2HNYA

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
534
structure length
522
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 140
structure length 522
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnyA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnyA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnyA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnyA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hnyA05
2YKMB 2ILZA 2R2SA 1VK0A 1RTHA 3ICLA 4Z4GA 4UQGA 3NFAA 3NGDA 4ICLA 4HYKA 2G8FA 1IO2A 2W9CA 3MECB 1FKPA 1S6QA 3K57A 3TI0A 2RN2A 4FM0A 3HPOA 2KTQA 5C42A 3RMAA 2UUWA 4CJUA 3BREA 2JEGA 3HPGA 4F4WA 3KK1A 1ZBHA 4KAZA 3KLFB 2ALZA 3AVLA 1ZTWA 4O44A 3K5LA 3AO5A 3KKRA 3PW4A 3OL6A 2QK9A 4R5PA 3H08A 5KFKA 1QE1A 1J54A 1IKWB 3PJWA 1RDBA 4Q8FA 1VSLA 3T3FA 3I0RB 3VQ7A 3OYAA 4DLEA 3FSIA 1T05A 4QCLA 1UAXA 1OS5A 2J6SA 1SUQA 4KBIA 4R8UB 4E7JA 4EYHB 4J9MA 4KB7A 3JYTB 1JLBB 3O4NA 1X9WA 2C2RA 2G8VA 2X78A 4CIGA 1WAFA 4KHSA 4O4GA 2V0NA 2R8IA 3LZJA 3ZSWA 3AVGA 1S6QB 3MEDB 2HB5A 1QSLA 1UA0A 3QEVA 4RG8A 4LH5A 2OPQB 3I5AA 2Y1IA 4Z4EA 1RBSA 3CJ5A 4CGHA 3OYFA 1S97A 2PYLA 2FVSA 3BSAA 3MFHA 4Q43A 1TP7A 1QSSA 3KOAA 4W5OA 4BDZA 4NRUA 3DOLB 4KB1A 5J2NA 3NAEA 4Y34A 5J2MB 3T5KA 4DG1A 4ZTJA 4IFVB 4CJQA 4Q45A 4F2SA 3KMQA 4QW9A 3AA2A 1C0TB 2W9AA 3HJFA 1N6QA 1BIUA 1TK5A 4I2PA 1JLFA 4ZPAA 1TKTA 5HLFA 3RB3A 1QSYA 5DG9A 5F8HA 4B8AB 3AVKA 5EDWA 4FYDA 4ECRA 4OVLA 4KTQA 4FS2A 3CVKA 3KLFA 3SQ0A 4I9LA 2RF2A 4DS5A 2JC1A 1RDRA 1S9GB 4E7HA 3EY1A 4DTOA 1R0AB 3K2PA 4R0EA 3RMDA 3D28A 4CK2A 4RNNA 1S1WB 2R8HA 1YVUA 5KFXA 4ZHRA 3DOKB 4KI6A 1TVRA 4AHRA 2BR0A 4B3OB 1LWCA 2OZSA 3G10A 3T19A 2OPSA 4CJSA 1KLNA 4IKAA 1HMVA 1IKYA 3DOLA 3AO3A 3MXIA 4QAGA 4J2DA 4QWCA 1JLAA 4CGJA 1DTTB 3N6LA 4ED7A 4FJMA 4FJJA 4H54A 5KFRA 4KFBB 4HCCA 1BI4A 2VG7B 4G1QA 5KG5A 3JSMA 4KV8B 2JGUA 1NJYA 1HYSA 3CWJA 4CESA 4DQSA 4HCBA 1WSJA 4C8NA 1XI1A 4I9QA 3N6NA 4PQUA 4TSXA 5KRTA 5I42A 1S49A 2DTUA 3DLBA 4W5NA 2VA2A 5F8NA 1SV5A 2HW3A 3GIJA 3RR7A 4ZP6A 2Z1GA 4E89A 2ITGA 4Z0UA 2GV9A 3KK2B 3SUPA 4C8MA 3KLEA 3TAEA 3DOKA 4O3SA 1L3SA 5KG0A 1BGXT 4NRTA 1JXLA 1RT2A 3QESA 3V1RA 2OPSB 1BIZA 4DU4A 4KHYA 4CEQA 1IKYB 3QLHB 5J2QB 1XC9A 3NF6A 4J9LA 3ZT0A 5KFIA 3I5CA 4DSJA 4DQRA 4WE1B 4MFBB 3FQKA 2Z1HA 1LW2A 1KVBA 3TAMB 5EWEA 2R2RA 4BE1A 3QEWA 4U6PA 4WFZA 1TL3A 2OPPA 3DLKB 5C42B 1Y97A 1DTQA 3FFIB 5KT6A 5KGWA 3OS2A 4IOBA 4HUGA 4NLSA 4FK4A 4BACA 4PQUB 2Z1IA 1VSKA 3NF9A 3BGRA 3AVCA 3BSCA 3V6JA 1RAJA 2XCPA 4O3QA 3L8BA 4DTPA 3DLEA 2YNHA 3AO4A 1LAVA 3PR5B 3OYEA 2W9BA 1KVAA 4CJRA 4DMNA 3AVAA 4R8UA 2WOMB 4GVMA 4LY7A 1XHZA 4MIBA 4J9KA 1U49A 3QINA 1JLBA 3Q8QB 3I0RA 4FZZA 2W42A 4I2QA 5EU7A 4Z4IA 3HKWA 1I6JA 3ZSYA 3L2VA 5CZ2A 4CJTA 4XIUA 4OPKA 4QOZB 3QIPA 4MKBA 4OKJA 1ZYQA 2JC0A 3TVKA 2XO7A 4F3TA 4NCBA 1KHVA 4IG0A 4RNMA 2VG7A 4G1QB 2X74A 3OYMA 2YV0X 3TANA 3HT3A 4ZVHA 3DLRA 5HRPA 4RNHA 5CYMA 5KFDA 4O5BA 3QO9B 4ECQA 4GC7A 1EXQA 4CF2A 5KFEA 3D45A 1RBTA 2BANA 4KO0A 3NCIA 3TQ1A 3SUQA 3PUFA 1RT1B 1T94A 1U48A 3S3MA 3OVNA 5KRSA 3V6KA 4IR1A 1N4LA 4PWDB 2YNFA 5KFCA 3OJSA 2XI2A 5KFZA 2UVVA 3NH0A 3M9MB 2E6LA 4DS4A 1RTIA 1CXQA 1J53A 4DFMA 2HNYA 4IH5A 3SFUA 5J2PA 4M95A 5F8GA 1NKCA 1ZBFA 4OJRA 2AGOA 2FJWA 4ECXA 3UPFA 4Q0BA 1RT5B 4ELUA 4I2PB 2AX1A 4DTNA 2UUTA 2VWJA 2LSNA 3C6UA 4BWJA 3OYHA 2AU0A 2KQ2A 1UA1A 4Y2AA 1TV6A 3EPIA 4KAIA 4FJLA 3MFIA 5I3UB 3VQDA 4HVJA 2XY5A 5DK5A 1QQCA 1NOZA 4DFPA 3L3VA 4TY8B 4EO6A 5EWGA 1HPZB 4CJKA 3LP2A 3M8PB 4ZPCA 3RAXA 1BHLA 4HUEA 4CJFA 2BE2A 2HMIA 3B6OA 4WXOA 4YNQA 4PWDA 1VSHA 4EEYA 4RW8B 4QPXA 3K5NA 3MAQA 5KFOA 3PW0A 2WOMA 1S6PA 2J6TA 4RNFA 4JS5A 4KRFA 2IM2A 1EX4A 2JEFA 3KKSA 1JL2A 3NGYA 4DSLA 2D0AA 3OYLA 4JV1A 3KTQA 4E1MA 5D3GA 3RBEA 5F8MA 2E9RX 1FXXA 3A2FA 4YR2A 4FJ5A 4H4OB 4CEBA 4YR0A 3BQ0A 3KK3B 4PUOB 3DLGA 4C8OA 3WNHA 2GIQA 2O5DA 4B9TA 2XGQA 1HARA 2V9WA 4WYLA 1ASVA 4NLTA 2UVRA 3PV8A 3V1OA 3KLHA 5KFYA 1NK4A 4CJLA 4KSEB 2IM0A 1ZBLA 3RRHA 2X6NA 1JLEA 4CHQA 1RYSA 3S3NA 3IS9B 1C1CA 1HPZA 3QZ8A 4ZMMA 2HMIB 2ZE2B 3GILA 4FLZA 3CDUA 5HRSA 4OL8A 3ITHB 3CJ2A 2BQUA 5DMRA 2W9BB 3EPGA 4ID5B 3CO9A 3BDPA 3CM5A 4AHCA 4ZPDA 4O55A 1SL0A 2R2UA 4F50A 5D3GB 4DFJA 4WYWA 4K4YA 2GUIA 3HVRA 3H4DA 3RMCA 2ETJA 4JLHA 1RT7A 1S1UB 1N5YA 1LW2B 4CF0A 2QV6A 5KT4A 1YT3A 4DU1A 2A1RA 1X9SA 1S5JA 2D0CA 4YP3A 5FROA 4MQ3A 1SL2A 4QWDA 1KFSA 1KLMA 5FDLA 2IC3A 4NLYA 3OS0A 4TXSA 2HVIA 5KFTA 4E7IA 3FFIA 1B92A 2I5JB 4N47A 3VQ4A 2IAJB 5KTQA 1LAWA 4DL6A 1IG9A 3AVMA 2ZE2A 5KI6A 1I3AA 1LWEB 4TY9A 3VQ9A 3H4BA 3ZT1A 1RA7A 2QE5A 1S6PB 5KFSA 1BQMA 5HBMB 1C0TA 2IJFA 4ID5A 3F9KA 1EETB 3MR3A 2R8KA 1TAUA 4IDKA 1RBUA 2BDPA 4DL3A 1WN7A 4LQ9A 5KT5A 3OHAA 4FJNA 4XPEA 2W9CB 1DLOB 3NF7A 1NJWA 4CEEA 3V81A 2FJVA 5DGBA 3OYNA 3TAQA 3SI6A 3HK2A 4FS1A 4OLAA 2P1JA 3OYDA 4URSA 1JLGB 5KFAA 1TL1A 3M8RA 3RB4A 1KLMB 5FDLB 3CIZA 3KLHB 2P5GA 4URQU 4DL2A 3IAYA 3PZPA 1WNEA 1IKXB 1RTDA 1NKEA 4OGCA 3RMBA 3HPHA 3KK2A 2R2TA 3NF8A 1RTIB 2JLEA 4F2RA 4CIEA 2OPRB 3OL9A 2D0BA 3GV7B 4K8XA 1TAQA 4GMJB 3DRPB 4RZRA 3ITHA 3RAQA 5C25B 4KHRA 4E7KA 1UWBA 2W8KA 2IJNA 5KFHA 1LWFB 3M9NB 3HVWA 4TQSA 2UVUA 4M3UA 3PO5A 4NCAA 3TAPA 5KG2A 4GC6A 4ED2A 3BSOA 1YTAA 4PY5A 4KV8A 2YNGA 3BR9A 1NJZA 3MR2A 3S9HA 2IOCA 4DL7A 3SV4A 2ZD1A 2ATQA 3AVJA 3AVNA 1NNDA 5I3UA 4CF8A 3PX0A 1REVB 1ASWA 3AA3A 1JLGA 3QZ7A 4RW4B 1VRUA 2WK4A 1S1XA 3T5JA 1KSPA 1RBRA 2HVHA 2YNHB 2DY4A 1QE1B 1IKXA 4Q8EA 4NLUA 1TKDA 2RPIA 1W0HA 1NHVA 1K1SA 5L1JA 1L3TA 3B6PA 1D5AA 4PA1A 4EP5A 4K8ZA 4ED1A 4CF1A 3OYKA 3MEEA 4DFKA 3IG1A 5L1KA 1BQNB 3ULDA 3KHLA 5J2QA 1C1BB 4MIAA 3HP9A 4I2QB 2WHOA 4CEDA 4W5QA 5KFPA 4NCGA 2B5JB 5C24B 1UWBB 4N56A 4DL5A 4J2EA 3OYIA 2WRMA 3LP3A 4IG0B 1T7PA 3H2LA 2XI3A 1N6QB 2RDIA 2C2EA 4ID1A 4PUOA 4QWBA 5DGAA 4CFCA 2ASJA 3MEDA 1RDCA 5HLFB 5CYMB 2XHBA 3L2WA 3QERA 2KZMA 2B4JA 2QKBA 3K5MA 4GW6A 1VSIA 3DM2A 3DLGB 1N5YB 3KIOA 2WONB 1RT6B 3D0PA 4EP4A 3NAHA 4CEZA 4J9NA 5T7BA 2R7YA 1VSJA 1VRTB 2BQRA 2JEIA 2VG6A 2G8UA 3V9XA 3DLEB 1IH7A 1RTDB 1VSMA 4RNOA 2IC3B 4F4KA 4Y1CA 3HM9A 1TVRB 4DQPA 4O3RA 3KLEB 1SH2A 4O4RA 3KD1E 1S0NA 4ZP8A 4K4WA 3F73A 3IG1B 2P5OA 4DTSA 1Q9XA 4KHUA 3VN5A 1A5VA 1ZTTA 5K14B 2VG5B 4WXWA 3D5MA 4K50A 3KMSA 4FK2A 2UVWA 1U47A 1NK8A 1X9MA 1GOAA 2BRLA 4O3PA 4WZQA 3HP6A 4OGEA 2YNGB 3SQ1A 1TKZA 4ICLB 1GX5A 4ED0A 3RTVA 4E1NA 3PHEA 1FKPB 4BWMA 2AGPA 4YR3A 1HNIB 3QO9A 3LP1B 4FXDA 4EBCA 2AGQA 2RKIA 4DSKA 1HYZA 4KHMA 3OLBA 4J9OA 4EO8A 5CY4A 3MXMA 1TL1B 3FQLA 2VG6B 2QKKA 4NLXA 4K4VA 3GYNA 1HQEB 3BQ1A 1U4BA 1SL1A 4N41A 5F8IA 3LP0B 3ZSRA 1BCOA 3CJ4A 2XC9A 4CK1A 4FJIA 4DQIA 1ITGA 3KLVA 4LSNA 1RT2B 3K58A 2WCXA 2AJQA 3NH1A 4DQQA 2FLNA 1JLQB 3NGIA 1D0EA 4Q0BB 1S1TA 4E0DA 3VQQA 2PYJA 2VG5A 3E01B 4OKEA 4CFDA 5HBMA 4CJ4A 4DEZA 5HRNA 4DSIA 2FVCA 3K5OA 1RNHA 2CJQA 4Y2CA 2R8GA 1EP4A 4CGGA 2F8TA 4X2BA 2F96A 3VQBA 1SKWA 3NMAA 1TKZB 2OZMA 3DRSB 4JV0A 4MK9A 3HVTA 5KG4A 1KHWA 3AVIA 4FJHA 2OPPB 1K1QA 2D5RA 2PZSA 3PW5A 3CDWA 4W5RA 3KNAA 2WB4A 2BANB 4KO0B 4DF4A 2ZQBA 1S0OA 3TR8A 2KFZA 4CERA 3PX6A 3IS9A 1C2PA 4H8KA 2OYQA 1WSIA 3I5BA 2ZKUA 3MXJA 3PW7A 4YQWA 1S9EA 3T1AA 4KTZA 4EBEA 4HUFA 4ZVFA 3LDSA 2HNZA 3LWLA 2V4RA 3O3HA 5EWFA 1VSDA 2BGGA 3ZT3A 2W8LA 2R8JA 1G15A 3P5JA 4YFUA 4WFXA 5J1EB 1N56A 4YMEA 3C95A 3O3FA 2D3UA 2PY5A 3NBPB 2DPIA 2FBYA 2YKNB 3VQSA 3V9UA 5HP1A 2AWZA 1XR7A 1T8EA 5KFQA 4ZP7A 4B9NA 2HHQA 1QAJA 3ASMA 3DRSA 1BCMA 3DI6B 1KFDA 4MKAA 4ZVEA 1O1WA 3NKYA 3V6DA 4KTWA 1RT4A 5L9XA 4EYIB 3QYYA 3HHKA 4DF8A 4Y1DA 4E19A 3VQPA 1W25A 4DTMA 1S0MA 1C1CB 3AO2A 5HROA 2HNZB 4BDPA 1HQEA 4MK7A 1QAIA 4AHSA 2NUBA 4CHYA 1JLCB 4RW6B 4IR9A 1DTTA 1NHUA 3WNGA 3GV8B 3AVHA 3PVXA 4K4TA 1RT5A 1T03A 4CEFA 4ED3A 1TKXA 4M3WA 4AILC 3V1QA 3C6UB 3V9SA 4ECYA 3L3UA 1S1UA 5DQGA 3V4IB 3OYBA 1RT3B 4ELTA 1GOCA 4E3SA 4O4GB 1KTQA 4K4SA 1F21A 1S9FA 4IFYA 3E51A 4CHZA 4DU3A 3M8SA 2D41A 5KFMA 1TL3B 3DLKA 3ISNC 3KHGA 3RWUA 4L8RB 4CJEA 4XO0A 4QWAA 1L3VA 2BE2B 2YHBA 1TK0A 4IKFA 2YNIB 2HHTA 2HNDA 3MEGB 4RW7B 3NAIA 3H5YA 4EZ9A 3CDEA 2EHGA 5J1EA 4FJ8A 4ZPBA 3ZT4A 1T3NA 3IRXA 4ZP9A 2G8IA 2E9ZA 3RR8A 2XY8A 1WLJA 3H5XA 4IH7A 3V81B 3G86A 3ZSVA 3LWMA 3V9ZA 4W5TA 4KI4A 4EBDA 4CIFA 1CXUA 2RKIB 2HWIA 4Z4CA 1D9DA 1D8YA 4IRDA 4HTUA 4DTUA 4CGDA 2E6MA 4NLOA 4JV2A 4B9VA 3DDKA 1A5XA 1BL3A 5DG8A 3LP2B 3M8PA 4ECWA 2ASDA 3DYAB 3BGRB 4LQ3A 3HL8A 1EKEA 4FM1A 1JXBA 1RT1A 1JIHA 1LW0A 4B3OA 3EYZA 4DG1B 4JUZA 1JLQA 3H40A 2GIRA 3MF5A 4BDYA 2XCAA 1LWEA 4B9UA 3LP0A 4ELVA 2IS3A 1HYVA 2XY6A 1HRHA 4DLGA 3AV9A 3I8DA 1B9FA 2ATLA 4CE9A 4O0IA 4FBUA 1WSFA 2DFEA 2CKWA 2HAIA 1HMVB 4FLUA 4NYFA 4XPCA 4ECTA 3M8QA 1C6VA 3OYGA 4URGA 3KHRA 3OS1A 4H4OA 3QIDA 4FLWA 3U6FA 5KFUA 4NLPA 4CJPA 1C0MA 5F8JA 3AVBA 3HSTB 4WFYA 3GIKA 3KK1B 3LALA 4FVMA 4NZ0A 3HVTB 4RW9B 1VRUB 1SH0A 1HYSB 2XWYA 4CFBA 4FJ7A 2C22A 2OPQA 5I42B 4H4MB 3OJUA 2FVQA 3FRZA 2IDOA 3VQ8A 3UR0A 2RDJA 3G6YA 4ECUA 3RRGA 1D9FA 3KLIB 3LAMA 3NH2A 4JS4A 3G6XA 3V6HA 3VQAA 4F8RA 4RUAA 1C1AA 3M9OB 4CHOA 2W7OA 1T05B 1ZETA 3MEGA 1RA6A 4RU9A 5JS1A 1XWLA 3DMJA 4O3NA 4WZMA 1ZBIA 2FC0A 1KCFA 4MH8A 3U3YA 1RYRA 2FVRA 1NK5A 3H5SA 1JLCA 4RW6A 3L2RA 1TV6B 4MFBA 1NK0A 1J5OB 1N48A 4IDKB 3EZ5A 3H5UA 3QLHA 4C8LA 4HHTA 4M3TA 3CM6A 3ZT2A 4FK0A 5HRRA 2FBTA 3ZSOA 1IKVB 2VWKA 1Q9YA 3KD5E 2FLLA 3C94A 1DLOA 3LP1A 5DG7A 1JXEA 4AH9A 3WNEA 1KRPA 4OLBA 5T14A 4KKOB 3DI6A 4IG3A 2HHWA 3G6VA 2IGIA 2C28A 3LPUA 4JRQA 1RT4B 5KFLA 2IM3A 4I7FB 3PJXA 4TYBA 2Q3SA 3SYZA 5KG1A 3Q8PB 2D7SA 1JLEB 1Z25A 4FJKA 2FVPA 5F9NA 3SQ2A 2IA6A 1IM4A 1RDAA 3KLIA 1B9DA 3HO1A 5DQIA 2OPRA 2VA3A 3OL8A 2OA8A 1VSEA 3KJVA 5J2NB 4B9LA 4CF9A 1TKXB 3DRRB 3IGVA 1S1TB 3HXMA 3THVA 2YKMA 3JYTA 1JL1A 1W9HA 2E9TA 3PY8A 5KT2A 4WE1A 1CLQA 1C0UA 1NK7A 2G8HA 3LPTA 3RB0A 4ED6A 4F4XA 3VQCA 1J5OA 3ZSXA 2QXFA 3JSMB 2GC8A 4M3RA 4M3ZA 3OL7A 5SZTA 1HNIA 1VSFA 1CSJA 4TN2A 5DLFA 2B43A 3UIQA 2DPJA 1REVA 2C2DA 2RF2B 4F3OA 4N76A 4IG3B 4CJ3A 1R0AA 4KE5A 2A1SA 4I7FA 4NLGA 2P51A 4FM2A 2YNIA 1U45A 4LSLB 3Q8SB 2O4IA 3SFGA 3QETA 2X6SA 3OLAA 3TARA 3KLGB 2FBVA 4FLYA 3DRPA 4ECZA 3KJVB 2OH2A 5J2MA 2F8SA 3MEEB 4C8KA 3ZSQA 2AQ4A 5CYQA 4DWIA 4NCGB 4IRCA 1LV5A 2D3ZA 3SQ4A 4KHWA 5L1LA 4NYNA 4FLXA 5KT7A 4FLVA 5E41A 1ASUA 3BSNA 2DFHA 3C6TA 3DLHA 5KGXA 1GX6A 1RDDA 1HNVA 4DSEA 3DM2B 3G0ZA 2WONA 4KHNA 4J9RA 5DQHA 1S9EB 4J9QA 3OY9A 4M94A 4R5PB 2E4LA 3O4QA 2Z1JA 3AVFA 3P1GA 3BQ2A 4Z4HA 3CQ8A 5KFVA 4U7CA 4ZHRB 1CZ9A 2GBZA 3UQSA 3PO4A 1RCHA 2B6AB 1BQMB 4KHQA 4J2AA 5KG3A 3TWHA 4TLRA 4IBNA 2KW4A 3QNNA 1HQUB 5KG6A 1BQNA 4DTXA 1Z4UA 4CJ5A 1MU2B 5KT3A 5CZ1A 3NBPA 2B5JA 1SUQB 5C24A 3NHGA 3MR5A 1XHXA 4Z4FA 3MTKA 3AA5X 4M41A 1GOBA 3T5HA 4CCHA 3CFPA 3TAGA 1WSGA 1WSEA 1K6YA 3BJYA 3TAMA 2DFFA 5FRMA 4ED8A 4RW9A 1JLFB 3TABA 3OHBA 3V6DB 3C6TB 4QW8A 3PW2A 1SH3A 1JX4A 2ZD1B 2F8EX 4RUCA 4ECSA 4CGFA 1RT6A 3K59A 4AHUA 3RB6A 2IBKA 2XGPA 1SV5B 4DL4A 4HKQA 4CGIA 3SNNA 3I0SA 5DLGA 1RTJB 3DMJB 1WSHA 1J9AA 4RW7A 1NKBA 4M42A 3HVAA 2HHSA 2W7PA 3LAKA 4NYZA 5C5JA 2O4GA 3CFRA 4M3YA 1RILA 4FBTA 1T03B 5K14A 3T5LA 4DSFA 5C25A 3E01A 1MU2A 5KFFA 2XRIA 1RBVA 5L1IA 4ECVA 3KHHA 1JLAB 4K4UA 3KK3A 1L3UA 1RT7B 1TQLA 1BI4B 4OKKA 1TKTB 4MK8A 4NLWA 3VA0A 2FBXA 3NGZA 1XR6A 3LZIA 3CJ3A 2BRKA 2XY7A 4J2BA 2HWHA 4EZ6A 1X1PA 4K4ZA 5JUMA 4BE2A 1QHTA 4FJXA 3SI8A 3S3OA 2IAJA 2BQ3A 4CHPA 3DYAA 3ZSZA 1CZBA 4O3OA 3GIMA 4FLTA 4FZXC 4DTJA 3ISND 5SWMA 3SUNA 1NK6A 3L2QA 1L5UA 3PR4A 1S10A 5HROB 4CFAA 1YTUA 1IKWA 4QWEA 2HNYB 5J2PB 4IRKA 4LSNB 1C0UB 1HQUA 1D1UA 4KPYA 5KFJA 3KLGA 3IRXB 3CG7A 4B9MA 3DRRA 3MECA 3ALYA 4IH6A 1JKHA 3QGHA 3LANA 5F9LA 5HP1B 4B08A 4CEAA 1A5WA 3QEPA 4AHVA 4CK3A 4Y3CA 1NK9A 3QEXA 3O3GA 3ZCMA 1XR5A 3CYMA 4B9SA 4IQXA 4TQRA 3QEIA 2IMWP 3OYJA 4LH4A 4OPJA 3QIOA 4TY8A 1QTMA 3SV3A 3AO1A 4N5SA 4FZYA 1I39A 1QUVA 1DTQB 4Q44A 5FRNA 5KFNA 3CJ0A 2KFNA 4TYAA 1YVFA 2IM1A 5KG7A 3VQ5A 3QGGA 1VRTA 3QNOA 2JEJA 3OYCA 3H59A 3QGIA 4ZVGA 2FLPA 3I0SB 4LSLA 5CYQB 3VQ6A 3AA4A 3NL0A 3VQEA 3MR6A 2B6AA 1LWFA 3U3GA 1QS4A 3V9WA 4ZTFA 3SPYA 2YHAA 4NLVA 4IFVA 3M8QB 2I1RA 4JRPA 4FJ9A 3TAFA 3NDKA 3IN5A 3FDSA 3QIPB 1Q8IA 4G3IA 1WNSA 4E7LA 3NE6A 1RT3A 1WAJA 2HHXA 1HNVB 3Q8RB 1TGOA 4IFYB 4CJVA 5F8LA 4FW2A 4H4MA 3UDLA 4RW4A 4J9SA 3WNFA 5EUHA 4M3XA 4O44B 2G8WA 1UOCA 3RBDA 1S48A 4LD0A 3VA3A 4K4XA 4CJWA 4DTRA 2WTFA 1S1VA 1S9GA 3CFOA 1FKOB 2ASLA 3GIIA 1LW0B 1S1WA 1FK9B 1C1BA 1NOYA 2G8KA 3SZ2A 2HNDB 3HYFA 2FJXA 3GV5B 1RTJA 3OSPA 2KZZA 1RTHB 1HJRA 1EETA 1TK8A 2EX3A 4NLQA 1JKHB 1SKRA 5JXSA 3SUOA 1KVCA 2YKNA 3SJJA 3H98A 3OSNA 1IKVA 3V4IA 2V4QA 4FJGA 1EP4B 5KFGA 4F4YA 4KFBA 5KFBA 2HHUA 1ZBUA 4NLRA 4Q5VA 5KFWA 4BE0A 4KKOA 4O0JA 1SKSA 3SCXA 2HHVA 1S1XB 4KREA 3EZUA 4NLDA 1NJXA 3IGNA 4CHNA 1Z26A 3SPZA 4CEOA 1S4FA 2I5JA 1BISA 2Y1JA 1S1VB 1LWCB 4CECA 4FCYA 1U09A 5JS2A 4FW1A 3L2UA 4B8CA 2ILYA 4M45A 2AX0A 1FKOA 3N6MA 3P83D 2YNFB 4F4ZA 4AHTA 1MMLA 2EC0A 4KB0A 1FK9A 4J9PA 3GQCA 3PX4A 2J6UA 1U04A 4RW8A
chains in the Genus database with same CATH superfamily
2YKMB 2QL7B 1KVJA 3BBCA 3EE8A 3O1WA 1HWUA 4CQ1A 2NREA 3CJKB 3NFAA 1CG2A 3OXFA 2G8FA 1IO2A 1Q7LB 2W9CA 3CCMN 3MECB 1VBXA 1CJTB 3K57A 3M2VB 1LXNA 3EZWA 4YEAA 3BREA 3OW2M 1ZBHA 4KAZA 3POTB 3KLFB 2KXHA 3E9PA 3K5LA 2J7KA 3H08A 3PHTA 3BP8A 3BBBA 4A8QA 2D9OA 5B0FA 3P96A 1RDBA 4DN0A 1BD6A 1RKJA 3H45C 3VQ7A 2DPNA 5C2CA 3LDQA 4LFCJ 1YKWA 3D3BJ 4R8UB 2MMYA 3FZHA 3JYTB 3GG4A 3O4NA 3O80A 2O66A 2C2RA 2UXDF 5CHCB 3IMXA 1E3MA 3ZSWA 1CJTA 3MEDB 2HB5A 2CDQA 3J80Y 1NU4A 3CCEN 2B9WA 2QXLA 2ZH3A 4AL6A 3OTCA 1QSLA 5IQQA 3TUZC 4RG8A 4PL8A 4LH5A 3I5AA 3D68A 4JI4F 5KQDA 4WYBA 1RBSA 4WKYA 1LK5A 1ZM2A 4BR0A 3OYFA 3BZCA 4DR4K 2CJBA 1RHUB 5E3RA 3PRVA 1Y4ZB 5M2RA 2C3OA 4CO1A 3VAJA 1MN7A 1M5OC 4KB1A 3T5KA 2NYIA 4Q45A 3FGVA 4QW9A 3C6HA 5C2FA 4BY9C 2A2DA 3OUYB 5GAHI 4DV5F 3SLCA 3O9SA 5AQKA 2UXCJ 4I2PA 1TKTA 4V19J 4LRDA 3RB3A 3ENQA 2KT5A 3QSIA 5AZIB 2IVOA 3J7AN 4KTQA 4UY8T 4LF9K 2FDNA 3WXKA 4YOXA 2J7WA 1UFLA 5M1PA 3NGTA 5DO2A 2CQ0A 1HBNA 3CGIA 4K7QA 3EY1A 4DTOA 4X66K 1DARA 1DKGD 1ZXOA 1RHMB 2R8HA 4EUVA 5KFXA 2BX6A 5LJVA 4KI6A 2BR0A 4B3OB 3VEOA 1LWCA 3D1HA 2RRAA 5C2DA 3T19A 4CJSA 3RW6A 4C7QA 3DOLA 3DFEA 2M5YA 3BF4A 4QWCA 2Q6CA 3R1XA 2FD2A 3KYLA 4LF4F 4CI0B 1KC8T 4KFBB 3CJ8A 1BI4A 5KG5A 1N34F 4KV8B 2XSJB 4CTAB 4XEIA 1RKIA 1J27A 4S0MA 1PJ5A 2W24A 2DNHA 1VQKN 4I9QA 1A0OB 4PQUA 1M0SA 4P52A 4X65F 2DTUA 1IJFB 2K3KA 3AOBA 1K8KB 1SV5A 2FZKB 2HW3A 3L3CA 4DR2F 5BN8A 4DR6F 5A8RA 2PD1A 4Z0UA 5BPNA 2P9PB 3KK2B 3TAEA 4O3SA 5E3CA 5KG0A 5M1NA 4YOYA 1JXLA 1RTZA 3W5YA 1RT2A 1X4GA 2OPSB 1YWXA 4CEQA 4RBUA 1JK9B 4Y65A 4N8NA 1HHSA 3KJNB 3VAGA 5J2QB 1U8SA 3MPYA 3AA8A 2E1MC 2HLUA 3I5CA 2UXCF 3LPEA 3G82B 4WE1B 2Z0GA 3U8XA 3FQKA 1KVBA 5EWEA 1YDLA 3SSRA 3L0QA 3QEWA 1C4AA 2MKJA 1WBBA 1ZC6A 1ZPWX 1N8RO 2HQFA 3IC1A 3D3CJ 2DT9A 2BUNA 1FXLA 4PAAA 2XMTA 4FK4A 4PQUB 2LCWA 4LMZA 3J81j 3NF9A 3BGRA 1Q5VA 2G0JA 3CNQP 5A8WA 4YN3B 4QYRA 4AXIA 2PFDA 3J7Z5 4X4NA 2Q1LA 1RHJB 2NRHA 3QB0A 4R8UA 2Q31A 1SAZA 4J9KA 4BVOA 1UJ6A 1NGBA 2MXYA 2BW2A 1WC1A 2NXCA 3HKWA 2FY8A 4DR7J 4XIUA 3VOVA 4OPKA 4MKBA 2P9GA 4JI4J 2IVYA 1S6UA 4NYPA 2HF4A 4RNMA 1WJ9A 2VG7A 4G1QB 2CQ3A 1YXQA 4JKGB 1F6TA 3TANA 3J7YU 2O3DA 2YV0X 3HT3A 3DLRA 2E8AA 3IUCA 4G65A 1S72N 1LKZA 4LFCF 1OYDA 4ECQA 4KR0B 4NPOA 1EXQA 2ZC3A 5KFEA 4DUZJ 1UW9A 3QRPA 1RBTA 4KO0A 1JB0C 3NCIA 4OI4A 2GQ2A 5BYQA 3PUFA 1RT1B 5M1KA 2ZZTA 4HHJA 3S3MA 3OVNA 1RUSA 4RO0A 4OJ1A 2YJFA 5FPNA 3QPIA 4EIAA 1VQMS 2J5AA 1WSRA 5KOXA 3A5OC 3A5NC 2B0GA 1CZAN 3SFUA 2RQMA 4A8KA 2RDDA 5ETKA 1X4EA 1RT5B 4I2PB 4WJBA 2IFXA 2VF3A 2AU0A 3BPSP 3MHYA 3OUYA 1UA1A 4ZKAA 3ZYYX 3EPIA 1RAHB 4OZ2A 4BRMA 4J8FA 4KAIA 4P2MA 4FJLA 5JVHQ 5D77A 3JAMO 4CP5A 4J37A 3SBGA 2AZ1A 2VC0A 3F41A 5HQ8A 2V4JB 2RS8A 1QVFM 4NA1A 3P45B 3L3VA 4DV0J 4LRBA 3H0PA 2AJ0A 3UI3A 5EWGA 1HPZB 3VAMA 3MWBA 1TU0B 4CJKA 3LP2A 3CCSN 3RAXA 1BHLA 5BR8K 1HLUA 2HMIA 5CA5A 2LDYA 3DRXA 4LFAF 3VHQA 2WOMA 1S6PA 2J6TA 3J8AA 2K7KA 3EVOA 4JS5A 2B4VA 4A4JA 3KKSA 3VPZA 5ETQA 3RUBL 4MKYA 4BR5A 1WG4A 2COLA 3VVTA 1N5VA 1JL2A 4DSLA 2D0AA 3OYLA 1V4TA 3QQCD 2UUBJ 3ENOA 1XBWA 5F8MA 3C14A 3JXUA 1FXXA 4EMDA 4FJ5A 4ISGA 1OH8A 4H4OB 3BB5A 4DR1K 3RSEA 3HSZA 4YR0A 3KK3B 1CS4B 4PUOB 3N5BA 3BH7B 1ASVA 2GHPA 4NLTA 3PV8A 3V1OA 4NASA 4CJLA 1UVKA 2IM0A 1ZBLA 1URNA 2X6NA 1Q78A 2UUCJ 4ZLJA 2CYYA 4CHQA 2R7XA 4USVA 5L9NA 4OV6A 2HMIB 5A2QU 1U25A 2CZVC 3MK6A 5ETNA 4O8KA 1NH8A 1SC3B 3AGRA 3EPGA 2FXUA 4ID5B 2FHKA 1N54B 3IM8A 3EN9A 4BRQA 1URRA 4NMLA 4ZIWA 4CBXA 3PKYA 3I96A 2BJ7A 5D3GB 4WYWA 1W2BM 2O8FB 3RMCA 2GUIA 2ETJA 4CIOA 1QZ5A 1T6DA 2VBYA 4CF0A 2N7YA 1YT3A 1O13A 4YP3A 2D0CA 2FC8A 4WK1A 1RU1A 1KFSA 1KLMA 5L39A 2K1RB 2CZ4A 1IBCB 4DR6J 3FFIA 2I5JB 1K47A 3P3DA 4OX9F 4A8XA 1LAWA 4BBYA 3J80O 1VFJA 4JK8A 4ED4A 3I4HX 2GVZB 3EDQB 4YB1P 3CJ1A 4C48A 4ANEA 5IM0B 1LWEB 2ZFHA 3ZT1A 5KFSA 5HBMB 1WBDA 2IJFA 1LQ9A 3MR3A 2CUYA 3UDEA 2BDPA 4GVLA 1M90T 1HI1A 4FJNA 1NJWA 2FJVA 2X3GA 1DGKN 3UE5A 3HK2A 4FS1A 3CMAN 2UZAA 4AQYJ 2H5EA 4URSA 5BRHA 3OYDA 1FWLA 1TL1A 1LOTB 3ILOA 3M8RA 1KLMB 3KLHB 1YUWA 4URQU 4DL2A 3PZPA 2V7ZA 3TTCA 4NXMK 4M5LA 4JI8K 3HHEA 2FHJA 4CZEA 2GAGC 3GU0A 3HPHA 3VEYA 4NYOA 4JI0J 1G7CB 5HATA 2DCLA 3GE1A 3OL9A 3GV7B 1LEOA 3K9KA 1Q81O 4K8XA 4PG6A 3N0VA 3VEWA 3PNIA 2W8KA 3R1HA 3CI5A 3M9NB 4M3UA 2RUGA 3QJPA 3TAPA 4ILJA 1UVLA 1FJCA 3QNWB 4KV8A 2XSJA 1VQ8S 1Q86T 3MR2A 3S9HA 2IOCA 3H1QA 3AVNA 5AZIA 1YZ6A 5HQMA 1NNDA 1HHQA 1N34K 4CF8A 4W98A 1REVB 1HNWF 4EGLA 1KSPA 4BC4A 1RBRA 1FRKA 2DY4A 5H9FJ 3D9BA 1QE1B 1IKXA 4FKXA 3QAEA 1VQ9N 3B6PA 4PA1A 3BEXA 1MSWD 4QR0A 4B9QA 2BE7D 2F3JA 4XAKA 2MKYA 2HZAA 2XLKA 4DFKA 3OYKA 3JXOA 2QSWA 2H3EB 3KHLA 1C1BB 1N88A 4I2QB 4CEDA 4W5QA 5KFPA 3ZETA 2QGFB 3P5BP 3KJFB 4OFZA 3TNVA 2HS3A 2W2OP 4BC5A 1M5HA 2QWLA 3AJ2A 4DV6K 3B8HA 2O8CA 4PUOA 5DGAA 3TA0A 4H5NA 3SCLE 4PEOA 2J0WA 2M0GB 5BREA 3KJQB 1UJ5A 4GW6A 2GZOA 3DLGB 2NR0A 3KIOA 4BQZA 3DHWC 3CPWM 1P1TA 2GEMA 1VRTB 2VG6A 1RTDB 1VSMA 2KHCA 2A40A 3SMSA 3FZLA 3HM9A 3NWRA 5A8KA 2BA9A 3KD1E 1IVZA 1W2IA 4FYWB 2CGJA 2P5OA 4WXWA 3D5MA 3GG0A 2R7OA 3ENVA 4FK2A 1Q95G 3EJMA 2BRLA 4WZQA 4OGEA 1FKPB 2ZWHA 3ATUA 2E7WA 4EBCA 1YJ9S 2P9LA 4DSKA 3UCZP 4LF6J 1OIAA 2G9OA 2NRTA 3FBCA 3JS9A 4NLBA 1TL1B 2VG6B 2QKKA 4BRHA 4OX9K 1HBUA 4NL5A 3GR0A 4K4VA 3BQ1A 1SL1A 2BW7A 3ZO7A 3LP0B 1WHVA 2E7XA 4OX8A 3KLVA 2AZ3A 1AXQA 1RWVB 1JLQB 2GMHA 4CLYA 4E0DA 3WEEA 3VQQA 3F9MA 5LMNK 4OKEA 2CPYA 3SSQA 5HL7L 5HBMA 2LQJA 1G2EA 1BA0A 1RNHA 4KPCA 4Y2CA 2DB1A 4OYPA 4CGGA 2F8TA 1GNKA 2F96A 2M3DA 2Y0SD 3DRSB 1FRIA 4JV0A 5KG4A 1U1PA 3AVIA 2L3MA 2P5VA 1QZ6A 4FJHA 4OI2A 3MPDA 1K1QA 2D5RA 2KFYA 2F4VF 3M8ZA 3GYGA 4W5RA 4I56A 2H4WB 4KO0B 2LDIA 1ZA2B 3LF0A 4DF4A 3BGLA 2J9DE 3IS9A 2MLXA 3MXJA 5AT1B 5FD1A 2Q2RA 1DBDA 2YX4A 2QSFA 2MQOA 2V4RA 1TMMA 2OTJN 2R8JA 2XZDB 4DR1F 2HS0A 4EWTA 4YFUA 3N01A 5J1EB 1R59O 1RBLA 4CYUB 3CD6N 1NCLA 3VQSA 5AQTA 1U0HA 4WU2A 3IWNC 4U8VA 2P9EA 3DRSA 1YAGA 4U96A 3IRWP 2HPUA 4A59A 4ZVEA 1UFKA 1O1WA 3O9UA 3LPYA 5L9XA 2WSEC 2P9UA 4W90B 1VBYA 3QYYA 3HHKA 1FVSA 4Y1DA 3EICA 1IN0A 3W64A 3VQPA 2IJRA 5JVHL 1S0MA 5JLFA 5U47A 1OVQA 4DCOB 1X4FA 3B8AX 3DLLL 3W2WA 4A5AA 2UUCF 2ASYA 5HROA 2HG4A 3ILLA 3UR3C 4LR8A 1S7IA 2QMWA 2NUBA 4CHYA 2V34A 3MGJA 4LFBF 1Q53A 3Q8VA 3KZBA 3PG9A 1T03A 3AT1B 1X5PA 4CEFA 1VIXA 1Y7PA 1N5TA 5IZHA 2J9EA 2MQ8A 3V1QA 3BF3A 1S99A 4BROA 1KC8O 4WFBQ 1WORA 1P9YA 4O4GB 5LOQA 4K5SA 4OMFG 4PABA 3M8SA 2J76E 2RRNA 5KFMA 3DLKA 5B08A 3I4PA 1Q82O 4WWSA 5E0OA 3A12A 2XMAA 2D74B 4L8RB 4XO0A 2LQ8A 1L3VA 4QYZJ 1TK0A 2YNIB 1C0FA 2HHTA 3AODA 4A48A 2MYFA 5BJRA 3ZZ0A 3D54A 4ZPBA 3DNCA 1T3NA 3GFYA 4NOHA 1JJ2M 2XY8A 1WLJA 3G86A 1PJ6A 4A8SA 3NS5A 3VR1A 4C0HA 2ZOMA 2HWIA 2OGUA 1D9DA 1FA0A 3HT0A 4FWPA 2HBRB 4JK9A 3VZHA 1GLFO 4AYBD 4ID8A 4JV2A 4G9ZA 3D7EO 2XBPA 4H0VB 1BOTO 3C15B 2BV3A 1S12A 3M8PA 4NXMJ 3NOCA 3BGRB 3HL8A 4FM1A 1JXBA 3O1LA 1LW0A 3EYZA 1VQLS 4FO0A 4CZKA 4DG1B 4JUZA 3MTJA 1V3SA 4P2SA 2DXDA 1Y3JA 4FWOA 1VQPN 2XY6A 1VLYA 1T44A 3MM7B 4JKEA 1ZBSA 3BH6B 3AV9A 1HR0J 3AXKA 4O0IA 1WSFA 1TFWA 1HMVB 4FLUA 1FKAF 3CPWR 4U8YA 2YH1A 2O8FA 2QG9B 1YQHA 3KHRA 4X62J 4FLWA 5DM6L 5F8JA 3HSTB 1VRUB 1SH0A 4CFBA 4FJ7A 2OPQA 2VBWA 4X4TA 1YHQN 4OZ1A 3TZWA 2JWLA 4DR2K 4H4MB 3HHDA 4Z7YA 3UW1A 2UV8G 2FVQA 3FRZA 3RBXA 3IXQA 3CJAA 2IDOA 3TA1A 3RYLA 3GJRB 2XLIA 3E9LA 3NH2A 1IBKF 4JS4A 3V6HA 2GVZA 2VWBA 3M9OB 5CCLA 4BG9A 2W7OA 1T05B 1RA6A 2FF6A 4X4QA 3ZZOA 4JI2J 1J6ZA 3DMJA 1BHNA 1WEZA 4WZMA 3CC7S 2VD3A 1U8WA 3U3YA 1UZHA 1NK5A 5E7OB 2P9IA 1R0BG 1NK0A 1W97L 3PFOA 4IDKB 2XHWA 1HD1A 2H51B 4TLQA 1UAWA 4ENOA 1DLOA 2FB0A 3PFEA 3MN5A 1JXEA 1FWPA 1KRPA 3OTOF 3MM6B 2EI5A 3EE9A 2HHWA 3CSKA 3LPUA 3M05A 3IBCB 3H25A 1VIOA 1NEEA 3FBFA 3Q8PB 4KH5A 2D7SA 4L72B 1GMWA 3UE2A 6FD1A 1IM4A 3HMJG 3HO1A 5DQIA 2VA3A 1VQON 3FR0A 3OL8A 1NBWA 2OA8A 3K17A 5J2NB 5AQFA 2Y8YA 5LSRA 2OTLS 3OV7A 4LF8F 2XO6A 3WQUA 3G8TA 4DU8A 1E6YB 5KT2A 1NK7A 1VQ7N 5BN9A 3MXHP 4C23A 4DV5K 4ED6A 1NM2A 2C3PA 4OQJA 1B70B 4J9VA 1NMDA 5DZ6A 2QTDA 2GC8A 3Q7CA 3TA2A 2X51A 4NI2B 4M3RA 4YOEA 2IPOB 4CNYA 5DLFA 2KL8A 5HVHA 4DX5A 4K41A 3EGNA 4IG3B 2QA4G 1R0AA 3CCVN 3TR5A 2AW0A 4DR4F 4JI4K 4FM2A 5C7PA 2R9LA 4H5RA 2YX7A 1IJJA 1U45A 2ZJPL 1HQ2A 1YBUA 3QJJA 2ZZNA 2YTCA 5LMUF 2MQNA 3VF4A 1NPKA 3DRPA 4LUBA 4ZVOB 2F8SA 3NGKA 5ADXA 4M5KA 3MDFA 4NCGB 2HF3A 5AQGA 4JD2B 2HFZA 4IRCA 2Q43A 1RWXB 2D3ZA 2BJ1A 5JMVA 4NYNA 1Q81T 4FLXA 4CD3A 3IAS9 1K9MT 2A6OA 1F5AA 1NLVA 5CHIA 4DV7F 2LQBA 2WBRA 5KGXA 2YX6A 1WHYA 3CDAA 1HNVA 3R9PA 3QRRA 3G0ZA 1OQ3A 3POTA 4P6QA 1BY9A 1KP6A 1Q0NA 3OY9A 1HBOB 9ATCB 2DNLA 3TZZA 2FLOA 4Z4HA 1CZ9A 2M7SA 1BQMB 3ET6B 3TWHA 4TLRA 3QNNA 3CJTA 4DTXA 2EWSA 4B1YB 3TX0A 1MMDA 4CYUA 2LEPA 3WC2A 3AA5X 1LK7A 4CBWA 4Y2KA 4A8OA 4C0BA 3T5HA 4DDFA 4WQ5A 5DZ7A 1K6YA 2P9IB 7FDRA 4DV1J 4A47A 3GSIA 1WHXA 3OHBA 5DJBA 1YRTA 1G99A 1WEYA 2WBMA 2ZF5O 4RUCA 1RT6A 4YHHJ 3RB6A 2DGTA 2IBKA 2HBZB 4B3TK 2M70A 4OHWA 5CZVA 3O6QA 3HRGA 2GAHC 4BC9A 2DHSA 5B09A 5CYJA 5RUBA 2ZHOA 1HR0K 3DMJB 1NAQA 1PBAA 1U2CA 4M42A 3K8VA 1NKBA 4HTLA 2W7PA 5HAOA 4H5WA 2V2KA 3OW2R 1T03B 3T5LA 3UKUA 1UTAA 5K8OA 4GVBB 1B64A 1U7LA 2YHYA 1EWQA 5BR8F 1RBVA 5AQNA 5L1IA 3VGMA 2ZUGA 3EUNA 1RT7B 2QWNA 2I2YA 4GNIA 2FBXA 2AT1B 4CH0S 1X4BA 3C19A 2XY7A 2Q1NA 2IYIA 2HWHA 2NXNA 2WVFA 3HZ6A 1RZMA 5JUMA 3S3OA 2IAJA 2BQ3A 4FZXC 1RP5A 1HFEL 3M1FA 5SWMA 5HROB 1ZBTA 1IKWA 4QWEA 1WOOA 4CH1A 5AFUA 5D4OA 1UVIA 4FWSA 4JI6F 4B1XB 3FK4A 1XK8A 4L3QA 4LBIA 4C8ZA 3CXCM 1WB9A 1A5WA 4CK3A 4PXCA 1UVMA 2DCUB 4DUTA 5EVZA 1NK9A 3O3GA 4CLUA 1DJ0A 4B9SA 3LGNA 4TQRA 3OPKA 4AD6A 1N36F 1RBOB 3P39A 5GAEI 2HFSA 1VQ6S 3NMUA 1I5OB 3AO1A 3HSCA 1DTQB 5HOOA 1G6BA 5FRNA 1VQYA 4ER8A 3QGGA 1HKCA 1VRTA 1ZS6A 3FZFA 3QNOA 4FXVA 1ZM3A 2KO1A 3OR2A 5G4DA 3I0SB 4QIEA 4PKGA 4BRDA 3ZC4A 5DS7A 5I3PA 1ZH5A 3CUNA 3VQEA 2LMIA 5LMUJ 1FHTA 2BJEA 3R5GA 2AEJA 1AROP 3M8QB 3U1LA 3TAFA 3FDSA 1QQNA 4TKTA 2ZOFA 5LXYA 3ONQA 2W2QP 2HHXA 3DU6A 1HNVB 3QATA 3Q8RB 1RAFB 4I6YA 2JWNA 2BKOA 3T1HK 5F8LA 3UDLA 1H2VZ 4NA3A 4J9SA 3J7AP 3ZTQA 4LF2A 3RBDA 2G13A 1AZSB 3VA3A 1B0TA 1FDDA 4BR7A 3VENA 4DTRA 1O8BA 2UUAF 4ED5A 3CFOA 1NBEB 1NJIO 2DJWA 3GIIA 1LW0B 2GHWA 3ZTOA 2MSTA 2V67A 2CGLA 2H5JB 2BH1A 3VETA 1NOYA 2RS2A 3GV5B 5BPLA 1HJRA 3UCUP 3OHRA 1TK8A 2EX3A 2M8HA 3ZNUA 4JKDA 4C4WA 5GAHP 5H9FK 5JXSA 3SUOA 3PACA 2FY1A 3H98A 3OSNA 3V4IA 2V4QA 1EP4B 4X64F 2YBVA 3M8WA 3OTOJ 2HHUA 4Q5VA 1SKSA 2HHVA 4BREA 2RRBA 2V51B 2F65A 2GX9A 4YY3F 4DCHA 1NJXA 1HKGA 3D4JA 4UF4A 3VAHA 1Z26A 3HKZD 1BISA 2HBQB 4PYAA 2Y1JA 4IFEA 3I82A 4ALZA 4FW1A 1DQ9A 1WTFA 1JJ2R 3L2UA 1KQGB 2NS1B 3N6MA 4YUDA 2EC0A 3MMCB 4R0JA 3FZMA 4KHPJ 1T02A 5EN1A 3HHLD 1ZZNA 2R2SA 3B4DA 1VK0A 4DV1K 1RTHA 3ICLA 2H9ZA 2DIUA 4F26A 4UQGA 4PXDA 3NGDA 4ICLA 2EFGA 3S01A 1S6QA 1JMTA 3CF5Q 1Q7YT 1XNRK 1EZZB 2YHXA 4PQAA 2F40A 1UETA 1ATNA 4CWBA 3FCHA 3EVWA 4O44A 5CABA 3PW4A 2CZ9A 4R5PA 4WP8A 4DV4J 4USKA 1QE1A 4PKDB 3NVKA 1IKWB 4OYBA 2U1AA 3TSUA 1KKHA 1VSLA 4QU7A 5ETTA 4HHHA 1OS5A 2J6SA 1V5IB 4EYHB 3PIPQ 1IBKK 4KB7A 1JLBB 4J91A 2NXUA 1X9WA 3KWIA 4DPXA 2CGKA 2G8VA 1FJGJ 4KHSA 1Z2LA 3LZJA 3B82A 4HR2A 2LXUA 1N36J 1VQLN 4IOAQ 4JKBA 2DH9A 1WUUA 4ZCMA 4PKIA 1K8AT 3C66A 4K2XA 1RAGB 3CCJN 2I0XA 4C11A 4G6VB 4YOVA 2Q0RA 4JKHA 1K8KA 4JI5K 3CJ5A 4YDUC 2FVSA 1ZZFA 1EB0A 1Y5LB 2EFOA 4Q43A 2CPEA 4UOFA 4WQ4A 4B3MK 4W5OA 3AFGA 4NRUA 2Z4PA 4Y2IA 4Y34A 1CJVB 2EFQA 5LJ5Y 1S4EA 5A0YA 2W9AA 1Q82T 1U1KA 1VQ4N 3HJFA 2XSFA 3THPA 1RFQA 3KK7A 4RX6A 1TK5A 3B6BA 1JLFA 3TVZA 5A6PA 5HLFA 2BJ9A 5DG9A 5F8HA 3I31A 3A5LC 1YRUA 2LA6A 3B54A 4NWBA 2DNOA 5D4LA 4ECRA 4LR9A 2KT2A 3CVKA 2ABYA 1SC1B 3KLFA 3DRYA 2JC1A 3BF1A 4I6MB 1S9GB 2OAUA 5B0BA 4E7HA 2Z2ZA 4YOTA 4ILRA 2WW8A 2PFUA 2FJDB 2HSTA 1W7AA 1OMSA 2BXJA 2OMLA 1R0CB 1SC4B 2OZSA 4LFBJ 1UZDA 4IKAA 4ZPTR 1HMVA 2RH3A 4TU8A 3MXIA 5BYRA 1JLAA 3M8YA 1DTTB 3CJQA 3M2RA 3N6LA 4ED7A 4FJMA 3SAHA 4I67A 4NO7A 1J5EK 4QBUA 2VG7B 4G1QA 3JSMA 2HRUA 2O8BB 3VGUA 3CWJA 3I9ZA 1X4AA 2IVPA 2PN6A 2B3TB 4HCBA 1AW0A 4XK8C 1WSJA 1IBMJ 4ILMA 3N6NA 5KRTA 2FSNA 5MLCQ 3DLBA 3I32A 4W5NA 1HBUB 3MUMP 3IO1A 2PBDA 3RR7A 3CD5A 5LL6Z 2W2MP 2K8GA 3EXCX 1WC6A 2GV9A 3SUPA 2X1BA 3ISZA 3DOKA 1BGXT 4GY2B 3VAFA 4GMKA 1OH7A 5DDPC 3NVMA 1YG0A 2O8DB 2JHEA 2V8HA 2NRVA 1QHAA 1YI2N 2C2OB 3IM9A 4EU0A 1VISA 1WKLA 4J9LA 3H3OB 4EAHD 1B0VA 1T9TA 4USHA 1YRXA 5KFIA 4M5DA 2DXFA 3N79A 1VQ9S 3T1YJ 5AE3A 3SQGA 2ZH4A 1ROFA 1XMOF 3UN3A 4BE1A 1CLFA 2EK1A 1FFSB 4C9DA 4WFZA 5C42B 1CC8A 3GFZA 3OS2A 4NLSA 4IQMA 2EFNA 2Z1IA 2L08A 1VSKA 2H54B 3ZXWA 1SIZA 4O3QA 4EHUA 3H8YA 3TTFA 2VFSA 1N32K 2ZH2A 2MEWA 3OYEA 1KVAA 2QYCA 4DPOA 2QI2A 5KAKA 4GVMA 2V8GA 2AMCB 3Q8QB 5A8KB 2PEHA 1E6VA 4I2QA 3L2VA 4CJTA 4GKJJ 4QOZB 3NRBA 1ZYQA 2NZCA 1XNRJ 4OKJA 1FJ7A 1PKUA 2ZHBA 4NCBA 4X65J 1RAOA 4MAKA 1O51A 4ZVHA 3N4PA 5AZJA 3HOSA 2M8DB 2X1FA 4IOCL 4WKRA 4O5BA 3W0LA 1VQMN 4BRFA 1H73A 3HHNB 4UZBA 3ADAC 3SUQA 1VI7A 4M1KA 3CETA 3N4QA 1T94A 4C1NI 2GFFA 2YHWA 1Y3KA 1OQ6A 1H0HB 2E1YA 2XI2A 3NH0A 4DS4A 1FWKA 4DFMA 4CLPA 1QVFR 1DFDA 5J2PA 3SAGA 4ZLNA 1ZBFA 2OMOA 4WU3A 1JCFA 4X4SA 2W6KA 4Q0BA 4JI3K 3D6TB 1R8AA 4DTNA 2LSNA 3TOQA 4WIQA 3OYHA 4LF7F 4FOEA 4MT1A 1QAXA 3CE8A 4YY3K 1TV6A 5B0DA 2WVCA 4K43A 1AB8A 3MFIA 5F0XA 3VQDA 5GAHU 4HVJA 1V5VA 4H03B 2AIRB 3TUJC 1CPZA 1NOZA 4DFPA 2EKNA 1U02A 2P9LB 1FTCA 5D15A 5KOWA 3EZOA 4ZPCA 1I51B 4HUEA 3TTDA 3L7PA 3OTEA 4CJFA 2HFNA 3NG8A 3OR2B 1NRKA 2ZH7A 4C97A 4RW8B 1H98A 1HKAA 3K5NA 1KXPA 3PW0A 1Q8BA 3RW7A 4RNFA 2E5HA 3MMJA 4K0KJ 3QBXA 2C42A 2ZH1A 3EGVA 4CO5A 2QX0A 5AQZA 1KD1O 5JMNA 3LDOA 2E9RX 2DY1A 5MLCV 3UKRA 3CCLN 1S76D 3J7ZO 4RBVA 3BQ0A 4C8OA 2Z56B 3WNHA 4F9OA 2IDLA 4ZJLA 1WKKA 2RILA 2K3IA 1HARA 1MNEA 2V9WA 4IEEA 3R97A 1U2VA 3PJ9A 3R5CA 3DGPA 3CD7A 4F02A 1MWMA 3CF5L 3I55S 1IR2A 1RYSA 3S3NA 3IS9B 1J2VA 1C1CA 3QZ8A 4A8WA 4FF1A 4OL8A 3QWPA 3H2UB 1AUSL 1M1KO 2AJ2A 1J5EJ 2BE9B 3CO9A 2AYMA 3KG1A 3BDPA 2FZGB 3NWGA 4WFNQ 4AHCA 3G25A 1SL0A 2VJVA 4F50A 3Q7BA 4KGKA 4DFJA 1VK3A 4K4YA 3HVRA 1FX2A 3THXB 1RT7A 3P38A 2HSEB 3LA0A 1X9SA 4J9UE 1GMVA 4F7VA 2W2NP 4MQ3A 2N3LA 4QWDA 1AUDA 3ZNJ1 3JSYA 5FDLA 4F4AA 4ZVQB 4BR2A 1X4HA 2BJ3A 4E7IA 4X66F 2F8MA 4N47A 4X84A 2G1DA 1I3OB 4DR3F 2KLAA 3G4SS 1MG7A 1RHKB 4DL6A 5KI6A 2OIHA 4X4PA 3VQ9A 4MYTA 2LXFA 1YGYA 3KWGA 4FOIA 4YY3J 1C0TA 2B9XA 1V3ZA 3F9KA 2JOQA 1EETB 2C2KB 1SJFA 2R8KA 5F2RA 3QBWA 4J90A 4FPRA 4DL3A 2HQDA 4LQ9A 4XPEA 4QIVA 1DLOB 3NF7A 2VASA 4JI1F 1HD0A 1VDHA 3DU5A 3CCUS 2ZUAA 4OLAA 2P1JA 1UMJA 1FRJA 1JLGB 4TNOA 1HNXJ 3RB4A 4I6MA 3CIZA 5A76A 2P5GA 3IAYA 4LRCA 4H0PA 4PXBA 4DMZA 1RTDA 3SJHA 3T9ZA 1Q16B 2PO4A 4F2RA 4FWMA 2ACMA 5A6WA 4FL9A 2CIMA 1NPRA 3BEGB 2RHSB 3RAQA 3VGLA 5C25B 5I4MA 4L75A 4E7KA 1UWBA 5KFHA 1GMWD 1JWWA 3WZ0A 3PO5A 4GC6A 3GCXP 3CJKA 3DGVA 3BSOA 4PY5A 1T95A 2DGXA 4ZLPA 4LF7J 4DV3F 4H4KC 1NU0A 2CG8A 4DPWA 3K0SA 1WI6A 3AVJA 4LRAA 3ETMA 3D0GE 4YDDB 3PX0A 2OEJA 1ASWA 2YWGA 3AA3A 3QZ7A 2E20A 4RW4B 1VRUA 2EWHA 2DGWA 1FD2A 2VCPA 3U27A 2Q36A 3T5JA 2HVHA 2YNHB 2MZ1A 4Q8EA 4NLUA 1YJWN 1K1SA 5L1JA 1L3TA 2FPHX 5HQLA 5EX5A 3A4TA 3UCGA 2K06A 4CF1A 5L1KA 5J2QA 4MIAA 2WHOA 4NCGA 2Z57B 3C7NB 5I9EB 4HI2A 5E84A 4RL1A 3H2LA 2XI3A 2RDIA 4G1PA 3HDSA 4QWBA 2HOEA 1ELOA 4ZJOA 4CZCA 2HBLA 4CFCA 1X5TA 3HFVA 2ASJA 3MEDA 1YJ7A 4BS2A 5E5NA 1Y5IB 2E66A 1U2VB 4HEA9 3WT0A 3K5MA 1RBAA 2RNEA 3OFGA 1KAXA 3DM2A 1N5YB 1WSVA 4DUYK 2HKEA 4M5HA 2RU3A 4MO4A 4NB4A 3NAHA 3N5FA 4RPFA 4FP9A 2RUSA 4Z7CA 3V9XA 1OSCA 1PC4A 2MKIA 2VQFK 2IC3B 4F4KA 1ACMB 1TVRB 4O3RA 3KLEB 1S0NA 3BZQA 1HWKA 3VN5A 4LFAK 5J1PA 1ZTTA 3BR8A 3GFXA 2VG5B 4K50A 3RAMA 4PWUA 2UVWA 4OYAA 1U47A 2V7YA 4UY8O 1P9QC 1NK8A 1RXOB 1EJ7L 1UEKA 3MAHA 3A8JA 4IO8A 2GJFA 4P72A 1W7WA 3TX8A 3FEZA 2BACA 1VQOS 4ICLB 1GX5A 4ED0A 1HKBA 3O5TB 1RQ0A 2BM1A 2X7IA 1B7YB 3OXGA 2IHR1 1U2RA 4L76A 4FXDA 2W4DA 2RKIA 4ZOSA 4B3SK 3J81U 1Y00A 1HYZA 2VKRA 4BC3A 4J9OA 4KGXB 4EO8A 5CY4A 3MXMA 2MQQA 2DY9A 4KJIA 1C4CA 3TSQA 2UYTA 1HQEB 1NSPA 4N41A 2E1CA 1AT1B 1BCOA 3DWLA 4FSVA 4FJIA 2DHXA 5F3TA 5AXMA 1TUVA 1I94J 2VL1A 1RT2B 2OP5A 3NH1A 3T1HJ 4N7TA 3NGIA 1XNRF 2KRRA 1S1TA 2PYJA 4CFDA 1WF1A 2QMUB 4CJ4A 2M52A 4M8LA 1VCTA 4DPUA 4CT9A 3CMAS 2BZ2A 4X2BA 3VQBA 3S7RA 2HK2A 2Z58B 1KHWA 3CCJS 2YWKA 1ZAVA 2OPPB 4DJBA 3VF0B 4DPTA 2PZSA 4HT7A 3KNGA 4UTGA 5LL6d 3PX6A 4JI8F 3I5BA 1FE4A 1RWWB 3AAPA 3EO3A 1S9EA 3KUGA 4HUFA 4ZVFA 3LDSA 2ZNYA 1FRHA 4C98A 4OZ0A 2KKHA 2W8LA 3K89A 3TVYA 1G15A 1V4SA 2XNRA 3GWCA 3MX5A 3P5JA 4KRWA 4K0KK 2NSCA 2DIVA 1N56A 1R7IA 2HIQA 2D3UA 2FBYA 2YKNB 3MX2A 1IXKA 1F3FA 2AWZA 1M1KT 2N7CA 1T8EA 4ZP7A 2HHQA 2D4WA 3OBYA 1TL5A 4JV5F 2I9SA 2HHHF 2CQBA 5LM7E 1JJ4A 2HFVA 3LM9A 1KFDA 3E66A 2DGQA 3MDQA 1ILYA 2RE1A 1QDUB 2YX1A 1RT4A 2IMOA 1Q1KA 3HHLA 3A3NB 3NNHA 1W25A 1JCGA 4DTMA 1C1CB 4PG5A 4F25A 3AO2A 4ZPVR 4ZJQA 4KT0C 3KXDA 1GXUA 3A8EA 1QAIA 4HACA 4FNHA 2QL5B 4RW6B 1NHKL 3T1HF 1NHUA 4N8OA 3WNGA 2N3OA 2E29A 3AVHA 3PVXA 2QA1A 2HHHK 4DX6A 4TU7A 2QRRA 1TUYA 1G4CA 2G2ZA 2HIYA 2CFXA 1GLEG 1U0HB 1VRQC 5DQGA 1XIQA 5E2QA 3OYBA 1RT3B 1GOCA 4K0KF 5HSPA 2DD8S 2NCKL 4K4SA 4CHZA 2BUPA 2ZH8A 1ZM4A 4B3RJ 2OUGA 2EBEA 3PLAA 1UWAA 3GP9A 5H9EJ 2WVBA 3ISNC 3LTOA 1KDNA 2E5JA 3GR1A 2QWMA 4QWAA 2FJEB 1TL7A 4PPZA 1N36K 2Z8QA 2LVWA 4RW7B 2RJZA 2DH8A 4EZ9A 1RWUA 3CDEA 3IKMA 4HH1A 3PEJA 5T41A 4DI6A 2R7QA 3ZT4A 3ZEUA 1HIYA 4ZP9A 2F1FA 2G8IA 5HMWA 3PIOQ 1TTHB 4IH7A 1GXTA 1Z05A 3GL1A 3IR5B 1UVNA 4I4BA 4DUYJ 3QSYB 4EBDA 4CIFA 2AHOB 4Z4CA 4IRDA 4Z37A 1FFGB 1DQ8A 3HX9A 2WVEA 2ZKTA 2JLGA 4RJVA 3ULHA 3V4MA 1XMQJ 3D1QA 4BCAA 3EGZA 2AV5A 3QT5A 1PBUA 5IC6B 2DR5A 4LQ3A 1JIHA 1XQIA 3QT8A 4FNIA 4B3OA 1XN9A 1RWKB 4HDGA 4IDHA 3MOZA 2VU5A 2GIRA 1H3DA 4ELVA 2GHVC 2IS3A 3DLJA 2GMLA 1F9EB 4RUHA 1IM6A 1WOPA 1HRHA 4DLGA 2GX8A 3I8DA 3MI7X 4FBUA 5L8RC 1S22A 5ADXH 2HAIA 5AQRA 4NYFA 4XPCA 4ECTA 3M8QA 2ZM6K 4URGA 4FN5A 3QIDA 3RJMB 2UXBF 1VR6A 5JJBA 3AVBA 3BDEA 3LALA 4FVMA 1HR0F 4NZ0A 5AZJB 2CXEA 1KOOA 5E26A 5I42B 3LM2A 3ILIA 3SAFA 4B1VA 3CIMA 2WC9A 1L3KA 2NSBA 2RDJA 3G6YA 2FIUA 3EEQA 3RRGA 2ZDOA 3MUTP 4CZJA 1D9FA 3LAMA 2KB2A 3EM1A 4L3NA 3G6XA 4F8RA 3VQAA 1WWHA 3PIOL 4CHOA 3NS6A 4USJC 3CMEN 4QIGA 1ZETA 1YX2A 3MEGA 2EVZA 2VQEF 1NGAA 4BGBA 5JS1A 4O3NA 1RYRA 4Y6IA 1GEHA 3AA9A 3CJ9A 2HFOA 3IFEA 2O8CB 3C65A 4BRIA 3QLHA 2AA4A 3GG1A 3UN5A 4M3TA 5HRRA 2FBTA 5B0AA 3KD5E 1Q9YA 3LP1A 5DG7A 4U7UK 4AH9A 4M63C 3VGTA 1R27B 1YLXA 2AEFA 4A2BA 4IG3A 3G6VA 1A9NB 4DL0C 3R6LB 2C28A 1ZOTA 3CT9A 2NRXA 1RT4B 2UUBK 4HLBA 4LF5J 1HBOA 4H0OA 1FO1A 4ILGB 3PRDA 5LMNF 2ZJPQ 2KYZA 5BYSA 2FVPA 2VQFJ 3GFHA 2CQIA 3D0HE 4OLPA 1IR0A 1RDAA 4YOUA 1B9DA 3KLIA 1S3XA 2OPRA 2WBNA 5AJ3K 1VSEA 4CF9A 1TKXB 3HXMA 2YKMA 3JYTA 3PY8A 4WE1A 2LEAA 5ETLA 1C0UA 3WQTA 2QWQA 1KNZA 2FF3B 4WQ5C 4JI5F 3M2VA 1CQNA 2KJWA 1CSJA 5AQWA 4E98A 4TN2A 2I8EA 1VOMA 3D6FB 4OV1A 1FRMA 4CO2A 1VQ5N 3EL2A 3UIQA 2QWRA 3RZAA 2RF2B 4N76A 5CD4A 4CJ3A 1GAOA 1VQ8N 4I7FA 4X65K 2CVEA 4LSLB 2EG1A 5BRFA 2Q97A 2YWEA 3W7BA 3QETA 3K8WA 4JV5J 3KLGB 4DX8H 2D3O1 1HUXA 4FLYA 5IV3A 4DN9A 1I94K 3MEEB 5H1SQ 4R25A 4CDIA 3ZSQA 3B4MA 2MY8A 1FE0A 1YF5L 4OJHA 1DT9A 3R5AA 2CH5A 3W9IA 5AFUH 3IBFB 4JHDA 3JAMY 3DOMA 4LF4K 1YI2S 4KHWA 4FLVA 1ASUA 3FJ2A 2RT3A 5GMDA 3G4SN 2DFHA 2Q79A 1CC7A 3SXLA 4A61A 4ZDNA 4PYDA 4PG8A 4KHNA 1LFPA 5DQHA 2AKWB 1T0TV 1HBNB 2WVDA 2E4LA 3QRQA 1ATRA 3BQ2A 3PXGa 4DBQA 3UQSA 3TEGA 3PKMA 2B6AB 3MMVA 1PYSB 1HQUB 1BQNA 1Z4UA 4ES3A 3CPEA 3NHGA 2DHAA 5KPZA 1NGJA 1XHXA 4Z4FA 2MGZB 3MTKA 2NRWA 1GOBA 3CFPA 1WSGA 3CCSS 1HNWK 5ETOA 5F1XA 4RW9A 1WI8A 1JLFB 1DEJA 4FWKA 2LLZA 5K8PA 4LF9J 4MDAA 1IV0A 1BU6O 4QW8A 3VCDA 1SH3A 2W41A 2ZD1B 2QZ8A 3D0IE 2YY3A 2XGPA 1SV5B 4X66J 2W4PA 3VESA 4IYQA 3Q2TC 3JS6A 4CGIA 3SNNA 1OJ4A 3I0SA 5DDOC 1XMOJ 1RTJB 1WSHA 2ADCA 2EEYA 1YBAA 1RILA 4FBTA 3T7ZA 1K73T 2NRZA 4DSFA 5C25A 2MZQA 5KFFA 3WEEB 2XRIA 2NLWA 1WOQA 5FPEA 4OO1J 1JLAB 1EAYC 1NGEA 5IT9O 1BI4B 1S79A 2NUHA 2DISA 4MK8A 2DGSA 3CCMS 2N4DA 4J2BA 1X1PA 4JV5K 4K4ZA 2EKYA 5H9EK 3MPWA 3SI8A 3TEHB 2M4MA 4NMXA 3ZSZA 4O3OA 3GIMA 4FLTA 4DV6J 2VFUA 4OI3A 2QTWA 1QLNA 1L5UA 4ISFA 3A8KA 4RBTA 1BLUA 1IJEB 2GWKA 2Q66A 1RB0A 3T69A 4KPYA 1RAEB 3NCPA 2VFVA 1U6FA 2A2CA 4IH6A 3KVGA 3QGHA 4JP8A 5HP1B 4B08A 4CEAA 3BO4A 3QEPA 4DKWA 1GT8A 1U2FA 4UUWA 1R43A 1VBKA 4KGMA 4X4VA 3OYJA 4IO1A 1X4DA 3QIOA 5IWAK 2J9DA 4FZYA 3SV3A 1R6YA 1QUVA 4Q44A 4AUKA 1XMQK 3CJ0A 2HEKA 1W2BR 2RHQB 5KG7A 4HI1A 1TZ0A 3HSGA 4QZVB 3OYCA 3H59A 4ZVGA 3KWMA 3CCTA 5FPDA 3GIRA 4LSLA 4ZLLA 1OY8A 5A2QY 5CYQB 3ZZPA 5MAOA 3MR6A 2B6AA 1X31C 2WB1D 3BUZB 1QS4A 4HWIA 3T1YF 4Y00A 1NNEA 2I1RA 4JRPA 4FJ9A 2VGNA 1UL3A 5IV4A 4G3IA 4E7LA 2FUG9 1RT3A 3NE6A 2PSZA 3WIVA 1WAJA 4O23A 1WC0A 4IFYB 2ZJQQ 4CJVA 4B1UB 4H4MA 1RHRB 4P71A 1F0XA 3WNFA 2H3GX 1FW6A 2G8WA 3QT6A 4KC5A 2VV5A 3FSYA 2I7NA 5EX3A 3TUIC 4K4XA 5DM7Q 2YQ3A 4CJWA 1S1VA 4PL7A 3MN6A 1FRXA 2V5HG 1RDWX 1KOHA 3CCQS 3VGKA 2ASLA 4IXCA 1ZPVA 3J7ZT 1S1WA 2IRUA 2O8EA 2WUSA 1C1BA 2R7TA 3W8GA 2X1GA 3HYFA 3S41A 2FJXA 1EX8A 1YHQS 3OSPA 2KZZA 1FFWB 2J8AA 3FE1A 2E1AA 3CJRA 1XNQJ 1SKRA 2A18A 4CLLA 4C0OC 4ZN3A 3WX4A 5KFGA 4L73A 5TKYA 4H0TB 2HRTA 5KFWA 4M5NA 4O0JA 2CJAA 3THYA 1S1XB 5B0EA 3EZUA 2H48B 1QQMA 4NLDA 3A3OB 1X0PA 3SPZA 1VQKS 3SDEA 1S1VB 4USMA 4FCYA 1XERA 1U09A 3UFCX 5D0GA 4B8CA 2ILYA 4EI2A 2AX0A 3DXMB 2GJIA 4F4ZA 4AXJA 3MCOA 1MMLA 3GCWP 3PX4A 2VKZG 2CH6A 1E6YA 3CW2C 4RW8A 1H2TZ 3HSJA 2ILZA 1SZ2A 3QBCA 2W4CA 1Y64A 4Z4GA 5EX0A 4HYKA 4UT4A 5IWAJ 4FPIA 2CPHA 1FKPA 2ZWOA 5DETA 1B99A 3HPOA 2J0XA 2KTQA 4DR7K 2I38A 1WOSA 1DHMA 3RMAA 1HWJA 2JEGA 3HPGA 4F4WA 3KK1A 1RGIA 2RVJA 3PYEA 7FD1A 3PRBA 2ALZA 3EXYA 4HH0A 3W66A 2POKA 3AO5A 4B3RF 1XTZA 2QK9A 5C0YA 1EWRA 2XMKA 2UU9F 3SDEB 1BG3A 4KIAA 3VV2B 1J54A 2KDOA 4DUZK 2VJUA 4P2FA 3T3FA 3AY0A 1UPPA 2VPWB 4RKUC 3OYAA 4DLEA 4QIFA 2MZJA 1U1RA 4QCLA 1UAXA 4M5JA 3CQXA 3ZLJA 1SUQA 2DRAA 4B3SJ 4E7JA 1T3VA 5IT9Y 4Q7AA 4CD1A 4ES2A 2J9CA 3OQ2A 3OXLA 1G1XA 4DB3A 2VDIA 2X78A 1GLAG 1WAFA 3C3LA 2XMWA 2R8IA 3AVGA 1Y10A 5ETSA 3T41A 3T6BA 2HGLA 1WF2A 1UA0A 3QEVA 1YJRA 2OPQB 1BQXA 3ZX3A 5C10A 5ETPA 2Y1IA 4Z4EA 3KKFA 2PMHA 4OHXA 2F5GA 4CGHA 1HJOA 1S97A 2PYLA 5G0RA 1FI4A 3C2PA 1Z6RA 3MFHA 1TP7A 2A42A 4BDZA 2ASOA 3O8MA 1KQSR 3OVAA 2GNKA 2R4FA 4DXLA 4DV7J 5AQIA 1YTYA 3FZ2A 5J2NA 3NAEA 5J2MB 4WF9Q 4IFVB 4CJQA 5C2GA 4F2SA 3JSRA 3AA2A 3N9UC 1RAIB 2KI2A 3OVBA 5DM7L 3CCRS 1OO0B 1N6QA 1BXNA 4LBPA 1SJRA 2VZ9A 3UNGC 4FYYB 1QSYA 2SXLA 3NS7B 4B8AB 2QMXA 5EDWA 3AGKA 1VK8A 1S7HA 2D9PA 4KH1B 3O8WA 3G2XA 2QT7A 3SQ0A 4CO0A 2E2QA 4I9LA 2RF2A 4DS5A 1RDRA 2A3ZA 1VJWA 3CMQA 1WC3A 3UN2A 1R0AB 3K2PA 4R0EA 3D28A 2IBOA 4RNNA 1S1WB 3E8OA 1NH7A 1SPBP 5AQOA 4LREA 2DR7A 4ZHRA 2APOA 4Y28C 2XG8A 4AHRA 1PIEA 3M1VA 2CVIA 2OPSA 1KLNA 1RWNB 3NGUA 2K7JA 1IKYA 4QIWD 4K8RA 2CJ9A 3CCVS 2ZBQA 4QAGA 2LP4A 1CJVA 3M3ZA 4CGJA 3KUEA 5ETMA 3BN4A 2R7RA 4BQLA 2RQKA 1XC3A 2JGUA 1VC5A 4LF9F 5FLXU 3W2VA 4E8UA 4DQSA 3E1YA 4JI2K 4DV2F 1VQNS 4C8NA 1XI1A 2ZHAA 5JLHA 3W2WB 5I42A 3Q86A 1S49A 4LBHA 2FGCA 3U7JA 3CC4N 4DV4F 4UOGA 4FWLA 4FWRA 2NYHA 4U95A 4ZP6A 2Z1GA 4E89A 2ITGA 4LIRA 4P9SA 3F2KA 4C8MA 1BWVA 1L3SA 3Q2SC 5LSOA 1AFIA 4BRCA 2XM3A 2EPIA 3QFHA 3V1RA 4D3HA 1SJ3P 5BR8J 2BVZA 3QLHB 1WC4A 4U67Q 2ERRA 2AYEA 1CJUA 1WDTA 5HMXA 2M9KA 3NF6A 3ZT0A 2PMZD 4DQRA 4MFBB 3FZKA 3TAMB 3HOTA 1G3OA 4BR4A 2ITMA 2R2RA 3O9TA 5LJWA 4WFNL 4OJGA 4U6PA 3DLKB 3AB4B 1DTQA 3FFIB 5KGWA 3C15A 2A6AA 4DR1J 4BACA 4YHHF 2M88A 1MWYA 4DV5J 3AVCA 3CC7N 2XCPA 4DHVA 1RAJA 3L8BA 3WXJA 2D69A 2BBEA 2FZCB 2JWKA 3DLEA 2YNHA 3AO4A 3PR5B 2W9BA 2CQGA 4V1Ak 4CJRA 4DMNA 3AVAA 3MPVA 4LY7A 1XHZA 3VGSA 1U49A 3QINA 3N28A 5AQSA 1I6JA 2WTUA 2NXEA 3SEOA 5M1OA 3TVKA 6AT1B 4F3TA 2QLFB 1R3NA 3HFZB 4K25A 2E5IA 3CCES 1WDDA 2YKQA 4RNHA 5CYMA 3EVMA 5KFDA 3QO9B 4GC7A 1HW8A 3HHLB 1VLOA 1CQMA 2P9UB 2BANA 2B8PA 4TVAB 3TQ1A 1A7GE 2B4OA 4ERDA 2CJXB 5A8WB 2XMMA 4OX9J 2YCHA 5FLXO 3V6KA 1N4LA 4PWDB 2A0FB 4IR1A 3HD2A 5KFCA 1D9AA 5KFZA 1PAUB 1RWOB 3MM7A 1RTIA 1CXQA 1J53A 3AHPA 4IH5A 4M95A 5F8GA 4OJRA 4PZVA 3UPFA 3F44A 1BO5O 1B3TA 2CNKB 3ZTRA 2UUTA 4BWJA 2BKNA 3QICA 4C3LA 2VOOA 3CD0A 2MGZA 4Y2AA 5F0UA 3RSEB 2AF6A 1OWXA 3ULEB 5I3UB 3HCXA 4GV6A 2XY5A 2GO9A 1QQCA 1SQGA 4P75A 3P8BB 2E44A 4TY8B 4RCHA 2ZJRL 4EO6A 5LXRA 1CULA 4BC2A 5DRKA 3MEKA 3NEKA 4ISEA 3DXMA 1DZ5A 4YNQA 1VSHA 3OD2A 3MAQA 4ZS6A 3L4QA 2C3MA 2IM2A 1CBKA 2JEFA 2OSRA 2NQPA 3MCPA 3OR1B 4AM7A 2PAVA 2IY5B 4JV1A 4A5BA 3KTQA 5HN0A 3RBEA 1FXRA 2D1KA 3HLUA 2GW8A 2BEFA 2C3YA 4JBCA 3GPAA 2FSKA 2UXDJ 3KDOA 2ZEJA 3DLGA 4FF4A 2E7VA 4YB5A 2H1YA 2QLBB 4WYLA 2UVRA 2R42A 2YWHA 2JFKA 3MM5B 1P8GA 3CC4S 3UD5A 4CRJA 2RSQA 2ALYB 2PGCA 3VERA 4PHTX 3JTNA 2ZBCA 1GLLO 4FLZA 3CDUA 2F7TA 2DGVA 3M2UA 1GK8A 9RUBA 5BRDA 2BQUA 5DMRA 3DJCA 2KYXA 5H1SV 2W9BB 2X1AA 3H6EA 3O2IA 5E3QA 5A0YB 1F5CA 2CQ4A 1OH5A 4CLWA 4ZPDA 4O55A 3G8SA 2ZOGA 2DEJA 4AT1B 3HM8A 2R2UA 2CQ2A 1D8ZA 5IQ6A 2Y9HA 4BRLA 5CE3A 3GE9A 4JLHA 3CCRN 1IBLF 1CJKA 5KT4A 3Q89A 2JVOA 2A1RA 2KXNB 1S5JA 3OBWA 3EKSA 1SL2A 8ATCB 5EGYA 4TXSA 5KFTA 1B92A 2MHEA 3W63A 3DXKB 2HAFA 1F3VA 5IT0A 4QQBA 1FJGF 1TELA 1H2UX 5KTQA 2K2PA 4W92B 3K7RA 1IG9A 3AVMA 4X64J 4FZVA 2DYAA 4FF3A 4WK3A 2UP1A 4CNZA 4DV7K 2ZGZA 3PYDA 1BQMA 3HFKA 2HQ3A 4ID5A 2IDEA 3THWB 4JKCA 2GO8A 4OI6A 1RBUA 3W5XA 4ETXA 3D67A 1WN7A 2UXCK 1U1NA 1O5JA 5KT5A 2F9WA 2AD9A 4CEEA 3V81A 5DGBA 3SI6A 2A5XA 2P6SA 5CQGA 2A1BA 2ZVIA 1QY7A 4DQ8A 5KFAA 2NPFA 5D78A 1WNEA 1NKEA 3VF6A 3QGPA 1O0PA 4MTPA 4DV6F 3LGHA 5GIPA 3RMBA 2R2TA 3NF8A 1RTIB 2JLEA 2OPRB 5AQMA 2N4CA 2PA3A 1TAQA 2Q0UA 3ITHA 4ZCIA 3UKUB 2B7BB 2JDJA 4KHRA 2IJNA 1LWFB 2OI2A 1LFWA 3HVWA 4TQSA 2UVUA 1SJ1A 4RWWA 5KG2A 5K8NA 2O8BA 2B7CB 4I6AA 4Y0FA 3BR9A 1VYAA 1YIJS 4LF8K 2ATQA 5I3UA 4U7UD 2V63A 3M32B 3AAQA 2XMJA 4MLHA 1JLGA 5CAAA 1S1XA 2DK2A 2HBKA 1UPMB 3R5DA 1TKDA 2RPIA 5M1QA 1W0HA 1NHVA 1D5AA 5AQUA 2DNNA 4YS2A 3OTOK 3MEEA 3CERA 1BQNB 3JTPA 3ULDA 3DKDA 3VALA 2HS4A 5GAEU 2B5JB 3SCKE 1UWBB 4DL5A 4OYWA 3OYIA 2WRMA 4IG0B 1T7PA 1WD6A 1WC5A 1HA1A 1RDCA 3TU5A 4DV0K 2DRDA 1WF0A 5HLFB 4ZCLA 3A8YA 3ETOA 1PYTA 3US5A 3R3TA 2XHBA 3L2WA 2KZMA 2QKBA 3PIPL 1VSIA 2KVQE 3DXBA 4X64K 4QS9A 2W6LA 8AT1B 4J9NA 5T7BA 3H46O 1VSJA 3NNCA 2G8UA 3DLEB 1U24A 2AJ1A 4RNOA 4IO9Q 2G0IA 3A1YG 1WHWA 4JKAA 1YJ9N 2E5LF 4DQPA 4BC7A 4F67A 1SH2A 2YI1A 4O4RA 4XDCA 4JK7A 3PM9A 4DR5K 4PG4A 1Q9XA 4KHUA 2XYHB 4P7TA 3TZXA 2VOPA 2UXDK 5ELZA 5CR4A 3D6MB 2W01A 3ILJA 5FPMA 2DHGA 3S8SA 1GOAA 3WBZA 3ZZRA 3HP6A 2YNGB 3SQ1A 1DAXA 2W25A 2L48A 4DOZA 3KUHA 5AQHA 4E1NA 2VFRA 3M7VA 3PHEA 1SC6A 2A3JA 1JCEA 4UUXA 3SMZA 2AGPA 4WTYA 4PXEA 4YR3A 1HNIB 3QO9A 4OYOA 3LP1B 1N52B 4CO4A 4FF2A 1IWGA 3IR7B 4Q2LA 3H90A 4KHMA 3OLBA 4GV3A 2QWOA 1IBMF 3GB0A 2B9EA 5BPMA 3BYPA 1WACA 1YJWS 3FQLA 3MMBB 4NLXA 4LRFA 3L7UA 1PYOB 3ZSRA 3CJ4A 2GVDA 3VVUA 2E2NA 4QPTA 4DQIA 2J0SD 2IA0A 4H0XB 1ITGA 3A5MC 2FLNA 1X5OA 1D0EA 4ZN1A 4DUZF 4CLKA 1IBLK 4QYZK 3E01B 4LF8J 1DURA 2RE2A 1HLWA 4DEZA 5HRNA 4DSIA 3K5OA 4XH4A 2R8GA 1EP4A 3CMES 3FC9A 1Q86O 1SKWA 3NMAA 4MK9A 3HVTA 2FHJD 2AP1A 4XDDA 3W65A 2BTFA 1KONA 2LFVA 3CDWA 4CZIA 1BUXA 4KBOA 3KNAA 3FRYA 2BANB 1F60B 2KFZA 4CERA 1C2PA 4J7CA 4OHVA 2FHOB 3PW7A 4YQWA 4KTZA 2GQQA 2YKOA 2G2YA 3OFFA 1C0GA 2HNZA 3LWLA 4MO5A 3GONA 1IR1A 1WTBA 1U1MA 1RGVA 5DDQC 1VSDA 3TQEA 1M5PC 1NO8A 3ZT3A 2VC1A 2PI4A 2IRXA 2KHDA 3HBTA 2CQPA 4PKHA 5C15A 3NP5A 4A8FA 3AD8C 2VBXA 3C95A 3O3FA 2PY5A 2DPIA 3NBPB 4NX9A 4PWWA 3V9UA 5HP1A 1Q4RA 1XR7A 2QLWA 5KFQA 1H74A 3R6MA 2QW9A 2MKCA 3ZFVA 2HGNA 3ASMA 1MROA 4G1IA 1AYEA 5GADP 3W60A 1M5KC 3G8QA 1RWMB 3OT9A 3TJAA 4LFBK 1EQMA 2M2BA 3V6DA 4KTWA 4NZ6A 2EBGA 2OEMA 2MJNA 2YPZA 4DF8A 4JI0K 1RCXB 4M7YA 1NPPA 5D0HA 1K9MO 1FNOA 3UVJA 3I9V9 3MCMA 1BWEA 1NJIT 2HNZB 4BDPA 1HQEA 3S1TA 4MK7A 3WX8A 4IEIA 2CPXA 2NZ4A 4AHSA 1GMUA 3PDNA 1JLCB 2DH7A 4IR9A 1MWKA 2Y0BB 4K4TA 1RT5A 2GQCA 1GLCG 3IWXA 4M3WA 4AILC 2YH0A 2IRYA 3C6UB 1CEZA 3V9SA 1S1UA 3M6WA 1N34J 3MM8A 2XS2A 3MM6A 3CCLS 1KTQA 1F21A 1YJNN 1S9FA 3E51A 3B78A 3W2VB 3TZYA 2QM1A 4LFCK 3TJ8A 1RWPB 1HL6A 3UDVA 3HD1A 4K42A 4JB8B 3R9LA