2HODB

Crystal structure of fragment d from human fibrinogen complexed with gly-hydroxypro-arg-pro-amide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
307
structure length
307
Chain Sequence
b'LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
molecule tags Blood clotting/peptide
total genus 59
structure length 307
sequence length 307
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2006-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hodB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2hodB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2hodB03
1RE4C 1RE3B 1RE3A 3E1IB 3E1IA 2XNXB 1LTJB 2XNXA 2J3FD 1FZGA 2Z4EC 1RE4A 1JC9A 1FZBC 4EPUA 2HPCC 2Z4EB 2Z4EA 2J0GA 1T3UA 2HODC 1JY3N 3H32B 2FFDB 2J61A 3H32A 2FFDA 2HPCA 4M7FA 2A45G 3E1IC 1JY3P 1FZCC 1LTJC 2JHHC 1N86C 2HODB 1RF0B 2HODA 1FZFB 1FZFA 2OYIC 1FZCB 1FZCA 1FZAB 4JZCA 1LTJA 1N86B 1N86A 2D39A 2J64A 1JY2O 2A45H 2OYIB 2OYIA 3H32C 2FFDC 2OYHB 1FZEB 2OYHA 2J0YA 1RF0C 1FZFC 2Q9IB 2JHKF 2J3FA 2J1GA 1N73B 1N73A 1RF1B 1LWUB 2HLOB 1LWUA 1LT9B 1FZAC 2J0HA 2JHMF 1RF0A 2J3GA 3GHGB 1FIBA 1FIDA 1FZAA 4ZFGA 2OYHC 1FZEC 2J3UA 1JY3O 1FICA 4M7HA 2GY7A 4R9TA 2Q9IC 3BVHB 2A45I 1N73C 2JHIF 1Z3UA 1JY2N 1FZEA 1LWUC 1RF1C 2HLOC 1M1JC 2FIBA 1LT9C 1JY2P 4JYOX 4NYTA 2Q9IA 2WNPF 1RF1A 1M1JB 2HLOA 1M1JA 3GHGC 2J3OA 1LT9A 1FZGB 2H43B 2H43A 4R9JA 1RE4B 3FIBA 3BVHC 2J60A 3GHGA 1FZDA 1FZBB 3HUSC 3BVHA 1FZBA 2J61B 1Z3SA 2HPCB 1RE3C 2JHLF 2J2PA 2XNXC 1W2EA 1FZGC 2H43C 3HUSB 3HUSA 2J5ZA
chains in the Genus database with same CATH superfamily
4D6TJ 4D6TE 2ZJSE 5CJ0A 1U57A 2OYOA 4H0LB 3KXDA 3CMEP 1OXZA 2WSSH 2OGUA 1KILA 3VYIA 3M0DA 1L2PA 2HODB 1RF0B 1FZFA 2E75D 1LTJA 1PL5A 2XNDH 2KS1B 2PFXA 4PJ0H 2J64A 2O1KA 2LR2A 1SQXK 1IFNA 2GA1A 4KJMA 2W90A 2J1GA 1PIXA 2PP6A 2D2CC 2XV5A 3AEBC 1Z56A 2JHMF 3B8EB 1M56D 5TISH 5AVYB 1SFCB 3Q1MA 1JCCA 3O6QB 4LGDE 1H0TB 2QIWA 1NU1J 1NU1E 3CXHI 3GG2A 1J2JB 1G1IA 3GF3A 2SPZA 3AE2C 2FKWB 1AQTA 2IBZE 2XU6A 2AXCA 3CCLP 1NU1D 1SQPG 1KV4A 2KLVA 4C46A 3V6IA 4K3AA 1FZGB 2H43A 3KHUA 1S5LE 1YQ4C 1FDMA 2YO3A 2UWJE 4W80A 1LTSC 2E74B 2Q6QA 3PLNA 3L73G 5KAFE 1W2EA 2V7QH 1NAFA 3MUDC 3H1LG 1WT6A 3C1LA 3V5BA 1S72P 3FWNA 3FXDA 2HPCC 1EQ7A 1S4XA 3H1HG 3AE7C 1M8OB 2HODA 1J1DC 4OWFA 3Q5PA 1USEA 3TNUA 3I56P 2KS1A 2Y0CA 1JY2O 3GF7A 2ZYGA 4AYCA 1FZEB 2NPSD 2J3FA 3CCRP 3RL0g 3D71A 2KB7P 3CX5H 1KFNA 4I7ZC 1SFCA 1FZAA 3H1JE 3CCUP 5KAIE 2Q5UA 3G4SP 3CWBJ 3CWBE 1MZ9A 2B88A 5AW7B 4WWIA 5EFWB 1FOSE 1VQ8P 1ZXGA 1BGYE 5B66H 2JJLA 2OTKE 3KYQA 2WPSA 2HR3A 3LW5H 3ITKA 3G9RA 2WITA 2IZ1A 4PD4E 3FWLA 2IX7C 3MZWB 3B5NB 2QJYC 1SQPJ 1SQPE 1ZRTE 1SQVG 3V4QA 1T3UA 2QM7A 3C8VA 4IFFA 3AE1C 2O1JA 1JY3P 3CD6P 3ABVC 4Y99B 1GD2E 1SQPD 2K9YA 5APWA 1LNQA 1PV3A 1X9VA 3AE5C 3L4FA 1WMKA 3L73J 3L73E 2ITAA 2IFMA 2W27A 3AE6C 3AE8C 1NJIQ 1S3JA 3CCSP 3H1LJ 3H1LE 1Q81Q 2OYHB 3GW6A 1DEEG 3M91A 4EI2A 1FZFC 3L73D 1LWUB 5AVTB 3LIEA 3H1LD 2HG5D 3MGNA 3JSVC 3D6ZA 3H1HJ 3VN0A 1PZQA 2D2CB 2H7HA 5APVA 5CBOA 1USDA 3M9HA 5KTBA 3RK3C 2Q7CA 2GM4A 3H1HD 3QWOC 1L4AC 4JYOX 3USSA 3HD7B 1GW4A 3WU2H 3S1KA 4RO0A 1S9KD 2XZRA 1M90Q 2RN0A 4A7PA 2YKOA 1YHQP 5APSA 2YMKA 4C7NA 3CI9A 5GTIE 3F5HA 3CC4P 4UB8H 1IK7A 2H43C 1DEBA 1AA0A 3TGUG 3T97B 4GIFA 2R44A 3RL0B 5CCHD 1HGZA 5H2FH 1KN7A 4JBZA 5APQA 2GUSA 3RK2B 1YIJP 2L5GB 5APTA 1VQ6P 1EXJA 2FXOA 3HRNA 3L71G 3MD0A 2QSIA 3A2AA 3QH9A 3SFEC 3RBXA 2OYHA 1ZR2A 1VQOP 4U3FE 1EZVI 1RF0C 1SQQG 2IYPA 1VQNP 2AXTE 1RF1B 1LWUA 5AVSB 1SQVJ 4RJTA 1DH3A 1LTBC 3G3ZA 1PGPA 1U7JA 2A06G 3U1AA 2KZIA 1QEXA 2WWWA 3BVHB 4R9TA 1KILE 1SQVD 1Z3UA 2N9BA 3AEGC 4H13C 2FYUG 1SFCC 3HD7A 2KYVA 2M5AB 1EDKA 1RY3A 1RQUA 2K37A 4GOFA 3P8CE 2BCCG 4NPDA 3TF5A 1P84H 3HE5A 1FZBB 1VQLP 3G71P 1RE3C 3D70A 3P8CD 1ZR4A 4DZOA 1FZGC 3E1RA 1A02J 2NRGA 3R2PA 2KLUA 3MP7B 1LP1B 5KKZB 2E43A 4JYBA 3MUDA 3FXEA 2E74C 1NOHA 2Y9YA 1YBKA 2POHA 1IFPA 2R3CA 2HPCA 1BCCG 1UIXA 4O9BA 4BRYA 1OZHA 3L75E 2W8ZA 1JNMA 1FDIA 2WT7B 2K1AA 2H88C 4JPZB 1H8AA 3TGUJ 3TGUE 1NTZG 4I2LC 1CI6B 3L70J 3L70E 4EIJA 2WPRA 3V2QA 1SQBG 1AJYA 2E5TA 3RBZA 1YTZT 4PD4H 2BASA 1KB9E 3TGUD 4I6MC 3PP5A 1QVFO 3IAOA 1FZEC 3WUUA 3L71J 2JWAA 1FICA 4H0LD 1NTKE 1KB9D 3VMAA 5AVZB 1G1JA 1M1JC 3CXHD 3AE9C 1H88A 3P8MC 4ZMDA 3M9QA 1IZNB 3L71D 2JR8A 2O3JA 2M5AA 4TLFA 1ZLLA 1SQQJ 1SQQE 3FIBA 1NTMK 1GL2B 4YXWH 1KC8Q 1MFZA 1FZBA 3N7NA 1BDDA 1N8RQ 1SQQD 3PHLA 1UIIA 1HF9A 2J3FD 2N1TC 2FYUJ 2FYUE 2HFED 2A06D 3EFGA 2K3RA 1SFCD 1FJKA 1JB0J 2FFDB 2ZAEB 1DD4A 2FYUD 4K35A 2BCCJ 3NMDA 2JHHC 4IL6H 1EC5A 1GK6A 1KYOI 3B5NC 5AVVB 1OVVA 1K05A 2R3SA 2BCCD 5KJ7C 2KNCB 1K8AQ 1IK9A 4Y99C 4KHXA 3CCEP 1OVUA 1N2DC 1CI6A 5AW5B 3AEEC 2HLOB 2Q3IA 2J0HA 2YXRB 2ZXEB 4GDOA 3AE3C 5L8RJ 2J3GA 2M8RA 1FIDA 1BCCJ 1R5SA 2OYHC 4L73A 3N4XA 3OW2O 5KLVK 2WSCH 4EDFA 1PGQA 1E79H 5M1BA 2HYNA 1LWUC 3CC7P 1BCCD 3M9BA 2O01H 2WNPF 4H13B 1L4AA 3V2NA 2PAJA 1NTZJ 1NTZE 2QEXP 2ZT9B 2ZVOB 3EQ2A 1GL2A 3CX5I 1SQBJ 1SQBE 3JCUE 1PGOA 5AVWB 3U59A 2OARA 1HGVA 3TK1A 1NTZD 3HD7C 5APYA 2JHLF 3L74G 5DJUB 5AW6B 1SQBD 1PP9G 1EZVG 1IFDA 1RE3B 4PV1D 2WPVB 1FBMA 4YXDC 4N6JA 2IYOA 1SS1A 2QVAA 2WSFH 1N7LA 3IF4A 1JMMA 2FFDA 3II6A 3KDPB 3SFDC 1GU4A 1N86C 4LLHA 1KYOH 1G2CB 3RL0C 1NKZB 2OYIC 3Q5SA 5GTHE 3NXSA 1Y9BA 4R4MA 2W6AA 1HH0A 3RK2C 2IFNA 4ZKPA 1TU3F 2KNCA 1Y47A 3B71A 3TYYA 2AEJA 2E75B 4Y28J 3MHVA 3UIAA 1K73Q 5AW0B 3F89A 1RF0A 1LGHB 4UB6E 1OMIA 3K5BA 4M7HA 2JDIH 3H25A 1RF1C 1OW7A 1JY2P 2Q3EA 4XE5B 5AVQB 1M1JB 1T2KC 5KJ7D 2WSEJ 1RE4B 1GK4A 3BVHC 3O6QA 1H0TA 1SLQA 3OJAB 1L0NK 1MKMA 1RE3A 2IPPA 1ZMEC 1FZGA 2PRRA 1FZBC 1NTKK 4EPUA 2N1TB 3V2RA 1VDFA 1L0LK 2D2CD 2BEZF 3L37A 1QGKB 4H44C 5KKZC 3VP9A 1HJBA 3V4WA 1G2CA 1SQXG 1JM0A 1X22A 3SWFA 1VQ7P 5CBNA 5CHXA 3L74J 3HD7D 3L74E 3AEAC 4I1LA 2A45H 1PP9J 1PP9E 3TDKA 2IDBA 4L76A 1FE6A 3AEFC 5B5EH 1KQFB 2OTJP 1N73B 3A5TA 3L74D 3CCMP 1LT9B 1PP9D 2IBZI 3A0HH 1EZVD 3P32A 2E76C 1KFMA 2I8DA 1N7SB 2NPSB 1JY3O 1OWAA 3VMZA 5E79E 1OW6A 2FXMA 1FZEA 2Y0DA 4BWNA 1QLED 3C9IA 4CPGA 5CJ4A 2FXPA 3RK2D 1M1JA 3G6EP 3H1HE 1JMBA 4ASVA 4IL6X 1NH4A 3BCCG 2QJKB 2J61B 1J1EB 2RMZA 2R5BA 3Q5RA 1S9KE 1Q90D 2IZ0A 1CSBA 1GL2C 1Q82Q 3W68A 1K9MQ 3VTPC 3VOPA 2QG4A 1NKNA 3KZIE 2N1TA 2I1JA 2KXPB 1JY3N 1P84I 1T2KD 1BE3G 4MN4C 1LTGC 1N86B 5AW8B 1NU1K 1VF5B 2B9BA 2OYIB 2WMMA 3B5NA 2FFDC 2YO2A 3M06A 4RESB 4DOJA 2Q9IB 5KJ7A 3I5CA 1N73A 1H89A 5CCGC 3KQGA 5AW9B 1RH5B 1N7SA 4PJ0E 1S5LH 2J3UA 2JO1A 1OFCX 1SQXJ 1SQXE 3A0BE 3PTZA 2HLOC 2FIBA 5KAFH 4WVZA 2WVRA 1SQVE 1SQXD 4PD4I 1ZP0C 1FC2C 1GZLA 1GU5A 4WB4A 4BXLA 3CCVP 1BSNA 1KZUB 3VMYA 3AE4C 3TSIA 3E7KA 1URQB 2ZT9C 2JEEA 3SWYA 3NTNA 4UB6H 3CCQP 4WY4C 3SWKA 4HB1A 1AFOA 1OVRA 1JTHB 2G8YA 1IJDB 2K9JB 3PRJA 5AW1B 1BSHA 3L72G 3H32B 2V7QJ 1MFTA 4HYTB 3RK3E 4GT1A 3I55P 1EDIA 1X0TA 3BCCJ 4R4LA 4H44B 1X79B 3S4RA 4DJGA 2JP3A 2Y0EA 1N86A 3H1KG 3T97A 3CCJP 1FDOA 1LTIC 3RK3D 4D6TG 1LTTC 1L4AD 2GUVA 3HTKB 2OYIA 1K04A 3BCCD 1HVVA 5KAIH 1GL2D 1OX3A 1YI2P 2B87B 2JHKF 4GODA 5APXA 4DT0A 4OGQB 4ZKUA 4HH2A 1CW5A 2I1KA 5AW3B 1BE3J 1BE3E 3GHGB 1KQSO 4EOTA 2E76B 2E75C 2PGDA 2QRXA 2YIUB 1BE3D 1R8EA 1VQ4P 1YITP 1RF1A 3CXHE 1IO4A 4OVNF 2KP8A 2J59M 2AEMA 1SQPK 2KZJA 2ZYAA 4RKUJ 3L71E 4GOEA 1KILB 3CX5D 3HUSC 3BVHA 1OW8A 3WUVA 3BRVB 2J2PA 2OTLP 1DX7A 3OAKA 1URQA 1RE4C 2LKMA 3P7KA 3E1IB 1LTJB 2FBWC 1VQMP 2Z4EC 1KMIZ 2IBZG 1NO4A 1VQ5P 4XFJA 2J0GA 3LW5J 3H32A 1GTWA 4M7FA 2M0BA 2A06E 1CZQA 1MV8A 2FYNB 2ZYDA 3M0AA 1PGJA 2B89A 4HKZH 3VMXA 1LP1A 4QMAA 1Q2NA 1DIPA 1SVFA 2C0XA 4H13D 2MKVA 1M57D 2B87A 4AQRD 3EFFK 2BCCE 4OH8B 1JCDA 1PFIA 3L72J 3L72E 2JKVA 2YKPA 1NAYA 2WT7A 3CL3D 3KZIH 2WZ7A 1HTLC 1N73C 2Z5IA 3L72D 3AEDC 3EWKA 1YTZI 1LT9C 3IN6A 3H1KJ 3H1KE 5GTIH 4L74A 1NGMB 1D7MA 1N7SC 2L91A 2NPSC 2E74D 2NZ2A 5AW2B 3H1KD 1BCCE 3GMAA 4D6TD 2ZXXA 3S9OA 3A7OA 1SP4A 3Q3DA 1EDJA 2MJZA 3H1JG 2E42A 4WBAA 3W67A 3WU2E 3E1IA 1JEKA 3TNUB 1WRGA 3CWBG 2QJKC 1JC9A 1J1EC 2H89C 1W2BO 4WY4B 1VQ9P 3A0BH 4UB8E 1S5LX 1BGYG 5APUA 1FZCC 1KD1Q 1R5LA 2AXTH 1SQVK 2Z5HA 1FZAB 5H2FE 1KB9I 2QJPB 1BDCA 4NPFX 1M1KQ 2M3BA 1ZW0A 2J0YA 2CPSA 3Q2YA 1T8ZA 1VF5C 1E5WA 4LC1A 4Z1MH 2IBZD 4ZFGA 2R32A 2KIKA 2G3AA 5CCGA 1XTCC 2Q9IC 2A45I 2C9LY 1S2EA 1JO5A 2QE7H 4JF7A 3WMM0 2N1TD 1NTMG 3L35A 2HLOA 4TT3H 5K5GB 1HJ0A 3L36A 2YMYA 3PH0A 3KPEA 1AQ5A 1Z3SA 1X8YA 1DD3A 2XNXC 3B5ND 3HUSB 4ZNCA 3O8ZA 4YTPC 2ZFCA 4W7ZA 1P84E 2P7JA 2K88A 2Z4EB 2BEQD 4WY4A 1N7SD 4PV1B 1URQC 3AECC 1P84D 2H8PD 1ZV8A 1KB9H 5KLIC 3H1JJ 3CXHH 2RH0A 1KORA 1YJWP 3H32C 4DCKA 5CCHC 2FYZA 3MIWA 3H1JD 1RHZB 2XKMA 1GDTA 1IFIA 1FOSF 2M3EA 1NHLA 1SQQK 5KLVG 5AVRB 3CWBD 1BGYJ 4C7NB 1LT1A 1EZVE 3RGUA 1JY2N 1HWTC 2Q1KA 2R5DA 1BGYD 4OGQC 1AVYA 3GHGC 2KK7A 4U3FG 2FYUK 2YIUC 4U7JA 4PD4D 3LIDA 1PPJG 1VF5D 1NVOA 3RL0D 1EDLA 3H1IG 5DJTB 1HBWA 3HUSA 1ZRTD 3CMAP 3ZDMA 3V2PA 1RE4A 5AW4B 1KILC 1YYCA 3M0DC 1NTMJ 1NTME 2QA4P 2Z4EA 5C39A 3BATA 4HJGH 2KSJA 1KQLA 2LXBA 3E1IC 1LTJC 1NTMD 2P58A 3VP8A 1FZCB 2E5YA 1HUCA 4JZCA 2WPQA 3H6PA 1XTGB 2J5UA 1YQ3C 2FYNC 4XA4A 4IL6E 2P1JA 1MUUA 1NTZK 2C9NY 1SQBK 1URQD 4C7RA 4IFMA 3HE5B 1T3JA 1VPCA 3JCUH 3L75G 1FJPA 2KI7B 1LJ2A 2JHIF 5AVUB 4NYTA 3CLQA 1Q86Q 1LT9A 3PJSK 4YPCA 4GKGA 2KOGA 3L70G 2NPSA 4NPEA 1L0NG 2WSCJ 1VQPP 3FX0A 4H44D 5KLVJ 5KLVE 4W7YA 3SSUA 1IFMA 1FAVA 2KUBA 2WTYA 2HPCB 2O01J 4BRYB 4H0LC 2RKLA 2J5ZA 1NTKG 5KLVD 2XNXB 5TISE 1QX8A 1L0LG 1J1DB 5GTHH 1IFJA 2P67A 2O01N 3U1CA 4IOIH 4OGQD 1JUNA 1FS0E 4U3FJ 2Y9ZA 2HODC 2V4HA 1JOCA 2J61A 2A45G 2E76D 4IFDK 2DW3A 1W5CE 1PPJE 1AV1A 4U3FD 2W83C 1FZCA 2LXCB 2D39A 2VRSA 3H1IJ 3H1IE 5AVXB 2WSFJ 4I7ZB 5KLIB 1QL2A 1PPJD 2ZVNB 1EXIA 1U7MA 2W6BA 3B4SA 3OA7A 4AUWA 3H1ID 4N78E 1KYOE 1NWQA 2WQYC 1FZAC 4N3YB 1KILD 4EYYQ 3BCCE 2QJPC 3BASA 2J58A 2WSEH 1GW3A 1FIBA 1VL2A 2N9YB 1IC2A 1KQGB 4N78D 1GMJA 1KYOD 3FGAD 3BRTB 3NFQA 1S1CX 2C0WA 3HE4B 4JYCA 2Q9IA 2CPBA 1A02F 3D6YA 1LTAC 2YNYA 2CK3H 4R9JA 1ZOYC 2AEFA 2QM8A 1FZDA 1QL1A 2QJYB 3A3YB 4L75A 3R4YA 3L75J 3CX5E 2XNXA 4KT0J 2KSEA 5BU8B 3GLMA 3L75D 4JQ0D 1YJ9P 5CCGD 1L0NJ 1L0NE 1NU1G 1FZFB 2P2UA 2JWDA 2FY8A 1T6AA 2YXQB 2P10A 1VQKP 1Y8AA 3L70D 5B66E 1YJNP 5BVZA 1L0ND 4PV1C 1JTHA 1NTKJ 5CMZA 2K9JA 5E79H 1M7LA 1L0LJ 1L0LE 1Q7YQ 1AVOA 5CCHA 3RK3B 1L4AB 1NTKD 5TJHA 1L0LD 3IR9A 4M3LA 2XDJA 2GY7A 3HTKA 3MTUE 5B5EE 2ZT9D 1KTMA 3HE4A 1OIPA 2OQQA 1NYHA 3CC2P 1QVGO 3A0HE 4WY4D 4B86A 2J3OA 3JC22 2H43B 2W6JH 5BU5A 1RQVA 3CPWO 2J60A 3GHGA 3IFMA 4ASWA 1FU1A 3WUTA 1ZN5A 2YKQA
chains in the Genus database with same CATH topology
1A02J 3O8ZA 1CSBA 1GL2C 3R2PA 5CJ0A 2ZFCA 2E43A 3VTPC 1OXZA 4JYBA 3VOPA 3MUDA 1NOHA 1NKNA 4W7ZA 2P7JA 2Z4EB 2N1TA 4WY4A 2I1JA 1N7SD 2POHA 1KILA 1JY3N 2R3CA 1URQC 3VYIA 3M0DA 1T2KD 2HPCA 4O9BA 1LTGC 2HODB 1RF0B 1FZFA 2H8PD 1ZV8A 1JNMA 1LTJA 1N86B 5AW8B 1NU1K 2WT7B 2J64A 2O1KA 2OYIB 3B5NA 1SQXK 1H8AA 2FFDC 3H32C 2YO2A 5CCHC 1IFNA 3M06A 4RESB 2FYZA 4DOJA 3MIWA 4I2LC 2Q9IB 5KJ7A 1CI6B 2J1GA 2XKMA 4EIJA 3I5CA 1N73A 2WPRA 1GDTA 1IFIA 3V2QA 2PP6A 2XV5A 1Z56A 1YTZT 1FOSF 2JHMF 3B8EB 2BASA 1NHLA 1H89A 5CCGC 1SQQK 3KQGA 5AW9B 4I6MC 3PP5A 5AVYB 5AVRB 1N7SA 1SFCB 1JCCA 4LGDE 1FZEC 2J3UA 4C7NB 1FICA 1J2JB 1G1IA 1JY2N 5AVZB 2HLOC 1HWTC 1G1JA 1M1JC 2FKWB 2FIBA 2R5DA 2XU6A 1H88A 3P8MC 3M9QA 3GHGC 2KLVA 4C46A 1FZGB 2FYUK 2H43A 1ZLLA 3FIBA 1NTMK 1FDMA 1GL2B 1GZLA 1GU5A 2YO3A 4WB4A 4W80A 3LIDA 1LTSC 1MFZA 1FZBA 3N7NA 1KZUB 3RL0D 3VMYA 1W2EA 3TSIA 1HBWA 3HUSA 1URQB 1NAFA 2JEEA 3SWYA 1WT6A 3NTNA 2J3FD 2N1TC 3V2PA 4WY4C 3V5BA 1RE4A 5AW4B 2HFED 1AFOA 1KILC 1YYCA 3M0DC 1JTHB 1IJDB 2HPCC 1EQ7A 3EFGA 2Z4EA 5AW1B 1SFCD 3BATA 1FJKA 3H32B 2FFDB 2KSJA 1KQLA 3E1IC 4HYTB 1LTJC 3NMDA 4GT1A 2JHHC 2HODA 3VP8A 1J1DC 1GK6A 3B5NC 1FZCB 1X79B 1HUCA 5AVVB 3TNUA 4JZCA 1N86A 3T97A 2WPQA 1LTIC 3RK3D 1JY2O 1LTTC 3H6PA 4AYCA 1L4AD 1XTGB 2GUVA 3HTKB 5KJ7C 2OYIA 1FZEB 1HVVA 1IK9A 2NPSD 4Y99C 1GL2D 4KHXA 2JHKF 2J3FA 1N2DC 1CI6A 5AW5B 4XA4A 2HLOB 5APXA 2Q3IA 2P1JA 2J0HA 1MUUA 1NTZK 2C9NY 2ZXEB 2KB7P 4ZKUA 4HH2A 1CW5A 2J3GA 2I1KA 1KFNA 5AW3B 2M8RA 1SFCA 3GHGB 1SQBK 1FIDA 1FZAA 2OYHC 1URQD 3N4XA 4EOTA 4C7RA 4IFMA 5KLVK 3HE5B 2WSCH 1T3JA 1VPCA 1FJPA 2HYNA 2JHIF 1LWUC 2Q5UA 5AVUB 1MZ9A 3M9BA 4NYTA 5AW7B 2O01H 2WNPF 3CLQA 1RF1A 1FOSE 1LT9A 1L4AA 3V2NA 2PAJA 4GKGA 2KOGA 3EQ2A 1IO4A 2KP8A 2J59M 2NPSA 1SQPK 1GL2A 2JJLA 3U59A 5AVWB 3KYQA 2OARA 2WPSA 1HGVA 3TK1A 1KILB 3HUSC 4W7YA 3BVHA 1IFMA 1FAVA 2HPCB 2WTYA 3HD7C 5APYA 2JHLF 3BRVB 3LW5H 2J2PA 2WITA 1DX7A 3OAKA 5AW6B 2J5ZA 1URQA 1RE4C 1IFDA 1RE3B 2LKMA 2IX7C 3P7KA 3E1IB 2XNXB 1LTJB 2Z4EC 1FBMA 1J1DB 1IFJA 1NO4A 2P67A 3B5NB 4N6JA 3U1CA 1JUNA 2WSFH 1N7LA 3V4QA 1T3UA 2J0GA 2QM7A 2HODC 4IFFA 1JMMA 1JOCA 2J61A 3H32A 2FFDA 2O1JA 1GTWA 3II6A 3KDPB 4M7FA 2A45G 1JY3P 1GU4A 1CZQA 4Y99B 4IFDK 1N86C 1MV8A 4LLHA 1GD2E 1G2CB 3M0AA 3RL0C 1NKZB 5APWA 2OYIC 1X9VA 3VMXA 3L4FA 1FZCA 3NXSA 2IFMA 2W27A 1SVFA 2D39A 2W6AA 1HH0A 2C0XA 2VRSA 3RK2C 2IFNA 5AVXB 4ZKPA 2OYHB 1QL2A 3TYYA 3M91A 1FZFC 2W6BA 3OA7A 4AUWA 4AQRD 1LWUB 4N78E 5AVTB 1NWQA 3UIAA 1FZAC 3LIEA 4OH8B 5AW0B 1JCDA 4N3YB 1KILD 1RF0A 2HG5D 3MGNA 1PFIA 1LGHB 3BASA 3VN0A 2YKPA 2J58A 2WSEH 2H7HA 1GW3A 5APVA 1FIBA 1IC2A 2WT7A 4N78D 3CL3D 3M9HA 4M7HA 2WZ7A 5KTBA 1HTLC 1N73C 3BRTB 2Z5IA 3NFQA 3RK3C 1RF1C 2Q7CA 2C0WA 2GM4A 1YTZI 1LT9C 3HE4B 1L4AC 1JY2P 4XE5B 4JYCA 4JYOX 2Q9IA 2CPBA 1A02F 1N7SC 5AVQB 3HD7B 1GW4A 1M1JB 2NPSC 1LTAC 1T2KC 2YNYA 5KJ7D 4R9JA 1RE4B 5AW2B 1S9KD 1GK4A 2XZRA 3BVHC 2YKOA 5APSA 1SLQA 2QM8A 4C7NA 1FZDA 1QL1A 1SP4A 3A7OA 3CI9A 2MJZA 3OJAB 1L0NK 3A3YB 2E42A 4WBAA 2H43C 1DEBA 1RE3A 3E1IA 2IPPA 3TNUB 2XNXA 1WRGA 4GIFA 1FZGA 3RL0B 5CCHD 1HGZA 1JC9A 1FZBC 1NTKK 5BU8B 4EPUA 1J1EC 2N1TB 4WY4B 3V2RA 5APQA 2GUSA 3RK2B 1VDFA 1L0LK 2L5GB 5APTA 5APUA 5CCGD 3L37A 1FZCC 1SQVK 3VP9A 1HJBA 1FZFB 3HRNA 3MD0A 2P2UA 3V4WA 1G2CA 2Z5HA 3A2AA 3SWFA 1FZAB 5CHXA 5BVZA 3HD7D 4I1LA 2A45H 1JTHA 2M3BA 5CMZA 2OYHA 1ZR2A 2J0YA 2CPSA 1RF0C 1M7LA 1N73B 5CCHA 3A5TA 3RK3B 1RF1B 1T8ZA 1LWUA 1LT9B 1L4AB 5AVSB 1E5WA 3P32A 1KFMA 1N7SB 4LC1A 2NPSB 1DH3A 1LTBC 4ZFGA 3G3ZA 2R32A 3IR9A 3U1AA 1JY3O 1OWAA 5CCGA 4M3LA 2XDJA 2WWWA 3VMZA 1XTCC 2Q9IC 2GY7A 4R9TA 3HTKA 3MTUE 2A45I 2FXMA 3BVHB 2C9LY 1Z3UA 1FZEA 2N9BA 1JO5A 3HE4A 4JF7A 3WMM0 2N1TD 3C9IA 4WY4D 5CJ4A 3L35A 1SFCC 3HD7A 2HLOA 3RK2D 1M1JA 2KYVA 4B86A 2J3OA 1RY3A 2H43B 5BU5A 2J60A 3P8CE 3GHGA 3IFMA 3L36A 2YMYA 1NH4A 3KPEA 3HE5A 1AQ5A 1FZBB 2J61B 1Z3SA 1J1EB 1X8YA 1FU1A 1RE3C 2R5BA 1S9KE 2XNXC 3B5ND 3P8CD 1ZR4A 4DZOA 1FZGC 1ZN5A 3HUSB 2YKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RE4 C;  1RE3 B;  1RE3 A;  3E1I B;  3E1I A;  2XNX B;  1LTJ B;  2XNX A;  2J3F D;  1FZG A;  2Z4E C;  1RE4 A;  1JC9 A;  1FZB C;  4EPU A;  2HPC C;  2Z4E B;  2Z4E A;  2J0G A;  1T3U A;  2HOD C;  1JY3 N;  3H32 B;  2FFD B;  2J61 A;  3H32 A;  2FFD A;  2HPC A;  4M7F A;  2A45 G;  3E1I C;  1JY3 P;  1FZC C;  1LTJ C;  2JHH C;  1N86 C;  2HOD B;  1RF0 B;  2HOD A;  1FZF B;  1FZF A;  2OYI C;  1FZC B;  1FZC A;  1FZA B;  4JZC A;  1LTJ A;  1N86 B;  1N86 A;  2D39 A;  2J64 A;  1JY2 O;  2A45 H;  2OYI B;  2OYI A;  3H32 C;  2FFD C;  2OYH B;  1FZE B;  2OYH A;  2J0Y A;  1RF0 C;  1FZF C;  2Q9I B;  2JHK F;  2J3F A;  2J1G A;  1N73 B;  1N73 A;  1RF1 B;  1LWU B;  2HLO B;  1LWU A;  1LT9 B;  1FZA C;  2J0H A;  2JHM F;  1RF0 A;  2J3G A;  3GHG B;  1FIB A;  1FID A;  1FZA A;  4ZFG A;  2OYH C;  1FZE C;  2J3U A;  1JY3 O;  1FIC A;  4M7H A;  2GY7 A;  4R9T A;  2Q9I C;  3BVH B;  2A45 I;  1N73 C;  2JHI F;  1Z3U A;  1JY2 N;  1FZE A;  1LWU C;  1RF1 C;  2HLO C;  1M1J C;  2FIB A;  1LT9 C;  1JY2 P;  4JYO X;  4NYT A;  2Q9I A;  2WNP F;  1RF1 A;  1M1J B;  2HLO A;  1M1J A;  3GHG C;  2J3O A;  1LT9 A;  1FZG B;  2H43 B;  2H43 A;  4R9J A;  1RE4 B;  3FIB A;  3BVH C;  2J60 A;  3GHG A;  1FZD A;  1FZB B;  3HUS C;  3BVH A;  1FZB A;  2J61 B;  1Z3S A;  2HPC B;  1RE3 C;  2JHL F;  2J2P A;  2XNX C;  1W2E A;  1FZG C;  2H43 C;  3HUS B;  3HUS A;  2J5Z A; 
#chains in the Genus database with same CATH topology
 4D6T J;  4D6T E;  2ZJS E;  5CJ0 A;  1U57 A;  2OYO A;  4H0L B;  3KXD A;  3CME P;  1OXZ A;  2WSS H;  2OGU A;  1KIL A;  3VYI A;  3M0D A;  1L2P A;  2HOD B;  1RF0 B;  1FZF A;  2E75 D;  1LTJ A;  1PL5 A;  2XND H;  2KS1 B;  2PFX A;  4PJ0 H;  2J64 A;  2O1K A;  2LR2 A;  1SQX K;  1IFN A;  2GA1 A;  4KJM A;  2W90 A;  2J1G A;  1PIX A;  2PP6 A;  2D2C C;  2XV5 A;  3AEB C;  1Z56 A;  2JHM F;  3B8E B;  1M56 D;  5TIS H;  5AVY B;  1SFC B;  3Q1M A;  1JCC A;  3O6Q B;  4LGD E;  1H0T B;  2QIW A;  1NU1 J;  1NU1 E;  3CXH I;  3GG2 A;  1J2J B;  1G1I A;  3GF3 A;  2SPZ A;  3AE2 C;  2FKW B;  1AQT A;  2IBZ E;  2XU6 A;  2AXC A;  3CCL P;  1NU1 D;  1SQP G;  1KV4 A;  2KLV A;  4C46 A;  3V6I A;  4K3A A;  1FZG B;  2H43 A;  3KHU A;  1S5L E;  1YQ4 C;  1FDM A;  2YO3 A;  2UWJ E;  4W80 A;  1LTS C;  2E74 B;  2Q6Q A;  3PLN A;  3L73 G;  5KAF E;  1W2E A;  2V7Q H;  1NAF A;  3MUD C;  3H1L G;  1WT6 A;  3C1L A;  3V5B A;  1S72 P;  3FWN A;  3FXD A;  2HPC C;  1EQ7 A;  1S4X A;  3H1H G;  3AE7 C;  1M8O B;  2HOD A;  1J1D C;  4OWF A;  3Q5P A;  1USE A;  3TNU A;  3I56 P;  2KS1 A;  2Y0C A;  1JY2 O;  3GF7 A;  2ZYG A;  4AYC A;  1FZE B;  2NPS D;  2J3F A;  3CCR P;  3RL0 g;  3D71 A;  2KB7 P;  3CX5 H;  1KFN A;  4I7Z C;  1SFC A;  1FZA A;  3H1J E;  3CCU P;  5KAI E;  2Q5U A;  3G4S P;  3CWB J;  3CWB E;  1MZ9 A;  2B88 A;  5AW7 B;  4WWI A;  5EFW B;  1FOS E;  1VQ8 P;  1ZXG A;  1BGY E;  5B66 H;  2JJL A;  2OTK E;  3KYQ A;  2WPS A;  2HR3 A;  3LW5 H;  3ITK A;  3G9R A;  2WIT A;  2IZ1 A;  4PD4 E;  3FWL A;  2IX7 C;  3MZW B;  3B5N B;  2QJY C;  1SQP J;  1SQP E;  1ZRT E;  1SQV G;  3V4Q A;  1T3U A;  2QM7 A;  3C8V A;  4IFF A;  3AE1 C;  2O1J A;  1JY3 P;  3CD6 P;  3ABV C;  4Y99 B;  1GD2 E;  1SQP D;  2K9Y A;  5APW A;  1LNQ A;  1PV3 A;  1X9V A;  3AE5 C;  3L4F A;  1WMK A;  3L73 J;  3L73 E;  2ITA A;  2IFM A;  2W27 A;  3AE6 C;  3AE8 C;  1NJI Q;  1S3J A;  3CCS P;  3H1L J;  3H1L E;  1Q81 Q;  2OYH B;  3GW6 A;  1DEE G;  3M91 A;  4EI2 A;  1FZF C;  3L73 D;  1LWU B;  5AVT B;  3LIE A;  3H1L D;  2HG5 D;  3MGN A;  3JSV C;  3D6Z A;  3H1H J;  3VN0 A;  1PZQ A;  2D2C B;  2H7H A;  5APV A;  5CBO A;  1USD A;  3M9H A;  5KTB A;  3RK3 C;  2Q7C A;  2GM4 A;  3H1H D;  3QWO C;  1L4A C;  4JYO X;  3USS A;  3HD7 B;  1GW4 A;  3WU2 H;  3S1K A;  4RO0 A;  1S9K D;  2XZR A;  1M90 Q;  2RN0 A;  4A7P A;  2YKO A;  1YHQ P;  5APS A;  2YMK A;  4C7N A;  3CI9 A;  5GTI E;  3F5H A;  3CC4 P;  4UB8 H;  1IK7 A;  2H43 C;  1DEB A;  1AA0 A;  3TGU G;  3T97 B;  4GIF A;  2R44 A;  3RL0 B;  5CCH D;  1HGZ A;  5H2F H;  1KN7 A;  4JBZ A;  5APQ A;  2GUS A;  3RK2 B;  1YIJ P;  2L5G B;  5APT A;  1VQ6 P;  1EXJ A;  2FXO A;  3HRN A;  3L71 G;  3MD0 A;  2QSI A;  3A2A A;  3QH9 A;  3SFE C;  3RBX A;  2OYH A;  1ZR2 A;  1VQO P;  4U3F E;  1EZV I;  1RF0 C;  1SQQ G;  2IYP A;  1VQN P;  2AXT E;  1RF1 B;  1LWU A;  5AVS B;  1SQV J;  4RJT A;  1DH3 A;  1LTB C;  3G3Z A;  1PGP A;  1U7J A;  2A06 G;  3U1A A;  2KZI A;  1QEX A;  2WWW A;  3BVH B;  4R9T A;  1KIL E;  1SQV D;  1Z3U A;  2N9B A;  3AEG C;  4H13 C;  2FYU G;  1SFC C;  3HD7 A;  2KYV A;  2M5A B;  1EDK A;  1RY3 A;  1RQU A;  2K37 A;  4GOF A;  3P8C E;  2BCC G;  4NPD A;  3TF5 A;  1P84 H;  3HE5 A;  1FZB B;  1VQL P;  3G71 P;  1RE3 C;  3D70 A;  3P8C D;  1ZR4 A;  4DZO A;  1FZG C;  3E1R A;  1A02 J;  2NRG A;  3R2P A;  2KLU A;  3MP7 B;  1LP1 B;  5KKZ B;  2E43 A;  4JYB A;  3MUD A;  3FXE A;  2E74 C;  1NOH A;  2Y9Y A;  1YBK A;  2POH A;  1IFP A;  2R3C A;  2HPC A;  1BCC G;  1UIX A;  4O9B A;  4BRY A;  1OZH A;  3L75 E;  2W8Z A;  1JNM A;  1FDI A;  2WT7 B;  2K1A A;  2H88 C;  4JPZ B;  1H8A A;  3TGU J;  3TGU E;  1NTZ G;  4I2L C;  1CI6 B;  3L70 J;  3L70 E;  4EIJ A;  2WPR A;  3V2Q A;  1SQB G;  1AJY A;  2E5T A;  3RBZ A;  1YTZ T;  4PD4 H;  2BAS A;  1KB9 E;  3TGU D;  4I6M C;  3PP5 A;  1QVF O;  3IAO A;  1FZE C;  3WUU A;  3L71 J;  2JWA A;  1FIC A;  4H0L D;  1NTK E;  1KB9 D;  3VMA A;  5AVZ B;  1G1J A;  1M1J C;  3CXH D;  3AE9 C;  1H88 A;  3P8M C;  4ZMD A;  3M9Q A;  1IZN B;  3L71 D;  2JR8 A;  2O3J A;  2M5A A;  4TLF A;  1ZLL A;  1SQQ J;  1SQQ E;  3FIB A;  1NTM K;  1GL2 B;  4YXW H;  1KC8 Q;  1MFZ A;  1FZB A;  3N7N A;  1BDD A;  1N8R Q;  1SQQ D;  3PHL A;  1UII A;  1HF9 A;  2J3F D;  2N1T C;  2FYU J;  2FYU E;  2HFE D;  2A06 D;  3EFG A;  2K3R A;  1SFC D;  1FJK A;  1JB0 J;  2FFD B;  2ZAE B;  1DD4 A;  2FYU D;  4K35 A;  2BCC J;  3NMD A;  2JHH C;  4IL6 H;  1EC5 A;  1GK6 A;  1KYO I;  3B5N C;  5AVV B;  1OVV A;  1K05 A;  2R3S A;  2BCC D;  5KJ7 C;  2KNC B;  1K8A Q;  1IK9 A;  4Y99 C;  4KHX A;  3CCE P;  1OVU A;  1N2D C;  1CI6 A;  5AW5 B;  3AEE C;  2HLO B;  2Q3I A;  2J0H A;  2YXR B;  2ZXE B;  4GDO A;  3AE3 C;  5L8R J;  2J3G A;  2M8R A;  1FID A;  1BCC J;  1R5S A;  2OYH C;  4L73 A;  3N4X A;  3OW2 O;  5KLV K;  2WSC H;  4EDF A;  1PGQ A;  1E79 H;  5M1B A;  2HYN A;  1LWU C;  3CC7 P;  1BCC D;  3M9B A;  2O01 H;  2WNP F;  4H13 B;  1L4A A;  3V2N A;  2PAJ A;  1NTZ J;  1NTZ E;  2QEX P;  2ZT9 B;  2ZVO B;  3EQ2 A;  1GL2 A;  3CX5 I;  1SQB J;  1SQB E;  3JCU E;  1PGO A;  5AVW B;  3U59 A;  2OAR A;  1HGV A;  3TK1 A;  1NTZ D;  3HD7 C;  5APY A;  2JHL F;  3L74 G;  5DJU B;  5AW6 B;  1SQB D;  1PP9 G;  1EZV G;  1IFD A;  1RE3 B;  4PV1 D;  2WPV B;  1FBM A;  4YXD C;  4N6J A;  2IYO A;  1SS1 A;  2QVA A;  2WSF H;  1N7L A;  3IF4 A;  1JMM A;  2FFD A;  3II6 A;  3KDP B;  3SFD C;  1GU4 A;  1N86 C;  4LLH A;  1KYO H;  1G2C B;  3RL0 C;  1NKZ B;  2OYI C;  3Q5S A;  5GTH E;  3NXS A;  1Y9B A;  4R4M A;  2W6A A;  1HH0 A;  3RK2 C;  2IFN A;  4ZKP A;  1TU3 F;  2KNC A;  1Y47 A;  3B71 A;  3TYY A;  2AEJ A;  2E75 B;  4Y28 J;  3MHV A;  3UIA A;  1K73 Q;  5AW0 B;  3F89 A;  1RF0 A;  1LGH B;  4UB6 E;  1OMI A;  3K5B A;  4M7H A;  2JDI H;  3H25 A;  1RF1 C;  1OW7 A;  1JY2 P;  2Q3E A;  4XE5 B;  5AVQ B;  1M1J B;  1T2K C;  5KJ7 D;  2WSE J;  1RE4 B;  1GK4 A;  3BVH C;  3O6Q A;  1H0T A;  1SLQ A;  3OJA B;  1L0N K;  1MKM A;  1RE3 A;  2IPP A;  1ZME C;  1FZG A;  2PRR A;  1FZB C;  1NTK K;  4EPU A;  2N1T B;  3V2R A;  1VDF A;  1L0L K;  2D2C D;  2BEZ F;  3L37 A;  1QGK B;  4H44 C;  5KKZ C;  3VP9 A;  1HJB A;  3V4W A;  1G2C A;  1SQX G;  1JM0 A;  1X22 A;  3SWF A;  1VQ7 P;  5CBN A;  5CHX A;  3L74 J;  3HD7 D;  3L74 E;  3AEA C;  4I1L A;  2A45 H;  1PP9 J;  1PP9 E;  3TDK A;  2IDB A;  4L76 A;  1FE6 A;  3AEF C;  5B5E H;  1KQF B;  2OTJ P;  1N73 B;  3A5T A;  3L74 D;  3CCM P;  1LT9 B;  1PP9 D;  2IBZ I;  3A0H H;  1EZV D;  3P32 A;  2E76 C;  1KFM A;  2I8D A;  1N7S B;  2NPS B;  1JY3 O;  1OWA A;  3VMZ A;  5E79 E;  1OW6 A;  2FXM A;  1FZE A;  2Y0D A;  4BWN A;  1QLE D;  3C9I A;  4CPG A;  5CJ4 A;  2FXP A;  3RK2 D;  1M1J A;  3G6E P;  3H1H E;  1JMB A;  4ASV A;  4IL6 X;  1NH4 A;  3BCC G;  2QJK B;  2J61 B;  1J1E B;  2RMZ A;  2R5B A;  3Q5R A;  1S9K E;  1Q90 D;  2IZ0 A;  1CSB A;  1GL2 C;  1Q82 Q;  3W68 A;  1K9M Q;  3VTP C;  3VOP A;  2QG4 A;  1NKN A;  3KZI E;  2N1T A;  2I1J A;  2KXP B;  1JY3 N;  1P84 I;  1T2K D;  1BE3 G;  4MN4 C;  1LTG C;  1N86 B;  5AW8 B;  1NU1 K;  1VF5 B;  2B9B A;  2OYI B;  2WMM A;  3B5N A;  2FFD C;  2YO2 A;  3M06 A;  4RES B;  4DOJ A;  2Q9I B;  5KJ7 A;  3I5C A;  1N73 A;  1H89 A;  5CCG C;  3KQG A;  5AW9 B;  1RH5 B;  1N7S A;  4PJ0 E;  1S5L H;  2J3U A;  2JO1 A;  1OFC X;  1SQX J;  1SQX E;  3A0B E;  3PTZ A;  2HLO C;  2FIB A;  5KAF H;  4WVZ A;  2WVR A;  1SQV E;  1SQX D;  4PD4 I;  1ZP0 C;  1FC2 C;  1GZL A;  1GU5 A;  4WB4 A;  4BXL A;  3CCV P;  1BSN A;  1KZU B;  3VMY A;  3AE4 C;  3TSI A;  3E7K A;  1URQ B;  2ZT9 C;  2JEE A;  3SWY A;  3NTN A;  4UB6 H;  3CCQ P;  4WY4 C;  3SWK A;  4HB1 A;  1AFO A;  1OVR A;  1JTH B;  2G8Y A;  1IJD B;  2K9J B;  3PRJ A;  5AW1 B;  1BSH A;  3L72 G;  3H32 B;  2V7Q J;  1MFT A;  4HYT B;  3RK3 E;  4GT1 A;  3I55 P;  1EDI A;  1X0T A;  3BCC J;  4R4L A;  4H44 B;  1X79 B;  3S4R A;  4DJG A;  2JP3 A;  2Y0E A;  1N86 A;  3H1K G;  3T97 A;  3CCJ P;  1FDO A;  1LTI C;  3RK3 D;  4D6T G;  1LTT C;  1L4A D;  2GUV A;  3HTK B;  2OYI A;  1K04 A;  3BCC D;  1HVV A;  5KAI H;  1GL2 D;  1OX3 A;  1YI2 P;  2B87 B;  2JHK F;  4GOD A;  5APX A;  4DT0 A;  4OGQ B;  4ZKU A;  4HH2 A;  1CW5 A;  2I1K A;  5AW3 B;  1BE3 J;  1BE3 E;  3GHG B;  1KQS O;  4EOT A;  2E76 B;  2E75 C;  2PGD A;  2QRX A;  2YIU B;  1BE3 D;  1R8E A;  1VQ4 P;  1YIT P;  1RF1 A;  3CXH E;  1IO4 A;  4OVN F;  2KP8 A;  2J59 M;  2AEM A;  1SQP K;  2KZJ A;  2ZYA A;  4RKU J;  3L71 E;  4GOE A;  1KIL B;  3CX5 D;  3HUS C;  3BVH A;  1OW8 A;  3WUV A;  3BRV B;  2J2P A;  2OTL P;  1DX7 A;  3OAK A;  1URQ A;  1RE4 C;  2LKM A;  3P7K A;  3E1I B;  1LTJ B;  2FBW C;  1VQM P;  2Z4E C;  1KMI Z;  2IBZ G;  1NO4 A;  1VQ5 P;  4XFJ A;  2J0G A;  3LW5 J;  3H32 A;  1GTW A;  4M7F A;  2M0B A;  2A06 E;  1CZQ A;  1MV8 A;  2FYN B;  2ZYD A;  3M0A A;  1PGJ A;  2B89 A;  4HKZ H;  3VMX A;  1LP1 A;  4QMA A;  1Q2N A;  1DIP A;  1SVF A;  2C0X A;  4H13 D;  2MKV A;  1M57 D;  2B87 A;  4AQR D;  3EFF K;  2BCC E;  4OH8 B;  1JCD A;  1PFI A;  3L72 J;  3L72 E;  2JKV A;  2YKP A;  1NAY A;  2WT7 A;  3CL3 D;  3KZI H;  2WZ7 A;  1HTL C;  1N73 C;  2Z5I A;  3L72 D;  3AED C;  3EWK A;  1YTZ I;  1LT9 C;  3IN6 A;  3H1K J;  3H1K E;  5GTI H;  4L74 A;  1NGM B;  1D7M A;  1N7S C;  2L91 A;  2NPS C;  2E74 D;  2NZ2 A;  5AW2 B;  3H1K D;  1BCC E;  3GMA A;  4D6T D;  2ZXX A;  3S9O A;  3A7O A;  1SP4 A;  3Q3D A;  1EDJ A;  2MJZ A;  3H1J G;  2E42 A;  4WBA A;  3W67 A;  3WU2 E;  3E1I A;  1JEK A;  3TNU B;  1WRG A;  3CWB G;  2QJK C;  1JC9 A;  1J1E C;  2H89 C;  1W2B O;  4WY4 B;  1VQ9 P;  3A0B H;  4UB8 E;  1S5L X;  1BGY G;  5APU A;  1FZC C;  1KD1 Q;  1R5L A;  2AXT H;  1SQV K;  2Z5H A;  1FZA B;  5H2F E;  1KB9 I;  2QJP B;  1BDC A;  4NPF X;  1M1K Q;  2M3B A;  1ZW0 A;  2J0Y A;  2CPS A;  3Q2Y A;  1T8Z A;  1VF5 C;  1E5W A;  4LC1 A;  4Z1M H;  2IBZ D;  4ZFG A;  2R32 A;  2KIK A;  2G3A A;  5CCG A;  1XTC C;  2Q9I C;  2A45 I;  2C9L Y;  1S2E A;  1JO5 A;  2QE7 H;  4JF7 A;  3WMM 0;  2N1T D;  1NTM G;  3L35 A;  2HLO A;  4TT3 H;  5K5G B;  1HJ0 A;  3L36 A;  2YMY A;  3PH0 A;  3KPE A;  1AQ5 A;  1Z3S A;  1X8Y A;  1DD3 A;  2XNX C;  3B5N D;  3HUS B;  4ZNC A;  3O8Z A;  4YTP C;  2ZFC A;  4W7Z A;  1P84 E;  2P7J A;  2K88 A;  2Z4E B;  2BEQ D;  4WY4 A;  1N7S D;  4PV1 B;  1URQ C;  3AEC C;  1P84 D;  2H8P D;  1ZV8 A;  1KB9 H;  5KLI C;  3H1J J;  3CXH H;  2RH0 A;  1KOR A;  1YJW P;  3H32 C;  4DCK A;  5CCH C;  2FYZ A;  3MIW A;  3H1J D;  1RHZ B;  2XKM A;  1GDT A;  1IFI A;  1FOS F;  2M3E A;  1NHL A;  1SQQ K;  5KLV G;  5AVR B;  3CWB D;  1BGY J;  4C7N B;  1LT1 A;  1EZV E;  3RGU A;  1JY2 N;  1HWT C;  2Q1K A;  2R5D A;  1BGY D;  4OGQ C;  1AVY A;  3GHG C;  2KK7 A;  4U3F G;  2FYU K;  2YIU C;  4U7J A;  4PD4 D;  3LID A;  1PPJ G;  1VF5 D;  1NVO A;  3RL0 D;  1EDL A;  3H1I G;  5DJT B;  1HBW A;  3HUS A;  1ZRT D;  3CMA P;  3ZDM A;  3V2P A;  1RE4 A;  5AW4 B;  1KIL C;  1YYC A;  3M0D C;  1NTM J;  1NTM E;  2QA4 P;  2Z4E A;  5C39 A;  3BAT A;  4HJG H;  2KSJ A;  1KQL A;  2LXB A;  3E1I C;  1LTJ C;  1NTM D;  2P58 A;  3VP8 A;  1FZC B;  2E5Y A;  1HUC A;  4JZC A;  2WPQ A;  3H6P A;  1XTG B;  2J5U A;  1YQ3 C;  2FYN C;  4XA4 A;  4IL6 E;  2P1J A;  1MUU A;  1NTZ K;  2C9N Y;  1SQB K;  1URQ D;  4C7R A;  4IFM A;  3HE5 B;  1T3J A;  1VPC A;  3JCU H;  3L75 G;  1FJP A;  2KI7 B;  1LJ2 A;  2JHI F;  5AVU B;  4NYT A;  3CLQ A;  1Q86 Q;  1LT9 A;  3PJS K;  4YPC A;  4GKG A;  2KOG A;  3L70 G;  2NPS A;  4NPE A;  1L0N G;  2WSC J;  1VQP P;  3FX0 A;  4H44 D;  5KLV J;  5KLV E;  4W7Y A;  3SSU A;  1IFM A;  1FAV A;  2KUB A;  2WTY A;  2HPC B;  2O01 J;  4BRY B;  4H0L C;  2RKL A;  2J5Z A;  1NTK G;  5KLV D;  2XNX B;  5TIS E;  1QX8 A;  1L0L G;  1J1D B;  5GTH H;  1IFJ A;  2P67 A;  2O01 N;  3U1C A;  4IOI H;  4OGQ D;  1JUN A;  1FS0 E;  4U3F J;  2Y9Z A;  2HOD C;  2V4H A;  1JOC A;  2J61 A;  2A45 G;  2E76 D;  4IFD K;  2DW3 A;  1W5C E;  1PPJ E;  1AV1 A;  4U3F D;  2W83 C;  1FZC A;  2LXC B;  2D39 A;  2VRS A;  3H1I J;  3H1I E;  5AVX B;  2WSF J;  4I7Z B;  5KLI B;  1QL2 A;  1PPJ D;  2ZVN B;  1EXI A;  1U7M A;  2W6B A;  3B4S A;  3OA7 A;  4AUW A;  3H1I D;  4N78 E;  1KYO E;  1NWQ A;  2WQY C;  1FZA C;  4N3Y B;  1KIL D;  4EYY Q;  3BCC E;  2QJP C;  3BAS A;  2J58 A;  2WSE H;  1GW3 A;  1FIB A;  1VL2 A;  2N9Y B;  1IC2 A;  1KQG B;  4N78 D;  1GMJ A;  1KYO D;  3FGA D;  3BRT B;  3NFQ A;  1S1C X;  2C0W A;  3HE4 B;  4JYC A;  2Q9I A;  2CPB A;  1A02 F;  3D6Y A;  1LTA C;  2YNY A;  2CK3 H;  4R9J A;  1ZOY C;  2AEF A;  2QM8 A;  1FZD A;  1QL1 A;  2QJY B;  3A3Y B;  4L75 A;  3R4Y A;  3L75 J;  3CX5 E;  2XNX A;  4KT0 J;  2KSE A;  5BU8 B;  3GLM A;  3L75 D;  4JQ0 D;  1YJ9 P;  5CCG D;  1L0N J;  1L0N E;  1NU1 G;  1FZF B;  2P2U A;  2JWD A;  2FY8 A;  1T6A A;  2YXQ B;  2P10 A;  1VQK P;  1Y8A A;  3L70 D;  5B66 E;  1YJN P;  5BVZ A;  1L0N D;  4PV1 C;  1JTH A;  1NTK J;  5CMZ A;  2K9J A;  5E79 H;  1M7L A;  1L0L J;  1L0L E;  1Q7Y Q;  1AVO A;  5CCH A;  3RK3 B;  1L4A B;  1NTK D;  5TJH A;  1L0L D;  3IR9 A;  4M3L A;  2XDJ A;  2GY7 A;  3HTK A;  3MTU E;  5B5E E;  2ZT9 D;  1KTM A;  3HE4 A;  1OIP A;  2OQQ A;  1NYH A;  3CC2 P;  1QVG O;  3A0H E;  4WY4 D;  4B86 A;  2J3O A;  3JC2 2;  2H43 B;  2W6J H;  5BU5 A;  1RQV A;  3CPW O;  2J60 A;  3GHG A;  3IFM A;  4ASW A;  1FU1 A;  3WUT A;  1ZN5 A;  2YKQ A; 
#chains in the Genus database with same CATH homology
 1A02 J;  3O8Z A;  1CSB A;  1GL2 C;  3R2P A;  5CJ0 A;  2ZFC A;  2E43 A;  3VTP C;  1OXZ A;  4JYB A;  3VOP A;  3MUD A;  1NOH A;  1NKN A;  4W7Z A;  2P7J A;  2Z4E B;  2N1T A;  4WY4 A;  2I1J A;  1N7S D;  2POH A;  1KIL A;  1JY3 N;  2R3C A;  1URQ C;  3VYI A;  3M0D A;  1T2K D;  2HPC A;  4O9B A;  1LTG C;  2HOD B;  1RF0 B;  1FZF A;  2H8P D;  1ZV8 A;  1JNM A;  1LTJ A;  1N86 B;  5AW8 B;  1NU1 K;  2WT7 B;  2J64 A;  2O1K A;  2OYI B;  3B5N A;  1SQX K;  1H8A A;  2FFD C;  3H32 C;  2YO2 A;  5CCH C;  1IFN A;  3M06 A;  4RES B;  2FYZ A;  4DOJ A;  3MIW A;  4I2L C;  2Q9I B;  5KJ7 A;  1CI6 B;  2J1G A;  2XKM A;  4EIJ A;  3I5C A;  1N73 A;  2WPR A;  1GDT A;  1IFI A;  3V2Q A;  2PP6 A;  2XV5 A;  1Z56 A;  1YTZ T;  1FOS F;  2JHM F;  3B8E B;  2BAS A;  1NHL A;  1H89 A;  5CCG C;  1SQQ K;  3KQG A;  5AW9 B;  4I6M C;  3PP5 A;  5AVY B;  5AVR B;  1N7S A;  1SFC B;  1JCC A;  4LGD E;  1FZE C;  2J3U A;  4C7N B;  1FIC A;  1J2J B;  1G1I A;  1JY2 N;  5AVZ B;  2HLO C;  1HWT C;  1G1J A;  1M1J C;  2FKW B;  2FIB A;  2R5D A;  2XU6 A;  1H88 A;  3P8M C;  3M9Q A;  3GHG C;  2KLV A;  4C46 A;  1FZG B;  2FYU K;  2H43 A;  1ZLL A;  3FIB A;  1NTM K;  1FDM A;  1GL2 B;  1GZL A;  1GU5 A;  2YO3 A;  4WB4 A;  4W80 A;  3LID A;  1LTS C;  1MFZ A;  1FZB A;  3N7N A;  1KZU B;  3RL0 D;  3VMY A;  1W2E A;  3TSI A;  1HBW A;  3HUS A;  1URQ B;  1NAF A;  2JEE A;  3SWY A;  1WT6 A;  3NTN A;  2J3F D;  2N1T C;  3V2P A;  4WY4 C;  3V5B A;  1RE4 A;  5AW4 B;  2HFE D;  1AFO A;  1KIL C;  1YYC A;  3M0D C;  1JTH B;  1IJD B;  2HPC C;  1EQ7 A;  3EFG A;  2Z4E A;  5AW1 B;  1SFC D;  3BAT A;  1FJK A;  3H32 B;  2FFD B;  2KSJ A;  1KQL A;  3E1I C;  4HYT B;  1LTJ C;  3NMD A;  4GT1 A;  2JHH C;  2HOD A;  3VP8 A;  1J1D C;  1GK6 A;  3B5N C;  1FZC B;  1X79 B;  1HUC A;  5AVV B;  3TNU A;  4JZC A;  1N86 A;  3T97 A;  2WPQ A;  1LTI C;  3RK3 D;  1JY2 O;  1LTT C;  3H6P A;  4AYC A;  1L4A D;  1XTG B;  2GUV A;  3HTK B;  5KJ7 C;  2OYI A;  1FZE B;  1HVV A;  1IK9 A;  2NPS D;  4Y99 C;  1GL2 D;  4KHX A;  2JHK F;  2J3F A;  1N2D C;  1CI6 A;  5AW5 B;  4XA4 A;  2HLO B;  5APX A;  2Q3I A;  2P1J A;  2J0H A;  1MUU A;  1NTZ K;  2C9N Y;  2ZXE B;  2KB7 P;  4ZKU A;  4HH2 A;  1CW5 A;  2J3G A;  2I1K A;  1KFN A;  5AW3 B;  2M8R A;  1SFC A;  3GHG B;  1SQB K;  1FID A;  1FZA A;  2OYH C;  1URQ D;  3N4X A;  4EOT A;  4C7R A;  4IFM A;  5KLV K;  3HE5 B;  2WSC H;  1T3J A;  1VPC A;  1FJP A;  2HYN A;  2JHI F;  1LWU C;  2Q5U A;  5AVU B;  1MZ9 A;  3M9B A;  4NYT A;  5AW7 B;  2O01 H;  2WNP F;  3CLQ A;  1RF1 A;  1FOS E;  1LT9 A;  1L4A A;  3V2N A;  2PAJ A;  4GKG A;  2KOG A;  3EQ2 A;  1IO4 A;  2KP8 A;  2J59 M;  2NPS A;  1SQP K;  1GL2 A;  2JJL A;  3U59 A;  5AVW B;  3KYQ A;  2OAR A;  2WPS A;  1HGV A;  3TK1 A;  1KIL B;  3HUS C;  4W7Y A;  3BVH A;  1IFM A;  1FAV A;  2HPC B;  2WTY A;  3HD7 C;  5APY A;  2JHL F;  3BRV B;  3LW5 H;  2J2P A;  2WIT A;  1DX7 A;  3OAK A;  5AW6 B;  2J5Z A;  1URQ A;  1RE4 C;  1IFD A;  1RE3 B;  2LKM A;  2IX7 C;  3P7K A;  3E1I B;  2XNX B;  1LTJ B;  2Z4E C;  1FBM A;  1J1D B;  1IFJ A;  1NO4 A;  2P67 A;  3B5N B;  4N6J A;  3U1C A;  1JUN A;  2WSF H;  1N7L A;  3V4Q A;  1T3U A;  2J0G A;  2QM7 A;  2HOD C;  4IFF A;  1JMM A;  1JOC A;  2J61 A;  3H32 A;  2FFD A;  2O1J A;  1GTW A;  3II6 A;  3KDP B;  4M7F A;  2A45 G;  1JY3 P;  1GU4 A;  1CZQ A;  4Y99 B;  4IFD K;  1N86 C;  1MV8 A;  4LLH A;  1GD2 E;  1G2C B;  3M0A A;  3RL0 C;  1NKZ B;  5APW A;  2OYI C;  1X9V A;  3VMX A;  3L4F A;  1FZC A;  3NXS A;  2IFM A;  2W27 A;  1SVF A;  2D39 A;  2W6A A;  1HH0 A;  2C0X A;  2VRS A;  3RK2 C;  2IFN A;  5AVX B;  4ZKP A;  2OYH B;  1QL2 A;  3TYY A;  3M91 A;  1FZF C;  2W6B A;  3OA7 A;  4AUW A;  4AQR D;  1LWU B;  4N78 E;  5AVT B;  1NWQ A;  3UIA A;  1FZA C;  3LIE A;  4OH8 B;  5AW0 B;  1JCD A;  4N3Y B;  1KIL D;  1RF0 A;  2HG5 D;  3MGN A;  1PFI A;  1LGH B;  3BAS A;  3VN0 A;  2YKP A;  2J58 A;  2WSE H;  2H7H A;  1GW3 A;  5APV A;  1FIB A;  1IC2 A;  2WT7 A;  4N78 D;  3CL3 D;  3M9H A;  4M7H A;  2WZ7 A;  5KTB A;  1HTL C;  1N73 C;  3BRT B;  2Z5I A;  3NFQ A;  3RK3 C;  1RF1 C;  2Q7C A;  2C0W A;  2GM4 A;  1YTZ I;  1LT9 C;  3HE4 B;  1L4A C;  1JY2 P;  4XE5 B;  4JYC A;  4JYO X;  2Q9I A;  2CPB A;  1A02 F;  1N7S C;  5AVQ B;  3HD7 B;  1GW4 A;  1M1J B;  2NPS C;  1LTA C;  1T2K C;  2YNY A;  5KJ7 D;  4R9J A;  1RE4 B;  5AW2 B;  1S9K D;  1GK4 A;  2XZR A;  3BVH C;  2YKO A;  5APS A;  1SLQ A;  2QM8 A;  4C7N A;  1FZD A;  1QL1 A;  1SP4 A;  3A7O A;  3CI9 A;  2MJZ A;  3OJA B;  1L0N K;  3A3Y B;  2E42 A;  4WBA A;  2H43 C;  1DEB A;  1RE3 A;  3E1I A;  2IPP A;  3TNU B;  2XNX A;  1WRG A;  4GIF A;  1FZG A;  3RL0 B;  5CCH D;  1HGZ A;  1JC9 A;  1FZB C;  1NTK K;  5BU8 B;  4EPU A;  1J1E C;  2N1T B;  4WY4 B;  3V2R A;  5APQ A;  2GUS A;  3RK2 B;  1VDF A;  1L0L K;  2L5G B;  5APT A;  5APU A;  5CCG D;  3L37 A;  1FZC C;  1SQV K;  3VP9 A;  1HJB A;  1FZF B;  3HRN A;  3MD0 A;  2P2U A;  3V4W A;  1G2C A;  2Z5H A;  3A2A A;  3SWF A;  1FZA B;  5CHX A;  5BVZ A;  3HD7 D;  4I1L A;  2A45 H;  1JTH A;  2M3B A;  5CMZ A;  2OYH A;  1ZR2 A;  2J0Y A;  2CPS A;  1RF0 C;  1M7L A;  1N73 B;  5CCH A;  3A5T A;  3RK3 B;  1RF1 B;  1T8Z A;  1LWU A;  1LT9 B;  1L4A B;  5AVS B;  1E5W A;  3P32 A;  1KFM A;  1N7S B;  4LC1 A;  2NPS B;  1DH3 A;  1LTB C;  4ZFG A;  3G3Z A;  2R32 A;  3IR9 A;  3U1A A;  1JY3 O;  1OWA A;  5CCG A;  4M3L A;  2XDJ A;  2WWW A;  3VMZ A;  1XTC C;  2Q9I C;  2GY7 A;  4R9T A;  3HTK A;  3MTU E;  2A45 I;  2FXM A;  3BVH B;  2C9L Y;  1Z3U A;  1FZE A;  2N9B A;  1JO5 A;  3HE4 A;  4JF7 A;  3WMM 0;  2N1T D;  3C9I A;  4WY4 D;  5CJ4 A;  3L35 A;  1SFC C;  3HD7 A;  2HLO A;  3RK2 D;  1M1J A;  2KYV A;  4B86 A;  2J3O A;  1RY3 A;  2H43 B;  5BU5 A;  2J60 A;  3P8C E;  3GHG A;  3IFM A;  3L36 A;  2YMY A;  1NH4 A;  3KPE A;  3HE5 A;  1AQ5 A;  1FZB B;  2J61 B;  1Z3S A;  1J1E B;  1X8Y A;  1FU1 A;  1RE3 C;  2R5B A;  1S9K E;  2XNX C;  3B5N D;  3P8C D;  1ZR4 A;  4DZO A;  1FZG C;  1ZN5 A;  3HUS B;  2YKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...