2HO0A

Structure of a hyper-cleavable monomeric fragment of phage lambda repressor containing the cleavage site region
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
132
structure length
128
Chain Sequence
SHMYEYPVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTTPTSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSVVGKVIASQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Hyper-cleavable Monomeric Fragment of Phage lambda Repressor Containing the Cleavage Site Region.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Viral protein
molecule keywords Repressor protein cI101-229DM-K192A
total genus 21
structure length 128
sequence length 132
ec nomenclature
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 2ho0A00
1B12A 1F39A 4NV4A 1JHHA 3K2ZA 1JHEA 1AY9A 1JHCA 4ME8A 3IIQA 3BDNA 3S04A 1KN9A 1UMUA 2HO0A 1I4VA 3JSOA 2FKDA 4N31A 4K8WA 1JHFA 2FJRA 3JSPA 2HNFA 1T7DA 1KCAA
chains in the Genus database with same CATH superfamily
1B12A 1F39A 4NV4A 1JHHA 3K2ZA 1JHEA 1AY9A 1JHCA 4ME8A 3IIQA 3BDNA 3S04A 1KN9A 1UMUA 2HO0A 1I4VA 3JSOA 2FKDA 4N31A 4K8WA 1JHFA 2FJRA 3JSPA 2HNFA 1T7DA 1KCAA
chains in the Genus database with same CATH topology
1B12A 1F39A 4NV4A 1JHHA 3K2ZA 1JHEA 1AY9A 1JHCA 4ME8A 3IIQA 3BDNA 3S04A 1KN9A 1UMUA 2HO0A 1I4VA 3JSOA 2FKDA 4N31A 4K8WA 1JHFA 2FJRA 3JSPA 2HNFA 1T7DA 1KCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B12 A;  1F39 A;  4NV4 A;  1JHH A;  3K2Z A;  1JHE A;  1AY9 A;  1JHC A;  4ME8 A;  3IIQ A;  3BDN A;  3S04 A;  1KN9 A;  1UMU A;  2HO0 A;  1I4V A;  3JSO A;  2FKD A;  4N31 A;  4K8W A;  1JHF A;  2FJR A;  3JSP A;  2HNF A;  1T7D A;  1KCA A; 
#chains in the Genus database with same CATH topology
 1B12 A;  1F39 A;  4NV4 A;  1JHH A;  3K2Z A;  1JHE A;  1AY9 A;  1JHC A;  4ME8 A;  3IIQ A;  3BDN A;  3S04 A;  1KN9 A;  1UMU A;  2HO0 A;  1I4V A;  3JSO A;  2FKD A;  4N31 A;  4K8W A;  1JHF A;  2FJR A;  3JSP A;  2HNF A;  1T7D A;  1KCA A; 
#chains in the Genus database with same CATH homology
 1B12 A;  1F39 A;  4NV4 A;  1JHH A;  3K2Z A;  1JHE A;  1AY9 A;  1JHC A;  4ME8 A;  3IIQ A;  3BDN A;  3S04 A;  1KN9 A;  1UMU A;  2HO0 A;  1I4V A;  3JSO A;  2FKD A;  4N31 A;  4K8W A;  1JHF A;  2FJR A;  3JSP A;  2HNF A;  1T7D A;  1KCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...