2HNYA

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
534
structure length
522
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 140
structure length 522
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnyA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnyA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnyA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnyA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hnyA05
4G1QB 3KTQA 4CGJA 4IBNA 3OHAA 4LY7A 1TKXA 3KLGA 3TAGA 3ZSZA 4CF1A 3IG1B 5KFVA 3DRSB 4URQU 1BCMA 3FFIA 1VSMA 3NF7A 4DF8A 4CJUA 3MEEA 2WK4A 4J2BA 1VRTB 1QAJA 1S6QA 4CJSA 4BE1A 4L8RB 3KMQA 1ASUA 3HVTA 3OLAA 3D5MA 1RT5B 1L3SA 2IDOA 3AVAA 1NNDA 3PX4A 5KFCA 1N6QA 1UOCA 4FW1A 4CJFA 3H08A 1S1UB 2A1SA 2FLPA 1JLGB 2W9CB 4KREA 3DLKA 4IFYA 4EZ6A 1YTAA 3PR5B 3NGZA 4TQRA 2IC3A 2Z1HA 3CJ0A 5CYQA 3AVFA 3ZSRA 1LWCA 2OZMA 4FJLA 3HO1A 1N4LA 4YNQA 3TVKA 4ECZA 2VWJA 3T5KA 1ZBIA 4FM2A 3NH1A 4WFXA 4I2PB 2HNDB 2Y1JA 3QGHA 5C42B 2WTFA 3LP1B 1RT2B 1C0MA 3DRPB 1T94A 1D9FA 1X9WA 3F9KA 4J9LA 3KLHB 2FVPA 3MEDA 4M94A 4PWDB 4KHUA 2HHTA 2JEJA 3BGRB 2R8JA 3NAHA 4XPEA 2V4RA 4RNHA 4Q8FA 1RYRA 4CCHA 3LAKA 1GX6A 4ZTJA 3V9XA 2KZMA 1JLFB 5DG9A 4ED6A 3RAXA 3O3HA 3QESA 3HYFA 3SV4A 3PO5A 4DU3A 2OPQB 4FK2A 1FKPA 1DTQB 1ASWA 3QEXA 3CJ3A 3C6UA 2R2SA 2FJWA 4I7FA 2YKMB 3OJSA 5KFRA 2BQ3A 1ZBLA 3SI6A 2X74A 1LW0B 3WNFA 3UDLA 3HPHA 3E01A 2XGPA 1NK8A 1L3UA 3IRXB 3MECB 2ATQA 1JIHA 2W42A 3LZIA 4FLZA 1W9HA 4Z4FA 2Z1GA 3ZT4A 3AVBA 1NHVA 3TABA 3T1AA 1RT3B 1B9FA 4BDZA 3RBDA 5DQGA 2Y1IA 4HUEA 4FLUA 4YFUA 4FLXA 1JLGA 2W9CA 1QQCA 1VSHA 4E7HA 1XC9A 2D3ZA 1TQLA 4EBEA 3AVIA 2KZZA 1T8EA 3AVMA 1I6JA 4RW9A 3KLEB 4W5QA 2IJFA 2JEFA 3QNOA 5JXSA 1WSEA 2XY5A 4OKKA 3VQAA 3OYEA 4O44A 2FLLA 2F96A 3UPFA 4K4ZA 4OPKA 1RBUA 2D0AA 1FKOB 4K8ZA 1RCHA 1LW2B 2HNDA 1SH2A 1K6YA 3WNGA 4RNFA 1RT2A 4CERA 4IFVB 4F4YA 1B9DA 4N41A 1S48A 5DGBA 4NYNA 4R5PB 1UA0A 3KLHA 3KHLA 4CIFA 4DL3A 4PWDA 5KI6A 3EZ5A 2KW4A 2G8UA 2KTQA 2D0CA 3H4BA 4NLUA 1CXUA 3CG7A 2X6SA 4DQRA 4DSFA 1BQMB 4G3IA 4MIAA 4E1MA 3L2VA 1GOBA 2CKWA 4NLTA 4WZQA 4FJGA 4J9KA 5J2PA 1JLCA 1S4FA 3OL6A 1SKWA 3T5LA 4KAZA 3SI8A 1NK0A 4J2DA 1C2PA 2AX0A 4CEOA 3VQ9A 4M45A 3G86A 5T14A 1ASVA 1JL2A 1LAVA 4HCBA 5FDLB 4H54A 4CJLA 4F2RA 2W9BA 1S9EB 3MECA 3PW2A 1WN7A 4PQUB 4KHWA 3PR4A 3AVCA 4E0DA 2BRKA 4O4GA 5DG8A 5KT4A 2BGGA 4Z4GA 4GC6A 1RT3A 4ED2A 2RKIA 3PV8A 3KHRA 3RRGA 1VSIA 1J53A 1TKTB 1WAJA 4F4XA 2EHGA 3VQ7A 4DF4A 4NLVA 2F8SA 3OYBA 2D41A 3H59A 4CF8A 1C1CB 4DTOA 4F4WA 3KLEA 1JL1A 4MFBA 3KHGA 3NHGA 3PW0A 3I5BA 3TQ1A 4KB0A 2UUWA 4OPJA 5KGWA 3RR8A 3CJ5A 1LW2A 1VSFA 4Z4EA 1NHUA 4E7JA 5HROB 4IRDA 5KG1A 4R5PA 4ZHRB 1YTUA 1T05B 4N47A 2PY5A 3OVNA 4E7LA 4NCGB 4CEBA 1TV6B 1TK5A 2C2DA 1BQMA 4CJVA 3AO3A 4B08A 2ZE2A 2IJNA 3IAYA 2VG6B 4CF9A 3QZ8A 4OVLA 4QPXA 4FK0A 3V4IB 4IH7A 5F9LA 4WE1B 3FRZA 1RT7B 1JXBA 1SH3A 3DLRA 4K4WA 2IM1A 1RBTA 2DFFA 3OL9A 1XR6A 2Q3SA 4LH5A 3O4QA 1RDRA 3NH2A 2XI3A 1S9GB 3GV8B 2XO7A 4DQPA 1RAJA 4FJHA 3SYZA 2DPJA 3KD1E 2R8HA 4I9LA 4XPCA 4Y1CA 4KAIA 3U3GA 2GUIA 3O3FA 4OKJA 3N6NA 4DFPA 3C6TB 2JC0A 2B5JB 2AGQA 3VQEA 3PW7A 2FBXA 1TKTA 3QEWA 4Q44A 4Q45A 4HTUA 5JS1A 3KKSA 3JSMB 2WRMA 4YR3A 4B9UA 1QTMA 3AO2A 3GV7B 4IG3B 1GOAA 3RB3A 5F8NA 4M3UA 3KLIB 4W5OA 1U4BA 3QINA 4IR9A 3K2PA 4FZZA 1KVAA 3CIZA 1NOYA 4M95A 4LSNB 5C24B 3VQQA 4K4XA 3RBEA 1SUQB 2E6MA 2D7SA 4K4YA 1Q9XA 1VSJA 4ZHRA 1T05A 1RDDA 4F2SA 5HBMA 1VSDA 3D0PA 5K14B 2R7YA 3NCIA 1I3AA 4CJQA 1HYVA 4B8AB 2C28A 4ED0A 4AILC 2IA6A 2VG6A 1I39A 2R8KA 4BWMA 2W8LA 1KCFA 2AWZA 1A5XA 1QS4A 4CJTA 4MKAA 1RT7A 1TL3B 4QAGA 3SNNA 1BI4B 3BSNA 3FFIB 3KOAA 1KRPA 3TANA 2XHBA 4KHNA 3G6YA 3QO9B 3MEEB 4QWBA 1ZBFA 1HYSA 4ZMMA 5KT5A 4M3RA 4E1NA 1S6QB 4URSA 4RU9A 3RAQA 5C25A 4F4ZA 3DMJA 5SWMA 3V1RA 1Z4UA 1HQEA 4FW2A 3QIDA 1BIZA 2ASDA 2OPPB 1D1UA 1RDAA 2IC3B 1EX4A 3DOKA 2XCAA 4CJWA 2G8FA 4CJRA 4CECA 5J2NA 4ZPDA 3NAIA 1LWCB 3P5JA 3EZUA 1S5JA 5CY4A 3AVHA 1S97A 1RT1A 4O0JA 3OYKA 2R2UA 5KFJA 2FBVA 3E51A 3L3VA 4RG8A 1S49A 3KLIA 4IOBA 4C8OA 3EYZA 1D9DA 2W7PA 3QGIA 4TY8B 2X78A 4H8KA 4CF0A 4MIBA 2LSNA 4X2BA 5KG0A 1ZBUA 3RB4A 4FJJA 2ZD1B 4KKOB 1RYSA 2BDPA 1X9MA 1RTDA 5K14A 4DLGA 1LWFB 2FJVA 2ASLA 3M8QB 4IKAA 2I5JA 1UAXA 2FVSA 1NJWA 4CJEA 4KTQA 4C8NA 3Q8PB 3B6PA 3PZPA 3C6UB 2O4GA 1EKEA 4DSLA 2ITGA 1S0NA 3MF5A 3Q8SB 3S3MA 3SQ1A 2J6SA 1VK0A 3M8RA 3K58A 1TL3A 4Y3CA 2HB5A 1BI4A 1KVBA 2YNGB 3E01B 3H4DA 4CEEA 1JLAA 1S1VB 3BDPA 4DL4A 1CLQA 3OYCA 2HAIA 4NZ0A 4JS5A 3QO9A 1UWBA 4NLXA 4OLAA 5L9XA 4B9NA 1C1AA 4FLVA 2ASJA 3D28A 3V1OA 4IKFA 3VQBA 4J9QA 4URGA 3H5UA 4B9MA 3I0RA 5L1IA 2O5DA 3OL7A 3N6MA 3IS9A 3ISNC 3HKWA 5CYMB 3HL8A 4AHRA 4KPYA 2OPPA 2BR0A 1WSFA 3QEIA 4RNNA 4U6PA 5T7BA 4J9MA 2UVWA 4RW8B 4DTRA 5KFBA 4GMJB 4RW9B 3LP2A 3MEGB 1YVUA 4KHQA 5FROA 3SCXA 2O4IA 1HRHA 3RTVA 4OKEA 1C0TB 3T3FA 1TK0A 3K57A 3ASMA 4IRCA 3ZT3A 1A5WA 4O44B 3EY1A 4KB7A 2HHUA 3HJFA 1JKHA 1C6VA 4M3WA 4DG1B 4K4TA 2AGPA 4CEFA 4GC7A 3GIJA 1ZBHA 3CFOA 4M42A 2Z1IA 4YQWA 4PUOB 4TY8A 3TAMB 4I2QB 3HSTB 3I5AA 3HPGA 4J9OA 2FVCA 3OYMA 4BE0A 2FJXA 2ZD1A 4KKOA 4ECRA 1LWEA 1LWFA 3M8QA 2IMWP 1IKXB 1GOCA 5F8IA 2P51A 5J2PB 1JLCB 1CZBA 3M8PB 3KK2A 4ELTA 4AHTA 1N56A 3V6JA 3LPTA 4FXDA 4Q0BB 4QWAA 2YHAA 1KSPA 4ZP6A 1IO2A 4NYFA 3OS0A 2HW3A 3PVXA 3OYHA 1HPZB 1EP4A 2RF2A 2W9BB 2YNGA 4Z4HA 4CIEA 3B6OA 1DTTA 3V9ZA 1S1VA 5KFMA 1KLMA 1NK4A 5KFTA 4N56A 4HUFA 4QOZB 3RB0A 3P83D 3MXJA 4NLOA 3GYNA 1XHZA 3HVRA 1ITGA 4O4GB 1QHTA 3MXMA 3NMAA 2RKIB 4ZVHA 3OYNA 5CYMA 5J2QB 4CK3A 2HVHA 3O3GA 3S3NA 4BWJA 4Y2AA 4RW8A 1WSIA 2JEGA 2OPRB 4WZMA 3MEGA 4FLWA 4ECVA 3TAFA 2BQRA 3GV5B 1C0TA 4RNMA 4MFBB 2QKBA 4CHYA 3S3OA 1UA1A 1QUVA 2J6TA 2V9WA 4JLHA 4DG1A 4KO0B 1DLOA 4ECSA 4QW9A 4KE5A 4JV0A 1U47A 2ZQBA 4DTSA 4PUOA 1F21A 3CFRA 1W25A 1BIUA 3TAMA 3JYTB 4I2QA 1QSLA 1LAWA 2XY6A 5C5JA 4KB1A 1JXLA 3M9OB 2B6AA 4NLYA 2ZE2B 2DPIA 4XIUA 4GVMA 1NK5A 1IKXA 1NKEA 2WHOA 3WNHA 1RT6B 1XWLA 2XI2A 2ETJA 3QEPA 1S9FA 3ZCMA 3M9MB 1B92A 3M8PA 1XR7A 1NJYA 4FLYA 4MK9A 4WXWA 4NLQA 1NKCA 3KJVA 5F8MA 4Q0BA 3LWMA 1X1PA 5KFQA 4CJ3A 3KLVA 1QSSA 1HPZA 3VQDA 3T5HA 1IKYA 1SH0A 3AA3A 4I9QA 3PW5A 1HMVA 3OL8A 4J2EA 1TAQA 2GV9A 4FJXA 3KIOA 2ZKUA 4KTWA 4DFMA 3EPGA 4OJRA 3L2UA 4ED7A 1SL1A 3HVAA 4DTJA 3HVWA 3MR5A 2WOMB 4ZPCA 2AU0A 1S1WA 2YNIA 4B9TA 3G10A 3MR2A 1WNSA 5J2QA 1Z25A 3NAEA 3QIPA 1K1QA 5L1LA 2BANA 2OPSA 4UQGA 1S6PA 2OPRA 2GIQA 2JLEA 2IGIA 2XWYA 4FBUA 3ISND 1S1XB 4IR1A 4Y2CA 4K4UA 1EETA 3G6XA 2R2TA 5KGXA 3TR8A 4KO0A 4F50A 3LALA 4RW7A 2G8IA 4EEYA 3MXIA 4O0IA 4CESA 5KT3A 3PW4A 3OYAA 5F8GA 3JYTA 2HNZB 2HNYB 3H5SA 5HBMB 5KFYA 4IH5A 3S9HA 4FK4A 3SUPA 4OLBA 1C0UA 4CJ4A 3VA0A 2PYLA 1D5AA 2WB4A 4QW8A 3EPIA 4JRQA 3BJYA 3NE6A 1BCOA 4JV2A 1S0MA 4ZVEA 1RTIA 1RT6A 5DG7A 1IKVA 3VQ8A 4IG0A 4DL5A 3OYIA 3ZSOA 3ZT0A 4FJMA 3RMBA 3PJXA 4NLDA 3L3UA 4CGGA 1J9AA 4CFDA 4ZVGA 2E4LA 2EX3A 3M8SA 4BE2A 4H4OB 5JS2A 4CK2A 1HARA 3U3YA 1FXXA 2YNFA 2PZSA 2YNHB 1HYSB 5F8HA 5C25B 4N5SA 3RWUA 4FJ7A 5KFNA 2XY7A 3VQ6A 3DMJB 3L2QA 1FK9A 3KK1A 1BGXT 1HNVA 4O5BA 3SV3A 1HQEB 1OS5A 1SKRA 2GIRA 4R0EA 2WOMA 1SV5A 5HRSA 3GIKA 2YV0X 4FBTA 3DOKB 3L2RA 4GW6A 5KFKA 4ZVFA 2B4JA 3RRHA 5J2NB 5D3GA 1N48A 2HVIA 2HMIA 4R8UB 4DU4A 5E41A 1RT1B 4ECUA 4CJPA 4QCLA 3KKRA 4ZP8A 1S1XA 2BE2A 3IGNA 1VRUA 3P1GA 4NYZA 4K4VA 4W5NA 3DOLA 1NJZA 1JLEB 3HP6A 1RDBA 1EXQA 5DMRA 3T19A 3GQCA 4U7CA 5DGAA 5EUHA 1GX5A 4KV8A 2HNZA 2HNYA 2EC0A 3NH0A 2AJQA 3Q8RB 1RTDB 4Q8EA 5KFXA 3NL0A 1N5YB 3PUFA 1T03A 2I5JB 4CGHA 3K5NA 3OJUA 3ITHA 2BRLA 4H4MB 3IGVA 4CK1A 5DK5A 3SQ2A 4BACA 2JGUA 2VWKA 4O3PA 4QWDA 5HP1A 3K5OA 4KBIA 3NDKA 3THVA 3SZ2A 3LWLA 2F8EX 3CDUA 2DFHA 4DSIA 1NK6A 3SUOA 4ECYA 2E9RX 1K1SA 4IDKB 4QWEA 4O55A 2R8GA 3AV9A 3SFGA 4KHRA 2VA3A 1JLAB 4H4OA 4PY5A 5KTQA 3H5YA 4TYAA 1U04A 2YNHA 2BQUA 2GBZA 1UWBB 3V6KA 2F8TA 4HCCA 1QSYA 3NGDA 5EDWA 1TGOA 5DLGA 3NKYA 1KLNA 4CFCA 3V6DB 2P5GA 3KK3B 4ZP9A 4YR2A 2DTUA 5JUMA 3NBPB 4W5RA 2XCPA 3I0RB 1REVA 3IS9B 4KTZA 1R0AA 4DSEA 5DQHA 4ECTA 5KFIA 3TI0A 3V9SA 3L2WA 3FDSA 5KT6A 1CZ9A 2FBYA 4CEQA 4LQ9A 4E7KA 3LP2B 3CDEA 5KFDA 4RW4B 4TQSA 3DLEA 4R8UA 2D0BA 4DSKA 2W9AA 2QKKA 3T5JA 5EWGA 1L3VA 2A1RA 1JKHB 5J2MA 3RB6A 4TSXA 4J9NA 3SPYA 4AH9A 4NLRA 2WONB 2IS3A 5EU7A 4DS5A 4MQ3A 3KNAA 1RT4A 1JLEA 5KFAA 3F73A 4WXOA 3L8BA 4CFAA 4DEZA 2W7OA 3QNNA 4B9SA 5F9NA 4W5TA 4KHSA 3GIMA 4K50A 3BSAA 3D45A 3NF8A 2JEIA 1LWEB 2YKNB 3OLBA 4AHUA 1N5YA 1XR5A 3FQKA 1U48A 1T3NA 4H4MA 1IKWB 1T7PA 3N6LA 2CJQA 5KG2A 3IN5A 1JX4A 1X9SA 4DTNA 4CIGA 5CZ1A 3KK2B 4CF2A 4TY9A 3UIQA 3O4NA 1WSHA 5KT2A 3OYJA 1EP4B 4IDKA 2RF2B 4ID5B 1SL0A 4DQSA 3BSOA 1DTTB 4MK7A 5KFZA 1JLQA 3DDKA 4DSJA 3RR7A 1KLMB 4Q5VA 3ZT1A 3LDSA 3AA2A 3C94A 3U6FA 2I1RA 3ULDA 4ED3A 3HT3A 4DTMA 3QETA 2FVQA 2RDJA 1Q9YA 3V6DA 4QWCA 3KK3A 3OY9A 4NCAA 3NBPA 3Q8QB 4HUGA 4F3OA 4JS4A 3BSCA 1TL1A 5HLFA 3LPUA 4EP4A 2ILZA 1JXEA 1L3TA 3OHBA 5KRTA 3SFUA 1NK7A 1VSKA 4CEDA 1TVRA 4RW4A 4J9SA 3DRRB 1RA7A 3AVJA 3K5MA 4F4KA 2XGQA 2IOCA 1RDCA 2R2RA 4DL2A 4OL8A 1HNIA 4O3OA 3DI6B 3LP0B 4DS4A 4DQIA 4TLRA 4EP5A 1VSLA 4WYLA 1DLOB 3DLBA 2WONA 2HHVA 5DQIA 4EO6A 3UQSA 5KFLA 4M3YA 4DMNA 1RBSA 1J5OB 1JLBA 3CJ4A 3KLFA 4ECQA 4EO8A 1TP7A 4IRKA 4DTUA 4IQXA 2B6AB 5J1EA 2V4QA 4K8XA 1S10A 4NLSA 2ILYA 4NLGA 4EZ9A 3PHEA 1KHVA 1KTQA 2YKNA 1XHXA 3H5XA 1D8YA 3LAMA 3BQ0A 1ZETA 5F8JA 1IKWA 2OZSA 4CHNA 3SQ0A 1L5UA 3FSIA 4CGDA 4FYDA 4RUCA 2UVVA 4Y34A 2FLNA 4CHQA 4DLEA 3ICLA 4DTXA 3TAQA 2IBKA 3KJVB 2XRIA 4PA1A 1KVCA 3CDWA 2G8WA 4RW6A 4DFKA 4ID5A 2ALZA 4N76A 1IKYB 4TYBA 1HMVB 4ZPAA 3BQ1A 2C2RA 4E89A 3AVKA 4YP3A 1TKDA 4LSLB 4G1QA 4WYWA 4EYIB 3AO1A 4ZTFA 2P5OA 3CWJA 3OSPA 2AX1A 2QXFA 4OGCA 3IG1A 3H2LA 5F8LA 4M3ZA 3DRSA 1RNHA 1J54A 2HHXA 1S1WB 2YNIB 1IH7A 3DM2B 4ECXA 5EWEA 4DQQA 2C22A 3K5LA 3QIPB 4AHCA 1VRTA 1SL2A 5KFEA 3NGIA 2BANB 2OPSB 5HRPA 1S6PB 4MH8A 1RT5A 4BDYA 5KFGA 4KI6A 1ZYQA 3DRRA 2XC9A 1S1UA 2V0NA 1EETB 5KFWA 2R8IA 3DI6A 3LP0A 4YR0A 1BQNB 1RBVA 3I0SB 3LZJA 3DLHA 5KG3A 2G8VA 2GC8A 4RW7B 2PYJA 4M3TA 3I8DA 4RUAA 4OGEA 4FJIA 1QAIA 4FCYA 1J5OA 5KFHA 5I42B 3FQLA 5CZ2A 1C0UB 4CHPA 3TWHA 4MKBA 4I2PA 3AVLA 3VA3A 5C42A 2P1JA 3LP1A 3DRPA 2E9TA 3VQPA 5EWFA 1G15A 4ECWA 1RTIB 3VQCA 1IKVB 2HHSA 4IG0B 1NJXA 2RN2A 3BGRA 2OYQA 1S1TB 3G6VA 2IM0A 3G0ZA 1YVFA 4FM1A 5I3UB 4CJ5A 4B9LA 5L1JA 3TAEA 3V9WA 4DU1A 1JLFA 4CGIA 2YNFB 1NKBA 2B43A 3TAPA 2Z1JA 4B3OB 4Z4CA 2IM2A 4DWIA 2OPQA 4LD0A 3MFHA 5KFUA 1DTQA 4Z0UA 1C1BB 3CFPA 2YKMA 1FK9B 5HRRA 3KK1B 4LSLA 3MR6A 1TKZB 1HNVB 5KG4A 3I5CA 1LW0A 4AHSA 2RDIA 1Y97A 3CJ2A 3HHKA 4O3NA 2KFZA 4MK8A 3H40A 1SV5B 4NLPA 3DM2A 3IRXA 4C8LA 1IG9A 3OYLA 3NF9A 4FJ8A 5D3GB 3RMAA 2HMIB 4FLTA 3QYYA 2YHBA 5KFFA 4ED1A 2HHQA 4NLWA 4CHZA 3A2FA 4DTPA 2UVUA 3SJJA 1TAUA 2OH2A 3BREA 4B8CA 2BE2B 3ZSQA 5FRNA 4YMEA 3M9NB 4ICLB 3MAQA 1VRUB 4WFYA 1BHLA 1ZTWA 1BQNA 3I0SA 3DOLB 2AGOA 3VQ5A 3OSNA 4CE9A 3K59A 3RMCA 3PY8A 3AO4A 3NFAA 2UVRA 4J2AA 3QGGA 1MMLA 3HK2A 3HXMA 3HM9A 4KV8B 5FRMA 2HHWA 4CJKA 2HWHA 1RTHB 5I42A 3CM5A 1FKOA 1T03B 4LH4A 3ITHB 4LQ3A 4E3SA 3AO5A 4IFVA 3ZSXA 3RMDA 4FJ9A 3MFIA 5HP1B 5KG6A 3HPOA 2JC1A 4KFBB 4KHYA 4F3TA 2W8KA 4O3RA 3DYAB 4DL6A 4CGFA 1S1TA 2J6UA 4RNOA 3KHHA 3AVNA 5I3UA 1MU2B 4NRTA 4Q43A 2NUBA 1NOZA 4M41A 4CFBA 1HJRA 2VA2A 4B3OA 1WSJA 3V81B 2FBTA 3DLGB 4Z4IA 3ZSYA 4RZRA 1RILA 1C1BA 3V6HA 3ZSWA 4C8MA 3OYFA 4TN2A 1TKZA 4KRFA 2UUTA 2C2EA 1REVB 1R0AB 5FDLA 4AHVA 4B9VA 4O3SA 3NF6A 3VN5A 4FS1A 1QE1B 1S9EA 1Q8IA 4M3XA 4F8RA 1SKSA 4PQUA 4ID1A 1TK8A 3NGYA 4O4RA 3PX6A 2HWIA 3DLEB 2G8KA 3CVKA 4HYKA 2DY4A 2X6NA 2VG7B 5KFPA 5J2MB 1WAFA 3QLHB 2VG5B 3HP9A 3OYGA 4ICLA 5SZTA 2DFEA 1HQUB 1RA6A 1RT4B 3VQSA 4ED8A 4J9PA 5HRNA 1C1CA 4EBDA 3SUQA 2KQ2A 2IAJB 1S0OA 4HHTA 5KFOA 1RTJB 5KG5A 4CEAA 1RTHA 3CYMA 4JUZA 1BL3A 3QERA 5HROA 3SPZA 4FJKA 3VQ4A 4E19A 4FM0A 1HYZA 4CEZA 1U09A 4KFBA 1BISA 4NCGA 2WCXA 3QZ7A 3V1QA 3H98A 1TV6A 3DYAA 3ALYA 4O3QA 2KFNA 3ZSVA 1KHWA 1JLQB 1MU2A 1CXQA 3AA4A 4FJ5A 2ATLA 1WLJA 1Z26A 3V81A 3DLGA 3V4IA 3LANA 2D5RA 1TKXB 4WE1A 1O1WA 3CM6A 3KLGB 1VSEA 4CHOA 4FZYA 1LV5A 4ZP7A 2QE5A 4JV1A 5KRSA 1KFSA 1TL1B 5HLFB 3C95A 2FC0A 3CO9A 5DLFA 1S9GA 1QE1A 3WNEA 3OS1A 3OS2A 4ELUA 3HVTB 2D3UA 1TVRB 2QV6A 3MR3A 1N6QB 3AVGA 3LP3A 3GIIA 2QK9A 4FS2A 4KI4A 3SUNA 3ZT2A 3QIOA 1YT3A 1WSGA 5KG7A 2VG7A 4FZXC 1HNIB 3C6TA 3DLKB 4IFYB 3TARA 2B5JA 3QLHA 3OYDA 1NK9A 4KSEB 2VG5A 3BQ2A 1IM4A 4TXSA 4E7IA 4K4SA 1HQUA 4WFZA 3SQ4A 3KD5E 5CYQB 1ZTTA 2G8HA 3JSMA 4KHMA 2FVRA 4J9RA 4BDPA 2E6LA 1JLBB 1CSJA 3KLFB 3GILA 2IAJA 4IH6A 4ELVA 2XY8A 3V9UA 2RPIA 4IG3A 4EYHB 4FVMA 1RTJA 5J1EB 1U49A 4ZPBA 3CQ8A 1W0HA 4FJNA 4HKQA 3PJWA 3MEDB 4LSNA 5C24A 3MTKA 2AQ4A 4NRUA 5KT7A 4JRPA 4DFJA 1SUQA 4C8KA 1A5VA 1XI1A 1D0EA 4Y1DA 3BR9A 3UR0A 5L1KA 4EBCA 2OA8A 5KFSA 1U45A 3PO4A 4RW6B 4DL7A 4HVJA 2E9ZA 2IM3A 3KMSA 3PX0A 3QEVA 1FKPB 3AA5X 1WNEA 4NCBA 1KFDA 4XO0A 4I7FB 1RBRA
chains in the Genus database with same CATH superfamily
3DGPA 5C2CA 3KLGA 2V2QA 3UO0A 3ZSZA 4CF1A 4JHDB 5KFVA 1S0VA 2O8BB 3OHRA 2ZNYA 4DF8A 2A2DA 4CJUA 5AXKA 3MEEA 4CJSA 4DR6K 3BO2A 1CQMA 4WQ5A 2G4BA 1N6QA 4QQBA 1UOCA 4FW1A 2GHPA 3H08A 4CJFA 1NWKA 4OHYA 1HL6A 2W9CB 4KREA 2HQFA 3DLKA 1OY6A 2FSKA 3TSPA 3Q0AA 1UTAA 1RWKB 2BYCA 5CYQA 3D7EO 2B9EA 4E98A 1QHAA 3QAUA 1OYDA 2VUGA 1N4LA 4ECZA 2MQNA 1ZBIA 3R5GA 1VDHA 4QYZJ 1JCFA 3NH1A 4WFXA 1U1PA 1HX1A 2QWPA 2Y1JA 5T7LA 3M2UA 4YY3J 2OSRA 3R8EA 3I55S 2XBPA 3HRGA 2BJ8A 5BPMA 3F9KA 2M7SA 1RP5A 2FVPA 4M94A 2R7VA 2Y3YA 4KHUA 3CD5A 3CF5L 2HFNA 3K8WA 1R43A 3NAHA 4XPEA 5BN8A 2Z56B 2CQDA 3MPVA 4USUA 2NPFA 1GX6A 5FLXY 5DG9A 4X4OA 3RAXA 2DO4A 5CH7B 3HHDA 3SV4A 4DU3A 3JXUA 1RWNB 4I4BA 3QEXA 3CJ3A 3DAWA 3U9DA 2YKMB 1Y10A 2VD3A 2EVZA 3OJSA 2BQ3A 1ZBLA 2ZBRA 3SI6A 3UDLA 5M1OA 5IWAF 3PIOL 1WUAA 4XH5A 3W8PA 1BWEA 1YHQS 2ATQA 1W9HA 2FY1A 1HIYA 3CCRS 3CPWM 5E3AA 2XS2A 1SC3B 4QZVB 3W2VA 3O9TA 4FLUA 4O8KA 1JLGA 3LO3A 1QQCA 3TP2A 4EBEA 4H4KC 2ZH8A 2EFPA 2HMPA 3AVIA 1H73A 3NMRA 3TTCA 1RGIA 2NXCA 2V8VA 4B17A 1TL7B 4PWWA 4OKKA 3VQAA 1VBXA 3FZFA 1VHXA 3ENWA 3UPFA 5MAOA 3WX4A 1R89A 1VQ6S 4RNFA 1M90T 4JYAF 4N41A 3ZC4A 5DGBA 4R5PB 5F0UA 4CIFA 4DL3A 4PWDA 2ZOMA 3F41A 4MT1A 1T3VA 3TZYA 1F60B 5M1KA 4CO2A 1BQMB 3C16A 4G3IA 4MIAA 1RHUB 5DM6Q 3EXYA 4WZQA 3EUNA 4FJGA 4J9KA 4UF4A 1UPMB 5E7OB 5AJ3K 1JLCA 1S4FA 4A57A 3TUZC 4C1NK 1SKWA 4KAZA 1FWPA 2CRLA 4FF2A 1KEKA 1BG3A 5BRDA 3G86A 5T14A 5D15A 1MDUB 1JL2A 4ZJLA 5FDLB 4H54A 4CJLA 4F2RA 4ANDA 3EX7B 1RHRB 3DRXA 3H42A 2CVIA 4KHWA 1MLAA 2ZJRQ 2RSQA 3ZX2A 2E5HA 5AQOA 4CZLA 1SC1B 4DV7K 5KT4A 4NYPA 4QIWD 4GC6A 5D4NA 3P49B 2BW7A 1N33F 2UUAK 3OBWA 3CC7S 1GLDG 4A46A 4OPAA 1TKTB 4WF9Q 1XMOK 4DTOA 1JL1A 3IUCA 1OH5A 3KHGA 4JN4A 3GFHA 4M63A 5ETNA 4FP9A 4K8RA 4CT8A 1HJOA 1AYEA 1SQKA 1Q78A 4X4VA 1EWQA 4OPJA 4CJ7A 1HNXF 1LW2A 3QRPA 1SAZA 4Z4EA 2C2OB 1M5HA 3HHLB 4IRDA 4KQZA 5KG1A 4EMDA 2VASA 1YITS 4ZHRB 1XMQF 5HVHA 4LF2A 4N47A 3JSYA 3DHWC 5AQIA 3SCKE 3MAAB 4B3RK 2W6LA 3IO1A 1TELA 2EXUA 4QPTA 2ZE2A 3OXFA 2C42A 2R9LA 3AQPA 4DR1J 2K7JA 1XIQA 2RMLA 2ZFHA 3DHXA 1RABB 4QPXA 3SK3A 3OR2A 1WI8A 3F56A 1JXBA 2O8FA 3PNIA 1CJTA 2IM1A 2XHWA 1N8RT 2Q3SA 3O4QA 4NL5A 3BKTA 4ITSA 3M2RA 4K2JA 3NH2A 2YX1A 1BO5O 5GAGI 3SYZA 3KD1E 3KXDA 2AYBA 2QZ8A 1EKSA 3BH6B 3EZOA 3MWPA 2A6OA 1ILYA 4QIFA 1O6XA 4NB4A 2HQCA 4USKA 2KXHA 5JMVA 3M2VA 1X4DA 3MCOA 3NCPA 3VR1A 4I56A 3D66A 4B3TK 4YR3A 2RB7A 5B0DA 4GVBB 1Y5LB 3AO2A 3GV7B 2H4YB 1KVIA 2NSBA 2MDAA 2VQEK 2IDEA 2VCPA 2EBGA 3RB3A 4M3UA 3LPYA 3KLIB 3VGTA 1Y0HA 1U4BA 3CD6N 3QINA 1KVAA 4M95A 5C24B 3VQQA 1Q4RA 2GHVC 2QG9B 2E6MA 3R9LA 4ED4A 4CDIA 1RDDA 2P6SA 4CO1A 4F2SA 5HBMA 1VSDA 4Q2LA 4C11A 3BS9A 3D0PA 5K14B 2R7YA 3PYDA 1I3AA 4WKRA 4CJQA 2XULA 1CC7A 1HYVA 1RCXB 1FXLA 4OZ2A 2C28A 5AT1B 4OZNA 4FOIA 4BG8A 2IA6A 2VG6A 3FBCA 4X84A 1I39A 2CQ1A 3S01A 3CCUS 2AWZA 5CHCB 1C4CA 1RADB 2HAFA 3BBFA 3TEHB 1QS4A 2HS3A 1RT7A 1TL3B 3F44A 4QAGA 3FFIB 1KRPA 2XHBA 1OSCA 4KHNA 3HHEA 2ZZNA 1GH8A 3QAEA 3J81O 4JI4F 2N4CA 3NGRA 3AD9C 3QO9B 4J37A 4QWBA 5JVGL 1NGCA 5KT5A 4ZMMA 1ZBFA 3ID6A 4CH1A 1S6QB 4M3RA 3RAQA 1IJJA 1N36J 4JI3F 2BW2A 1FWKA 3R2DJ 2WTUA 2ZJPQ 3PYFA 4DUZK 4FYWB 2DPNA 5DZ7A 1Z4UA 4Y0WA 2GMJA 4JKHA 2UXCK 2OPPB 2YWHA 2DY9A 2G0JA 4P74A 1NUEA 4DR7F 3SMZA 2PMZD 1PYTA 1EX4A 4H4KA 4CJRA 4CECA 1QVGM 1J27A 2XTJP 4IZ9A 2E1PA 1S5JA 3MGJA 1OH7A 1RT1A 4O0JA 3I56N 3OYKA 2VC1A 4M7XA 3L3VA 4RG8A 2OSQA 1H6KX 2FHOB 4GY2B 4TY8B 1TFWA 1ZA1B 1NGAA 4H8KA 2DHHA 3OW2M 1NXIA 2ZHBA 3P6YC 3CPEA 1WG4A 2IFXA 3KWMA 1M1KO 1XNRF 1N34F 2E1YA 1X9MA 1N5TA 5FPMA 3TJAA 5HJXA 2GELA 4JK7A 2I5JA 1RB0A 1UZHA 2RDDA 2W1BA 2FVSA 4XDCA 1WKLA 3PFEA 1RHMB 5K8MA 3PHTA 2HGMA 3C6UB 4C3MA 3W0LA 3R1LA 3S3MA 3BGLA 2VOPA 1VK0A 5L9NA 1OQ6A 1TYQB 4IYQA 4Y3CA 2H54B 2HB5A 1BI4A 5F2RA 3BDPA 4JNEA 5ETMA 3O6WA 4JS5A 5D77A 4OLAA 2H5IB 6AT1B 5L9XA 4B9NA 1N0VC 4FLVA 2ASJA 3CERA 3H5UA 2ZVSA 3VEWA 2KHOA 4GKJJ 3N6MA 3ISNC 3EGNA 1H2UX 4AHRA 1E6VB 3HCXA 3T1HJ 5BREA 3QEIA 5T7BA 2UVWA 4RW8B 2BTFA 3QICA 3D2WA 1YVUA 2NREA 2CQCA 1UJ6A 4Z37A 3RTVA 4HL9A 4NMLA 1C0TB 2YTCA 1ZC6A 2ROPA 4IRCA 1N88A 1A5WA 2EFNA 3HJFA 5EX3A 2RQMA 4LF1A 4CEFA 1ZPVA 3Q23A 4GC7A 4DDFA 1ZBHA 2E5GA 2LYVA 3MPYA 2Z1IA 4YQWA 4DHYA 3GYGA 3Q8UA 1VQ7S 3TAMB 3KWIA 2HQDA 2MZSA 2HHHJ 4J9OA 1GLFO 3OYMA 1D3WA 2EG1A 5K8OA 2Q2RA 1M5SA 1WC6A 4CNYA 3DU6A 2FTRA 4JI8F 2RHSB 4F36A 5F8IA 2P51A 4NA2A 2QA4N 3FZKA 1H7WA 2ADCA 4ELTA 2DD8S 4ZK7M 1U25A 3HLUA 1VS3A 3VPZA 1KSPA 3A8JA 1IO2A 3OS0A 4YHHK 3PVXA 1CJUB 1EP4A 3ZTRA 4Z4HA 2GUPA 1DTTA 1W2BR 2D0OA 4BR9A 5KFTA 3RB0A 2MQ8A 3MWTA 5M2RA 2QM1A 1ZM3A 1YIJN 2I6WA 3UE2A 4LBPA 5LSLA 3H46O 3TYTA 3BGOP 3UVJB 1YG0A 1KAZA 2MMYA 2XZDB 2L9NA 2YCHA 4ZVHA 4DV4K 2HVHA 2HZAA 2CJKA 4EFHA 2IJRA 4WQ4A 1WSIA 2JEGA 4WZMA 5BYQA 4FLWA 2CA9A 3GG0A 2BQRA 1HKBA 2QKBA 2PGCA 3P3DA 2OTJS 5TKWA 1WACA 3OPKA 2AMCB 1QUVA 2J6TA 4DG1A 4P72A 1NGBA 1NNEA 1JXVA 4ECSA 1RAAB 4CQ1A 3IM9A 4KE5A 3TJ8A 1SJ3P 1UPPA 2O8CB 3OFFA 4DTSA 4PUOA 1S6OA 2WVBA 3SBTA 3EVOA 4YOEA 1W25A 1BIUA 4JI5K 2F4VK 1K9MT 2CNOB 5HVGA 2HSEB 1WF2A 1ZZNA 3CJKA 2HBMA 4KB1A 5ADZA 4DU8A 2B6AA 3NGSA 1GK8A 2Q43A 4MO4A 2QTDA 3VZIA 3SQOP 2OCEA 3CJ1A 4I6WA 1GMWA 1V5IB 3M9MB 1B92A 3SLCA 1EB0A 4KH1B 5BRFA 4NLQA 1X60A 3KJVA 5F8MA 4LFAJ 4C4WA 2X1BA 1HNWK 4CJ3A 2ACMA 1HPZA 4B3SK 2UUBF 4GRSA 1JQGA 3AA3A 1VYAA 1HMVA 3OL8A 4J2EA 1TAQA 3NGKA 4F0MA 4FJXA 3QJPA 1SS6A 1MWMA 4NXNF 5IM0A 3DDNA 4DFMA 4OJRA 3HVAA 3DRYA 3HZGA 4WP8A 1U0SA 2AU0A 1S1WA 2YNIA 1ZAWA 3BKUA 1DHMA 4OX9K 2MQOA 1FD8A 4DZ6A 1HWIA 3POTB 3PDNA 5L1LA 2OPSA 3M4XA 5H9EJ 2OPRA 2P9SB 1ZZFA 2IGIA 2PN6A 1S1XB 4IR1A 1X5TA 2DH9A 3HTVA 3G6XA 3RRKA 3CHWA 2WBRA 5I3QA 3LOUA 3ZETA 4NA1A 2G8IA 1UVMA 4OMFG 2E7XA 4XH1A 4CESA 3H5SA 3FZLA 4IH5A 3KHYA 1O5JA 4F0HA 2F9WA 3AXMA 1V6HA 3CCVN 1QAYA 2VOOA 4I0WA 1OIAA 2JFKA 3VF0B 1S0MA 3CGIA 1Z1ZA 4U7UD 1VQKN 2QI2A 1RT6A 2VC0A 5IQQA 2VQFK 2HRYA 4LF4F 2HPUA 4FJMA 1S7HA 3QSYB 2KVQE 5LOQA 1J9AA 1UAWA 2YH0A 3DXSX 1IR0A 4H4OB 5JS2A 3MUVP 2QTWA 2P9NB 2XSJB 3R5DA 2YNHB 1K8KB 3ZTQA 1RU1A 4BHQA 5F8HA 3UKUB 1QZ6A 3VEYA 3CJSA 4BS2A 3RWUA 4FJ7A 4X62J 3VQ6A 1YJWS 2DKOB 3PTWA 1BGXT 1EKRA 1HQEB 1OS5A 3R6MA 2QW9A 1R8CA 4QS8A 1CS4B 2O1PA 2Z2YB 4FBTA 4CP5A 3CC2N 1VJWA 4GW6A 5EGYA 1YX2A 2VDIA 3QMQA 5BR8J 4LF8K 3QT6A 4DU4A 2ZWHA 2DNQA 2UXBF 4CJPA 4QCLA 3JTPA 2DITA 2I0XA 3J7ZT 4A8WA 4W5NA 3Q2SC 1HR0K 2JOQA 4R79A 1JLEB 2GGPA 4UUXA 1FJGK 3T19A 3E9OA 3GQCA 3GFXA 3KYLA 5EUHA 2W41A 4KV8A 2GX8A 1OSDA 3J81Y 4DR6F 4DR3J 1RTDB 4Q8EA 4YUDA 5BPNA 4DR5J 3ITHA 2EPIA 1V4TA 2VWKA 2NRVA 5AQSA 3VETA 4O3PA 3UNYA 2D4WA 3THVA 3CDUA 4DSIA 2YPYA 2L9WA 1WHVA 4KHRA 2ZH1A 5KTQA 5AE1A 4KHPF 4TYAA 3AOCA 2BJ3A 3V6KA 2DXDA 3LDOA 2O3DA 2YWGA 1FXDA 3NBPB 2XCPA 2BUNA 1REVA 2QWQA 3IS9B 1IBKK 4ILHA 2QMUB 2HBYB 2CQHA 1QLNA 3V9SA 1XUPO 2PAVA 3OTCA 2FBYA 3K0SA 3W1YC 3TA0A 4LRFA 5D0HA 3W5ZA 1K8AO 1G6BA 2DR6A 2FHJD 2ASOA 5BPLA 1NGIA 1JKHB 2B8PA 3RB6A 4IQMA 3UD3P 1F0XA 1N54B 4FPAA 4AH9A 2Q6BA 1PJ6A 3GIRA 5EU7A 4MQ3A 3K0JA 3KNAA 3VEOA 1RT4A 5KFAA 4WXOA 4UOCA 3JAMO 4CFAA 4L6V3 1RBOB 3B54A 4KHSA 5HO4A 3BSAA 3D45A 4NYOA 2H5EA 1N5YA 5HQ8A 5B0CA 2IVFB 4V19J 2VBWA 3ZNJ1 1T3NA 2QFIA 1RHQB 1T7PA 1NH7A 3N6LA 2E1RA 3VCDA 1X9SA 4CIGA 5E33A 3G8SA 4CF2A 4TY9A 2DGTA 3A8YA 3UIQA 1U6BA 5CE3A 1WSHA 2KHCA 5KT2A 2GO9A 4FWNA 3KK7A 2BUPA 1ESVA 2WW4A 4PYAA 3D9BA 3HDSA 3QATA 3T9NA 4NMXA 1KLMB 3HSCA 3ZT1A 3HSDA 4R25A 4RR5A 3AA2A 1MMDA 1APSA 5AZJB 4M1KA 2RDJA 1HHTP 3GG1A 1UVIA 3OY9A 2V9KA 1OY9A 3DXKA 3JQJA 3BSCA 1TL1A 4JI8J 1HI0P 4MKYA 3G8QA 2ILZA 2Q97A 3OHBA 5KRTA 3SFUA 4IOXA 4CLLA 2LKZA 1HBMB 1VSKA 4RW4A 2OJ3A 1IWAA 2XGQA 3AOAA 2IOCA 1VQNN 5AJ3F 1UMJA 4TLRA 3CO0P 2B4VA 2CAJA 2A40A 4CW7B 1FDDA 2CZ9A 2WONA 5DQIA 3IAM9 5H9FK 3KG1A 2VFUA 3G71N 4GO7X 4EO8A 1OKJA 1JNZB 3B6BA 1G4CA 4IRKA 4IQXA 1H2TZ 2RAQA 2DCUB 4J7CA 2V4QA 1SZ2A 2ILYA 4NLGA 2Q1NA 1AXQA 4WCEQ 1XHXA 1D8YA 3LAMA 4DV1J 3HHLC 1ZETA 1IKWA 4MDBA 2UUAF 3OT9A 3W9JA 4CHNA 3SQ0A 4FYDA 4RUCA 3QWPA 1VBYA 3JSBA 3R1XA 4PCQA 2C1EB 4PA1A 2KDOA 1XMOF 4RW6A 1CJKB 4ID5A 1IKYB 1U2RA 4ER8A 4OYWA 3H3OB 3GOIA 1Q81T 3AVKA 3KJFB 1UFKA 3OFHA 1TKDA 1WG5A 3US5A 4EYIB 1R0BG 2IBOA 2B8QA 1XNQJ 4DL0C 2AX1A 2QXFA 1UJ5A 3H2LA 4JHDA 2O8BA 1J54A 4B3MK 1IH7A 2NLXA 3RAMA 4F04B 4AHCA 2J0SD 4B3RF 4LIRA 3S41A 5IXUA 2KYXA 3CCZA 3AY9A 5HJYA 4PHTX 4OYOA 2H51B 4DV2K 5H1SV 3I0SB 3HHNB 1RHKB 5F3TA 2G8VA 5DS7A 2PYJA 4M3TA 4HVZA 4NXNJ 1OH6A 4OGEA 4FJIA 1M5KC 4JV5J 4FCYA 2HQ3A 1GLLO 1ROFA 4F02A 5IFMA 1YF5L 1OVQA 3AVLA 3VQPA 3IM8A 4YOUA 1FVQA 4L3NA 4BRDA 5AQPA 4IG0B 3SAFA 4CO3A 1NJXA 4BRKA 4OYAA 1Y5NB 3G6VA 2NRZA 4FPIA 3UCZP 5I3UB 4CJ5A 4B9LA 4PKIA 4B3TF 1BD6A 1ZAXA 3T6JA 3MMCA 3FR0A 2FZGB 2Z1JA 4DV3J 2IM2A 1WOSA 4DWIA 3RSEB 4LD0A 2VQEF 3Q2TC 3C0BA 2LMIA 1C1BB 2YKMA 1V4SA 1TKZB 1S5ZA 1HNVB 5KG4A 1HD1A 3I5CA 3MMJA 2HZCA 3CXCM 3CDAA 5C12A 1U0HA 3J81U 2BZ2A 3DM2A 4C8LA 3G96A 1WDTA 3TZXA 5BN9A 3FJ2A 1OY8A 2UZAA 4HH0A 3CD6S 1V5VA 2QT7A 5AQLA 3QYYA 2YHBA 2DT9A 1OYEA 4HACB 4NLWA 4A48A 1GLEG 4DUYJ 3D6FB 3SJJA 1TAUA 2QC3A 2UXDJ 4B8CA 4YMEA 1VRUB 4WFYA 1BHLA 3NFAA 3AJDA 3MMAB 5DDRC 4CH7A 1DBDA 4LF9J 5E3RA 3HFVA 4GKKJ 2V51B 3J7Z5 3P4UB 2ZBCA 3HK2A 3EICA 2UP1A 3W61A 5FRMA 5A8WB 4FNIA 5BXIA 1RTHB 2LECA 1HI1A 2E8AA 4OYMA 4DUZF 4QYZK 4FJ9A 2UXCF 3L9ZA 3HPOA 4F3TA 2UXBJ 4O3RA 4MLEA 1CULA 3WHIA 2YI1A 2C3YA 4CGFA 2FYXA 2J6UA 4RNOA 3KHHA 2AP6A 3AVNA 1U1RA 3VGUA 3GDQA 4NRTA 4YOTA 4M41A 2V4JB 2VA2A 3CJ7A 2W4DA 2MTLA 2GW8A 3H3NO 3V6HA 1Y3JA 4C8MA 1X8DA 1N5VA 3TWZA 3PCOB 4Y28C 4HEA9 5FDLA 4AHVA 3I56S 4LREA 5AQHA 2AT1B 2EK6A 2LLZA 3SXLA 1QE1B 2D74B 1XBWA 2G8KA 3QBCA 3F9MA 4ZVOB 2DY4A 1X7VA 1FJ7A 2P9LB 4ICLA 1D8ZA 1P1LA 4FWKA 4A8KA 1MROA 3R9PA 4ED8A 4Y65A 1P8ZA 3SUQA 4RCHA 3KJQB 2IAJB 5CR4A 1AFIA 4CLWA 3O8WA 2R7QA 2XS7A 5KFOA 1IWGA 4DPOA 3D1OA 5MLCV 2Q36A 3PRVA 4JP8A 2ZEJA 3PIPQ 5HQMA 4J8FA 2E7WA 2RRAA 2W4PA 4E19A 4FM0A 1V3RA 3WT0A 2V8HA 1FRHA 2R7WA 3H98A 2MLZA 4LBIA 3MAAA 1KVKA 1PIEA 3Q7CA 1XQIA 3P45B 1DURA 4FPRA 2RRBA 4C8ZA 1WLJA 3X3UA 1RKJA 2D69A 4CI6A 1I51B 3DGPB 4MYTA 4AT1B 2XLJA 2YKOA 4B1YB 3KLGB 3D67A 4FZYA 1LV5A 1FRIA 1DAXA 2QE5A 2DNPA 1RTZA 1F3VA 4KR0B 3CO9A 4B1XB 5ADXA 2EWHA 2HBJA 3L7UA 1YRXA 2DHSA 4ELUA 2MSSA 4I69A 1YJ9N 2D3UA 3EWGA 1TVRB 2CG4A 3MR3A 2IRXA 1N6QB 3AVGA 3LP3A 5I3PA 3SUNA 3QIOA 1HNIB 3DLKB 1RK8A 3HZEA 3QLHA 2ATCB 1QAXA 4TXSA 1HQUA 1YAGA 5CYQB 1YJNN 4HHHA 5F41A 5F3ZA 4YHHF 1WB9A 5JVHQ 4DB3A 2QA4S 3KLFB 1EIYB 4GVBA 5LJ3Y 4FOEA 1JJ2M 2XY8A 5T7LB 5J1EB 3CQ8A 3FEYB 5FIIA 1E6YB 3FK4A 3UN5A 5C24A 3MTKA 3KFWX 5KT7A 2GVDA 2LU1A 4XK8C 2M5YA 1XI1A 4DV4F 2E20A 1QVFR 1D0EA 1KC8O 4Y1DA 4M7YA 3BR9A 5L1KA 1YIJS 3P96A 2XQCA 3JXOA 4LC9B 4DL7A 1PBUA 4LF6J 3CD7A 3KMSA 3EVMA 3QWUA 3R5BA 4AE5A 3M1FA 4OV1A 1KFDA 3PXGa 4XO0A 2V8DA 3LGMA 4DR1K 2C2MB 2XMVA 2E1ZA 3F0NA 3FFIA 1VSMA 3NF7A 2F4VF 4DV7J 3FC9A 3TUIC 4CO4A 4FO0A 2BBEA 2YX6A 4L3QA 3MN5A 1VIXA 1VRTB 1QAJA 1S6QA 3CC4N 4BE1A 4XAKA 3HVTA 3D5MA 2IDOA 2JX2A 3W7BA 1JLGB 5JLHA 1YTAA 2AV5A 3IWXA 3P4IA 3NGZA 1FRJA 5ETLA 1BLUA 1HNWF 2IY5B 3TU5A 2NRWA 4B3SF 2CZVC 1NSAA 2ZBPA 4FM2A 4ZLLA 4I2PB 5G4DA 1X4GA 3QGHA 3A13A 3DRPB 1T94A 1FDBA 2DNHA 2HLTA 4OI4A 4B3RJ 3NG8A 3MEDA 4PWDB 3TSQA 5F0XA 1VQ9N 4DV0K 3BGRB 4OX9F 2OELA 3ETMA 4RNHA 4Q8FA 1RYRA 3PM9A 3O08A 1JLFB 2WSCC 3IR7B 5CYJA 3DJCA 5EX5A 1K0TA 3HYFA 1AA1B 1BE4A 3D3CJ 1AB8A 2WFBA 1FKPA 2GFFA 1ZH5A 4MYUA 3C6UA 4ZIVA 3CUNA 2R2SA 1K73O 5D4PA 2FJWA 4I7FA 4K43A 3LQVA 2PC6A 1LW0B 1TYQA 1B3TA 4G6VB 4OI3A 1WEXA 3T7ZA 1HLWA 4JEPA 1NK8A 1L3UA 3IRXB 4WTYA 4DX6A 3LZIA 4FYVB 4A8OA 4UOFA 3J7A1 4Z4FA 4A8YA 3DDIA 2ZJQL 3AAWB 4C8YA 3RBDA 2VZ9A 5DQGA 1F9EB 2PI5A 3DFEA 3T9ZA 4HUEA 1Q8LA 4FLXA 3TTFA 4GNIA 2VQFF 1R8HA 2LQBA 4E7HA 1E6VA 3CCVS 1FW6A 3AVMA 2F40A 5CD4H 2KG0A 1JCGA 2IJFA 5JXSA 3WXMB 1VQKS 2UU9J 2HQGA 2CPJA 3L09A 4DBQA 2FLLA 2V50A 3UR3C 4OPKA 3IWNC 2D0AA 1FKOB 1RCHA 1LW2B 1PYOB 4RKUC 2HNDA 3OD2A 3T41A 3AHPA 1RISA 4CERA 2I38A 3OR1B 4IOAQ 1S48A 3R5CA 4OHVA 3KHLA 2LQJA 2P2CB 4KGKA 1SQFA 2G8UA 3M5RA 3CCLN 2JSXA 2D0CA 3H4BA 3HI0A 5LMNJ 1U8WA 1CXUA 3CCMN 2X6SA 2VJVA 1FX2A 1FTCA 2P9KA 2VV5A 1GOBA 1LNQA 4LF8F 4BR7A 4P52A 5A8KA 4ZVPB 4DPWA 3CC2S 4CLKA 4DZDA 3T5LA 3SI8A 1NK0A 3NP5A 4J2DA 4Z2XA 2V52B 4CEOA 1HR0F 1ASVA 1FJGF 1OJ4A 1UZDA 2BABA 1S9EB 3DU5A 3GWCA 3VESA 1XJWB 1WKKA 3PR4A 4B1UB 3HSGA 2BRKA 3UVJA 1KNZA 1RT3A 4CBWA 4DUTA 3PV8A 2NRHA 4QIEA 3RRGA 1J53A 2E1MC 3MPUB 2Z8QA 1YJ7A 4NLVA 3OYBA 1FFWB 1NBEB 4GKJK 2D41A 2QYCA 4F4WA 4UY8T 1H72C 2F8MA 4K5RA 1I94K 2K8GA 2B4PA 3T1HK 1YK9A 4CNZA 2FGCA 3V4MA 4KB0A 2UUWA 2HFOA 3RR8A 2MYFA 5AR0A 3R3TA 1EHWA 1VIOA 5A76A 4B9QA 3M7VA 2IMOA 2O8CA 1IBKF 4U8YA 4PG4A 1URRA 2C3MA 3JAMU 6FDRA 1YTUA 4H0XB 4CD3A 3K2YA 3OVNA 4OFZA 4C11B 4DPUA 2EW9A 4CJVA 1ACMB 3AO3A 3ZO7A 2NCKL 2HHHK 1XQSC 2VG6B 2L41A 3VEVA 3QZ8A 1FNMA 4FK0A 3N5BA 2KFYA 2JLFA 2KH9A 2XEXA 2NXUA 1RT7B 4P9SA 2QWMA 1SH3A 2YKPA 2DFFA 1XR6A 4LH5A 4PRFA 5HMYA 1S3XA 1RHJB 1RDRA 2KKHA 3G9CA 1WBDA 4WK1A 1S9GB 2XO7A 2DHXA 1RAJA 4FYXB 2DPJA 2DCLA 2R8HA 4Y1CA 4XPCA 4KAIA 3U3GA 4DV6J 2GUIA 3O3FA 3C46A 4OKJA 1U2FA 1WOOA 1ZBTA 3N6NA 2F65A 1YJTA 4BVOA 2AGQA 2YBVA 3PW7A 3JS9A 2HS4A 3POTA 2W6KA 1BDGA 4JB8B 2P9SA 3OTOK 3CEDA 3FCHA 1U7LA 1QTMA 1M1GA 3AGKA 3D3BJ 5F8NA 3JQKA 3HI9A 1NGHA 4IR9A 3CIZA 4LSNB 3HMJG 3RBEA 1SUQB 1AZSB 2MJNA 4I6AA 2D7SA 4K4YA 1T05A 1ZM2A 4Z7YA 2CFXA 2A2CA 2EFVA 3QSIA 2J4RA 2P6TA 4NPOA 3ATUA 1M1HA 3CCSN 4B8AB 1M90O 3SBGA 1B0VA 1HA1A 1MW7A 4ES3A 2R8KA 3Q22A 2DR9A 4BWMA 3NNCA 1A5XA 4MKAA 2PI4A 4JKFA 4PXEA 1BI4B 3BSNA 3KOAA 3TANA 1VQNS 4DCHA 5DRKA 3BYPA 3J81j 2YWKA 5T41A 5ITHA 1K8KA 4E1NA 2OAUA 4URSA 4RU9A 1REGX 4LFAK 2DXFA 2W7AA 1UKUA 5C2DA 2LEAA 2R7SA 3W2WA 4L74A 2HFVA 3G71S 2AIRB 1HQEA 2KHDA 1CS4A 4BRFA 2IC3B 1CC8A 4CTAA 4CJWA 2G8FA 4YORA 5HN0A 3P5JA 3AVHA 4EHTA 1MN7A 1AFJA 4LF7J 2F4FA 2GJFA 3TUJC 3K9KA 4JI5J 2F4VJ 2O66A 1N5SA 5H9EK 2HYIB 2MKHA 1S49A 2RH3A 4IOBA 3EYZA 1J5EJ 4FWRA 1QUPA 3G4SN 5HMWA 2HWTA 1RXOB 2ASYA 4OYBA 4B3MF 4MIBA 1ZBUA 3QNWB 4IUFA 5SUHA 2CWXA 1RYSA 2MEWA 3W60A 1RTDA 3LDQA 1RWUA 2HIYA 1UCNA 1VLOA 3D1HA 4ZCIA 3GR0A 4UOHA 4C8NA 3Q8PB 5AQQA 4DV2F 1S0NA 2QN6B 5AXLA 3BGUA 2W2MP 3Q8SB 5AQNA 1SJ4P 2J6SA 4B1VA 4CZCA 1PCAA 1KVBA 3H4DA 3QRRA 2P9UA 4DL4A 1CLQA 4NZ0A 4A8SA 4A8MP 1C1AA 3U4LA 2WZ1A 3V1OA 4JI0J 2MZJA 3JTNA 1RUSA 5HMZA 3BZKA 4URGA 1N8RO 3VF2A 1VRQC 2VH7A 1PKUA 4MO5A 5B8HA 3IS9A 1RCOB 3EGVA 3H0PA 3BBBA 4X62K 4DI6A 3HL8A 4AQYJ 4QU6A 3QT7A 3RBXA 1WSFA 2ZUGA 4F0KA 5KFBA 2R3VA 3M30A 3WZ0A 4F9OA 1E4GT 3FSYA 1TK0A 4OYZA 1SC4B 4O44B 3EY1A 1NLVA 3M32B 2HHUA 4MAKA 1JKHA 4QBUA 5BR8K 2NXJA 3D6MB 4DG1B 4C7QA 4K4TA 2LCWA 1JB0C 1BUXA 3GIJA 2WVDA 1PAEX 2E1CA 4PUOB 3D2EA 2QA2A 4QS9A 1A0OB 2Y9HA 3SAGA 3WDOA 4ECRA 2DH8A 1LWFA 3CMAS 3MN6A 2BX6A 4CD1A 1WJ9A 1GOCA 1VQSA 1CZBA 2QLJB 1D09B 2BJ7A 4DR3K 3NVKA 3MCMA 4AHTA 4DR5K 3V6JA 4EGLA 1WORA 1TZ0A 4LRCA 1CPZA 1VQ4S 2GJ2A 2V2KA 2HVZA 3CJTA 2HW3A 1F5AA 2HQIA 2PT0A 1HPZB 2ADBA 2W9BB 2GIFA 4CIEA 3B6OA 5AQTA 2XYHB 1GQEA 5ETRA 1KLMA 1NGDA 1NK4A 4HUFA 1LCUA 3OBYA 1G7CB 3MXJA 3GL1A 2GS8A 5IT9O 1IM6A 3GYNA 5IT4A 4HTLA 5A6PA 5B0BA 2YHXA 4O4GB 3HKZD 4RUBA 5A2QY 2IDLA 4USTA 3FE1A 4NLBA 3S3NA 2U2FA 2N7CA 5BJRA 3THXA 2GCFA 2OPRB 3PYGA 2FC9A 3W62A 3KVGA 1HBMA 4ECVA 4IDHA 3TAFA 3GV5B 4RNMA 3EJMA 3BZQA 3UDVA 3S3OA 4RJVA 2YHWA 3B78A 3THWA 3FBEA 2V9WA 4JLHA 2DY1A 4UY85 4RUHA 2J7WA 4QW9A 4E1JA 5CAAA 3ID8A 3ZETB 5AQRA 4HT5A 4JV0A 1U47A 2EI5A 1LAWA 4QR0A 2XY6A 2QA4G 3UI3A 1U1NA 2QMXA 2AEJA 1S79A 4ENOA 1JXLA 3M9OB 1VOMA 1KXPA 4NOHA 1R59O 4XIUA 4GVMA 1NKEA 2QFJA 1K0VA 1RT6B 3WNHA 1XWLA 5IC4B 5E26A 2ETJA 3QEPA 3GE9A 1JJ4A 1KQSM 3ZCMA 4K5SA 3M8PA 3R2CJ 3VZHA 1NJYA 3GTYX 4PPDA 4MK9A 3RBZA 2V67A 4Q0BA 1NG9A 4UZBA 1M5PC 3LWMA 1X1PA 5KFQA 1CJKA 3T5HA 2QO3A 1IKYA 1SH0A 4PXBA 5U47A 3C65A 3GR1A 1VI7A 1RAEB 2M70A 4KTWA 3L2UA 4ED7A 1SL1A 4DCOB 1FX4A 2H1YA 4IEEA 4YDXA 1YLXA 2IRUA 4ZPCA 1R6YA 5ELZA 1R8AA 3G10A 1HHQA 1W97L 5J2QA 1Z25A 3TTDA 1M5OC 4A8FA 3HD2A 1P90A 5DM7Q 3N0VA 2JLEA 3HT0A 2CUYA 4HI1A 3G8TA 3TR8A 4FXWA 4KO0A 3D0IE 4F50A 4DCJB 1FKAF 4EEYA 5ETKA 3AODA 2E88A 4QIVA 3JYTA 2IVYA 1QQNA 4PL7A 4OZ1A 3RUBL 4JKCA 3VA0A 1D5AA 4FVUA 4CLTA 2JL9A 4QW8A 1QD1A 4NXMJ 3CPWR 1R0CB 4OX6A 4JV2A 5DM6L 3BN7A 2NXEA 3VQ8A 4IG0A 1EO1A 3MZIA 3ZT0A 4H5TA 3RMBA 1YJ9S 4KC5A 3PJXA 4DV1K 3L3UA 3G6EN 3MDQA 2W4CA 1X4HA 1KOHA 2QA1A 4CZFA 4OJ3A 2VBZA 4ZITA 4DX5A 2PZSA 2POKA 2CJ9A 1SCJB 1HYSB 3D68A 3VF6A 1PJ5A 3RSEA 5C25B 1W7WA 4N5SA 2FD2A 1JNRB 1YJNS 5I4MA 2J0QD 5HL7L 3L2QA 1KAYA 2K1RA 2KRBA 1HNVA 1W7AA 3NCRA 2ZJRL 4JD2B 2KYZA 4R0EA 1LFWA 3GIKA 2YV0X 2C3PA 4X4SA 4EUVA 1XNQK 2GVZA 1FT8A 1N48A 4WF9L 3AD7C 4HACA 3V5RA 2KT2A 3KKRA 2NYHA 3IGNA 3UCUP 1VRUA 5FPDA 4K4VA 4DR1F 1NJZA 1RDBA 3PFOA 3B4DA 3EL2A 5DMRA 3S6EA 3L3CA 3ZZYA 4P71A 3GB0A 4J5OA 2D9OA 2HNZA 1RSCA 1NM1A 4M5HA 1C0GA 5KFXA 3NL0A 1N5YB 3UD4P 3CIMA 4PABA 4JV5K 2XO6A 4GVLA 4O8UA 4LMZA 2R4FA 3FNNA 2XYPB 1K9MO 2JGUA 1WC4A 1VC6A 3K5OA 3CC4S 3SZ2A 3G25A 1P8GA 2QLWA 3RU0A 2DFHA 2XB2D 3SUOA 3JS6A 3MMBA 1JLAB 1YJUA 4PY5A 5ETOA 3H5YA 2GMHA 1UWAA 2V4JA 3FEXB 3BGFA 3OTEA 4B3MJ 4JI1J 4C97A 1QSYA 5EDWA 1TGOA 2I7PA 4CFCA 3AA8A 2BKOA 2YQ3A 4CLSA 3BZCA 5B7WA 2FXUA 1SBRA 2EEYA 4DV3K 3I0RB 3MM6B 4BGBA 4U67Q 3DXKB 9ATCB 4KTZA 4DV0F 1Y7PA 2CPDA 1MWYA 3TI0A 3FDSA 1NCLA 4RW4B 1VQPN 2WVFA 4R8UA 2D0BA 4WIQA 2RIJA 4DSKA 1VK8A 2QKKA 3O3LA 4DCPB 3DOMA 5EWGA 2E7VA 2Q79A 2ZWPA 4AL7A 5HVFA 1F2GA 2P9LA 2WONB 1Q5YA 4W4MA 3Q8VA 4DUYK 2IS3A 4DS5A 1C4AA 2BOPA 2UXDK 1ZOTA 2HS0A 4ISGA 4ZLNA 1F1BB 1FEHA 2C3UA 1QQOA 3ENHA 2WVCA 4DEZA 4W5TA 3CJQA 2ZDPA 4I6MA 2YVSA 4LF9K 2HBQB 4GKKK 2IVMA 1LWEB 2KN4A 1XR5A 1X0FA 3FQKA 1U48A 2HGLA 2MXYA 3D2FA 4H4MA 1IKWB 4DV5J 3IN5A 2CJQA 4KYZA 1N36F 4K0KK 3KK2B 3ETOA 4YB6A 5AQMA 2YKQA 2H65B 3JQMA 3M6GA 2RF2B 4ID5B 2JJ4D 2GQQA 2ZOGA 3VGVA 1SL0A 4DQSA 4NZ6A 5M1QA 5C10A 1WG1A 3DDKA 5KFZA 4DSJA 3RR7A 2F9DA 2V34A 3UN2A 4DTMA 1RAIB 3THYB 2BACA 3HF5A 1HBNB 4DMZA 4MDAA 1JJCB 4PXDA 2FHJA 4HUGA 3MX2A 5AFUA 2ZJPL 3J7AN 2NS1B 3SAHA 8AT1B 3ILIA 3A3OB 1QQMA 1TVRA 4J9SA 2QWLA 3MN9A 3ZX0A 3AVJA 4F4KA 2IA0A 1HNIA 3CCLS 3LM9A 4DS4A 1DLOB 1VJQA 2EKNA 1X4FA 3M8WA 4DJBA 3FLCO 2OO4A 2HHVA 1SJFA 2PIIA 1WDDA 3SIPB 3TSUA 5KFLA 3GCXP 4USHA 3KLFA 1DGKN 2VPXB 2CYYA 4IJAA 4TU9A 3EDQB 3J7ZO 5J1NA 5J1EA 4EZ9A 1KHVA 1KTQA 2NZCA 2W01A 1E6YA 3BQ0A 3SBMA 2OZSA 2QSWA 4CGDA 2AEFA 2DR7A 3I9V9 3ICLA 4DTXA 2X1AA 4CI0B 1RJJA 4GKJF 1QVGR 4DFKA 1TU0B 3MMCB 3BEXA 1VR6A 1I94F 1MA9B 1DY3A 3T1HF 4TYBA 1SI9A 4ZPAA 3BQ1A 2C2RA 2RUSA 3CJAA 1VISA 2GAHC 5LSOA 3AO1A 4PL8A 1AROP 4HT7A 4ZTFA 1IBMJ 3OSPA 3PKYA 4TLQA 4M3ZA 1U0HB 1J2VA 3DM2B 2K3IA 3OW2R 4ECXA 2N3OA 3QIPB 4KIAA 1VRTA 2EK1A 4ZPVR 5HRPA 3MHYA 3NY0A 3P5TL 2DNKA 4BDYA 5KFGA 3HBTA 3NS5A 1HBOA 2HHHF 1ZYQA 2P9IB 3DRRA 2QWOA 5KFWA 2R8IA 3DI6A 3LP0A 2E1AA 2WB1D 1X5OA 1GNKA 2CPXA 4Y00A 3QB0A 3I8DA 4ZKAA 4W90B 1A7GE 4ANEA 1QAIA 1X3MA 2NPIA 2CPEA 1H7XA 2DEJA 3FQLA 5CZ2A 1C0UB 3GZ7A 2MGZB 4CHPA 1GXUA 4I2PA 3VA3A 2P1JA 4M5JA 2O8EB 3DRPA 2E9TA 3QMLA 4JAXA 2MKSA 5EWFA 4CH0S 1RTIB 4P10A 1IKVB 2X7IA 1LWXA 2HOEA 2RN2A 1CULB 3BGRA 1LEOA 3GJQB 5C2FA 2IM0A 3G0ZA 4FM1A 3F5TA 1JLFA 3NGUA 2BA9A 4C48A 1TUYA 3TAPA 1JMTA 3WQPA 2A10A 5E3QA 3MFHA 1NDPA 4Z0UA 3FZMA 3J7YI 5E84A 3THTA 2D1KA 1FK9B 3ZXWA 3KK1B 4LSLA 4LF6K 4OJHA 3W8GA 2BJEA 1LW0A 3BV8A 1HHSA 3ENAA 1QZ5A 3CJ2A 4LFCJ 1H74A 1SV5B 4NLPA 1ZXOA 3IRXA 1SB6A 5HL7Q 4JK9A 4CZMA 3NVMA 4FWMA 3MMVA 5E5NA 1BU6O 1BWFO 4ED1A 2QJ3A 3IP0A 2HHQA 4WP9A 2W25A 7AT1B 3I4HX 2OH2A 3BREA 4USMA 3ZSQA 2MKCA 3M9NB 1LXNA 4ICLB 1FE4A 1WF1A 1MROB 3OSNA 3CCSS 2JWNA 2NRTA 4ETZA 1QDUB 1B70B 2QEXS 3MUMP 4J2AA 3QGGA 1MMLA 2XNQA 2PA8D 4NI2A 3UD5A 2HHWA 2HVEA 2HWHA 2GQCA 1UJ4A 2G1HA 4LFAF 3BUZB 3CM5A 1FKOA 2FIUA 1T03B 4RWWA 2CGKA 3G82B 3OR1A 3ZSXA 4ILJA 3RMDA 1FJEB 4KHYA 3CD0A 1PAUB 2DGSA 3W64A 1Q86O 1ATNA 3R97A 2FZCB 5CHIA 3NS6A 1UEKA 1KONA 2NUBA 4B3OA 4LSZB 3ZSYA 4RZRA 4QR1A 1RILA 1DQAA 3MR7A 1CEZA 1DT9A 4WFNQ 3CJBA 1KP6A 1T02A 4TN2A 4JYAK 4E8UA 4KH5A 4QU7A 1XC3A 1QVFM 2FHKA 4JI2J 4ETXA 1S9EA 1Q81O 4M3XA 2Y8YA 3UNGC 1SKSA 4Z94A 2CQ3A 2IRYA 3G4SS 2HWIA 3SSSA 4P2XA 4HYKA 2XG8A 1E4FT 2V2ZA 5J2MB 5HANA 1GT8A 2YPZA 3QLHB 5GAEI 2L3MA 5SZTA 2N4DA 2E2NA 2DNLA 1HQUB 1NM2A 2V68A 4U96A 4WQ4C 1RA6A 3EMTA 1ZAVA 2RILA 2DRDA 1S0OA 2MZRA 1RQ0A 5TKYA 4X4TA 1LFPA 5ETSA 5KG5A 4LIWA 3HOTA 4DV0J 2M8HA 3MWBA 3ULEB 3BF4A 3H2VE 2UU9K 1BL3A 4AUKA 2HGNA 2GVDB 3D6RA 1BUPA 4FJKA 5GVQA 3TW0A 1FHTA 4X62F 1RE1B 4RO0A 4TKTA 3QZ7A 2Q3PA 3DYAA 3EGWB 4O3QA 1FE0A 3IR5B 1GLBG 1Z2ZA 3MM7B 1DARA 1MWZA 5LMNK 2ATLA 4RTFD 3V81A 5BR8F 4USWA 3R7NB 2D5RA 4FWSA 4ED5A 1HNXK 1IVZA 2IYIA 3CM6A 4BRQA 5HQLA 1Y64A 5KRSA 1WOQA 2PBDA 3MOJB 5HLFB 1FNXH 4JKEA 1IR1A 1G3OA 1S9GA 3WNEA 3OS1A 3DN9A 5IT9U 3HVTB 2BKNA 4PXCA 3ONQA 1FDAA 2QK9A 1R31A 4FS2A 1YT3A 1G99A 4J9VA 2EC2A 2DGUA 1OVYA 3PYEA 4DR3F 4LR7A 3BQ2A 1IM4A 4DR5F 2J5AA 4E7IA 4IO1A 4WFZA 2M9KA 3KD5E 3UE5A 1GEHA 3DGVA 1EX8A 4J9RA 3OTDA 2DGVA 5G0RA 1JLBB 2M8DB 1T9TA 1Q8BA 4USVA 4ELVA 2B4OA 5A0YB 2ERRA 3V9UA 1S76D 1RTJA 1KS2A 2K06A 3EXCX 4YB7A 4ZPBA 1XEZA 3M6VA 2NXNA 3MEDB 4LSNA 1BHNA 1ATSA 4DFJA 2BOAA 1SUQA 1AZSA 4C8KA 5KOXA 4OV6A 4PKDB 1OMSA 2HFUA 3DLJA 2AYGA 3UR0A 1HBUB 1FTRA 1U45A 5F1XA 3N01A 3QEVA 1FKPB 1WNEA 4NCBA 1TMMA 1NMDA 1CG2A 4I7FB 1BQXA 2VFVA 1NB2A 3VEXA 4G1QB 4KRWA 2DNGA 1PBAA 4ISFA 4IBNA 3OHAA 3BDEA 1TKXA 1EQYA 5LL6d 4OQJA 3TAGA 5D4OA 1VFJA 4LF5J 2JHEA 3IG1B 1WUUA 3DRSB 4URQU 1PC4A 1V3ZA 1JWWA 4A59A 1MWKA 2WK4A 1Q7LB 4J2BA 4I67A 1WKJA 3FSXA 1QTNB 1G1XA 4K42A 3KMQA 1RT5B 1L3SA 1X5SA 1NNDA 2AJFE 3D0GE 3H25A 2WC9A 2F9TA 4PQAA 1I94J 4IFYA 4EZ6A 5DZ6A 2LQ8A 3PLAA 4DV6K 2KI2A 3WX8A 3VAMA 4TQRA 2IC3A 4M8LA 2G1DA 2B7CB 2Z1HA 1S12A 1YZ7A 4KH4A 1H3DA 3K8VA 3ZSRA 2OZMA 4FJLA 3HO1A 3MM5A 4EHUA 4YNQA 3TVKA 3L7PA 2VWJA 2AHOB 1Z2LA 3FGUA 4MJKA 2HNDB 1KD1T 5C42B 4WU2A 2Z2MA 3ILOA 4YOVA 3IKMA 3N79A 3OVSA 1X9WA 3CW2C 4J9LA 3IBCB 3SDEB 2MKJA 4RBTA 4ZVSB 3P8BB 2HHTA 1HFEL 4ID8A 5E3PA 3THPA 2V4RA 3AARA 4IXCA 2P9KB 1RWPB 3D1QA 3J7YU 1FFSB 4CCHA 3GCWP 3W66A 4H5NA 2KZMA 1N5QA 2AD9A 5BR9A 1ZPWX 3O3HA 3PO5A 5A8KB 4FK2A 4QJVA 1I5OB 5KFRA 1IQTA 4ZA1A 3CMQA 1VHFA 3HPHA 1UP1A 5LJWA 3VWSA 2XGPA 4PG7A 3VAJA 1JIHA 5FLXO 1PYSB 3VTIA 5C7PA 4ZCLA 1TUUA 2Z1GA 3C15B 2V94A 3ZT4A 4BC7A 3AVBA 1NHVA 3R5AA 3TABA 4Z7CA 1RT3B 1B9FA 4X66K 2Y1IA 4FWOA 2HSTA 2UUCK 3OTOJ 1WEYA 5AQVA 2YH1A 1VSHA 1XC9A 3U9ZA 3JSRA 3IA0A 2KZZA 2CH5A 2DTJA 4DV1F 1I6JA 1HNZJ 3EE8A 2CQ2A 4W5QA 2JEFA 3QNOA 5CCLA 3GP9A 1WSEA 3IXQA 3QFUA 4O44A 4O0NA 3M32A 2A6AA 4K4ZA 3K7RA 3KWGA 1Q8KA 3G6ES 1SH2A 2RHKA 3PSFA 3WNGA 1RT2A 5FPNA 1B9DA 1PC5A 5CZVA 2FSJA 4LF7K 1UA0A 4UTGA 3KLHA 4XDDA 5HMXA 1T44A 3EZ5A 2KW4A 4WCEL 2KTQA 3GFYA 3HULA 1J5EK 2FJBB 4NLUA 3CG7A 1O0PA 3LUYA 1QM9A 1XNQF 4DQRA 4E1MA 2DGQA 3MAHA 4I64A 1LQ9A 3VENA 2GZOA 2A5XA 2KJWA 2FF6A 3GPAA 4WKYA 2Z2LA 3OL6A 3AB4B 1ELOA 2QRRA 4CWBA 3ZTSA 4M45A 1YBAA 5BYSA 1LAVA 2VWBA 1LOTB 3FZHA 2W9BA 2J7KA 4L76A 3PJ9A 5ETTA 3WEEB 3MECA 3PW2A 1IN0A 1GAOA 5GAEU 5IZHA 2Y0BB 4UT4A 5D4LA 1S77D 3AVCA 1NSPA 2ZZTA 4E0DA 4JV5F 4O4GA 5DG8A 5LMUJ 2BGGA 3HM8A 2XWXA 3I32A 4U95A 1KN6A 2AW0A 3KHRA 4ILRA 1D9AA 2EHGA 4JI0K 4DF4A 4D3GA 1HW8A 1GLCG 4CF8A 1JK9B 3KLEA 3KUHA 2FGOA 4AQYK 2B7BB 4OIXA 4BGAA 3NHGA 3PW0A 2FJDB 2PSZA 4BLGA 3R1HA 4K25A 3TQ1A 5KGWA 3CJ5A 3I6PA 2AYEA 5HK4A 4DV3F 4C3KA 2LQ9A 1YRTA 1T05B 4WFAQ 3Q89A 3BR8A 1HWLA 2PY5A 4WWSA 4P7VA 1DQ9A 4CLPA 4QS7A 4TVAB 5AQWA 4CEBA 4W92B 1SIWB 1TV6B 4MKVA 4KBOA 2C2DA 2LA6A 4IJNA 4UW2A 4B08A 2IJNA 2XZTB 3HHLD 2XLKA 3WC2A 4H5WA 4CF9A 3TA2A 4H5VA 5F9LA 5ETVA 3GJTB 4DUYF 3OL9A 1LXJA 2MZTA 3P38A 2UXDF 4IOCQ 2ZWOA 2LVWA 3QFPA 1GXTA 3ZZRA 3N4PA 2LFVA 5IV4A 4LFBJ 4DQPA 4EIAA 2BJ1A 4LF9F 1FJCA 4GKKF 4I9LA 3H6EA 2O8DB 3WXKA 2QLBB 3W2WB 5LY3A 4BR4A 2R7OA 3JB9k 4ATNA 4DFPA 2HK3A 3T1YJ 2B5JB 4YEAA 3VQEA 5L8RC 4CTAB 1PG5B 1IBLJ 4CYUA 3ADAC 2J76E 3AA9A 4Q44A 4Q45A 4BRPA 5JS1A 1NZ8A 2WRMA 4HDGA 3TQEA 1JJHA 1HLUA 4ZCKA 4BR0A 4IG3B 1GOAA 4U8VA 4W5OA 3TNVA 4FZZA 5B0FA 4N77A 4LVNP 3G87A 1VSJA 4NASA 4OHXA 3CTRA 2DB1A 3NCIA 2ZH3A 3CQYA 2C2KB 4BRLA 4AILC 4ISEA 4A2BA 3E1YA 3TX0A 4JI6J 3ILLA 1YZ6A 4HDHA 3MCNA 2AYMA 4CJTA 1Y11A 3SSRA 3WIVA 2P9UB 1LK7A 4MMOA 3DWLA 1XN9A 2CQGA 2BE9B 2MQQA 1HYSA 4BCAA 3NWRA 1T9UA 5C25A 4ZN1A 2AP1A 2D0PA 3W63A 3E66A 1YDLA 4NLCA 4F4ZA 1U1KA 4EWTA 2DNZA 5SWMA 4BVPA 4BBYA 3IBFB 2P9PA 2QWNA 4FW2A 3QFHA 4JD2A 1IUJA 1BIZA 2ASDA 4H03B 2CZ4A 2HFSA 1TL5A 3CDBA 2BEFA 2ZBIA 1RDAA 3ZTOA 3RJMB 2XCAA 4IO9Q 4CIOA 3M30B 1LWCB 3KNGA 2QL5B 3I8BA 3EZUA 4GO5X 5CY4A 1RAHB 2PA3A 2BKPA 2FBVA 2MZ1A 1T9YA 1YWXA 4C8OA 4JI7J 3LL3A 4BG9A 4HR2A 2YQ0A 1SQGA 3O44A 2W7PA 3D2EB 3QGIA 3UDEA 1BMQB 1T9WA 4UY8O 2EFQA 2LSNA 4PPZA 5KG0A 3PIPL 4FWLA 3RB4A 4D3HA 4FJJA 4OI2A 3R6GB 4DLGA 3CSKA 1LWFB 2FJVA 2ASLA 4PR6A 1UAXA 3HFKA 1V3SA 1NJWA 3J7AP 4CJEA 4BQLA 4KTQA 4LBHA 1RWOB 3GMGA 2ZGYA 3M8ZA 1RWXB 3C7NB 5GADU 2ITGA 1T95A 4ZS6A 4F7VA 1DKGD 4NXMK 2N82B 3SQ1A 2RS8A 4YN3B 3K58A 2B0GA 4H0VB 3E01B 1JLAA 5B0AA 4Y2MA 4Y6IA 2R42A 2B3TB 3KZBA 4FDFA 3BP8A 4H5RA 2B56A 3NOCA 3VQBA 2Q6CA 3ENVA 1VQ8N 4J9QA 2WVEA 4E2FB 4B9MA 3P31A 3I0RA 5L1IA 3MM6A 2O5DA 4FF1A 4NEZA 5ADXH 1EJ7L 4KPYA 4RNNA 4U6PA 4DTRA 3THXB 4GMJB 4RW9B 2HFZA 2PD1A 3H8YA 4KHQA 5FROA 4PG5A 2O4IA 3TVZA 3BYRA 4OKEA 1JCEA 4CM0A 4Q2MA 3T3FA 3ASMA 3ZT3A 3SCIE 4KB7A 4PKGA 4KHPK 2NRXA 5JVHL 2CNNB 2W2PP 3EM1A 1C6VA 3LF0A 3THWB 4IO8A 4YOXA 5DDOC 1NH8A 4G1PA 3OQ2A 3ZTPA 4LF6F 4M42A 3SSQA 2OKQA 3FMBA 2V7ZA 3M05A 3CJRA 2V69A 2UV8A 5B0EA 3HSTB 4YDUC 2F8HA 4FKYA 3HPGA 2HRUA 1Q86T 4BE0A 2ZD1A 4KKOA 4JKGB 2DHAA 1LWEA 3M8QA 4DV7F 2IMWP 4FXVA 1WOPA 3TPQA 5J2PB 1TL4A 2RQ4A 1IQZA 2VODA 3M8PB 3KK2A 4PWUA 1N56A 4Q0BB 4X64J 2GA7A 4L72B 3C19A 1F5CA 2RF2A 4OJGA 2YNGA 3V9ZA 1S1VA 2HEKA 3CNQP 1YJVA 4HHJA 4N56A 4QOZB 3P83D 4DPTA 3BB5A 5AXMA 1JJ2R 4B02A 3CCQN 1UVKA 1KWMA 1XHZA 2K3KA 3HVRA 3THYA 3A8EA 1ITGA 5K9FA 1HBNA 1QHTA 3NMAA 1B0TA 2DHGA 2NSCA 2RKIB 3VAIA 2ZUAA 4JI1K 5EXWA 3OYNA 5CYMA 5J2QB 4CK3A 3O3GA 2YWWA 3RW7A 4WFBQ 3NLCA 3MEGA 3MEKA 3CMEN 4TU7A 3X1LB 3UCGA 2B4UA 3O5TB 1RAGB 4MFBB 2NZTA 4CHYA 1UA1A 4A62A 2H9ZA 3P39A 4KO0B 1DLOA 1MMNA 2KT5A 3IFEA 4M5GA 5DJBA 2ZQBA 4ZLJA 1U1MA 1NJIO 1F21A 3L95X 3JYTB 4C0BA 4I2QA 4DHVA 3VAKA 1X31C 5D6GA 4BREA 2RQCA 1NDKA 4LT6A 3J7YP 4NLYA 2DPIA 3OXLA 3MI7X 1IKXA 3DLLQ 3EE3A 3O6QA 4FWQA 3U8XA 2P5VA 3MK6A 2E5JA 2ZM6K 2OTLN 4ZN3A 4R0JA 4DV5K 2R7TA 4LRAA 2KRRA 1ZM9A 2LXIA 3KLVA 3VQDA 3MD1A 1GTEA 4I9QA 5EOYA 2GV9A 2F63A 2M0GB 3FZBA 2ZKUA 2PDAA 2HBLA 2K1RB 2UU9F 3O2IA 3VAGA 1GFWB 3HVWA 4K59A 3MR5A 3MR2A 2XMAA 4C23A 3QIPA 2GVZB 5K5MA 2DXEA 4L3KA 4UQGA 1R3NA 2RNEA 2GIQA 3A5OC 2MHNA 4WJBA 1FWLA 3GSDA 2P9IA 5LMNF 3D7SB 2EKYA 3VMFB 1SKUB 4K4UA 2R2TA 5KGXA 3PSIA 3BEGB 4A4JA 1H1VA 1U1LA 2KG1A 1BOTO 2ZF5O 2X51A 5KT3A 2JZ5A 3PW4A 5F8GA 4IOAL 2HNZB 2X3DA 2AEMA 1NPRA 5KOWA 2OEKA 2KU7A 3WBZA 2VKRA 3LA0A 1C0UA 3FBFA 4K0KJ 2MGZA 4CJ4A 4OLBA 2PYLA 1T9VA 2CQBA 4B1WB 1WWHA 4JRQA 3NE6A 1VHIA 2O8EA 1BCOA 5LJVA 1P6TA 3D0HE 4DR2J 1RTIA 1IKVA 4F4AA 3ZSOA 3VGSA 2CH6A 5GIOA 4CFDA 2EX3A 3MMBB 4BE2A 4CK2A 5BRHA 3W5YA 4NX9A 3HSZA 2NRRA 5GAEP 3DMJB 1FK9A 3KK1A 3FCWA 5DO2A 2OLWA 1EWRA 3MD3A 1SKRA 2MKIA 2GIRA 2ROGA 4OHWA 4JKBA 1KKHA 1U2VA 2WOMA 1SV5A 4FF3A 1IBMK 1RBLA 3DOKB 3L2RA 1RAFB 3QJLA 4ZVFA 3NXZA 3RRHA 2U1AA 5J2NB 2HVIA 4R8UB 3PG9A 4DR4J 3DOMB 2IIHA 3N4QA 2PMWA 2DEIA 4ZP8A 2HURA 4ZVUB 2F3JA 3ET6B 5K8NA 3QBXA 2XSFA 4NYZA 3C14A 3MM8A 4DPYA 1HQ2A 3ENBA 1EXQA 2KXFA 3Q24A 4YDUA 4M5MA 1GX5A 3UFCX 3OA9A 2HNYA 4I6MB 3Q8RB 2VONA 2BE7D 1T03A 1VQYA 3AD8C 3GU0A 3K5NA 4J9UE 5AQXA 4CGHA 2A6MA 2BRLA 3D2FB 4H4MB 3G82A 3SQ2A 2CPYA 5L38A 2NUHA 3NDKA 3ZYYX 4DV6F 3CCWA 1NLKL 1BXNA 4C3LA 2VPZB 1Q7YT 1NK6A 4ECYA 2E9RX 2RD5C 1PSDA 4CT9A 9RUBA 3M8YA 1U04A 2GBZA 1UWBB 1FRLA 3QDKA 3MXHP 2F8TA