA 3ZZPA 2W41A 4IJNA 1YI2N 4WU3A 1IM4A 4RUBA 1P27B 4CIOA 4YP3A 2K06A 2R2RA 3GFZA 3ZSYA 3HVWA 3HOSA 4JI5K 2J0WA 2K3KA 3W0LA 4PWUA 3J81Y 3AJDA 3HSTB 3HSGA 3MM8A 1WSGA 3HZGA 1KHWA 2ASDA 3G87A 2FJXA 2YWFA 5A0YB 1XNRJ 1N5YA 2GUIA 3DDKA 1PO6A 3PXGa 5GADP 1MDUB 4H4MA 3X3UA 1UPMB 1BI4A 4ECRA 4JKAA 3P5TL 3ELHA 3CD5A 3D3CJ 2QJ3A 5D4LA 1WC4A 5F8IA 3TZYA 1T02A 4ISGA 3NOCA 3HKWA 2BJ3A 5E5NA 4HL9A 2UUCF 5KFQA 2HGMA 1T9YA 4F0KA 3UFCX 3QATA 4RR5A 3SQGB 4DV5J 4IOCL 4HHUA 4KPYA 2HPUA 1U7LA 4DU1A 3HFZB 4DTSA 2P2CB 4B17A 3CCJS 4DFPA 2ZGYA 4DR5K 3CCRS 2KTQA 4DUYF 2MQNA 1FF2A 4NOHA 3K0SA 4LFAF 1XERA 2IDOA 1HA1A 3FZ2A 2Z1HA 5FIIA 1YXQA 5T7LA 4AXIA 2UU9F 1BLUA 2G8IA 3C6TA 2Q43A 2V4QA 5JVHL 1GX5A 3LWMA 4ZITA 3JYTA 1X4GA 3BQ0A 4USKA 2XMJA 2E5GA 3BSCA 5FDLB 1IKXA 1NHUA 3G0ZA 2GEMA 4O0IA 2H9ZA 2DGQA 1U8WA 1URNA 1ZM3A 4WP8A 3AH6A 3KLVA 2N3LA 4F36A 3O4NA 4G65A 1YTUA 3B78A 3OA9A 3TAMB 1YKWA 4J9SA 4FJNA 4JP8A 2QSWA 2W2QP 1NGFA 3OD2A 3DLGA 2UUAJ 1HNZF 2MHEA 1K9MO 2AW0A 4JI0F 5AQFA 3BYPA 2WZ1A 2W25A 2ZUGA 1EX8A 2X1BA 4PWDB 4ID5A 4XDDA 3I4HX 2WOMA 1R43A 3QNNA 2V8PA 5IWAJ 4USWA 4ZCLA 3ZYYX 3FSIA 2WTUA 1S6QB 3AB2B 1RA7A 4LIRA 3GL1A 4ZP7A 4RUAA 4B9VA 3K9KA 1HBOA 3GFYA 4DN9A 3OS2A 4LFCF 1FJ7A 3MFHA 3PYEA 3M32A 4XH1A 2BDPA 4NLOA 5A6WA 4FK0A 1IV0A 2GS8A 2A3ZA 5C24A 2DPJA 5DMRA 3QO9B 1HJOA 4KE5A 4ILGB 3CJTA 3ZZTA 5BR8K 3KFWX 4PUOA 1HR0J 2Q79A 1EAYC 4CZLA 1N32J 2YY3A 2LMIA 1NK6A 4CZGA 2V68A 4GVBB 3NDKA 2R7YA 1JNRB 2MJUA 4EAHD 3NMUA 1S0NA 4J8FA 2PYJA 4JYAK 1S5JA 2G8WA 1EARA 4BRHA 2VL1A 3MMAA 2HS3A 1IG9A 3H46O 4OYXA 2P9KB 2AP1A 2OUGA 5CQGA 2OSQA 2W7AA 1NPRA 1E6YA 5A8KA 4DB3A 2VPZB 1YIJS 4PL7A 2HGLA 3GIIA 1WSEA 1WDDA 1UKUA 4NA2A 2RVJA 2W9CA 1I5OB 2QFIA 4DV3K 4GNIA 3MOZA 3CJ8A 3D2FB 3RMCA 3O6QA 1LNQA 2AX0A 4JKDA 2JGUA 5IC6B 1Y4ZB 2C2MB 5KOXA 5AXLA 4KHPK 4ICLB 5THWA 3ADAC 1D4XA 2DHSA 1PSDA 4X4TA 3H8YA 3KUGA 1BUPA 3I5AA 3AD7C 5ETRA 3MMBB 3EVOA 4ZPCA 5JMNA 4HUEA 2VBZA 4CK1A 3LPYA 3SYZA 5ITHA 1RA6A 3SFGA 4FW2A 4OV6A 1X5TA 3V9XA 3AD9C 4C0BA 4LY7A 2NRVA 3WXMB 3HD1A 4E1MA 1Y11A 1LWFB 2ITMA 3F41A 4WFXA 1S79A 2LSNA 2IOCA 5CYMA 4GY2B 4JI7K 4DR1K 3P83D 3HT0A 4FKYA 4FPAA 3OYLA 4O55A 3T6BA 2OD4A 3CWJA 1I3AA 1Y7PA 3ZSRA 2Q31A 1WTFA 3FRZA 4FJLA 1GQEA 1JQGA 3OFFA 3Q7CA 1IKVB 4CH0S 4F67A 3MX5A 2WK4A 5AQJA 1UFLA 2H3GX 4ZMMA 3LDPA 2KZMA 1KCFA 3HSDA 3HSCA 4CIGA 2H3EB 3G96A 2H4YB 2E29A 2RQCA 2CJAA 2YKPA 5F3ZA 1Q81T 1T9UA 4Q8FA 4I9QA 2A40A 3C95A 3FZKA 4AD6A 3F0NA 3HK2A 4RLEA 3L3VA 5F3TA 4GMJB 4NLRA 3AJ2A 3KJFB 3M2RB 2GC8A 4ZPDA 4PQUB 3O2IA 2HWTA 4EHUA 2A42A 2WAQD 2HNDB 2FUG9 3LTOA 5FPMA 5CABA 4JKEA 4U7UD 2FY1A 4U7CA 3ZSQA 1APSA 4RW9B 4CM2A 3QFUA 1PYSB 3T6JA 1FKPB 3HSZA 2LEBA 3QBXA 2HS4A 3DYAB 4IRKA 2O8BB 1NNDA 4CH1A 2EC0A 3S41A 2W7OA 3G6YA 2P6TA 4OKJA 5KFVA 1F1BB 2QL9B 3TRGA 1UTAA 4J9OA 4LR7A 4NLTA 2E1RA 3CGIA 3DXSX 1UVJA 3KUEA 5DM6Q 1K1SA 1KONA 3OHBA 4I6MB 3THWB 3CD6S 1MU2A 5EHHA 3O3GA 2JRSA 2GQCA 3V4IA 1OSDA 4NL5A 1MWZA 5LSLA 4LF6J 4X66J 1FRKA 1VBZA 3JQJA 2HYIB 3CJCA 1OH5A 3M6GA 2HVEA 3OSNA 2D3O1 1SJRA 5IT4A 3HFKA 1U48A 4IOAQ 5DG9A 4JI5F 2ZEJA 2EHGA 2VONA 3L2UA 3CPEA 3J80Y 3JSMA 4JEPA 4K42A 4O44B 3U7JA 5KQDA 1NO8A 3G4SS 4YY3K 4QJVA 5E3CA 1Q18A 3W61A 2OPPA 2QWOA 4BGBA 4IXCA 2R2UA 1UL3A 4B08A 2KYXA 3CHWA 4MLEA 3WEEB 3TUPA 3D45A 2W42A 2CQIA 4I2QB 4CFCA 4Z0UA 3I9V9 1RYSA 4JI6J 1U1LA 5HJYA 2L9WA 4H54A 4KO0A 2HS0A 2CRLA 4FOEA 3VPZA 3OR1B 3V9SA 2P8IA 1T3NA 4CHPA 1VQ6N 1HR0F 4GKJK 2XZWA 3DXKB 1RHKB 3WHIA 2HBJA 2IVMA 2AWZA 3FQLA 3DNCA 1ZH5A 2DRBA 3TSQA 2E1PA 2HBRB 1Q8LA 3R5DA 2MYFA 1R31A 5D15A 4JKGA 3AXKA 1X4HA 1T0TV 4CJFA 2C2OB 3R5JB 4JKFA 2PMWA 3EGNA 3IO1A 4CGGA 3FBFA 4I7FA 2EW9A 3FC9A 1WBBA 4HHHA 2FPHX 2QKKA 1D3WA 3TAFA 2M52A 3QSIA 2C3YA 3HHDA 2H5JB 3V81A 2QTDA 2A1BA 1SV5A 1HI0P 1VRUB 1XNQK 2LLZA 3AY9A 3FMWA 4A8XA 2DK2A 4FM1A 1N36J 1S97A 2WONB 2Q1NA 3BZKA 1AUSL 4DSJA 3G86A 4MK9A 1H7XA 4XH4A 4YMEA 2E2QA 1LW2A 2O8DA 4USUA 1FRIA 3A4TA 3Q89A 5HANA 2GJFA 3L7OA 1NG9A 2L08A 3RBXA 4HKQA 4C11B 1SC4B 3D3BJ 2EFQA 4ZTFA 3HSJA 1Z4UA 1QUVA 1JB0C 1IJEB 3IAS9 2W8KA 5AXNA 1C1CB 3I55N 1N34K 1CJKB 3C65A 1VS3A 3IM8A 1VQ4S 2IM1A 3VAHA 2ZH2A 4ZVQB 5AQKA 4LF4K 1AXQA 1S57A 4A8QA 4XIUA 4JI2K 1VGYA 2J0SD 4F4WA 1G99A 2DFEA 3MTJA 1KWMA 5CYQA 2R4FA 1JLBB 1VI7A 3BN4A 3TPQA 2YNIA 2V2KA 4WPAA 1UETA 2OPQA 3CPWM 5K8OA 1YBUA 3AJ1A 2EWHA 4K4ZA 3CC4S 1IKYA 1O6XA 2Z56B 4BLGA 1S0MA 4EBCA 3RB0A 2GWJA 5CH7B 4M3XA 1SBRA 4LFBJ 3GILA 1OPIA 2RILA 5HQ8A 2DNHA 1CXUA 5E2QA 3I5BA 2BE7D 4ED6A 2Z57B 1CZ9A 5BR8F 2EK1A 1U45A 4G1QB 2EBEA 1JJ2M 4M5DB 2ZC4A 3H3NO 3F56A 3OS0A 3MXIA 3IGVA 4FKXA 1FRLA 4DTPA 2V52B 2A3JA 4WFAL 3NAEA 4QW8A 2IVYA 4ETZA 2O5DA 1SKSA 1LW0B 3HTVA 1SJ3P 4F0HA 4JYAF 2XMMA 4DR6K 2GIQA 1NDKA 3JTOA 2J0QD 2WBNA 4IFYB 1GT8A 1TYQB 3MX2A 3FGVA 3AO5A 1HQUB 1QTNB 1WN7A 1RAGB 3MFIA 4B1WB 3DU5A 4ED3A 3MEDA 3WC0A 4DV4K 3VGLA 2HGNA 4BWMA 2EWSA 3E9PA 2DRDA 4ED4A 1S1TA 1Q7LB 5I3UB 4CO5A 4WQ5A 3GWCA 1RT3A 3SXLA 1SIWB 3SCJE 2N82B 4DBQA 4MQ3A 4DQ8A 2G2OA 1LOUA 5AQZA 1R0CB 3MMJA 3W5XA 2DR8A 1SCJB 3HBTA 2JHEA 4USMA 1TKXA 2DH7A 3MOJB 1GMWA 2BEFA 2WTFA 3GIRA 1LV5A 1HJRA 3OSPA 3OPKA 3R8YA 4KHPF 4F3MA 4ISEA 3CCVN 3CNQP 3KVGA 3JQKA 1NOZA 5A8WB 3G8QA 1L3KA 3QFHA 5IV3A 3THXA 2WSEC 5KFAA 1RE1B 1NBWA 3IG1B 2XEXA 3QWPA 3AFGA 3VA0A 1S3XA 3BGFA 2BACA 3VEXA 3DLKA 4KKOA 4BE2A 5EVZA 2OPRA 4EHTA 3HJFA 1NK4A 1QS4A 1RDRA 4KJIA 4M63C 2ZDOA 2RF2A 2BKNA 4JI7F 4KB0A 4DR1F 3VQQA 4BC9A 2CPIA 4YB5A 2EG2A 1C0GA 3HRGA 2D69A 1H1VA 3NWRA 1VIXA 2AQ4A 1CS4A 2D4WA 1HARA 4N8NA 2VG6A 2ZUAA 4KH0B 2M7SA 2RU3A 4K2XA 3NWGA 2V63A 2RU9A 3E01A 3WX4A 1ATSA 2HNZA 3SUNA 4C8LA 2XI2A 2UV8G 4F26A 2DR5A 2ADCA 2ITGA 2I9SA 2V5HG 3NF9A 4CHQA 1NPPA 3PM9A 4HHTA 5AE1A 4P74A 4ZP8A 2KYZA 3C16A 4RUHA 2VQEJ 3BO2A 4RNMA 1MROA 3BQ2A 2DTJA 2LQ5A 1S9GA 1WF2A 4QIVA 1X7VA 5IQQA 3QGHA 3M8PA 2BJEA 4P73A 5KFZA 4PHTX 2X7IA 2DEJA 2OI2A 4DU8A 1WSRA 3Q22A 4GW6A 2O4IA 3G2XA 4XO0A 3QQCD 3EO3A 4IH6A 1BWFO 4FWLA 3N6NA 2VU5A 5IQ6A 2BQUA 2KJVA 1NWKA 3SSSA 4D3HA 4DPTA 3NNHA 2HEKA 3AO1A 2ABYA 3EZOA 2F4VJ 2F65A 1DTQB 4TY9A 2XSFA 4KV8B 1KQSR 3KZBA 4NI2B 3TARA 4IG3A 2R7UA 1QUPA 4JKHA 4P2SA 2Q3SA 1NB2A 4CRJA 4IOBA 2AV5A 2KO1A 4K4UA 3OTDA 1EQ0A 4DL4A 2CVEA 3M2VB 3VEOA 2PDAA 2RQKA 2A6OA 3VF0B 4JUZA 3O4WA 4FL9A 2ZD1B 2JNJA 5BN9A 4X84A 1XR5A 4R8UB 3C8YA 3OYGA 1LWXA 3JSYA 2M0GB 3UKRA 4DTNA 4DMZA 3CFRA 4DV7K 2XY6A 5AZJA 5CA5A 4WE1B 4M5IA 5BYQA 2YNHB 2Y1RI 2YWWA 3O80A 1YITN 4A62A 3P49B 4NYFA 5LJVA 2HK3A 2QWQA 3AVLA 1QAIA 1R8PA 3OR2A 4C98A 3VQSA 3DI6B 5EUHA 2ZITA 2BR0A 4YY3F 5HP1B 1B4SA 3WNFA 4AQYJ 2NRHA 3PW7A 3MK6A 4O3QA 3M3ZA 4ZVUB 2YKMB 4GC6A 2LVWA 3N4PA 3QLHA 2JLGA 1VQ8S 4C1NK 1SC6A 1ASVA 2P5GA 3GJSB 3EX7B 3I9ZA 1DFDA 3CJ4A 1IG8A 3SBGA 3AGKA 2JWKA 4K4WA 1EQMA 3TVZA 1CZBA 3G82B 1Y0HA 2IRUA 1PAEX 2XMAA 1UVKA 3W64A 5C7PA 4GKJF 4ECTA 1S72N 1O0PA 4ZJOA 1ZPVA 2QEXS 2CZVC 2XRIA 1Q53A 5ETQA 3TZWA 1WC5A 2I7PA 3NF6A 2GBZA 2GX9A 4H0TB 2P9LB 3CCQS 5HVFA 2QXFA 2B7BB 3V9ZA 5TKYA 4CNYA 5U47A 1JLCB 3MMCA 3K5OA 1DAXA 4PYAA 5ADXA 1U47A 3Q86A 5AR0A 1RBRA 5KG1A 1IBKJ 2MZSA 3HI9A 1GAOA 5LY3A 5DDQC 1XNQF 3CQ8A 2W4CA 1S9FA 1KP6A 4YOEA 3CD7A 3GFXA 4DV6J 5AFUH 4K0KJ 5AQYA 1ZAXA 2J0XA 2FJBB 4K43A 2J6UA 2V9WA 3D5MA 1WC0A 2E9ZA 1C0MA 3PO5A 1X9JA 5F9NA 5FLXY 3R8EA 2MKCA 1ZETA 3FR0A 4WFBQ 2QKBA 2YX7A 1X5SA 1N34F 4KREA 3D4JA 5BR9A 1MSWD 3M6VA 3RBDA 1YJ9N 4YR3A 4YOVA 3FE1A 4LF4F 3T1YK 4N5SA 3CMEN 3J7YU 2G13A 1Z6RA 4W5RA 4JI2F 2YKNB 5D4OA 2R8IA 5KGWA 2P6SA 4JV5K 1VRTB 4DQPA 4FF1A 1KSPA 2R7SA 5JLFA 1EP4A 4TYAA 1RU2A 1Q86O 3DDNA 4BDZA 1GOAA 4WP3A 2RT3A 4GO5X 4QU7A 1FRHA 4USIA 4PKIA 5IT9Y 3PHEA 3M2UA 3MAAA 2RUSA 3SSRA 4J9VA 1HBMB 4FLYA 2FYXA 1X31C 3R5AA 4PG7A 3T5KA 1K47A 5L1IA 1Q8BA 2GGPB 1QSSA 1R59O 2P9IB 1QJHA 3D54A 4QZVB 2HQGA 4CO1A 2VA3A 2H51B 2B7CB 1VC0A 3HP9A 1NGDA 4FJGA 1E6VB 1YJWN 4B3OA 2DGVA 1NGIA 4BGAA 4B3RK 3IAM9 3H40A 1NK0A 1IH7A 4LT6A 3CJRA 1RDAA 4X65K 2FBVA 3AVAA 1IBLK 5LSOA 2NNWA 2HKEA 2XO7A 2IC3A 1N33J 2ZH9A 2RQ4A 1RT6B 2O01C 4DV2K 3NNAA 5KQ8A 4DR6F 2E6MA 2VH7A 2RE2A 1TKTB 5GAGI 5HRRA 2B9EA 3MCSA 4QR1A 4DV4F 3RJMB 4PG6A 5DM7Q 3VQ7A 2RE1A 2HFZA 3QZ8A 3SQGA 2FHMA 2V7YA 5DM6L 1URRA 4N77A 1EO1A 2NXNA 1I39A 2KQ2A 3R3LA 2BJ9A 2ACYA 3OYNA 2YQ0A 1SKUB 3QSYB 3DFEA 1IVZA 4NXMK 2V8VA 8ATCB 4AH9A 2MXYA 4MJKA 5KTQA 4CHYA 4CZMA 2CXEA 2OAUA 2W6LA 1S4FA 4NLVA 4ENOA 2MQPA 1H2VZ 1I51B 2Z30B 4K8XA 4ZVTB 3DKDA 4M5HA 1VQ9S 1MWQA 3EE9A 3V6DB 3CJSA 4YDUA 3L7UA 4LJMA 2VG5B 2VODA 1VJQA 4JD2B 3V9WA 3PDNA 1BQNB 4IOAL 1X9MA 2WHOA 2X74A 1NKCA 1NGEA 3DJCA 4CZCA 1B7FA 3FJ2A 1IQZA 3M8RA 3TZZA 3BBBA 2M9KA 1XR7A 1TVRB 1RK8A 1WEYA 1FXXA 3VTHA 1PKUA 2IM3A 4YB6A 2BJ1A 1ZBHA 2OPSB 2PGCA 1WOSA 2KI2A 4TY8B 1U6ZA 2F8HA 2V50A 5E3AA 4DG1B 3ZZZA 5LSRA 4E7JA 3RUBL 3Q83A 4LRFA 3ENVA 1LK7A 4HEA9 3VAKA 3SPZA 1VQYA 1ZM2A 4OPKA 1PGZA 1WDTA 1N52B 3ZSZA 4CO2A 2RN2A 2AMCB 2KKHA 5F41A 4O3NA 3KD1E 4J2AA 3QESA 4ELTA 1S1XB 4H0VB 4B1ZA 4LBIA 3FK4A 5G0RA 3S3MA 2MQ8A 1T94A 4FBTA 1FXLA 3EE8A 1IKWB 4N41A 1T9VA 5C42B 2FLOA 3A2FA 5GAGP 3TAGA 1L3TA 4JN4A 4FCYA 1K9MT 2HQ3A 4DU3A 4OX8A 3PHTA 5J1EA 3O4QA 1VR6A 1ZYQA 3DRPA 2IAJB 5DO2A 3VQCA 4OX9J 3AQPA 4EP4A 2BMBA 3OXFA 2NXCA 3NF8A 3MXMA 1RTJB 2KXHA 2YPZA 3N79A 3OW2R 3CC7S 3L4IA 4DV6F 3AVMA 1YBTA 3VQBA 2M70A 4DLEA 2A10A 1NJWA 3CIZA 1J5EK 3WNGA 3PW2A 2KT3A 2VBXA 7FD1A 3OYCA 1UA0A 3GV5B 2WSFC 4KHQA 2D0AA 2XMUA 4FF2A 3N5FA 2P9KA 4Z7CA 5C12A 3BDPA 1RB0A 3LP2B 5IFMA 1OVQA 4B9UA 4DV7F 1VQ5N 3H2UB 4WWSA 4F7VA 1U1NA 5JXSA 4I9LA 4WF9Q 4DU4A 3LGMA 3MPVA 4CO0A 2NXEA 4R0EA 1R6YA 5BJRA 5H9EJ 5AE3A 5I3QA 2GO8A 2W2OP 2ZOFA 3C19A 2LDIA 3EDQB 1OS5A 1YJ7A 1KQFB 2DNQA 2LYVA 2IMOA 4ZIVA 4OHZA 1CVJA 2LCWA 1VSDA 2KU7A 4UW2A 2E44A 4JS5A 1UA1A 3O1LA 2F1FA 5CZVA 2HWHA 3UNYA 3SIPB 3CERA 2RPIA 2DNZA 4KSEB 4FBUA 4G9ZA 2CQPA 2OTLN 1RT2A 1TFWA 5K8PA 2XWXA 1ZTWA 1GLAG 4WTYA 1ZAWA 3MM9A 3KWGA 3QRRA 5B0EA 4MYUA 1EHWA 4DSEA 2RS2A 1U8SA 3CCRN 4U8YA 4MMOA 5AQVA 2YTCA 2HNYB 4F4KA 3KK3A 5CAAA 5F8JA 3GTYX 3VEYA 2OCEA 5FROA 3M30A 2GVDB 1HQ2A 4L3NA 5KOWA 3F73A 3G8TA 2G9OA 4YUDA 1R0AB 1RBUA 2ZNZA 2PI4A 2E7WA 4OZ1A 4AM6A 3W2WB 3S6EA 3WXKA 2XHBA 2JDJA 1KVKA 2FJVA 2VUGA 1WUAA 3LM2A 1WJ9A 2DT9A 3RAMA 2MKIA 1VIOA 3OTOJ 1U1RA 4NA3A 5EY4A 3O5TB 4WYBA 4PCQA 2YH1A 1NB7A 1GTEA 2MLYA 1VSMA 2J8AA 4HWIA 4WXOA 4PQUA 3A3OB 4P71A 3CE8A 1LAWA 1GLBG 4E89A 2G8KA 5F8MA 3OVSA 4UY8T 4FF3A 4M42A 3DLHA 5SWMA 4OGCA 3SZ2A 2A18A 1UMJA 1CXQA 1X4FA 4QWCA 3AVBA 3LGHA 4RPFA 1F2GA 2BRLA 2O8BA 1ZTTA 3ZTSA 1SJ1A 5A2QY 2CPYA 4RNNA 3IR6B 3T1YF 3N5BA 3GYXB 3D68A 3QMQA 4JV5F 3QINA 4K5RA 2B56A 1BA0A 4R79A 3MM8B 1T05A 1W7AA 2FLNA 1D8ZA 1KAZA 4NLWA 2RHQB 3R6MA 3SDEA 5I4MA 4F50A 3AA3A 1J5OB 2UZAA 2V2ZA 4C8YA 1N5YB 4H4MB 1GMVA 3NVMA 2MKSA 1BI4B 3R2CJ 4CW7B 2ZJPQ 2VFTA 3Q8PB 2XLIA 4L8RB 4WKRA 5EXWA 5AE2A 3HPOA 2DB1A 5J2PA 1RQ0A 4OHXA 2LECA 1BIZA 3O9UA 3S9HA 2ZH5A 4B3RF 4DXLA 4I0WA 3VGUA 2VF3A 2ROGA 2DNGA 4X65F 1IBLF 2KG1A 2AU0A 3ZFVA 2EKYA 3WEEA 3NGRA 3BR8A 2VASA 1I94J 3U02A 3QBWA 1A6LA 3I0RB 4DV2F 2BOAA 5GIOA 4QOZB 5T7LB 3FNNA 1FFSB 4A61A 4NLGA 3C6TB 4R25A 2J5AA 2ASLA 4Z7YA 3JYTB 4QIWD 2V51B 3KG1A 5ETVA 3PEJA 2XCPA 3TOQA 3GG4A 5F0WA 2OJ3A 3SMSA 3NH2A 1IKXB 3PV8A 5DJBA 2IRYA 2VG7A 3L9ZA 4HHJA 5D78A 3S01A 3J7AN 5CCMA 3D1HA 2AEFA 4NLPA 2E1MC 4CZFA 1NMDA 2XS5A 3MEKA 4WK1A 1TELA 1LCUA 4IRCA 2Z1IA 4P2MA 2APOA 3OBIA 2X6SA 1YTYA 4NXMF 1YUWA 1KQSM 4Q0BA 3JAMY 1RADB 3DLGB 1GX6A 4C48A 2AYMA 2IDLA 2C28A 1TUUA 3VQ6A 3BQ1A 1C1BA 2IM0A 4LF2A 4ID5B 3PFOA 4DEZA 2WOMB 1S6OA 1DKGD 3VR1A 3LPEA 3ISND 2DGWA 2A6AA 4X62J 4BBYA 1VQLN 2DNPA 1S1UA 3S3OA 2BTFA 2QM1A 1Q5VA 3N6MA 4CF8A 4F3QA 2HLTA 3MDQA 1YRUA 3H5YA 3NGIA 1PCAA 3D67A 4UZCA 3ZZRA 4PQAA 3H5UA 1KVJA 3OQ2A 5C24B 2IBKA 2CQCA 1VISA 4L72B 2WSCC 4HVJA 5B8HA 3SUPA 2J9DA 3DLBA 3TEHB 3KLIA 4FJHA 4PUOB 2ZJQL 3KDOA 2Y9HA 1UAWA 2E8AA 1R8BA 1HI8A 3O9TA 4ES3A 1SJFA 4R0JA 4CLUA 3VQDA 4MT1A 3BBFA 2E20A 1WG1A 3QFPA 4ID1A 1T95A 4QYZK 1M5KC 4ZP6A 4Q45A 1OPZA 3NGYA 1JJ4A 5AQWA 1KFDA 1RDCA 4FO0A 2UUTA 1LFWA 4IQMA 1PIEA 1E6YB 4FXWA 5A8KB 2PEBA 5KG2A 3EM1A 5HK4A 1DRZA 2B4JA 2AZ3A 2HZVA 4J2DA 2NCKL 3OLBA 3OY9A 3EUNA 2W9CB 1YRXA 3NCIA 2VQFK 4I67A 4FJXA 4JI1K 2Q0RA 2UXDJ 1J5EF 4CEZA 2EEYA 3G71S 3T9ZA 3TA2A 1KN6A 5EX5A 3RMAA 2ZM6K 3VEZA 2QFJA 2R2TA 1WHYA 1FE4A 4B3TJ 4FZXC 3VQTA 1IR0A 3NMAA 4ZVPB 3D0PA 2HIYA 4I2PB 2AP6A 2K7JA 1RAHB 4MYTA 4FWKA 5B08A 2OD6A 4ES1A 1ILYA 1GOBA 4PXEA 2MQQA 3C6HA 4RO0A</