2HNYA

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
534
structure length
522
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 140
structure length 522
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnyA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnyA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnyA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnyA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hnyA05
4Q43A 5C42B 1MU2A 2OPPB 4O3OA 4Q44A 3U6FA 4NCGA 4I2PA 5JUMA 3UR0A 1EP4B 3V4IA 1BHLA 2DFFA 4RW4B 4NZ0A 4HUEA 4DEZA 3ZSVA 2IAJA 1I3AA 3O3FA 2DY4A 4JUZA 3Q8PB 4CJVA 2JEFA 4E3SA 2OPQB 5HP1B 3KK3A 5EDWA 4M3YA 4NRTA 4F4XA 1KSPA 4O3NA 4FLVA 4O55A 1X9WA 2IMWP 2XO7A 1U04A 4KAZA 2OPSA 4R5PA 1D0EA 3O4QA 3U3GA 3QYYA 2Z1IA 3MECA 3K2PA 4OPKA 3GIIA 3FDSA 4XPCA 3NF7A 4NLPA 3VQ4A 4CK2A 3H2LA 2XGPA 5CZ1A 3D28A 5KFTA 3NE6A 4FXDA 1S9GA 2ZD1A 2BRLA 2F8TA 1N5YA 3SFUA 4NLTA 2FVQA 3VQSA 2EC0A 1NKEA 4B9MA 3TQ1A 3KLFA 1T94A 4MKAA 3RWUA 3HXMA 1RT1B 1RBVA 1YT3A 4ICLA 2HMIB 3NKYA 4WE1B 2HHXA 3TAFA 3OY9A 1LWEA 4WFXA 1JLGA 2IM1A 3Q8SB 1U48A 3AVFA 3QIDA 1JXBA 1JLCA 1Q9XA 1KVBA 3D45A 1W0HA 1QS4A 4PWDB 4YR2A 5DG8A 2V9WA 3V81A 5F9LA 1KLMB 1FKOB 5KG7A 1BISA 3DRSB 4TQRA 2UVUA 4CIFA 2VG7A 1IG9A 4DMNA 1N48A 1RDRA 3THVA 1SKRA 1HPZA 1TL3B 1A5XA 4CEFA 5KRTA 4MQ3A 1IKXB 5T7BA 3EYZA 4E7JA 5CYMA 3H5XA 3EY1A 1TVRA 4G1QB 4EO8A 4M3RA 1VSMA 4ED2A 1IKVA 5DQIA 3LP0B 2ATQA 4RZRA 3KLIA 1S1WB 1HMVB 2IS3A 3C6UA 3AVKA 4DS4A 1LW2A 1TL1A 5C42A 4FJGA 3LAKA 1YVFA 4KB1A 4CECA 2ILZA 2OPPA 1JIHA 4O3RA 3OJUA 4FBTA 4EP5A 2HNZB 4AHVA 4ZTFA 4RW4A 1LAVA 3AVJA 4CCHA 4FK4A 1JL1A 4FJHA 4EEYA 1S1VB 4RNFA 3SUOA 4C8LA 4CGGA 3NHGA 4DTUA 1HRHA 1DLOB 4H54A 1EETB 2IDOA 3M9MB 3SQ2A 3MF5A 3HT3A 2OPQA 5HP1A 2VG6B 1XC9A 2R8JA 2O5DA 3SV3A 2BR0A 1RT6B 2AJQA 3OL7A 4BE0A 1RT5B 4TYBA 3I0SB 3BSOA 2HHUA 1WSGA 4EP4A 4OLAA 4O3SA 4O3PA 3CDUA 4TLRA 4HUFA 2R2TA 4OKJA 4PA1A 4M3TA 2D41A 3T5LA 4CGHA 2JC0A 2R2SA 2Z1JA 3QEWA 3CWJA 1VSFA 1JLBB 3M8SA 5KGXA 3SCXA 4CF0A 4J9OA 3VQCA 2XY5A 3KMSA 5KRSA 3PJXA 1WNEA 4CEAA 4O0IA 4K4XA 2X78A 4CJEA 2IC3B 5F8LA 4CEZA 1WSFA 3EZUA 1HNVA 4O3QA 4DFJA 2R8HA 4CJPA 1RT1A 3JSMB 3PW0A 3LP1B 4IR1A 4O5BA 2WONB 1UAXA 3BSCA 2HMIA 3S3MA 4WE1A 5HLFB 4QPXA 2JEGA 1KTQA 3AO5A 1EX4A 3L2QA 2FJXA 4JRPA 1RT7B 4F2SA 1T05B 4J9LA 3TR8A 4DTSA 4DFKA 4CJUA 3OSNA 4PWDA 1CSJA 5D3GB 3KK1B 1KLMA 1FKOA 1NJZA 3OL8A 3DRSA 4CHZA 3KMQA 1RBSA 4KTZA 3QEPA 4HUGA 1CXUA 5KFAA 3OYCA 1JX4A 1VSLA 1TL3A 3KKSA 4FK2A 1XR6A 3IGNA 4G1QA 2O4IA 1K1QA 1W25A 2HNYB 1VRTB 4IG0B 3LP0A 3HP6A 2AQ4A 4E0DA 1S1WA 5KFGA 1ZTWA 2YHAA 3BQ1A 1HMVA 3NGDA 2BGGA 1RNHA 3VQPA 4FS1A 4CE9A 4ZVHA 1TAQA 2AWZA 4RW9B 5L1IA 4M41A 4E1MA 3OS0A 5KFDA 2XY6A 1ASWA 3ASMA 2GV9A 1CZBA 2HNZA 4I2QB 1LV5A 3NAEA 4CJTA 3KJVB 3HL8A 5J2MB 2AU0A 2EHGA 4DL5A 4LH5A 1U49A 4OLBA 3G0ZA 3Q8RB 3SUNA 1S1VA 4KFBB 4BDYA 2HB5A 1I39A 4JV2A 4NLVA 2E6LA 1Q8IA 3V6DB 3ZT1A 1EETA 4DSLA 3HK2A 4AH9A 4ZP8A 3G6YA 1RYSA 3HVTB 4RNNA 3DLHA 1TK8A 3WNGA 1GX6A 1RT6A 3QGGA 2WCXA 1RT5A 1WNSA 3MFIA 3I0SA 5KFNA 3ISND 3QEIA 4J9QA 3AO2A 2P1JA 4OGEA 4IFVB 1REVB 1JLEB 5EWGA 3S9HA 1ZYQA 4FJ9A 4K4WA 2E9RX 1TKTB 2D0AA 2G8UA 2FLPA 4WYLA 3V9WA 4CGJA 3MXIA 2R8IA 2XGQA 3ZCMA 3OYMA 4J9RA 4FJKA 3QETA 5KFCA 4ID5B 1JLBA 3V9ZA 3ZSRA 5C5JA 3V1QA 3AA3A 3PY8A 4TQSA 2CJQA 3CYMA 4CFBA 5FDLB 4CEEA 4Q45A 3O4NA 4ID1A 4IOBA 4CJRA 2GIQA 2IC3A 3HPOA 3OYFA 3OYGA 2QE5A 4F2RA 1TK5A 1B9FA 2R8GA 3NAHA 3JSMA 4ECUA 3C6TA 3LP1A 4DL3A 1LAWA 2WONA 3UQSA 4FLXA 5F9NA 3RRHA 5HLFA 4KB7A 2IJFA 3DMJA 3TAEA 3ALYA 3BSNA 4F50A 4IKAA 3FFIB 1RT7A 1LWFB 1R0AB 4CHOA 4RG8A 1FKPB 1T05A 2HWIA 4CHQA 2B4JA 2ITGA 2FJWA 4M3XA 3RBEA 2XHBA 2QKBA 3VQAA 1QTMA 4CIGA 3QESA 5D3GA 3KK1A 2C2DA 4N47A 3BQ0A 3DM2B 2G8FA 2Q3SA 4K4UA 1C0TB 1B9DA 2G8IA 3QNNA 3F73A 4QWBA 2FVPA 5T14A 2AGOA 3EZ5A 4FK0A 2J6UA 3HJFA 5HBMB 2FBTA 1JLGB 2IBKA 2XY7A 1S49A 2D3ZA 4YP3A 1VRTA 3PW2A 4W5RA 3GIKA 4IG0A 1IKWB 4WXOA 5KT6A 1C0UB 2AGPA 3OLAA 2IM0A 4Y2AA 3PJWA 5KFBA 3TAMB 2RDIA 3M8PB 4CJ3A 3HHKA 4ED6A 1FK9B 2HWHA 4RW9A 4OPJA 3H59A 3F9KA 2KTQA 5KFVA 3BREA 4CGIA 2DPJA 2FC0A 1RA7A 2J6TA 1SH3A 4I2QA 3MEGB 3HPHA 3KJVA 1RTIB 5J2MA 1K1SA 4F3OA 3SZ2A 1S10A 3AO3A 4KO0B 4CK1A 3VQEA 1C1BB 4URGA 4IRKA 3PVXA 3V6DA 3AVGA 1Y97A 3OYNA 3MEDB 4NYNA 5JS1A 3HVTA 5KT3A 5K14B 3KOAA 3AA4A 4AHRA 3H5SA 4MIAA 2G8VA 4CEQA 3PUFA 4Z4CA 2G8WA 4ECWA 2RKIB 1LW2B 5F8IA 1TL1B 3G86A 1X1PA 4JV1A 4IFVA 1REVA 2E6MA 1JLEA 5F8HA 3K5LA 2HNDA 1TKTA 4KHUA 1S5JA 5DG9A 3ZT0A 2B43A 4URSA 1N4LA 3AVHA 4ELVA 4ID5A 1DTQB 5KG6A 4C8MA 4K8ZA 1XWLA 5J1EB 2ILYA 3CJ2A 3T3FA 4PUOB 1QAIA 4LQ3A 4L8RB 4NRUA 3L3UA 5FDLA 3K59A 1KVAA 2HHTA 5KFSA 2OYQA 4CIEA 4M45A 2HAIA 3HKWA 4GVMA 2QK9A 3CFRA 1RYRA 2WTFA 4IQXA 3VQDA 3KNAA 5I3UB 4E7HA 5KFMA 5KFHA 1J5OB 3CM6A 3QZ8A 3VQ5A 4KSEB 1HNIA 3FFIA 3BQ2A 4DQPA 1BCMA 1LWFA 1R0AA 1FKPA 2WK4A 4U7CA 3DLKB 3LPTA 3PHEA 2QXFA 4ZP6A 3K5NA 2I5JB 4IRCA 3RR7A 2IJNA 2WHOA 4TSXA 2X6NA 3KHHA 2PYJA 3DM2A 5DQGA 4M3ZA 3ZSQA 5HRSA 1C0TA 1S48A 2HHVA 1HNVB 4FM2A 2BQ3A 4FLYA 1VSHA 2C2EA 4MK7A 2R2UA 1XI1A 4B8AB 3C95A 1ASUA 3MR5A 3NF9A 2FJVA 1S97A 4K4SA 5HBMA 3AVNA 3C94A 3TAGA 2VG5B 4HVJA 3TWHA 3HSTB 4WZMA 1IKWA 2RPIA 2LSNA 1C0UA 4ED8A 4W5QA 3RAQA 4MFBB 4FCYA 3KLVA 1WLJA 1KFSA 4KPYA 3TAMA 1Q9YA 4G3IA 2WOMB 3SPYA 3RB3A 3M8PA 2DPIA 5CZ2A 1FK9A 3PW7A 2HHQA 1TP7A 2ASJA 3B6OA 3I5AA 3GV7B 4WFYA 4FYDA 1HYVA 3VN5A 3V9UA 4OVLA 1VSJA 4DS5A 3MEGA 4NLXA 5JXSA 1K6YA 4RNOA 1RTIA 4IH5A 1QHTA 4B8CA 3ZSZA 3SFGA 5KFJA 1NKCA 3AO1A 4J9PA 4KO0A 5DLGA 1C1BA 2BQRA 4B08A 1C1AA 4RW7B 1QSYA 3MEDA 4CEDA 4DWIA 1BI4B 3S3OA 3QGIA 5EUHA 5K14A 3V6KA 4HHTA 3UPFA 3EPGA 2EX3A 4I9QA 3CG7A 3H08A 4QWEA 2YKNA 1HARA 3GIJA 2ASDA 3NH1A 2W42A 1VSKA 4KHWA 4C8KA 4QAGA 2RKIA 3LWMA 4K4TA 2HW3A 2HHSA 3SJJA 3GYNA 4EYHB 4ZHRB 4Y2CA 2XCPA 3LAMA 1IKYB 3NBPB 3DI6B 3SV4A 3P5JA 4GW6A 3TAQA 4NLSA 5DK5A 3AVLA 4KHNA 4IH7A 1DTQA 4ZPCA 3SQ0A 4KHSA 2KFZA 3ZT4A 5J1EA 5KT7A 4PUOA 1QUVA 3I5BA 4O4RA 1J53A 3O3GA 4KB0A 5HRRA 3CJ4A 1HQUB 1C1CB 2CKWA 1GOAA 3MAQA 3K5OA 3Q8QB 3ICLA 3NDKA 5I3UA 3DDKA 3PR5B 2W8KA 3ZT3A 5KT2A 4YMEA 2KW4A 1J5OA 4NLOA 4CGDA 3KD5E 5KFLA 4EZ6A 1SH0A 3LWLA 4ECYA 3DLKA 2XCAA 5J2PB 4BE2A 4E7KA 5KFUA 2I5JA 1TGOA 2PZSA 1D8YA 2XC9A 3ZT2A 3KHGA 3OJSA 1L3UA 5CYQB 4KHMA 3I8DA 5L1KA 4DFMA 5EWFA 1CXQA 3C6TB 3AVCA 3L2RA 2V4QA 2YNIB 1BCOA 3LZJA 1S0OA 3KK2B 4ELTA 3H4BA 1U09A 3DMJB 4DFPA 1D1UA 2VG5A 4YR0A 4F4WA 4QCLA 2GUIA 5KFYA 1WSHA 3DLEB 4DL4A 4JRQA 4CJ4A 1ASVA 2XI3A 1SL1A 4MFBA 4URQU 3DLBA 1QE1B 1YVUA 2WOMA 4DU1A 4N76A 4OJRA 3VQ9A 4B9SA 4TXSA 4ED7A 3T19A 2FVCA 3NGIA 3OYEA 1N56A 1UOCA 4R8UB 3KLEA 4IFYB 1A5WA 2XY8A 5SWMA 2A1SA 4RUAA 4Q0BB 3H98A 1Z25A 4B9LA 4ZPDA 1S0MA 4RW7A 2ASLA 3ULDA 4Z4FA 3AVIA 2W7OA 4KE5A 4KV8B 1S0NA 4FW2A 3SPZA 1BI4A 4QWCA 4E7LA 4K8XA 4CFCA 4DSJA 1YTUA 5EWEA 1TK0A 2G8HA 3KLHB 3L2UA 4MKBA 3AA5X 4B3OB 2F96A 3AO4A 3OS2A 3M9OB 2P5OA 1UA1A 4F4KA 4ZHRA 4TYAA 3FQKA 1S1UB 3HPGA 3DLGB 3KHLA 3NF8A 2B5JB 1RTJB 1OS5A 4KHYA 1ITGA 2VWKA 1VSIA 1WAJA 1IKYA 3NBPA 3DI6A 3L2WA 1U47A 3D0PA 1SKWA 3QIOA 4RNMA 4DL7A 1RTDB 4NLRA 4KHRA 4E19A 2G8KA 3E01B 4TN2A 2FVSA 1BIZA 1RT3B 3QIPB 3SI8A 5KFWA 4DL6A 4WZQA 3AVAA 4LH4A 1KVCA 5F8JA 2GBZA 2W9CB 1HQUA 3CVKA 2C22A 1C1CA 4EBCA 3OHBA 4CJLA 1ZETA 2HNDB 1RDDA 3RMDA 4DSFA 4RW6B 1IH7A 3P1GA 5FRNA 3I0RB 4EBDA 2FLNA 3QGHA 3SQ1A 3RBDA 1ZBHA 4KAIA 1TAUA 3RMAA 5J2PA 2GIRA 4EZ9A 2W9BB 1NK7A 1JLFB 3L3VA 4J2AA 1HYSB 1YTAA 1ZBUA 4Z0UA 4DF4A 4RU9A 4K4ZA 5CYQA 1C6VA 4FJNA 2UUWA 4ED3A 2JLEA 4TY9A 4FJ5A 2YNIA 5KFZA 4M95A 3MR2A 1LWCB 1X9SA 1D9DA 3KK2A 3RB0A 3AVBA 3S3NA 4RW8B 4J9KA 4KTQA 4NCBA 5KG1A 3NMAA 4IKFA 1HNIB 2F8EX 3DLEA 4K50A 2JGUA 5J2NB 3UIQA 1QE1A 1VRUB 1IM4A 4YR3A 2UVRA 4GC6A 3M8QB 3ITHB 5KT5A 3CQ8A 3FRZA 1KCFA 5KG5A 4M94A 3KTQA 1S1TB 4R8UA 2BE2B 4IFYA 2YNGB 5KG3A 2YNFB 3JYTB 3IAYA 5E41A 1W9HA 3MXJA 3NCIA 4Q0BA 4ECSA 4DLGA 4UQGA 1A5VA 4KV8A 2WB4A 1Z26A 1TKXB 1ZBFA 1WSJA 3K58A 4JLHA 1SKSA 3IGVA 4ZPBA 2W7PA 4LSLB 3KLHA 2ZKUA 1RT2B 3CO9A 3PX0A 4AHSA 4B3OA 3DYAB 4NLDA 1QQCA 1Z4UA 4K4VA 2FBVA 2BDPA 1KHWA 2YV0X 3KIOA 1ZBIA 2UUTA 4BE1A 1S1UA 4DLEA 2D0BA 3PX6A 3DLGA 3KKRA 4CJSA 2B5JA 1RTJA 1U4BA 4FJJA 4CK3A 2D0CA 4CERA 3OYHA 3MEEB 3RAXA 4Q8EA 3OHAA 2E9TA 1RDCA 4DU4A 4MH8A 1BIUA 4CJKA 1RTDA 2E9ZA 3PO4A 2FBXA 2X74A 5FROA 4DTOA 3CJ3A 3FQLA 1JL2A 4OL8A 3E01A 1RT3A 3QIPA 1RTHB 1T3NA 1TQLA 4Q5VA 2YKNB 4DG1B 3OYKA 1NNDA 2W9CA 2BQUA 2WRMA 4LY7A 3BSAA 5J2QB 5DLFA 3E51A 1SL2A 4ZMMA 1WAFA 4ZP7A 3OYBA 3CM5A 3HVWA 3GILA 1IO2A 4FM0A 4RW6A 2DFHA 1RA6A 3QINA 5KFOA 3I0RA 3NGZA 3V6JA 4IRDA 2P51A 1BQMB 4QW9A 1D5AA 4DTMA 3SQ4A 1GX5A 4FJLA 4H8KA 3AV9A 4DF8A 3TAPA 3NH0A 4PY5A 2Y1IA 2W9BA 1JLFA 4ECTA 3H5UA 1HYSA 3LDSA 5KG2A 4ZTJA 2BRKA 2UVWA 3L8BA 3PW5A 3OYIA 4ECXA 5KFIA 3NGYA 3T1AA 2ZQBA 4CFAA 1C2PA 2C28A 4Z4EA 1NOYA 3RB4A 4E7IA 3NF6A 1S6PB 1LWCA 2Z1HA 3PO5A 4JV0A 4RW8A 5C24B 1B92A 3VQ6A 3HVRA 1TKZB 1NK8A 4NCAA 2RDJA 2Z1GA 1RCHA 3N6LA 2JC1A 4H4MB 4QOZB 5J2NA 3RMBA 3PR4A 1VRUA 1RDAA 4NLQA 2KZZA 4N5SA 3M8QA 4ECQA 2O4GA 3ITHA 2DFEA 4DSKA 3ZSWA 1QSSA 3PV8A 4NYZA 3HVAA 1S1TA 5KFFA 1LW0B 3CDEA 2BE2A 2YNGA 2YNFA 3JYTA 1GOBA 4ZP9A 3VA0A 4DQQA 1HQEB 4DQRA 2GC8A 3PW4A 4FJMA 3PZPA 4W5TA 4DQIA 4RNHA 4DU3A 4F3TA 1T03B 5L1LA 4MIBA 1HJRA 1CLQA 1QSLA 4Z4GA 4W5OA 1TKXA 3ZSXA 2UVVA 3IN5A 3AVMA 4O44B 4LSLA 3VQ7A 5DGAA 3RRGA 5DG7A 2QKKA 1JKHA 4DL2A 1RT2A 1QAJA 3LZIA 3DYAA 4CEBA 2AGQA 4KBIA 3OS1A 4HKQA 4CJQA 4JS4A 2B6AB 2W8LA 1U45A 4FJ8A 2V0NA 3WNHA 3KLEB 3DOLB 5CY4A 4KRFA 3CFPA 4Y1DA 2XRIA 4BWMA 3MEEA 2XI2A 4ZVFA 3IG1B 4CJWA 4B9NA 3B6PA 4QWAA 4CFDA 3PX4A 2QV6A 3OSPA 4AILC 3MXMA 2OH2A 1FXXA 3H5YA 4ZVEA 4FW1A 4EBEA 1RTHA 3GQCA 5I42B 4FZZA 2D5RA 4C8NA 5FRMA 4FS2A 3RR8A 4DG1A 3NH2A 2V4RA 4HCCA 4J9SA 4IG3B 1VSDA 3MR6A 4YNQA 4CESA 3O3HA 4QWDA 4FLWA 3GV5B 4OKKA 5J2QA 5KFQA 1KRPA 3SYZA 4OGCA 4CF2A 4DTRA 1UWBB 2RN2A 4FM1A 1NK4A 4IDKB 1C0MA 5HROB 1S6QA 1XR7A 1S1XB 3VQQA 3VQBA 4NLGA 1SL0A 1MMLA 3EPIA 4AHUA 4Q8FA 4O0JA 3QZ7A 3V6HA 1BQMA 3DLRA 4HYKA 4FLUA 4Y1CA 1XR5A 3P83D 1WSIA 1EP4A 1RAJA 4F4ZA 3GV8B 3DOKB 4DQSA 1D9FA 1NKBA 2NUBA 3N6MA 4CEOA 2VA3A 4Y3CA 5HRNA 3RMCA 1JLAB 5KFRA 3SUPA 4U6PA 1JXEA 4EYIB 4IH6A 2X6SA 1HYZA 4Z4HA 4AHTA 1S6PA 5SZTA 1WN7A 4Z4IA 5C24A 1BGXT 1TKZA 5KFPA 4DSEA 3DRRB 4ELUA 3TABA 3NL0A 4H4MA 1SV5B 3HYFA 1BQNB 1RDBA 4HTUA 1RBRA 5KG0A 3CJ0A 1EXQA 2A1RA 4XIUA 1S9EB 1NK9A 1NHVA 2D7SA 5L1JA 2ZE2B 4I7FB 2R7YA 1LW0A 1RBUA 3M9NB 1NJWA 2W9AA 3FSIA 1L3SA 1HQEA 2ETJA 3V1OA 3K57A 2RF2B 5F8MA 3BGRB 4F4YA 3ZSOA 2BANB 1T03A 3T5KA 1ZTTA 2FLLA 2VA2A 4M3UA 4LSNB 3BDPA 1NOZA 4Y34A 4CF8A 3I5CA 2OZMA 4ZVGA 4KKOB 5DMRA 4O44A 4W5NA 4AHCA 4ED1A 4C8OA 2R2RA 4KI4A 1G15A 1NK5A 3A2FA 4MK9A 3WNFA 3SI6A 3RB6A 1J54A 3HP9A 4H4OB 2B6AA 2HVIA 2OPRB 3L2VA 2YKMB 4DTNA 4M3WA 3DOLA 3GIMA 3TI0A 1VSEA 4NLYA 4WYWA 2IOCA 3LP2B 5F8NA 3MFHA 3IG1A 4LD0A 1N6QB 4MK8A 5KTQA 3M8RA 1RILA 5KFKA 1SUQB 4M42A 1RT4B 3QERA 5I42A 1IKXA 3G6XA 4IG3A 3IS9B 3QNOA 1JXLA 4HCBA 2JEIA 3T5HA 3BR9A 2R8KA 3QO9B 4IR9A 3OYLA 3LPUA 1UWBA 4DTPA 4IDKA 3T5JA 1ZBLA 5HROA 4PQUB 1S1XA 4FJXA 4DTXA 4I9LA 1DTTB 3OYJA 3IRXB 2YNHB 4J9MA 4CJ5A 1TV6B 3KLGB 3DOKA 4CJFA 1X9MA 4QW8A 3TARA 2DTUA 1JLAA 4O4GB 4E89A 4GC7A 4KREA 1DLOA 4TY8B 2P5GA 1JLQB 4RUCA 2ATLA 1KFDA 1EKEA 5L9XA 3G10A 2VG6A 2HVHA 4E1NA 3QLHB 3K5MA 3CFOA 5C25B 4BDZA 3DRRA 1S9FA 4X2BA 4FLTA 3DRPB 4J2EA 2AX1A 3N6NA 2PYLA 1MU2B 2FVRA 1SV5A 3H4DA 4CGFA 4NCGB 4I2PB 1BQNA 3V4IB 3LANA 1XHXA 1RBTA 5HRPA 3D5MA 2IAJB 4CHYA 2F8SA 3QEXA 3OLBA 4XO0A 1S9EA 2FBYA 3OYDA 2ZE2A 3LALA 3ZSYA 4ZPAA 4I7FA 1L5UA 4CF9A 1NJYA 3ISNC 5F8GA 4DSIA 4YQWA 3KK3B 5KFEA 3MR3A 2RF2A 3UDLA 2C2RA 4BDPA 4JS5A 5DGBA 3CIZA 3BGRA 4J2DA 2KQ2A 2BANA 2OPSB 4ECZA 2JEJA 4WXWA 4FZYA 4LSNA 4R5PB 1BL3A 3KD1E 1T7PA 2VWJA 2OA8A 4ED0A 3MECB 3TANA 4ECVA 4KKOA 1NK6A 2IM2A 5DQHA 2J6SA 4KTWA 4J2BA 4ECRA 4BACA 2D3UA 3H40A 1J9AA 4NLWA 3NAIA 1O1WA 2KFNA 4FVMA 4H4OA 2OPRA 1S9GB 2YKMA 3U3YA 4NYFA 2AX0A 2ZD1B 4B9UA 2XWYA 5EU7A 3V9SA 2IA6A 4XPEA 1UA0A 3V9XA 1SH2A 1N5YB 5KFXA 1VK0A 4YFUA 5KT4A 3V1RA 3LP2A 2PY5A 4KI6A 4B9VA 3HO1A 1I6JA 1N6QA 3KLFB 1SUQA 4DTJA 3TVKA 1RT4A 2IGIA 1KLNA 2IM3A 4ICLB 1JKHB 1LWEB 3IS9A 2I1RA 4CHNA 2HNYA 1JLCB 1KHVA 3QO9A 4CF1A 4K4YA 1GOCA 3KHRA 4N41A 3SUQA 2HHWA 4FBUA 3VQ8A 4PQUA 4F8RA 4R0EA 4FLZA 4LQ9A 3V81B 4FZXC 5KGWA 4B9TA 4OKEA 1DTTA 4J9NA 5KI6A 1L3VA 2VG7B 3IRXA 3BJYA 3MTKA 3LP3A 2YNHA 1NJXA 3G6VA 1CZ9A 1NK0A 1TV6A 3KLGA 3CJ5A 2KZMA 1HPZB 1WSEA 2Y1JA 3WNEA 1T8EA 4BWJA 2YHBA 2ALZA 3OL9A 2E4LA 3OVNA 5CYMB 3OYAA 4NLUA 4CHPA 1S4FA 4FJ7A 4O4GA 4KFBA 1TVRB 4IBNA 3AA2A 4TY8A 1IKVB 4N56A 1JLQA 5KG4A 4WFZA 3KLIB 3CDWA 4FJIA 4EO6A 1F21A 3SNNA 3NFAA 5JS2A 3VA3A 1TKDA 2OZSA 1NHUA 1XHZA 1L3TA 3QLHA 3QEVA 1S6QB 3C6UB 3HM9A 4KHQA 5C25A 4GMJB 3RTVA 3DRPA 3OL6A
chains in the Genus database with same CATH superfamily
1MU2A 1HHSA 3U6FA 4LF9F 1BHLA 4FXWA 3MK6A 4NZ0A 4JKFA 2VYPA 3TVZA 2D4WA 3E9LA 3O3FA 1W2BM 2DY4A 4JUZA 3Q8PB 2GW8A 5AQTA 2JEFA 4LFCK 1EQYA 2OPQB 5HP1B 3HJVA 2VKRA 1S57A 1U2FA 4OYMA 4FLVA 2IMWP 1EARA 3DLLQ 2E1YA 4WF9L 2OPSA 5A6WA 1ZOTA 1D0EA 1GEHA 3KZBA 4LF6J 5A8RA 3QYYA 4OPKA 3G8QA 1IR1A 4XPCA 3NF7A 1RU1A 1NDCA 4DV6F 3CD6N 3D28A 2LXIA 2WVBA 1WF1A 1YG0A 3BKTA 1HW9A 4FXDA 5DJBA 1S9GA 2AIRB 1HA1A 3R1HA 1NGBA 2F8TA 1S6UA 2YX6A 3SFUA 4LF6K 1FJCA 3EZWA 4P75A 2VGMA 1HBNB 1F60B 1KDNA 1GMUA 4JKEA 4J5OA 2NYHA 3K0SA 3OTOF 2HHXA 4DQ8A 3OY9A 3CJ1A 1LWEA 3QDKA 3D0GE 3UDEA 1NH7A 3KNGA 1JLCA 9ATCB 2L41A 3CETA 4I6MA 4UOGA 1KEKA 3EGZA 4UOFA 1LNQA 3DRSB 2VG7A 1N48A 2DNPA 3OA9A 4X66F 4KH4A 1M90T 2DHSA 1SKRA 1HPZA 2LQ9A 3Q23A 1TL3B 1A5XA 4CWBA 5CYMA 1B70B 2X3DA 4G1QB 4EO8A 5DQIA 3LP0B 3KLIA 5CCLA 1S1WB 3CDAA 2MMYA 1BHNA 3VF4A 5ETNA 3GJRB 4WFAQ 1FT8A 4DS4A 1S22A 3H25A 1LW2A 4A8WA 1JIHA 3PACA 3EXYA 2YKQA 5CHCB 4RW4A 3AQOA 3Q8UA 1A7GE 1H7XA 2V94A 4CCHA 2GAGC 3UI3A 2ZNYA 3TOQA 2DRAA 1Q18A 3A8EA 3IM8A 4C8LA 4CGGA 3NHGA 2L48A 2IDOA 1DURA 1YF5L 4DV5J 1SVDA 4G65A 3M6UA 3OL7A 1RT5B 3I0SB 2QYCA 4WF9Q 4GV6A 3CDUA 3G96A 2HQIA 5IV3A 3TX0A 1YJ7A 2EWHA 4OKJA 4PA1A 4OZ0A 1T9XA 1YGYA 2P9UB 4ZLJA 2QWPA 4DV5K 4DUYF 2JC0A 2GA7A 2PEHA 1CEZA 2Z1JA 3G9CA 3QEWA 1MWYA 2MQOA 5KGXA 1X4EA 4CF0A 3VENA 4E8UA 4J9OA 3ATUA 3VQCA 1XQSC 2HOEA 5KRSA 3PJXA 2MQMA 4CEAA 1U02A 2N7CA 3D6RA 5C2CA 3ZEUA 5IT4A 2JWNA 3OFHA 1FNOA 1WSFA 4CJPA 1RT1A 4DR7F 3LP1B 3IRWP 4IR1A 5D4PA 4CH0S 4ENOA 2QMWA 2MQ8A 1KQSR 2HMIA 4HT5A 1GMWD 2AHOB 2KO1A 4JI5J 2FJXA 2ZF5O 1UKUA 4F2SA 2LLZA 1T05B 2I7NA 1UVIA 4BRAA 3OVSA 3AD8C 4LVOP 3OSNA 4USIA 4PWDA 2LEPA 4EFAC 1M90O 3X3UA 1Q79A 3LPYA 4H5NA 1J2VA 3QEPA 1CXUA 5LMNF 4JI5K 1RDUA 3KKSA 3VESA 2XMUA 2NRRA 4ZPWR 1NJIO 2VJUA 2YY3A 2ASOA 4DX7A 3CDBA 2W4DA 4NASA 2H4WB 4IG0B 3J7A1 3R5AA 1LFPA 2AQ4A 4CYUB 2EK6A 4CD3A 3NGDA 1RFQA 3ZX3A 1RNHA 4K42A 1ELOA 3QFPA 3D54A 1TAQA 5AQOA 4BC3A 5L1IA 4E1MA 3K2YA 4USJC 1ASWA 1VAZA 2HZCA 3BF4A 4OHYA 3HSZA 3ASMA 1XUPO 4I2QB 3WC0A 1LV5A 4ZN1A 3IKMA 3FEYB 4DL5A 1U49A 3BBFA 4EHUA 3HHLB 2E1RA 1S1VA 4KFBB 1VLYA 5A8WB 5B0DA 1B64A 3QRPA 1VQKS 2HB5A 4NLVA 3CC7S 3TQEA 5L46A 4ZP8A 3G6YA 5B0BA 3FZLA 4RWTA 1FE4A 1IJJA 4BR7A 2DNOA 2NXNA 3IFEA 1TFWA 1RT6A 3K9JA 4AFFA 1GXUA 4BRPA 1WNSA 3ISND 3AO2A 2P1JA 3M2UA 4NA2A 3JXOA 3C2PA 3O80A 3DNCA 1JLEB 5EWGA 3DOMA 2C2NA 3S9HA 4K4WA 1YHQS 3V9WA 5AE1A 2R8IA 4V19X 1P90A 2VZ9A 4H5TA 1WEXA 4FJKA 1MW7A 3EE9A 4ID5B 3VOVA 1N8RT 2IDEA 3AA3A 3PIOL 2YTCA 1WUAA 3CYMA 2AV5A 4C1NI 4B3TF 4ID1A 3DXBA 3HPOA 2JJ4D 4F2RA 3O9RA 4NLCA 2AZ3A 1U8WA 3F56A 4NA3A 3CJAA 3FKBA 5KPRA 5F9NA 3CC4N 2HBMA 2CNKB 3FFIB 3VVTA 1CC7A 1R0AB 5E3PA 4CHOA 3CJSA 4K25A 4A61A 4HL9A 2B4JA 2FJWA 1H6KX 2GCFA 4AT1B 1QVGR 2LECA 5IT9U 2XHBA 2QKBA 1QJHA 4P74A 4CIGA 1PYTA 3KK1A 2DNKA 3CXCR 2G8FA 2HFZA 3Q24A 1O8BA 3MX5A 3D1HA 2R9LA 3ADAC 2E1CA 3C66A 2E2QA 4QWBA 2B4OA 3M8WA 2FVPA 3PKMA 3A5LC 3J80O 1FF2A 1UZHA 3HJFA 2KXFA 5HBMB 3TEHB 2IBKA 2PFDA 4YP3A 3BZKA 1VRTA 4W5RA 3ZFVA 2ABYA 2H65B 2AGPA 2IM0A 2KJWA 1CQMA 1UVMA 5KFBA 3PXGa 3VGUA 1A0OB 1HJOA 4K7QA 3M8PB 1FK9B 4RW9A 1IBCB 2C3MA 3F9KA 3KWGA 4X4NA 2YHYA 1OYDA 1B99A 1RA7A 3KJVA 4GVLA 3THXA 4KGZB 4CM2A 2BE7D 2Y8YA 4KO0B 2UUAJ 4CK1A 2VJVA 3V6DA 3Q0AA 3AVGA 4RTFD 1WOOA 5JS1A 4NOHA 1EHWA 1RISA 2X7IA 3K8VA 3KOAA 4XTTA 3H5SA 4MIAA 4HEA9 4CEQA 5LT5A 4DPOA 3IP0A 2MKSA 2A6AA 1VQLN 1TL1B 4DPTA 2BABA 1REVA 1K8KA 1D9AA 2UUAK 4U67L 2ADBA 4M63C 3K5LA 3NWGA 3QRQA 2HNDA 3L4IA 1SJQA 4WQ5A 3M7VA 3GE1A 5H9FK 2B43A 3TEGA 2MKHA 1KQKA 1N4LA 3ZC4A 4C8MA 4EU0A 2YBVA 3GP9A 3VGLA 1VQ6N 2BKPA 4OMFG 3PIOQ 4NRUA 3L3UA 5FDLA 4HR2A 3EO3A 4CH7A 4M45A 2HHHJ 1F2GA 1VIXA 1Z6RA 3CJ7A 5JLHA 2BW2A 1F6TA 2FSKA 9RUBA 2C2ZB 4DV4J 5ETMA 2ITMA 3QZ8A 4KSEB 4GVBB 3W5ZA 4NI2A 3KUHA 3Q8YA 2DB1A 1FKPA 1DEJA 4LF5F 3GOIA 1M1GA 3BH7B 2OTLS 4NZ6A 2QXFA 2HHHK 4ZP6A 2I5JB 4IRCA 1PO6A 4N77A 4FPAA 2M0GB 5I4MA 4TSXA 1R8PA 5DQGA 4L73A 1VQ8S 4QOTA 2XYGB 1C0TA 2VDIA 4DV4K 2HHVA 3VTHA 1VHXA 4XDDA 4A57A 4LFAF 5AQHA 4JI4J 4MK7A 3RBXA 5FPEA 3MR5A 1S97A 4MTPA 1HKBA 2ZOMA 1NZAA 1VJWA 4K2XA 1WBBA 2VG5B 4WZMA 1WTFA 3IM9A 2KDOA 1IKWA 2LSNA 4HDHA 2JZ5A 3NS5A 2UUBJ 1RWNB 4BS2A 1Q9YA 1X3NA 1ZXOA 4P2MA 2UXCJ 1KVIA 4JI4K 3R7BB 3VEXA 3VN5A 2SXLA 5EN1A 4OVLA 4CBUA 5FPDA 4M5IA 4JEPA 3MEGA 1K6YA 4RNOA 1VCTA 4DR3J 3O8WA 3P45B 4YDXA 3SFGA 1PBAA 5KFJA 1NKCA 4ZVOB 3AO1A 2UUBK 2KHOA 1C1BA 1HD1A 3ZXWA 4ZLPA 4WIIA 2W4PA 1FDDA 3CJ9A 5IOLA 2Y0BB 3MEDA 2UXCK 4DWIA 4GMKA 3ZZ0A 3QGIA 5EUHA 5K14A 4B17A 1PCAA 3OQ2A 3UPFA 3H08A 2CQ0A 2VFTA 2Z57B 2XS2A 4DR3K 4JI6F 4USUA 3LWMA 1WB9A 2O8EB 4K4TA 3D6TB 4QYRA 3SJJA 3A3NB 4Y2CA 4U67Q 1RWXB 1VBYA 4H5RA 3TAQA 3D1QA 3MCNA 5DK5A 1XQIA 1YJNS 3I56N 4NMXA 4A2BA 2A42A 3WBZA 1DTQA 1AZSA 1RABB 1WC6A 3SQ0A 3CB4A 1G99A 2GX8A 2KFZA 4KHSA 1XK8A 4PUOA 4F4AA 2QEXN 2O8FB 2AZ1A 4CTAB 4O4RA 3J7YU 3MM7B 2CJYB 1CJKB 3O3GA 1KTVA 3CJ4A 3OHRA 4OHVA 1C1CB 3MOZA 2E1AA 3VGTA 4GVEA 3NVKA 2G2ZA 5BYRA 3OVBA 2CQPA 4FN5A 3TNVA 5FLXU 3BF3A 2ZJQL 2C42A 2RS8A 5KFUA 1TGOA 1Q7LB 2PZSA 3TZYA 4K41A 2XC9A 3TA0A 4ITSA 2HBKA 4F0KA 3I8DA 2O8DA 1X9JA 5EWFA 5LJ5Y 2OEJA 5F0XA 4FDFA 4ELTA 3H4BA 1T9TA 4ILMA 2P8IA 3WEEB 1V4TA 4AE5A 4RX6A 4DFPA 1WI6A 4YR0A 2GHPA 1NPRA 5KFYA 4JRQA 5MLCQ 1ASVA 2WAQD 3W61A 2XI3A 3C6AA 2AJFE 4URQU 3DLBA 1QE1B 1YVUA 1H0HB 2K1RB 4Q2MA 2KG1A 3THYB 2MLYA 2Z2MA 1P9QC 2CQ1A 4ZVSB 4ED7A 3IDHA 3NOGA 2IVFB 1P1TA 3OYEA 1UOCA 5DM6L 5B0CA 1A5WA 1VS3A 4DCPB 3NEKA 5AQQA 2XY8A 3N28A 2COLA 3M4XA 4Y65A 5AQPA 4B9LA 1S0MA 4RW7A 3ULDA 4Z4FA 3AVIA 2MY8A 4CI6A 4FW2A 4JD2A 1BI4A 2KJVA 2BVZA 3PJ9A 4CZIA 2QLXA 4MKBA 2Z4PA 3US5A 3AO4A 1QVFR 2GELA 5B0AA 4JHDA 3FBCA 4WP3A 1WI8A 4CZHA 3HPGA 3DLGB 1HBMA 2CH6A 3B8AX 3NBPA 3DI6A 1U47A 3D2WA 4YOEA 1RJJA 4DL7A 1P27B 4NLRA 3HZGA 4KHRA 1TZ0A 4E19A 2G8KA 3E01B 3B82A 2CZ4A 2ZOGA 4DL6A 4WZQA 1HBUA 2V7ZA 2JLGA 3FEZA 2LFVA 1HWUA 7FDRA 1FXLA 3P4IA 1TUGB 2HGMA 2C22A 3A5NC 3MWPA 1SC4B 1SJ1A 2BACA 1YK9A 1ZETA 3RMDA 4C23A 2LU2A 3WIVA 4Y0FA 2VIHA 3FC9A 3P1GA 5A76A 3I0RB 4DMZA 3CCJS 3QGHA 1TUYA 1BY9A 1ZBHA 4DPYA 2ZJQQ 1I94J 1TAUA 1X4DA 1IQTA 2WBNA 4M8LA 4DV1F 3ID6A 3E9OA 4PYDA 4J2AA 3IAM9 4DF4A 1AW0A 2QMUB 1RCOB 4DR4F 2OELA 4TY9A 1IBMJ 1U1RA 4FJ5A 2YNIA 5KFZA 4M95A 1FFSB 2PI5A 3MR2A 2EPIA 2H54B 4WQ4C 1D9DA 3AVBA 1I94K 3S3NA 4NCBA 1SAZA 2JVRA 3NMAA 4IKFA 4TNOA 3RG6A 3QMLA 2F8EX 2XZTB 1EX8A 2FZKB 2RNEA 2UVRA 4DBQA 4OYBA 3ITHB 1IBLJ 4OHWA 3TP2A 2MLXA 1UPPA 4A5AA 4M94A 1S1TB 1ZS6A 5JJBA 5C10A 5DM6Q 2BE2B 3ID8A 3TYTA 3TJ8A 1W9HA 3N79A 2P9PB 3NCIA 1GLLO 2YHXA 4LRAA 4FWSA 1IQZA 3IR6B 5HVHA 4KV8A 2GJFA 1U1LA 3HHLC 2VBWA 1IBLK 1IVZA 2WB4A 1R8CA 2A18A 3M6XA 3IGVA 1PSDA 2BJ1A 1IN0A 2VL1A 3IMQJ 4Y6IA 2P9IB 1KHWA 4CO1A 2BEFA 4BE1A 1WSVA 1S1UA 2D0BA 3PX6A 2B5JA 3N4WA 5IS2A 3L7UA 2E9TA 3E8OA 2IA0A 4MH8A 1NMEB 3PO4A 5FIIA 1HBOA 5A2QY 3O9TA 4NZ7A 3U1NA 2OSQA 3QT6A 2ZH3A 2CA9A 1RT3A 3JTPA 2AEJA 3ILJA 3OTBA 1T3NA 1RAOA 4DG1B 2W9CA 4ZVUB 4LY7A 2WB1D 5C7PA 5CH7B 3HX9A 1V4SA 2ZBPA 2BJEA 2F5GA 1WAFA 4ZP7A 1C4AA 3GILA 3QINA 3KHYA 3DCAA 2HQCA 3HULA 2CWKA 5CZVA 4H8KA 4DF8A 1NSPA 3JS6A 3DN9A 2Y1IA 1JLFA 4ECTA 4FO0A 4X4PA 3WX4A 3LDSA 2E20A 2BRKA 3L8BA 4OHZA 4FVCA 3QICA 2PFUA 4ECXA 3SQGB 3LOUA 4KC5A 3IBWA 2V52B 3CERA 3NF6A 1S6PB 2RU9A 1DKGD 2DT9A 3A8IA 4XH5A 1FJGJ 2JC1A 3CO0P 5J2NA 1UVJA 1FD2A 1BA1A 4NLQA 4BR9A 1CJTA 3M8QA 4DSKA 1VIOA 1DQ8A 4D3HA 1QSSA 2UUCJ 2NRZA 3MPDA 5KFFA 1RE1B 1SIWB 2O67A 3VERA 3R3TA 2J4RA 4CO5A 4LF8J 1FJGK 2GC8A 4W5TA 3AJDA 3Q22A 4RNHA 4F3TA 1RDWX 2XM3A 1HJRA 3MAAB 4PG8A 3TU5A 1R31A 1VC0A 5BPNA 3ZSXA 4W5OA 2UUCK 2UVVA 3GMGA 4JBCA 3AVMA 3VQ7A 1JKHA 1RT2A 1QAJA 4GRSA 3DYAA 4USKA 4YUDA 4CEBA 2K8GA 2YX7A 5HN0A 4KBIA 4LF8K 1UTAA 2B6AB 5AZIA 4FJ8A 4LIWA 1NG9A 3DOLB 4PKGA 5CY4A 1AUSL 3AB2B 1X8DA 5THWA 4PXEA 4CJWA 3B6PA 4QWAA 5TKWA 2QV6A 1FXXA 1YVNA 4C3KA 2HBRB 3TWZA 4EBEA 5I42B 4RUHA 5FPNA 4CZCA 1XBWA 4M7YA 3RR8A 2J0WA 3NH2A 4J9SA 3GB0A 2N7YA 4NWBA 2I38A 3EXCX 2XS7A 4JN4A 4OKKA 5IWAF 2E1MC 4OGCA 4CF2A 1A9NB 3ZZTA 1C0MA 1S6QA 2QWLA 3VQQA 3NWRA 3VQBA 4B3RF 2FHJA 1SL0A 4PR6A 3EPIA 4AHUA 3CGIA 2E5IA 1BQMA 2N3LA 5ETRA 4ILLA 1U1MA 2V51B 2GQQA 1XR5A 3FBFA 1KOHA 3GV8B 2K3IA 2IIHA 1NKBA 1D9FA 3DU5A 4QR0A 2CPFA 3RMCA 5CAAA 1U1KA 3VF0B 2AYEA 3M6GA 5GAHI 2X6SA 1ATRA 1YSJA 1R59O 1ESVA 2J0XA 4Z4IA 1F9HA 2CJKA 1GQEA 2KLAA 2NCKL 5C24A 4ELUA 5B8HA 5D6GA 1MWKA 5EX5A 3IR7B 4JV5F 1X5PA 1DT9A 4KGXB 3GU0A 1NM2A 5BRDA 2HVEA 1EZZB 1XNRF 1EXQA 2HZVA 3TZWA 4QS9A 1RAEB 1NK9A 1G4CA 1FNXH 4V19S 1LW0A 1B0PA 3I4HX 3EM1A 4F0MA 3Q7BA 3R5CA 1ZM3A 3ZSOA 3HI9A 2GVDB 1V3ZA 2RIJA 2MDAA 4E2FB 4Y34A 1OH7A 1ACMB 5LMUJ 2OZMA 5DMRA 4C8OA 1DBDA 4KI4A 4ANCA 2QM1A 3PTWA 1NK5A 4CLYA 4BR4A 3UN2A 1AA1B 1KNZA 5EX0A 2I9SA 2OPRB 1Z2LA 2YKMB 4USVA 5F1XA 1RHKB 3GIMA 3TUJC 1FRMA 1RCXB 2H5JB 2JX2A 2CG8A 4WYWA 4U7BA 5LMUK 4L3QA 1U1OA 2M88A 5HVGA 2GO8A 1RILA 3J7ZT 1WORA 2CQDA 2I7PA 2APOA 4OI3A 3QERA 3O5TB 2L9DA 1IKXA 1N33F 4J90A 4GO7X 2MZJA 5A8KB 4C3LA 4LMZA 2JEIA 3T5HA 2R3VA 3CTRA 2DRBA 3IAS9 3M1VB 1GTEA 1TL7B 2CQ3A 4AQYJ 1BO5O 2QJ3A 1FJ7A 4I9LA 5EVZA 2XWXA 3IRXB 4CZEA 2YNHB 5E84A 4IQMA 5C2DA 2YKAA 1FI4A 1XMQJ 3UVJB 4ETZA 2ZM6J 3QFUA 2E1PA 1FX4A 5BYQA 4MT1A 1Q53A 4BR2A 4GC7A 1J5EJ 4B1XB 1MMDA 4AL7A 1O6XA 3JAMO 4AQYK 2ATLA 1KFDA 3G10A 4X64F 5HANA 4O8UA 3QLHB 4A4JA 4BC7A 3Q2TC 2F65A 4IJNA 4BDZA 4NYPA 1XMQK 4FLTA 2ZM6K 2PO4A 2AX1A 1U0HB 1VDHA 2PYLA 2XNQA 3C14A 3VETA 3J80U 4CGFA 1J5EK 3BKFA 3WUHA 1RBTA 4AD6A 5HRPA 5G0RB 3D0IE 2RSQA 4LFCF 3QEXA 2IYGA 2FBYA 1FTRA 3KK7A 3AH6A 5E0OA 3NMUA 2CG4A 2ZH6A 1NJYA 2RILA 1G7CB 1VC5A 4W4MA 4JAXA 1RGIA 2C2RA 4BDPA 4OYAA 1UCNA 4J2DA 2CQIA 1NUEA 3C15A 1DZ5A 2EBEA 4WXWA 1T7PA 2VWJA 4ECVA 1FESA 5LJWA 4ILHA 4ECRA 4BACA 2D3UA 3MEKA 3AODA 2CNOB 3H40A 3NAIA 4LBPA 4FVMA 1WEYA 4H4OA 1FRJA 4LF6F 3T69A 2G0IA 2OFGX 2GJIA 1RWOB 2DR8A 1ZBTA 5C2GA 1E6YA 1L3KA 1VK0A 3O6QA 1EJ7L 3MCSA 4KI6A 3AGKA 1SQEA 1I6JA 1KR4A 1IXKA 4H0VB 5HOOA 1SUQA 3JSRA 5HMYA 1VQLS 5LSRA 1RT4A 1KLNA 2IGIA 5BN9A 4ICLB 1EWQA 3DC2A 3DXMB 4K5RA 5C2FA 2XULA 3HSGA 1NDPA 2HK3A 4BGBA 5B0GA 3QO9A 2KXNB 4DV2J 2VASA 4FBUA 3G4SS 1X5OA 3ET6A 1VQ6S 4F8RA 3V81B 2GMJA 3EZOA 3D3CJ 4J9NA 5KI6A 4MKYA 3MTKA 4ILRA 1LEOA 1NJXA 3WT0A 4HDGA 2KZMA 1TV6A 3FSXA 2Y1JA 1WSEA 3WNEA 1T8EA 3B54A 4NX9A 4NLUA 4O4GA 4DV2K 1K9MT 3MCMA 1VQNS 1WC3A 1JLQA 2ZC4A 3CE8A 4FJIA 4L76A 3VA3A 1NHUA 4KHQA 4MO4A 1FVQA 3FZMA 4GNIA 5D4NA 3GLJA 3BEGB 1T11A 4PABA 5C42B 3M30A 2OPPB 5D0RA 4O3OA 4Q44A 4NCGA 1M5KC 3UR0A 4L74A 3V4IA 4I1TA 2IAJA 3MURP 5M2UA 3KWIA 4FXVA 3K7RA 2ZOFA 4LJMA 2E2OA 1R0BG 3ILOA 2AEFA 3KK3A 4M3YA 3MUVP 4NRTA 4F4XA 3V2UC 2RRAA 2KB2A 4O55A 1S4EA 2VB6A 2XO7A 1U04A 5AQMA 3BEXA 4R5PA 4DOZA 3U3GA 3VGVA 4DV5F 3MECA 1APSA 1HR0J 5EGYA 4LF4J 1ZM2A 1RAHB 2DNHA 4CZKA 2WVCA 3H2LA 4C4WA 5HAOA 4FP9A 2I0XA 4HI1A 1DFDA 2ZD1A 3D7EO 1KD1T 2BRLA 5HJYA 1NWKA 1N5YA 4L72B 2O1PA 4OI1A 2P2CB 4B3MJ 2FVQA 1T6DA 1HR0K 4LF4K 3HZEA 3VQSA 3TQ1A 3KLFA 1W2BR 4OJ1A 3LDPA 1T94A 4J37A 3RWUA 3O1WA 3W9JA 2ZBCA 4WE1B 1IJFB 2YKOA 3VQTA 1DQ9A 4WFXA 1JLGA 5HSPA 3MTJA 3PRDA 2HYIB 3I56S 2FSJA 2J9EA 4B3MK 3D45A 2H5IB 1QS4A 3G82A 1U1QA 2F9JA 1MA9B 4YR2A 1K47A 3H7HB 3B4DA 4DHVA 2Z8QA 5F9LA 1KLMB 1FKOB 2QEXS 1Y5LB 5KG7A 4JI5F 3OUYB 4TQRA 2E5GA 4BRIA 2DGVA 4MMOA 2RRBA 3CPWM 4CEFA 5E3CA 4KGVB 1HI8A 5T7BA 1UEKA 4E7JA 4LR9A 3H5XA 3EY1A 4WWSA 5HQMA 1FO1A 5D15A 1VSMA 3DRYA 5F3ZA 4H0TB 5CXTA 2ZFHA 4W98A 2BH1A 1HMVB 4A8FA 3D6FB 2DGTA 5AQLA 2P9KA 2EW9A 3FEXB 2RHQB 2ILZA 4O3RA 3OJUA 2V8PA 2C2OB 4EP5A 3QNWB 3L4QA 1FVSA 1LAVA 3EEQA 3FRYA 2LEBA 1YLXA 3AY9A 4FJHA 5SUHA 3P5TL 3N0VA 3SUOA 2PIIA 2RB7A 2W2QP 1EETB 3SQ2A 4OYWA 3HT3A 2OPQA 5HP1A 1WSRA 3G2XA 3SV3A 2GHWA 1VGYA 2M8DB 4BE0A 5I9EB 2YWEA 2HHUA 1WSGA 3MAHA 4O3SA 4M7XA 4ZKAA 1FX2A 4TLRA 2ZH4A 2QRRA 2R2TA 3MUTP 1CG2A 1EQMA 3VEVA 3LF0A 1YQHA 4OYIA 2ZH5A 1RWVB 5AQXA 4ID8A 1KD1O 1FKAF 3R97A 1KAZA 1VSFA 1IBKJ 2KHCA 1JLBB 3W7BA 3M8SA 1RAAB 2BM1A 2XY5A 3KMSA 3D4JA 1WNEA 4H4KC 4O0IA 4ZJQA 2K7KA 2IC3B 3KWMA 1X3MA 4CEZA 1MROB 3EZUA 2W01A 4F7VA 2ZHBA 5HL7L 1PYSB 3C0BA 4AM6A 2WONB 1UAXA 1IBKK 5GAGI 3S3MA 2V9KA 1KTQA 2NLXA 2QA2A 1MN9A 1VLOA 4RR5A 3L2QA 2F9DA 5FD1A 4L3KA 1Y0HA 4A59A 3CMEN 3L7PA 3TTFA 2QC3A 5D3GB 1WWHA 3GJSB 1TU0B 3DRSA 4JOUA 2P9GA 1EB0A 4P73A 1JJHA 2HPUA 3BYRA 4HUGA 3H2UB 5H9EJ 1TR0A 4F25A 1TL3A 1ZAWA 3ZZOA 3PLAA 4UTGA 4G1QA 4H0PA 1N5VA 2HNYB 3EKSA 4I0WA 3LP0A 2M2BA 4DUZF 4FSVA 5AXLA 3HP6A 2DHXA 2QMXA 1UMJA 1S1WA 2BOAA 3MMVA 1HW8A 2F1FA 2BGGA 3VQPA 3QRRA 4FS1A 5H9EK 1SI9A 4CE9A 4ZVHA 3ZZZA 1KAYA 2G4BA 2XY6A 5K8OA 2VKZG 2NPIA 5KAKA 2GV9A 1P1LA 3AFGA 3SBTA 4CJTA 1OY8A 3QB0A 3CMQA 5J2MB 4G6VB 5EY4A 3G0ZA 3Q8RB 3BN4A 3RW7A 3ZTOA 1I39A 1RTZA 2BOPA 1YBAA 3U1MA 5CABA 2OEMA 4PRFA 3ZT1A 2FF3B 1GLAG 4KGMA 3W3DA 1NLVA 4RNNA 3ATVA 1TK8A 1ZH5A 2F63A 2L9WA 5U47A 2WCXA 2UUAF 1RT5A 3I0SA 1RQ0A 2KKHA 3QEIA 1T9VA 1WC4A 1CBKA 2V4JB 1RAFB 2C3PA 3VV2B 1R27B 4P10A 3P38A 4JI8F 1TKTB 3T9ZA 2P9UA 2XGQA 4J9RA 3QJLA 4WKRA 3HOTA 3V9ZA 4GV9A 5C5JA 3GG1A 1RBAA 3VGMA 3V1QA 2HBLA 5M1NA 4OZJA 2UV8A 1XNQJ 4BLGA 3CCLN 4A2AA 4CEEA 3EGVA 4Q45A 2W40A 3LM2A 3OYGA 1AB8A 4TU8A 2QE5A 1TK5A 2XBPA 4YOTA 3BPDA 2IMOA 2R8GA 4QIVA 3A8JA 3SDEB 5HL7Q 4DV3J 3C6TA 3LP1A 4DL3A 4BRQA 1GK8A 1IR0A 1VQPN 1R8BA 4QQBA 4KB7A 3DMJA 1F5BA 1S7IA 4DPWA 3BSNA 1Q82T 2HHHF 1DY3A 4F50A 1XNQK 1T05A 3M8YA 2HBQB 3O9QA 3N5FA 2CPXA 1H1VA 5AFUH 3RBEA 2MZRA 4DV4F 1QTMA 1H2VZ 2C2DA 4DV3K 1XTZA 2Q3SA 4K4UA 5J1PA 1JNZB 4WQ4A 1RKIA 2D1CA 5EOYA 2OI2A 2CRLA 3B78A 1EKRA 5CA5A 3EGNA 2AGOA 4F0HA 4FK0A 2RQ4A 3QATA 5IT0A 2XY7A 1S49A 1IJEB 2D3ZA 2OIHA 4IG0A 3WC2A 5KT6A 1C0UB 4CYUA 5CHIA 4JI4F 4Y2AA 4X4OA 2MHEA 4FOIA 1GLJO 4ED6A 2HWHA 3C65A 3CCMN 3H59A 3CCEN 2KTQA 2OFHX 3N4QA 4CO0A 3FMBA 2J6TA 4I2QA 2UUBF 2PDAA 4JNEA 1B7YB 3HHLA 2UU9J 3AO3A 1HWKA 2BKOA 2UXCF 5A8WA 4Y00A 4OI2A 2VQFJ 3K89A 4UOHA 4ZLNA 1U7LA 4WQ5C 2XLKA 3I4PA 1LOTB 2KVIA 4DR3F 2PE8A 3GCWP 1N34J 3AXMA 2XG8A 2IRUA 3QBCA 5CR4A 2DKOB 2A1BA 1G1XA 2HFSA 3FSYA 2G8VA 2X3GA 2DXEA 3PUFA 2RKIB 2LA4A 1LW2B 5F8IA 2UU9K 1X1PA 1LCUA 1JLEA 5F8HA 1OWXA 1K73T 4KHUA 2VQFK 2CDRB 1EQ0A 1ICEB 4CNYA 1N34K 2W6LA 3E66A 3PEHA 3AVHA 4ID5A 4EK2A 4AUKA 4WCEL 1WDDA 1XWLA 5AR0A 3CJ2A 3IXQA 1QZ5A 2Q43A 1QAIA 4ED4A 4ETXA 2HSTA 5KFSA 2OYQA 1U0SA 2CGJA 5AE3A 2NXUA 4GVMA 2FHKA 4O0NA 3VHQA 1Q82O 3CFRA 3P4UB 3VQDA 4I68A 5I3UB 1KONA 2E44A 4I64A 4DZ6A 1EIYB 5KFMA 4KIAA 2G1DA 1J5OB 1HNIA 3FFIA 1R0AA 3H20A 3FNNA 1QDUB 1BUPA 1O5JA 3HD2A 4CZMA 2CFXA 3RAMA 4F36A 4ER8A 3OFFA 4Q2LA 3I55N 2IJNA 3CJ8A 4FWPA 4M3ZA 2PGCA 2RMLA 1FEHA 4WK1A 1RUSA 4FLYA 2C2EA 2FC8A 3C95A 1ASUA 3QFHA 4K4SA 2RVJA 5HBMA 3C94A 2J9CA 2W2OP 3QPIA 4OX9J 3P5BP 3BO3A 1LK7A 3DRXA 4OZ3A 4ED8A 3RAQA 4ANDA 4MFBB 4WK3A 4KPYA 1E6VB 1LXJA 2WOMB 3M8PA 1U8SA 1FK9A 1TL4A 2ASJA 3I5AA 1QM9A 1VBZA 3DXSX 2Y1LB 3ZETB 1HYVA 4BVOA 3HDSA 2PA8D 4RLEA 5JXSA 3ZX2A 1QHTA 1UVKA 1YIJN 2IVOA 4KO0A 3DDIA 1I3OB 4B08A 1YJ9S 3OTDA 1C1AA 2DH7A 1WD6A 1QQOA 5AT1B 1QSYA 2MSTA 2A10A 1X31C 4CEDA 4S0MA 3U7JA 3V6KA 2EX3A 1P6TA 2VFSA 3NH1A 4KHWA 1OIAA 5EXWA 5LY3A 3MDQA 2HHSA 3GYNA 4EYHB 4ZHRB 3ENAA 2DRDA 2IRXA 4RCHA 2H3EB 2XCPA 2XSJB 1IKYB 3SV4A 3D2FB 3W5YA 4LT6A 2NR0A 1QAXA 4KHNA 4ZPCA 4IH7A 2RT3A 2HS4A 4WCEQ 2XEXA 3SMZA 2W7AA 2LXUA 1KQSM 2J7UA 3J81Y 3CCWA 3CEDA 4Q7AA 1J53A 3WXKA 4DDFA 1Q1KA 3VGSA 4KB0A 3ZZYA 4BQZA 3DDKA 5LJVA 2LP4A 1AUDA 2HRYA 2DEIA 2EG1A 1ROFA 1NGDA 5KT2A 4YMEA 4NLOA 5B08A 2C1EB 2P5VA 1VR6A 4GVBA 3LWLA 4ZCKA 3I82A 1U6ZA 2V50A 1RLDA 2XCAA 2P6SA 4BE2A 2I5JA 5ETKA 1H73A 1RADB 3H8YA 4ZPTR 2JFKA 1TYQB 1YX2A 5CYQB 3WIUA 1I94F 4DFMA 1TL5A 3W5XA 2HFUA 3AVCA 3J81j 1BCOA 5BYSA 3W0LA 3LZJA 3E2EA 3M2RB 4CBXA 2B51A 4YHHF 1D1UA 2VG5A 3QT7A 5IC4B 3DLEB 3R7NB 1SL1A 5GIPA 1IBMF 4I6YA 2EG2A 2MPUA 4ZVQB 2RUGA 3FJ2A 1RB0A 3FFKB 4DU1A 4N76A 3SCIE 3JAMU 3NVMA 3KXDA 2ADCA 4YN3B 3RZAA 4QBUA 3AQPA 2Y0SD 1N56A 1JJCB 2DVIA 4RUAA 1IBLF 1ZC6A 2ASLA 1SZ2A 2B8QA 2W7OA 3T6BA 3AXKA 3NGUA 4QWCA 4E7LA 1KBRA 1Q86T 1B4SA 2QLWA 2ZDOA 4EAHD 2RE1A 4B3OB 2OSRA 1MNEA 4GKJJ 8ATCB 3M9OB 4KH0B 2P5OA 2O8EA 4ZCMA 3DJCA 2OTJS 2VUGA 4GKKJ 3KHLA 3CCQN 1VSIA 4KJIA 2X1GA 1WG5A 4RNMA 1U6FA 2A40A 3T7ZA 2RD5C 5IQ6A 1GXLA 1RTDB 3GR0A 2DR5A 2L3MA 4EI2A 3TSPA 4MO5A 4GKJK 2OMLA 1BIZA 3QIPB 8RUCA 2O8FA 4CTAA 3SI8A 3MM7A 1KVCA 1CJKA 2GBZA 4GKKK 1KS2A 3CVKA 1CC8A 1C1CA 5IFMA 4EBCA 4BRGA 4CJLA 1QVGM 2GHVC 1UJ5A 2HNDB 4PG6A 4RW6B 1TMJA 5FRNA 2IJRA 2FLNA 3SQ1A 1G2EA 4WJBA 2BYCA 4NA1A 2LQ8A 5E3RA 3K17A 3RMAA 2A3ZA 3FZFA 3C7NB 2GIRA 3OW2M 4EZ9A 4DR6F 5AQSA 4ZOSA 3K5PA 1HYSB 1ZBUA 3VAFA 2KHDA 1M5SA 4K4ZA 4QZVB 1SJ4P 4FJNA 2JLEA 3O1BA 4DR1J 4LRFA 4RKUC 4EHTA 5DDRC 1LWCB 3PFEA 1X9SA 3RB0A 3M32B 1NSKL 4G1PA 3MM6B 4J9KA 1FFWB 4KTQA 3WEEA 5KG1A 4YY3J 2KT3A 2JGUA 4BG9A 1QE1A 1VRUB 2A6OA 2K1RA 4GC6A 1OVQA 4UOCA 5A0YB 4DR1K 3THYA 5KT5A 2GZOA 3U4LA 1VQ4N 4CLWA 4IFEA 4YY3K 1UWAA 2VDHA 1FWLA 1N0VC 3JYTB 4OZNA 2NXCA 1T02A 3LA0A 3MXJA 5H1SV 4KR0B 1EKSA 1JMTA 5F0UA 2ZZTA 5FJ4A 2RH3A 4DLGA 4JKCA 4RWWA 4UQGA 2HF4A 5AFUA 4PL8A 2Z2YB 1A5VA 5B7WA 3FMWA 1T6CA 1TKXB 4JLHA 2BZ2A 4ZPBA 4LSLB 2IBOA 4LF8F 3D66A 2ZKUA 2IIRA 3PX0A 4K43A 2OLWA 4OLPA 2FBVA 3VAHA 3EMTA 1ZBIA 3A12A 3ILIA 3I6PA 4DLEA 3DLGA 5DM7L 1F5CA 2PA3A 2XMWA 2FIUA 4B1UB 3SMPA 2J8SA 4CERA 3RAXA 2ZH7A 2W1BA 1URRA 3OHAA 2DYAA 3UD3P 1VQ5S 2E9ZA 2FBXA 2Z58B 1XN9A 2X74A 5FROA 4H03B 1BXNA 5AXKA 4QU6A 2QSWA 3SSRA 4C2MA 3E01A 1RTHB 1IV0A 3PKYA 1RU2A 1TQLA 1NNDA 2WRMA 3BSAA 4RUBA 4PQAA 3PRVA 5DLFA 4Y2IA 2XS5A 5ETLA 1NGIA 2DFHA 1RHUB 4NEYA 3I0RA 3NGZA 3V6JA 4IRDA 2ACYA 4X65J 2P51A 1GLBG 3I31A 1D5AA 4B02A 1OQ6A 1QQMA 4FJLA 3HSDA 2XQCA 3G25A 4DL0C 3NH0A 2D69A 4R25A 4YS2A 4IWVA 1BUXA 3MWTA 2OMOA 3O08A 3PW5A 5KFIA 3BDEA 5ETQA 5CD4A 1NOYA 4X65K 3G8TA 2DO0A 4JV0A 3VEZA 2E5LJ 4DV7J 3VQ6A 4NCAA 1MMNA 2DH8A 2LMIA 3ILLA 3N6LA 1NPKA 4M5KA 4H4MB 4DJBA 2O3DA 4QOZB 2XMTA 5GAHU 4JK8A 1RDAA 2KZZA 4FNIA 1K8AT 1KVJA 3ITHA 3UO0A 2GGPA 2DFEA 1ZM4A 3ZSWA 3HVAA 2E5LK 1S1TA 4DV7K 2BE2A 4YB6A 4TVAB 1PC4A 2XZWA 4DQRA 2ZH9A 2P9PA 4DU3A 2BM0A 1WHVA 3EDQB 3THWB 1LWXA 4B1VA 1CLQA 1BDGA 2GJ2A 4YOWA 2Z0GA 3IN5A 4O44B 5DGAA 4M5GA 4DL2A 3VVUA 2DGSA 5BJRA 4EMDA 3OR2B 2NZ4A 5AQNA 4DHYA 2P9IA 4CT8A 4HKQA 2ZZNA 4CJQA 4JS4A 3PG9A 4LC9B 1U45A 2V0NA 3GCXP 5AJ3J 4KH1B 2CGKA 2HAFA 4UUXA 5LMUF 5DM7Q 4DB3A 4BWMA 2LQBA 2B7CB 4ZVFA 4DCJB 2CJ9A 4B9NA 2UZAA 3MXMA 1XMOJ 4FW1A 3F41A 2EBGA 3GQCA 3AY0A 4FZZA 4C8NA 3DHXA 1AT1B 4DG1A 5AQGA 4HCCA 5AJ3K 1VISA 3MR6A 4YNQA 1ZAXA 1VRQC 3VF6A 3SAFA 4OV1A 2R7WA 2IRYA 4DTRA 1UWBB 2RN2A 3GZ7A 4FM1A 4IDKB 1OSCA 1HNZF 3Q89A 1S1XB 1XMOK 2EFNA 4IXCA 3J7AN 3R1XA 4Q8FA 4O0JA 2DNLA 3QZ7A 2D9PA 4NPOA 1NAQA 3G6EN 2PMHA 2HFVA 4Y1CA 2YPZA 1FRHA 1RAGB 1EP4A 2DHHA 3D6MB 5HO4A 3DOKB 5BN8A 5AQJA 5K8NA 5KPZA 4Z2XA 4Y3CA 2YPYA 2ZC3A 5HRNA 4AQYF 4IUFA 1KOOA 4UUWA 3MOJB 3FBEA 4U6PA 1JXEA 2CPHA 3OBIA 3CD5A 3SQGA 4EYIB 4IH6A 5AQVA 1TUWA 5BRHA 1AFIA 3I9V9 2CZVC 1S6PA 2BKNA 1XMQF 3MN9A 2ZM6F 2C3UA 4BRFA 4XH1A 4MYUA 5RUBA 4MJKA 2JWKA 2WSEC 1J5EF 1K8AO 5F3TA 3MI7X 5LSLA 3PYGA 1SV5B 3W63A 4I56A 4IOAL 2DIUA 2R7UA 2VCPA 4QPTA 2V6AA 1S9EB 4OFZA 3X1LB 4X84A 2XZDB 4I7FB 2R7YA 3M9NB 1NJWA 3KG4A 2ETJA 3V1OA 3K57A 2RF2B 2RHKA 3TUIC 1VBKA 3BGRB 2ZWPA 4LFAK 4PWWA 1GLEG 5IV4A 2BANB 3T5KA 2VA2A 2HMPA 4M5DB 3MAAA 4ZITA 2Z2ZA 2E66A 3AAWB 3IWNC 4W5NA 4ED1A 1OY6A 1VQ9N 2G9OA 3SCLE 4H4KA 3RB6A 1P8ZA 4DX6A 2B6AA 2HVIA 2MZTA 3L2VA 5JVGL 4DTNA 1OYEA 4M3WA 3TR5A 4FWOA 3DOLA 3R8YA 2GEMA 1VSEA 4NLYA 3LP2B 3MPUB 1V5VA 5KFKA 3MDFA 3HD1A 4M42A 5I42A 1UZDA 2HQ3A 1BA0A 5A2QO 4BR0A 4LREA 1PGZA 3QNOA 1JXLA 4C3MA 1RP5A 1G3OA 3OYLA 1XMBA 2M3DA 3J7YI 1GMWA 3LW5C 2CVIA 1ZBLA 2NYIA 3UN3A 4PQUB 2QYGA 2NRVA 4CLLA 1FHTA 1NBEB 1AXQA 1YRUA 3CCLS 3I8BA 3RW6A 4BRHA 2QO3A 6FD1A 2QFIA 4DV2F 1M1KT 1WKKA 2KM8C 3TARA 4QIEA 1PAEX 4E89A 3AAQA 1B3TA 1OPIA 4J91A 1DLOA 2B3TB 4TY8B 2QXLA 4RUCA 2OUGA 2IDLA 5L9XA 2VG6A 4RL1A 4N8OA 3BZCA 4MAKA 4X2BA 3JS9A 2HS0A 5HJXA 1JQGA 3U9DA 1TMMA 2J9DE 2EK1A 2E1ZA 3H4DA 4I2PB 3IA0A 4IOAQ 4KT0C 1XHXA 2MJUA 2ZDPA 3TX8A 1GMVA 1R8AA 2F8SA 1I51B 1DARA 3I9ZA 1R8HA 3ZSYA 5D77A 4ZPAA 4ILGB 4CF9A 1YDLA 4QIGA 5F8GA 3FCHA 2AP1A 4ILJA 4DSIA 4X4RA 3SBMA 4KYZA 2B4VA 4AXJA 5DGBA 4AL6A 4F04B 2C2MB 3CIZA 3CC7N 1TUVA 3QMQA 2KQ2A 3QBXA 2GVDA 2JEJA 1HNWF 4ANEA 2MEWA 1BL3A 2QTDA 3KD1E 2OA8A 4YOUA 1NK6A 2IM2A 5DQHA 2R7VA 5D0GA 1OVYA 5AE2A 3EE8A 4KTWA 3PEJA 2ZVIA 1J9AA 3HHLD 4NLWA 2KFNA 2Q31A 3ZTRA 3UR3C 3CCTA 1OO0B 2DHAA 2OPRA 2YKMA 5JVGQ 3U3YA 4PYAA 4B9UA 4LF4F 1NCLA 2IA6A 1HR0F 1X4GA 3OR1A 4CIOA 4FZVA 4JKGB 3V9XA 5G4DA 5KFXA 1WC0A 4ZJOA 2VOPA 2PY5A 4B9VA 2FJAB 5J1NA 4OJGA 2XNRA 4DTJA 1SC1B 4B3SJ 3P39A 3TVKA 5IXUA 2IM3A 4OYOA 1V9OA 1JKHB 3L3CA 4LBIA 1NBWA 4B3MF 2R7TA 2AEMA 5A8KA 4DKWA 2MTLA 3CNQP 3Q86A 1KHVA 1VBXA 2EKYA 2PD1A 4CF1A 5AZIB 3KHRA 2OGUA 3SUQA 3M1VA 2HHWA 1CLFA 4UY8T 3VQ8A 2DJWA 3AD9C 2OP5A 4DI6A 4LQ9A 4B3SK 4OKEA 2VPYB 4YB1P 4KGKA 3IRXA 1CPZA 2YNHA 3G6VA 1NK0A 5ADZA 4ALZA 3CCSN 3UVJA 1NB7A 1RKJA 2YHBA 3WQPA 3UFCX 2ALZA 3OL9A 4FJ7A 1UAWA 4RBVA 1TVRB 4QR1A 1OH8A 4CLKA 2VH7A 3CC2N 1IKVB 2CPZA 5GADI 3TUPA 5E26A 4WFZA 1Y10A 3CDWA 1S12A 5H9FJ 4HLBA 2QW9A 5JS2A 1TKDA 2Z56B 3QLHA 1S6QB 3C6UB 1D8ZA 3HM9A 3LGMA 4BRDA 3RTVA 3I55S 2EXUA 3OL6A 3AOBA 1U0HA 4Q43A 3NLCA 3SLCA 4OPHA 4JYAJ 2B4UA 3ULHA 2Z2LA 2ZWOA 5M1KA 3TRGA 2DFFA 4NXNJ 4HUEA 5G0RA 5GAHP 1I3AA 1N8RO 2CPEA 2ZGZA 2MKCA 3V4MA 4J7CA 4CJVA 4E3SA 4Z7YA 2ZH1A 3OBYA 1JJ4A 5IM0B 4K0KJ 3H3NO 5KOXA 4JYAK 1KSPA 4JI2J 1X9WA 3NCQA 1BG3A 4FYYB 3FVYA 2FPHX 1X4FA 3CIPA 4NXNK 1F2HA 2Z1IA 3K2PA 1S99A 2ZVSA 4NLPA 3VQ4A 3O44A 4CK2A 2XYPB 4BC4A 2MHNA 4K0KK 5KFTA 1YIJS 1UEUA 3NE6A 2F8MA 4JI2K 4K5SA 1F0XA 4WU2A 3CJCA 3W66A 1Q78A 4OV6A 2BUNA 4BHQA 3UE2A 1HI0P 2EC0A 1GT8A 1IBKF 2GQCA 3CCUN 4LR8A 3HXMA 1YT3A 2CPDA 4ICLA 1UVNA 1WEZA 3NKYA 3C19A 4USWA 3ZTSA 3DXMA 2GTDA 1S6OA 1U48A 3AVFA 1O51A 2ZUGA 3MMBB 1JXBA 1SJFA 4LSZB 5ELZA 1DGKN 2QIFA 1KVBA 1W0HA 2X1AA 1TFYA 2JL9A 2KN4A 2V9WA 3V81A 1XJWB 1BISA 2DITA 5AQFA 2UVUA 5GAGU 2OTLN 2GIFA 4CIFA 4FWMA 4K8RA 4HHHA 3CMAN 1RDRA 4B1WB 1I5OB 5KRTA 1IKXB 1CQNA 5AXMA 2HBJA 2VU5A 2GX9A 2E2NA 2HGLA 4JI1J 2ATQA 4RZRA 5LXYA 2FJEB 3MMCB 1Q5YA 3R7SB 2IS3A 3UCZP 2P9NB 1KN6A 2NRHA 3AVKA 4A62A 3TTCA 5GAEI 2N3OA 2ZUAA 2W2PP 5C42A 2CYYA 4FJGA 1YVFA 1IR2A 2BMBA 2OPPA 4FBTA 2HNZB 4AHVA 3TA1A 2DIVA 3KJNB 2WVDA 3AVJA 4JI1K 3R6GB 2IFXA 4EEYA 3ULEB 4DTUA 2F7TA 4H54A 4PPZA 3MF5A 4BRLA 4J8FA 3W62A 1XC9A 2DGUA 1FW6A 5GMDA 2QZ8A 3UKUB 3AAPA 2AJQA 2HQFA 2HGNA 4TYBA 3BSOA 1PJ6A 3FBBA 4EP4A 3RRKA 3IO1A 2V5HG 2B56A 1HUXA 3BBBA 2MYFA 4M3TA 2D41A 5T7LB 4OYZA 3DU6A 3T5LA 1YJWS 2OAUA 4NLBA 3SCXA 2FY1A 2O8CB 2QWNA 1KP6A 1YJNN 2HKEA 2WVFA 4LVNP 4K4XA 1LK5A 3CHWA 5F8LA 2CH5A 3T1YF 1FJEB 3H90A 2BW7A 2AJ4A 1HNVA 4O3QA 2R8HA 1VQ7S 3JSMB 2VBZA 4O5BA 4A8YA 3BSCA 1XNQF 4WE1A 4CLSA 5HLFB 4QPXA 2JEGA 3AO5A 2E29A 1XC3A 3SMSA 3CCQS 4RWXA 1EX4A 4JRPA 1RT7B 1UPMB 3PFOA 3P3DA 4J9LA 1WG4A 3CI5A 3NGRA 4U96A 3GG4A 1D3WA 4DTSA 2YX4A 4DV3F 4CNZA 3D0HE 2NXEA 1CSJA 2FXUA 4R0JA 1KLMA 1FKOA 1NJZA 3OL8A 3L7OA 3OUYA 3EKUA 2D9OA 1TTHB 1PIEA 4CHZA 1WUUA 3KMQA 1RBSA 1SS6A 1MWZA 1MN7A 2A41A 4KTZA 4E98A 1UJ4A 1OPZA 1LOUA 5KFAA 1X5SA 3QBWA 4V19J 1RLCL 4ZJLA 1D09B 3I32A 3IGNA 4CDIA 2Q1NA 3BM7A 1W25A 1H7WA 2Y9HA 2VPWB 3VAMA 4USMA 4NXMJ 4E0DA 2EFVA 5H1SQ 5KFGA 4GV3A 4N8NA 3ZTQA 3BQ1A 1HMVA 2F3JA 3HTVA 5IWAK 2NLWA 2EEYA 4FYXB 2VPZB 2YX1A 1PKUA 4M41A 3OS0A 3UCUP 5F0WA 1CZBA 2HBYB 2QA4G 4GY2B 3NAEA 3EJMA 2AU0A 2EHGA 4OLBA 4DR5J 1ILYA 3SUNA 4NXMK 4UT4A 4WIQA 4BDYA 5DDQC 3VEWA 4W92B 4JV2A 1BWVA 2E6LA 1Q8IA 2MKKA 2DY9A 1EETA 1SQGA 3HK2A 1FE0A 1RYSA 3HVTB 4BCAA 2Q79A 4RBTA 3UN5A 3OBWA 2QLBB 2UU9F 3VALA 3S8SA 2QA4S 3QGGA 4M1KA 3H42A 3HHEA 4DCHA 5KFNA 2Y8WA 4DR5K 2LA6A 1W7WA 3GJQB 2VQFF 4IFVB 1VQ4S 2DNYA 3OFEA 5C0YA 1N34F 2E9RX 2D0AA 3RJMB 4WYLA 4WTYA 4C11B 4CGJA 3MXIA 2MGZB 3ZCMA 1OH5A 3OYMA 2FGCA 4UF4A 3LPEA 1JLBA 3FZBA 3ZSRA 4PG4A 1U26A 3PY8A 4DU7A 3EE3A 2CJQA 4CFBA 1RWMB 2V2KA 4IOBA 4CJRA 2GIQA 2IC3A 3OYFA 1NLKL 1NM1A 3DGPB 4OI0A 1K0TA 1MROA 1NGAA 1S5ZA 4FPRA 3H46O 3TZZA 3MPYA 2LQ5A 2V2VA 4JB8B 3W8GA 2WONA 1QTNB 4J9VA 3RRHA 3EDRB 2HLTA 3H0PA 3ALYA 5T41A 4IKAA 2V8GA 1GH8A 3EN9A 1HPMA 1LWFB 1WOQA 1DJ0A 1JNRB 4RG8A 2HWIA 5DS7A 2NRXA 4P9SA 2ITGA 2R42A 2Y3YA 4M3XA 2DBBA 4F26A 4TU7A 3VQAA 3ZNJ1 3QESA 1NRKA 1QY7A 5D3GA 3L6QA 2I8EA 3DM2B 5JLFA 1W2IA 1B9DA 3ONQA 3H1VX 1CJVB 3EZ5A 2J6UA 1JLGB 2WBMA 3PW2A 1JB0C 2BUPA 4CM0A 5M1PA 3TAMB 3AT1B 3NG8A 3IUCA 2RDIA 3BH6B 3P49B 4CJ3A 3HHKA 2CQCA 1VK8A 3BREA 5KFVA 4CGIA 2DPJA 4OX9F 4NEZA 1RHMB 4CLFA 3WXIA 3O4WA 3NMRA 2V8HA 1RTIB 5J2MA 4F67A 1U2VB 1HFEL 4P52A 3SZ2A 4IOXA 5DZ6A 4CBWA 1NZ8A 2E5JA 5E3QA 1Y97A 3OYNA 3HM8A 2PEBA 1RWPB 5KT3A 4BY9C 3VPZA 2Q3PA 2V67A 3AA4A 4AHRA 2HBZB 2P9SB 2NNWA 3M2VB 2WSCC 4Z4CA 2G8WA 2LXFA 3JSBA 2Q6BA 1YJUA 3KG0A 4OX7A 3VR1A 3G86A 3CD6S 5LOQA 4JV1A 2FZCB 2V4JA 1KXPA 4DN0A 4C0HA 2VODA 1TKTA 3SEOA 3U1LA 5DG9A 3ZT0A 4ZPVR 4ZVRB 4TLQA 1VYAA 3GE9A 4URSA 5KG6A 1KVKA 4K8ZA 1U2CA 3LQVA 4LRBA 5J1EB 2ILYA 4YB5A 3T3FA 3LDLA 3SBGA 3T1HJ 1WF0A 2HHTA 3GFZA 4ZVPB 4CIEA 1KWMA 1U6BA 4M5NA 2BJ3A 3K8WA 2GV1A 1AROP 8AT1B 2HVDA 3SDEA 4C0BA 1RYRA 2WTFA 3KNAA 4FWQA 1T9WA 2K3KA 1RI7A 2QFJA 4XEIA 5HI7A 3CM6A 2R7XA 4DQPA 3FR0A 3T1HK 1BCMA 4KH5A 2WK4A 3HFKA 3DLKB 3LPTA 3PHEA 4PXCA 2DK2A 4P7VA 2HVZA 3UDVA 2X6NA 1TUUA 2A6MA 3CULA 5AQKA 3ZSQA 3VEOA 2VPXB 5DZ7A 5GAGP 1U25A 4FM2A 1CZAN 2BQ3A 4DPXA 2NSCA 3GPAA 1VSHA 3FUYA 2DCUB 1KKHA 4M5LA 1XI1A 3QFWA 2M9KA 3NF9A 3AVNA 3WXMB 2QWOA 3BS9A 3UE5A 3TWHA 1YWXA 3HSTB 3HLUA 3W3SA 1C0UA 3G6ES 3D6HB 2ASMA 4FCYA 4TKTA 5F41A 1KFSA 5AQYA 2HURA 3S6EA 4C6AA 4G3IA 3SPYA 3AA9A 3RB3A 3AOAA 2P9LB 5CZ2A 3PW7A 2MZSA 1ULRA 1Y5IB 4WP8A 4DS5A 4IH5A 4B8CA 3ZSZA 2EFGA 3CJQA 2CAJA 3CJBA 2MZQA 5HMWA 2ERRA 3DXKB 5L9NA 5DLGA 2BQRA 3R2CJ 1NJIT 2DGWA 4U95A 3S3OA 3F9MA 2Q0UA 4BRKA 3L9ZA 4I9QA 3CG7A 4QWEA 2YKNA 1HARA 3CCZA 2ASDA 1WG1A 4YEAA 3AARA 4C8KA 2MY7A 2RKIA 3UB5A 2HHPA 3CJRA 1CULB 1YJRA 2U1AA 3L09A 4HACB 2B4PA 4CJ7A 3UWTA 1WTBA 3W2WB 3P5JA 4GW6A 2DGXA 3AVLA 4GKJF 4C48A 5CCMA 1FCAA 1BMQB 3ETMA 3U02A 2MKJA 3WDOA 3ZT4A 5IT9Y 2ZJRL 4MLEA 5KT7A 1QUVA 2RDDA 4GKKF 3I5BA 2PI4A 1YBUA 1RHQB 5KPTA 3W1YC 4CD1A 2V68A 5HRRA 3BPSP 2AJ2A 1HQUB 1UEVA 4OJ3A 3R6MA 1VQ9S 1HX1A 3MAQA 4YB7A 3Q8QB 3ICLA 3NDKA 5I3UA 3EL2A 3PR5B 1J5OA 3KD5E 4EZ6A 2G0JA 1SH0A 4FPBA 5DETA 1VHFA 4QIFA 4ECYA 5J2PB 4E7KA 3D2EB 5A2QU 2O01C 2B9WA 1YITN 1NU0A 2KFYA 1WHYA 3C6HA 2GUPA 3PRBA 4QJVA 1PJ5A 1L3UA 4KHMA 3QGPA 3C6TB 2V4QA 2CUYA 2LDYA 5E3AA 3WHIA 4W90B 3KK2B 3FK4A 4OZ2A 1U09A 3DMJB 3CJKB 1ZZFA 3LM9A 4ATNA 4YDUA 1SIZA 4F4WA 2GUIA 4OX6A 1WSHA 4DL4A 4CJ4A 1Q8LA 4DR1F 4CLUA 2N4DA 4MFBA 4A48A 1E6VA 3HBTA 4C0OC 2WOMA 1YI2N 4OO1J 3DGVA 4YY3F 3VF2A 3VQ9A 4B9SA 4TXSA 3ZETA 5IQQA 3F5TA 3RUBL 3T19A 2IPOB 2FVCA 4H5VA 3NGIA 1G6BA 4OQJA 1WF2A 3VMFB 2QT7A 5A6PA 4R8UB 3KLEA 4IFYB 1Z05A 3J7Z5 1VFJA 2FJDB 3DHWC 5SWMA 2XLIA 2A1SA 4C1NK 4Q0BB 1P9YA 3HHDA 4ZPDA 2QG9B 2P6TA 3SPZA 1Y64A 3UD5A 4K8XA 2ZKTA 4DSJA 1YTUA 2O8BB 5EWEA 2G8HA 3KLHB 3GFXA 3L2UA 5C12A 3MCAB 5CE3A 5K9FA 1SJ3P 1UA1A 2KRRA 4ZHRA 3FQKA 1RTJB 2XSJA 1WAJA 1IKYA 5B0EA 2PC6A 3D2FA 3D0PA 3N01A 2Y1RI 3QT8A 2AJ1A 1GLFO 1R3NA 3HFVA 3JB9k 3E9PA 2DXDA 4PG7A 2ZJRQ 3ZZRA 3NNHA 3MMAB 3NY0A 4CI0B 4TN2A 2FVSA 1U1NA 4C7QA 1WHWA 2JVOA 2DNGA 3D9BA 3AVAA 5F8JA 4B9QA 3CC4S 4NE9C 4FKYA 4USHA 3DWLA 3NGTA 4FOEA 2CZ9A 3OHBA 4PZVA 2A2DA 2MKIA 3BGLA 1RDDA 3M1FA 2VFVA 4DSFA 1IH7A 3R5GA 2G0CA 4EBDA 2R7RA 1MDUB 3RBDA 5LL6Z 4C98A 3LDNA 4P72A 2HFNA 5HQ8A 4LF1A 5AZJB 2W9BB 4IOCL 3LTOA 3NNAA 3L3VA 1FRXA 1YTAA 1WC5A 3ZO7A 4Z0UA 2MSSA 1U2RA 4X65F 1TYQA 3HMJG 5CYQA 4B1YB 3OTCA 1C6VA 4IO8A 5KQ8A 4ED3A 3HSCA 2EKNA 3M2RA 4RW8B 3PNIA 3S7RA 1VQSA 1HNIB 1QHAA 2MKYA 3DLEA