2HODB

Crystal structure of fragment d from human fibrinogen complexed with gly-hydroxypro-arg-pro-amide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
307
structure length
307
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting/peptide
molecule keywords Fibrinogen alpha chain
total genus 59
structure length 307
sequence length 307
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2006-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hodB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2hodB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2hodB03
3HUSC 1FZFC 2J1GA 1RF1A 1LT9B 1LTJB 1W2EA 2J0YA 3HUSB 1FZFB 1LTJA 1FZAC 1FZCC 2J3OA 3E1IB 1N73A 1Z3SA 2JHKF 4ZFGA 3HUSA 1FZFA 3H32C 1FZDA 1RF1B 1RF0C 2H43A 2Z4EA 2A45I 1FZEB 3H32B 2GY7A 2HLOB 3BVHC 2OYIC 2HPCA 1RE4A 1Z3UA 2JHLF 1FZAA 1LTJC 2A45G 2OYIB 1LT9C 3E1IA 1LWUB 1FZCB 3GHGA 2OYIA 2FFDC 2J61A 1JY2N 2HLOA 2J3FD 2HPCB 1M1JB 1FZBC 2D39A 2XNXA 2HODC 2FFDB 1RF0A 1FZEA 1M1JA 1N86C 2J2PA 1T3UA 4R9TA 2FFDA 2J64A 2HODB 1FICA 2FIBA 4JZCA 1FZBA 1N86B 2J0GA 2OYHB 2J5ZA 1JC9A 2OYHA 1FZCA 1LWUC 1LT9A 1FZAB 1FZGB 2J60A 2Q9IC 2J0HA 2J3UA 1M1JC 1N86A 1FZBB 1RE4C 2H43B 2Z4EB 2WNPF 3BVHA 2JHIF 1RF0B 2Q9IB 2XNXC 4EPUA 1JY2O 1RE3A 1FZEC 2A45H 2HLOC 3BVHB 2Q9IA 3FIBA 1FZGA 1JY2P 2XNXB 3GHGC 1N73B 1LWUA 2J3FA 4M7FA 2OYHC 1JY3N 2JHHC 2J61B 4JYOX 2J3GA 3GHGB 1N73C 1FIBA 3E1IC 1JY3O 1FZGC 4R9JA 1FIDA 1RE3C 2JHMF 1RF1C 4M7HA 2HPCC 1RE4B 4NYTA 2H43C 2HODA 2Z4EC 1RE3B 3H32A 1JY3P
chains in the Genus database with same CATH superfamily
5CJ0A 1BGYJ 2IFNA 1BE3D 2ZAEB 3G3ZA 3EQ2A 1QVGO 1Z3SA 2YKPA 4I2LC 1PP9G 4ZKUA 3GF3A 1ZN5A 1NU1G 1OW7A 2Y0CA 5APSA 1YQ4C 3KZIH 3ZDMA 4R4LA 4DCKA 1EDJA 3CMEP 1BCCE 4U3FG 3CC4P 1SFCD 2VRSA 3O8ZA 3KHUA 3B8EB 2O3JA 1M7LA 2J61A 2B87A 1L0LJ 2WSCJ 3H1JE 5AW8B 1KB9D 2BEZF 1YYCA 1P84E 3L72J 2E75D 4H13B 3V5BA 2M3BA 3HD7C 3C1LA 4XE5B 3I5CA 3CCEP 3NXSA 4JYOX 1NTME 5AW3B 3GHGB 3AE3C 2NPSB 1AV1A 5KAIE 1Y47A 2WSSH 2IPPA 3L70G 3KQGA 4XA4A 2OGUA 3L72G 1QLED 5APWA 3B4SA 2WSFH 3HUSC 3M06A 3WU2H 5AVYB 4H44C 2BASA 3CX5E 3E1IB 1M8OB 2WSCH 4OGQB 1KILB 1FZDA 1RF1B 1NYHA 2E42A 1QEXA 1IC2A 1LTBC 5KLVK 3WMM0 1SQQG 1DD4A 1S3JA 2FXPA 3LIEA 3MZWB 1WRGA 1SQVE 3E1IA 1NU1K 3F89A 2WTYA 1NTKJ 4YXDC 2FFDC 2QEXP 1S5LX 3L75G 2HPCB 1M1JB 3GG2A 3D70A 4OH8B 3CX5D 1M1JA 2XKMA 1IFDA 2FFDA 2E75C 3NMDA 2IBZG 1NHLA 2W90A 1BE3J 2E75B 1RH5B 1GK4A 1NU1D 1G2CB 1HF9A 2ZXXA 1L4AC 3VMYA 1SQQJ 5AVZB 2YO2A 1FZEC 1HWTC 1FZGA 5AVSB 3AE4C 1NAYA 2E5YA 1KQGB 1J2JB 2WMMA 2J3GA 1KYOD 1RQUA 1P84I 3RL0B 4KJMA 1H88A 2K9YA 2P7JA 3FXDA 1S9KD 2JR8A 1HJBA 3D6ZA 1N7LA 4N78E 1KB9E 3P8CD 3D71A 1J1DC 1FZFC 2PGDA 4DT0A 1FZFB 5KLVD 4GT1A 2GUVA 2J3OA 3P8MC 4CPGA 3AEGC 1FZFA 2WSEJ 4PJ0H 3L75D 4EIJA 4H0LD 4AQRD 1WT6A 1X0TA 4PV1D 1ZRTD 2L91A 3LW5J 1SQQD 1KQSO 4EYYQ 3GHGA 1IO4A 2OYIA 4DOJA 3OJAB 1A02F 3L74J 4HJGH 3M0DC 1GU4A 1OMIA 4WY4C 1JC9A 2AEJA 2POHA 3TGUJ 3L70D 2M8RA 1FZBB 4K35A 2W27A 5KLIC 2W6BA 3FIBA 2QJKB 3H1LJ 1DH3A 4I1LA 3TGUE 4OWFA 3Q5RA 3P32A 3BASA 5B66E 3S4RA 1PPJG 3CCUP 2HYNA 2HFED 1JM0A 1DEEG 5APVA 1L0NG 2R44A 2JJLA 1YJ9P 1N73A 4OGQD 2FBWC 3HTKA 1LJ2A 5DJUB 5KLVJ 2ZT9C 1YJWP 3CXHE 2C9LY 4ASVA 2J5UA 2K9JA 4U3FD 1RQVA 2G3AA 2FKWB 2XZRA 2KLVA 1NTKG 2QJYB 5GTIE 1BGYE 3RK2D 3GMAA 1FAVA 2A06D 2FYUJ 5CCGA 1IK9A 3L74G 1S5LH 1LTTC 1KB9H 1NTZK 2WQYC 2J0GA 2KK7A 3EFGA 3L4FA 1BE3G 3L73G 3MTUE 2C0XA 1HJ0A 2IZ1A 3P8CE 1GMJA 2ZFCA 1SQVK 2XDJA 4D6TG 1FJKA 2Z4EB 4RO0A 2H7HA 3B5NC 2YMKA 4GKGA 1X8YA 2HLOC 1HVVA 2KYVA 2XNXB 1SFCB 3AEFC 1K9MQ 1H0TB 1YHQP 1SFCA 4ZKPA 3HE4B 4R9JA 1BCCJ 3SSUA 1GL2D 5APUA 2Q7CA 4IL6X 3TK1A 1ZMEC 1ZLLA 1FDIA 3CXHI 1EZVG 2KSEA 1NTMJ 1LNQA 2PP6A 3CWBJ 1L0NJ 3EFFK 2QRXA 1NKNA 4K3AA 1ZXGA 1AVOA 2Q5UA 4I7ZB 4LC1A 1SQBD 1Z56A 3Q5SA 1KV4A 1OW6A 4ZMDA 1JEKA 2HLOB 4AYCA 3RL0D 1IK7A 3PJSK 1MV8A 1JNMA 1GL2B 1FE6A 1NTZG 5CCHC 1FZBC 2KSJA 1FS0E 4WB4A 5AVVB 5C39A 2C0WA 4PD4E 1RF0A 1SQBK 2Q1KA 5KAFE 1DD3A 3R2PA 2Y9YA 5AVUB 1YQ3C 2FYNC 1PL5A 4IFFA 2G8YA 4HH2A 1SQXG 2ZXEB 3CX5I 1RE4C 1W5CE 2Q9IB 3H1KJ 3V2PA 2Q9IA 3VP9A 1VQ7P 2RMZA 1JY3N 1VF5C 3AE6C 1PGQA 3CXHD 2BCCE 1MFZA 1FIBA 1U7JA 1L0LD 2FY8A 3BCCD 3OA7A 3M9BA 4AUWA 1KB9I 1RF1C 4U3FE 4NYTA 2H43C 1BCCG 2HODA 3HD7A 3H1KE 4NPDA 1Q86Q 4H13D 1S5LE 4OVNF 2M5AA 4EDFA 1LT9B 1P84D 2YNYA 1Y9BA 3MD0A 1SVFA 1FZAC 2R5BA 4YTPC 1SQXD 2H88C 2CPSA 3H1KG 1SQPJ 5AVWB 3CCRP 3TF5A 2BCCD 4DZOA 3H32B 1FOSF 2K88A 3V6IA 2B87B 1BDDA 1W2BO 3CI9A 4UB8H 1H0TA 4WVZA 2E76B 1NTZD 2OTLP 2YIUC 3H1IG 1N7SB 3PLNA 3RK3E 1BDCA 4C7NA 2FYUG 1NTZJ 1IFIA 2ZYAA 1T3UA 1NKZB 1SQXE 3AEAC 2WWWA 5H2FH 2KZJA 1M1KQ 1DX7A 1LP1B 3FXEA 2WPVB 2WPRA 5BU5A 5AW1B 1M1JC 3VN0A 2WNPF 1JOCA 3BVHA 2O1KA 3M0DA 1LTIC 4M3LA 1NWQA 5CHXA 2KOGA 4TT3H 1QX8A 2W8ZA 3RK3D 1JB0J 2KNCB 1JTHB 1RHZB 1USDA 2KNCA 3NFQA 3CPWO 2IBZI 2O1JA 3A0HE 4I7ZC 2QE7H 3M9HA 2YO3A 2WPSA 3G71P 3QWOC 3USSA 1RF1A 1PV3A 3BRVB 3MIWA 2AXTE 1NAFA 2J0YA 4WY4A 5B66H 1EC5A 2CPBA 4ZFGA 3GLMA 2FYUD 2XNDH 3EWKA 3MUDA 4HB1A 4IOIH 4LLHA 2GY7A 3V4WA 2DW3A 2HPCA 1HGZA 1OXZA 1YITP 1LTJC 4WY4B 2A45G 4UB6E 2A06G 1LT1A 3W67A 2BCCG 1KC8Q 3U1AA 5TJHA 2P1JA 1GZLA 4C7NB 1YI2P 3H25A 1U7MA 1FJPA 3A0HH 4EOTA 2OYHB 2D2CB 1U57A 1BE3E 2IX7C 3QH9A 2QM8A 2OYHA 1XTCC 4HYTB 5KKZC 3RL0g 1PFIA 5AVTB 2NRGA 3L74E 1EDKA 1L0ND 4JBZA 2H43B 2Z5IA 2L5GB 3OW2O 1L0LG 3A0BH 1KILE 1GW4A 3PP5A 1NTKE 1GK6A 2R32A 1VQNP 2QIWA 3H1LD 2KZIA 1NTZE 2J61B 3H1HG 3VYIA 5AW5B 4UB6H 1N7SD 5B5EH 2NPSC 1VQ8P 3HD7D 4NPFX 3HTKB 1GD2E 1LTGC 2JWDA 2ZYGA 3C8VA 3GW6A 1QL1A 1IFMA 3B71A 2R3SA 3WU2E 4RKUJ 1TU3F 5APQA 1EZVE 1PPJE 3CX5H 3AEBC 4TLFA 4R4MA 1H89A 1FBMA 4LGDE 3SFEC 1K05A 3RK3B 1Z3UA 5TISE 2W6AA 1OVRA 2OYIB 5KKZB 4BRYB 3RL0C 2N9YB 1LWUB 1S2EA 1FZCB 3KPEA 2O01H 3WUUA 4L75A 4PJ0E 1JY2N 1SS1A 2J3FD 3A2AA 1S4XA 1G1JA 2ZT9B 2FFDB 4GOEA 3KYQA 2OTKE 1EDLA 2FXMA 2NZ2A 2J64A 1FICA 5B5EE 1ZR4A 3IF4A 3K5BA 2KS1A 2N9BA 3PHLA 1Q82Q 4D6TE 1AFOA 5GTHH 3TNUA 1FZAB 1HGVA 2ZYDA 1N86A 1EZVI 3CCMP 1QVFO 3AEDC 5KJ7C 1N73B 4H0LB 4C7RA 3I55P 3VOPA 2RKLA 2JHHC 1BGYG 1N73C 3LW5H 2Y0DA 4IL6E 5E79E 2AEMA 2Z4EC 1KD1Q 4IFDK 4BWNA 1YTZI 3L73D 1AQ5A 3V2RA 1SFCC 1G2CA 3H1JD 3R4YA 1RY3A 1OVUA 3L74D 5APYA 1SQXJ 1L0NE 2JO1A 3B5NA 3L36A 2Q3IA 1T3JA 1NTKD 2H43A 2H8PD 3P7KA 5KAFH 4BXLA 2K37A 1R8EA 2IBZD 3SFDC 1S9KE 3BVHC 2JWAA 2M3EA 4JF7A 3OAKA 3TGUG 1Q7YQ 1L4AD 4L73A 2XNXA 2HODC 1NTKK 4IFMA 1CW5A 2AXTH 2B88A 2HODB 2UWJE 5AW7B 2J5ZA 3GF7A 3FWLA 2KS1B 3F5HA 1LT9A 1PPJD 4Y99B 4H13C 1X9VA 3G6EP 1RE3A 2Q6QA 3M0AA 1IFPA 3L72D 2J3FA 2WZ7A 3W68A 4W7ZA 3S1KA 4YXWH 1SQPE 5TISH 1AJYA 1KORA 2Y0EA 4BRYA 3AEEC 1PGPA 2P10A 5EFWB 1RE3C 3M9QA 3RK2B 1DIPA 2WSEH 5AVXB 1RE3B 2QVAA 4A7PA 1XTGB 1YTZT 2O01N 4GDOA 2IYPA 2QSIA 1FZCC 1E5WA 4O9BA 3HUSA 1EXIA 3L72E 3ITKA 2KB7P 1NTMD 3A0BE 3L70E 3T97A 1L2PA 1AVYA 2MKVA 1JMBA 3V4QA 1N7SA 1WMKA 2OYIC 1PGOA 3H1HE 3L73J 1UIXA 1KMIZ 3FX0A 2W83C 1HBWA 2P67A 1L0LE 2NPSD 3TGUD 1L0NK 2K9JB 2OTJP 3VP8A 2ZVOB 3CCLP 4R9TA 3LIDA 2W6JH 1VF5D 2N1TB 3VMAA 1NOHA 2N1TA 1PIXA 5CCHD 3H1JG 3MUDC 2IBZE 4XFJA 2LR2A 1SLQA 1VQMP 2A06E 1L4AA 4M7FA 1DEBA 4Z1MH 1HH0A 4OGQC 2M5AB 1FZGC 3TSIA 2I1JA 1VL2A 1ZRTE 1USEA 1LTSC 1SQQE 3CXHH 3S9OA 1VQ5P 1D7MA 1LTJB 1W2EA 1JCDA 2WSFJ 3G9RA 4NPEA 2YKOA 5DJTB 5KAIH 1ZR2A 3E1RA 3CL3D 2O01J 1RF0C 3U59A 1KILD 2AEFA 1KYOE 3BATA 3PTZA 1FOSE 1URQB 4MN4C 2R5DA 3L35A 3HE5A 1NTMG 2HLOA 3RGUA 3TYYA 4L74A 1CI6A 1ZW0A 5AW9B 2QM7A 2KP8A 4C46A 5GTIH 1EXJA 4N6JA 3L37A 2V7QH 2P58A 3PRJA 3TDKA 5KLIB 3CMAP 2FYUE 1CI6B 1M90Q 1RF0B 1YBKA 2JDIH 1SQBE 3WUVA 3CCVP 3GHGC 1CSBA 2OYHC 3KDPB 5CBNA 2I1KA 1NO4A 3L71J 3E7KA 2OARA 1RE4B 3H1LG 1JO5A 1SQVD 1JY3P 4PD4D 1M56D 1Q2NA 1T6AA 3N4XA 1NU1E 1LTJA 1PP9E 3L75J 5AVQB 2KUBA 2B89A 3Q2YA 1EDIA 5CBOA 2XU6A 4KHXA 4KT0J 4ASWA 5AW6B 2IFMA 2Z4EA 4GOFA 2M0BA 3VMZA 5GTHE 3CWBG 3IAOA 2Q3EA 1NVOA 1PP9D 2QG4A 1KTMA 1N86C 2QJKC 1VQ9P 1UIIA 5KJ7D 1VF5B 1N86B 5KLVE 2E43A 2D2CD 3MGNA 2E76C 1FZGB 1T2KD 3CD6P 2J3UA 1GL2C 2XNXC 5K5GB 1JY2O 2A45H 2NPSA 1BGYD 4QMAA 4Y28J 1PZQA 3FGAD 1G1IA 1AQTA 1M57D 4D6TJ 4W80A 1LP1A 1J1EC 1T8ZA 2MJZA 1L0LK 3SWYA 1JUNA 1FIDA 1CZQA 4H44D 2JHMF 3O6QA 1P84H 3AE8C 1NTMK 2HPCC 5L8RJ 3L71G 1BSNA 3A3YB 3MHVA 3O6QB 5CCGD 4JYBA 3B5ND 1ZP0C 2XV5A 3Q1MA 1KFMA 2V7QJ 1N8RQ 1X22A 2E74C 1NJIQ 2QJYC 2ZJSE 1HUCA 4U7JA 4EI2A 1SQXK 1FC2C 1VQLP 3CCJP 4W7YA 1KILA 1URQC 2QA4P 1IJDB 1RE4A 3TNUB 2LXCB 2JHLF 1FZAA 5CJ4A 1LGHB 2FYZA 5CMZA 4Y99C 1J1EB 3H1ID 2KI7B 2KXPB 1Q81Q 1SQPG 2SPZA 2WT7A 3IN6A 1K73Q 3BCCJ 3JCUH 1J1DB 4IL6H 2FYNB 1FZBA 3H6PA 4ZNCA 5CCHA 4RJTA 3H1HJ 3L73E 2GM4A 2N1TD 3H1KD 2Q9IC 1GTWA 1OW8A 3RK2C 2J0HA 3G4SP 1N2DC 2QJPC 1VPCA 2LKMA 3Q3DA 3H1HD 1URQD 3Q5PA 2PRRA 1E79H 5APXA 1Y8AA 1IZNB 3E1IC 2YIUB 3NTNA 3PH0A 3WUTA 2WITA 5H2FE 2PAJA 3BCCG 4M7HA 2HG5D 1VQKP 3N7NA 2HR3A 3AE1C 5KTBA 3B5NB 4PD4I 4B86A 1ZOYC 1KQFB 4PD4H 3AE2C 2IZ0A 4JQ0D 2E5TA 5E79H 3UIAA 1KFNA 3H1JJ 2WVRA 3H1IJ 3BCCE 2R3CA 2ITAA 1NH4A 2ZVNB 3IFMA 1SQPK 1KYOH 1JTHA 3RBXA 3U1CA 3CCQP 1SQPD 1EQ7A 2Z5HA 1SQBJ 4N78D 3AECC 5APTA 1KYOI 2QJPB 1S1CX 5KJ7A 3L70J 1VQPP 2J2PA 5AW0B 1X79B 3RK3C 1YIJP 1GW3A 1AA0A 1Q90D 1K04A 1FZCA 2BCCJ 1LWUC 3CC7P 1SQQK 2IYOA 2YMYA 2JHIF 1EZVD 2OYOA 1OZHA 2WT7B 4WBAA 1LWUA 1R5LA 2E74B 2AXCA 1YJNP 3AE5C 1FDMA 1R5SA 2LXBA 4GODA 2YKQA 3A5TA 1GU5A 4HKZH 5BVZA 1FDOA 1VDFA 4UB8E 4WY4D 3M91A 2RN0A 2IDBA 3JC22 5AVRB 2D2CC 3BRTB 3JCUE 3CC2P 2JKVA 2K1AA 1OVVA 3AE7C 1T2KC 3D6YA 2JHKF 1VQ4P 1FU1A 3A7OA 3HRNA 4RESB 1KN7A 2Y9ZA 2B9BA 2KIKA 1JMMA 1PGJA 1GL2A 4JYCA 4U3FJ 3IR9A 2JEEA 1SQVJ 1LT9C 1HTLC 4I6MC 1BSHA 1K8AQ 3CWBD 3I56P 2D39A 2J59M 2JP3A 3CLQA 2BEQD 1OFCX 1OWAA 1IFNA 2FIBA 4JZCA 2ZT9D 4H44B 1KQLA 2PFXA 1BCCD 3RBZA 1QGKB 1N7SC 1LTAC 2KLUA 3L75E 1JCCA 4EPUA 1ZV8A 1MKMA 2E76D 1JY2P 1MUUA 3AE9C 1SQVG 1KZUB 2WPQA 4YPCA 3C9IA 3MP7B 2C9NY 2CK3H 1VQ6P 2I8DA 1VQOP 2V4HA 5M1BA 4JPZB 3H32A 3HD7B 2K3RA 5CCGC 2J1GA 3HE4A 1GDTA 2N1TC 3HE5B 1OX3A 1IFJA 3HUSB 4H0LC 5BU8B 1MZ9A 1PP9J 2GA1A 4WWIA 4DJGA 3JSVC 4N3YB 5AW2B 3H1LE 3H32C 2E74D 2A45I 1FZEB 1SP4A 3KZIE 3V2QA 3L71E 4PV1B 3CCSP 4GIFA 2H89C 1SQBG 2J58A 2FYUK 4L76A 1KILC 1URQA 1QL2A 3FWNA 3T97B 1FZEA 3V2NA 1OIPA 2GUSA 2YXRB 2FXOA 2P2UA 1MFTA 2J60A 3L71D 3II6A 2YXQB 5KLVG 1NGMB 1NU1J 2RH0A 3VMXA 3BVHB 3SWKA 1A02J 3KXDA 4PV1C 3SWFA 3H1IE 1JY3O 1H8AA 3CWBE 5AW4B 2OQQA 1S72P 1L4AB 4D6TD 3VTPC 3ABVC
chains in the Genus database with same CATH topology
3B5ND 5CJ0A 3TK1A 2IFNA 2XV5A 1ZLLA 1AQ5A 2Q7CA 1KFMA 3V2RA 1SFCC 1G2CA 3EQ2A 3G3ZA 2PP6A 1RY3A 1HUCA 1Z3SA 2YKPA 5APYA 4I2LC 4ZKUA 1ZN5A 5APSA 3B5NA 1SQXK 1NKNA 3L36A 2Q3IA 1T3JA 2Q5UA 4LC1A 2H43A 2H8PD 4W7YA 1KILA 1URQC 1Z56A 3P7KA 1IJDB 1S9KE 2HLOB 3BVHC 4AYCA 1RE4A 3RL0D 3TNUB 2JHLF 1FZAA 5CJ4A 4JF7A 1SFCD 2VRSA 3OAKA 3O8ZA 1LGHB 2FYZA 3B8EB 1MV8A 5CMZA 1M7LA 4Y99C 1J1EB 1JNMA 2J61A 1GL2B 1L4AD 5CCHC 1FZBC 2KSJA 2WT7A 2XNXA 4WB4A 2HODC 5AVVB 2C0WA 1RF0A 1NTKK 1SQBK 5AW8B 4IFMA 1YYCA 1J1DB 1CW5A 2HODB 5AW7B 1FZBA 3H6PA 5CCHA 2J5ZA 2GM4A 3R2PA 5AVUB 2N1TD 3V5BA 4IFFA 4HH2A 1LT9A 4Y99B 2Q9IC 1GTWA 2ZXEB 2J0HA 3RK2C 1X9VA 1RE4C 1N2DC 2M3BA 2Q9IB 3V2PA 1RE3A 1VPCA 3M0AA 3HD7C 2LKMA 2Q9IA 4XE5B 1URQD 3VP9A 2J3FA 2WZ7A 5APXA 3I5CA 4W7ZA 1JY3N 3NXSA 4JYOX 5AW3B 3GHGB 1MFZA 1FIBA 3E1IC 3NTNA 3OA7A 2WITA 3M9BA 2NPSB 2PAJA 1RE3C 3M9QA 4AUWA 3RK2B 1RF1C 2IPPA 2HG5D 4M7HA 4NYTA 2H43C 2HODA 2WSEH 3N7NA 3HD7A 3KQGA 4XA4A 5AVXB 1RE3B 5APWA 2WSFH 5KTBA 3HUSC 3M06A 3B5NB 1XTGB 1YTZT 4B86A 1LT9B 2YNYA 5AVYB 3MD0A 2BASA 1SVFA 1FZAC 1FZCC 3E1IB 1E5WA 2R5BA 4O9BA 3HUSA 2WSCH 2CPSA 3UIAA 2KB7P 1KFNA 1KILB 1FZDA 1RF1B 2E42A 1IC2A 1LTBC 5AVWB 3T97A 4DZOA 5KLVK 3H32B 1FOSF 3V4QA 2R3CA 3WMM0 1N7SA 2OYIC 1NH4A 3CI9A 3IFMA 3LIEA 1SQPK 1WRGA 1JTHA 3E1IA 3U1CA 1NU1K 1EQ7A 2Z5HA 2WTYA 2FFDC 4N78D 1HBWA 1N7SB 2P67A 5APTA 2NPSD 2HPCB 1M1JB 1L0NK 4C7NA 5KJ7A 4OH8B 1IFIA 3VP8A 1M1JA 2J2PA 5AW0B 1T3UA 2XKMA 1NKZB 4R9TA 1X79B 3LIDA 1IFDA 3RK3C 2FFDA 3NMDA 1NHLA 2WWWA 2N1TB 1GW3A 1NOHA 1DX7A 1FZCA 1GK4A 2N1TA 1LWUC 1G2CB 2WPRA 5BU5A 5CCHD 5AW1B 1L4AC 1M1JC 1SQQK 3VN0A 2YMYA 3VMYA 2WNPF 1JOCA 3BVHA 2JHIF 2O1KA 3M0DA 1LTIC 4M3LA 1NWQA 1SLQA 5CHXA 2KOGA 5AVZB 2YO2A 1FZEC 1HWTC 2WT7B 1FZGA 5AVSB 4WBAA 3RK3D 1LWUA 1L4AA 4M7FA 1JTHB 1J2JB 1DEBA 2J3GA 1FDMA 3NFQA 1HH0A 2YKQA 3RL0B 3A5TA 1H88A 1FZGC 3TSIA 2P7JA 2I1JA 1GU5A 2O1JA 1S9KD 1HJBA 1N7LA 5BVZA 4N78E 1VDFA 1LTSC 3P8CD 4WY4D 3M9HA 1J1DC 3M91A 2YO3A 2WPSA 1FZFC 5AVRB 1RF1A 3BRTB 1LTJB 1W2EA 3BRVB 1NAFA 3MIWA 2J0YA 4WY4A 1FZFB 1JCDA 1T2KC 4GT1A 2GUVA 2CPBA 2J3OA 2JHKF 2YKOA 1ZR2A 3P8MC 4ZFGA 1FZFA 3CL3D 1FU1A 1RF0C 3U59A 1KILD 3MUDA 4EIJA 3A7OA 3HRNA 4LLHA 4RESB 4AQRD 1WT6A 2GY7A 1JMMA 3BATA 3V4WA 1FOSE 1GL2A 2HPCA 1HGZA 1OXZA 1URQB 4JYCA 1LTJC 4WY4B 2R5DA 3IR9A 3L35A 2JEEA 2A45G 1LT9C 1HTLC 4I6MC 3GHGA 1IO4A 2OYIA 4DOJA 3HE5A 3U1AA 3OJAB 1A02F 2HLOA 3TYYA 2D39A 2J59M 3CLQA 1CI6A 2P1JA 1GZLA 5AW9B 2QM7A 1OWAA 4C7NB 2KP8A 3M0DC 1FJPA 4EOTA 4C46A 1IFNA 2FIBA 4JZCA 1GU4A 2OYHB 4N6JA 1KQLA 2IX7C 4WY4C 1JC9A 3L37A 2QM8A 2OYHA 1XTCC 2POHA 4HYTB 1PFIA 5AVTB 2M8RA 1FZBB 2H43B 1CI6B 1N7SC 2W27A 2Z5IA 2L5GB 1RF0B 1LTAC 1JCCA 4EPUA 1ZV8A 2W6BA 1GW4A 3PP5A 1GK6A 3FIBA 2R32A 1JY2P 1MUUA 3GHGC 1CSBA 1KZUB 2OYHC 2J61B 2WPQA 3C9IA 2C9NY 3KDPB 3VYIA 2I1KA 1DH3A 4I1LA 1NO4A 5AW5B 3P32A 1N7SD 2OARA 3BASA 1RE4B 2NPSC 1JO5A 2HYNA 2HFED 3HD7D 3H32A 1JY3P 3HD7B 5CCGC 2J1GA 3HE4A 1GDTA 3HTKB 1GD2E 2N1TC 1LTGC 3HE5B 1IFJA 5APVA 3N4XA 3HUSB 5BU8B 1MZ9A 1LTJA 5AVQB 2JJLA 1QL1A 1N73A 1IFMA 5APQA 4N3YB 5AW2B 2XU6A 4KHXA 3HTKA 3H32C 5AW6B 2IFMA 2Z4EA 1H89A 2A45I 1FBMA 1FZEB 4LGDE 1SP4A 3V2QA 2C9LY 3RK3B 1Z3UA 2W6AA 4GIFA 3VMZA 2OYIB 2FKWB 2XZRA 3RL0C 1LWUB 1FZCB 3KPEA 2KLVA 2O01H 2J58A 1JY2N 2FYUK 3RK2D 2J3FD 3A2AA 1FAVA 1KILC 1URQA 1QL2A 1G1JA 5CCGA 1IK9A 2FFDB 1FZEA 1N86C 1LTTC 3KYQA 1NTZK 2FXMA 3V2NA 5KJ7D 2J64A 1FICA 2GUSA 1N86B 1ZR4A 2J0GA 3EFGA 3L4FA 2E43A 2N9BA 3MTUE 3MGNA 2C0XA 1AFOA 3P8CE 2P2UA 2ZFCA 3TNUA 1FZAB 1HGVA 1SQVK 2XDJA 1FZGB 2J60A 1T2KD 3II6A 2J3UA 1N86A 1FJKA 2Z4EB 1GL2C 2XNXC 2H7HA 3B5NC 4GKGA 1JY2O 3VMXA 1X8YA 2A45H 2NPSA 2HLOC 3BVHB 1HVVA 2KYVA 5KJ7C 2XNXB 1N73B 4C7RA 1SFCB 1G1IA 3VOPA 1A02J 2JHHC 3SWFA 4W80A 1N73C 1SFCA 1J1EC 4ZKPA 1JY3O 1T8ZA 1H8AA 3HE4B 5AW4B 2MJZA 4R9JA 1L0LK 3SWYA 1JUNA 3LW5H 1FIDA 1CZQA 2JHMF 1L4AB 1GL2D 1NTMK 2HPCC 2Z4EC 3VTPC 5APUA 4IFDK 3A3YB 5CCGD 1YTZI 4JYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUS C;  1FZF C;  2J1G A;  1RF1 A;  1LT9 B;  1LTJ B;  1W2E A;  2J0Y A;  3HUS B;  1FZF B;  1LTJ A;  1FZA C;  1FZC C;  2J3O A;  3E1I B;  1N73 A;  1Z3S A;  2JHK F;  4ZFG A;  3HUS A;  1FZF A;  3H32 C;  1FZD A;  1RF1 B;  1RF0 C;  2H43 A;  2Z4E A;  2A45 I;  1FZE B;  3H32 B;  2GY7 A;  2HLO B;  3BVH C;  2OYI C;  2HPC A;  1RE4 A;  1Z3U A;  2JHL F;  1FZA A;  1LTJ C;  2A45 G;  2OYI B;  1LT9 C;  3E1I A;  1LWU B;  1FZC B;  3GHG A;  2OYI A;  2FFD C;  2J61 A;  1JY2 N;  2HLO A;  2J3F D;  2HPC B;  1M1J B;  1FZB C;  2D39 A;  2XNX A;  2HOD C;  2FFD B;  1RF0 A;  1FZE A;  1M1J A;  1N86 C;  2J2P A;  1T3U A;  4R9T A;  2FFD A;  2J64 A;  2HOD B;  1FIC A;  2FIB A;  4JZC A;  1FZB A;  1N86 B;  2J0G A;  2OYH B;  2J5Z A;  1JC9 A;  2OYH A;  1FZC A;  1LWU C;  1LT9 A;  1FZA B;  1FZG B;  2J60 A;  2Q9I C;  2J0H A;  2J3U A;  1M1J C;  1N86 A;  1FZB B;  1RE4 C;  2H43 B;  2Z4E B;  2WNP F;  3BVH A;  2JHI F;  1RF0 B;  2Q9I B;  2XNX C;  4EPU A;  1JY2 O;  1RE3 A;  1FZE C;  2A45 H;  2HLO C;  3BVH B;  2Q9I A;  3FIB A;  1FZG A;  1JY2 P;  2XNX B;  3GHG C;  1N73 B;  1LWU A;  2J3F A;  4M7F A;  2OYH C;  1JY3 N;  2JHH C;  2J61 B;  4JYO X;  2J3G A;  3GHG B;  1N73 C;  1FIB A;  3E1I C;  1JY3 O;  1FZG C;  4R9J A;  1FID A;  1RE3 C;  2JHM F;  1RF1 C;  4M7H A;  2HPC C;  1RE4 B;  4NYT A;  2H43 C;  2HOD A;  2Z4E C;  1RE3 B;  3H32 A;  1JY3 P; 
#chains in the Genus database with same CATH topology
 5CJ0 A;  1BGY J;  2IFN A;  1BE3 D;  2ZAE B;  3G3Z A;  3EQ2 A;  1QVG O;  1Z3S A;  2YKP A;  4I2L C;  1PP9 G;  4ZKU A;  3GF3 A;  1ZN5 A;  1NU1 G;  1OW7 A;  2Y0C A;  5APS A;  1YQ4 C;  3KZI H;  3ZDM A;  4R4L A;  4DCK A;  1EDJ A;  3CME P;  1BCC E;  4U3F G;  3CC4 P;  1SFC D;  2VRS A;  3O8Z A;  3KHU A;  3B8E B;  2O3J A;  1M7L A;  2J61 A;  2B87 A;  1L0L J;  2WSC J;  3H1J E;  5AW8 B;  1KB9 D;  2BEZ F;  1YYC A;  1P84 E;  3L72 J;  2E75 D;  4H13 B;  3V5B A;  2M3B A;  3HD7 C;  3C1L A;  4XE5 B;  3I5C A;  3CCE P;  3NXS A;  4JYO X;  1NTM E;  5AW3 B;  3GHG B;  3AE3 C;  2NPS B;  1AV1 A;  5KAI E;  1Y47 A;  2WSS H;  2IPP A;  3L70 G;  3KQG A;  4XA4 A;  2OGU A;  3L72 G;  1QLE D;  5APW A;  3B4S A;  2WSF H;  3HUS C;  3M06 A;  3WU2 H;  5AVY B;  4H44 C;  2BAS A;  3CX5 E;  3E1I B;  1M8O B;  2WSC H;  4OGQ B;  1KIL B;  1FZD A;  1RF1 B;  1NYH A;  2E42 A;  1QEX A;  1IC2 A;  1LTB C;  5KLV K;  3WMM 0;  1SQQ G;  1DD4 A;  1S3J A;  2FXP A;  3LIE A;  3MZW B;  1WRG A;  1SQV E;  3E1I A;  1NU1 K;  3F89 A;  2WTY A;  1NTK J;  4YXD C;  2FFD C;  2QEX P;  1S5L X;  3L75 G;  2HPC B;  1M1J B;  3GG2 A;  3D70 A;  4OH8 B;  3CX5 D;  1M1J A;  2XKM A;  1IFD A;  2FFD A;  2E75 C;  3NMD A;  2IBZ G;  1NHL A;  2W90 A;  1BE3 J;  2E75 B;  1RH5 B;  1GK4 A;  1NU1 D;  1G2C B;  1HF9 A;  2ZXX A;  1L4A C;  3VMY A;  1SQQ J;  5AVZ B;  2YO2 A;  1FZE C;  1HWT C;  1FZG A;  5AVS B;  3AE4 C;  1NAY A;  2E5Y A;  1KQG B;  1J2J B;  2WMM A;  2J3G A;  1KYO D;  1RQU A;  1P84 I;  3RL0 B;  4KJM A;  1H88 A;  2K9Y A;  2P7J A;  3FXD A;  1S9K D;  2JR8 A;  1HJB A;  3D6Z A;  1N7L A;  4N78 E;  1KB9 E;  3P8C D;  3D71 A;  1J1D C;  1FZF C;  2PGD A;  4DT0 A;  1FZF B;  5KLV D;  4GT1 A;  2GUV A;  2J3O A;  3P8M C;  4CPG A;  3AEG C;  1FZF A;  2WSE J;  4PJ0 H;  3L75 D;  4EIJ A;  4H0L D;  4AQR D;  1WT6 A;  1X0T A;  4PV1 D;  1ZRT D;  2L91 A;  3LW5 J;  1SQQ D;  1KQS O;  4EYY Q;  3GHG A;  1IO4 A;  2OYI A;  4DOJ A;  3OJA B;  1A02 F;  3L74 J;  4HJG H;  3M0D C;  1GU4 A;  1OMI A;  4WY4 C;  1JC9 A;  2AEJ A;  2POH A;  3TGU J;  3L70 D;  2M8R A;  1FZB B;  4K35 A;  2W27 A;  5KLI C;  2W6B A;  3FIB A;  2QJK B;  3H1L J;  1DH3 A;  4I1L A;  3TGU E;  4OWF A;  3Q5R A;  3P32 A;  3BAS A;  5B66 E;  3S4R A;  1PPJ G;  3CCU P;  2HYN A;  2HFE D;  1JM0 A;  1DEE G;  5APV A;  1L0N G;  2R44 A;  2JJL A;  1YJ9 P;  1N73 A;  4OGQ D;  2FBW C;  3HTK A;  1LJ2 A;  5DJU B;  5KLV J;  2ZT9 C;  1YJW P;  3CXH E;  2C9L Y;  4ASV A;  2J5U A;  2K9J A;  4U3F D;  1RQV A;  2G3A A;  2FKW B;  2XZR A;  2KLV A;  1NTK G;  2QJY B;  5GTI E;  1BGY E;  3RK2 D;  3GMA A;  1FAV A;  2A06 D;  2FYU J;  5CCG A;  1IK9 A;  3L74 G;  1S5L H;  1LTT C;  1KB9 H;  1NTZ K;  2WQY C;  2J0G A;  2KK7 A;  3EFG A;  3L4F A;  1BE3 G;  3L73 G;  3MTU E;  2C0X A;  1HJ0 A;  2IZ1 A;  3P8C E;  1GMJ A;  2ZFC A;  1SQV K;  2XDJ A;  4D6T G;  1FJK A;  2Z4E B;  4RO0 A;  2H7H A;  3B5N C;  2YMK A;  4GKG A;  1X8Y A;  2HLO C;  1HVV A;  2KYV A;  2XNX B;  1SFC B;  3AEF C;  1K9M Q;  1H0T B;  1YHQ P;  1SFC A;  4ZKP A;  3HE4 B;  4R9J A;  1BCC J;  3SSU A;  1GL2 D;  5APU A;  2Q7C A;  4IL6 X;  3TK1 A;  1ZME C;  1ZLL A;  1FDI A;  3CXH I;  1EZV G;  2KSE A;  1NTM J;  1LNQ A;  2PP6 A;  3CWB J;  1L0N J;  3EFF K;  2QRX A;  1NKN A;  4K3A A;  1ZXG A;  1AVO A;  2Q5U A;  4I7Z B;  4LC1 A;  1SQB D;  1Z56 A;  3Q5S A;  1KV4 A;  1OW6 A;  4ZMD A;  1JEK A;  2HLO B;  4AYC A;  3RL0 D;  1IK7 A;  3PJS K;  1MV8 A;  1JNM A;  1GL2 B;  1FE6 A;  1NTZ G;  5CCH C;  1FZB C;  2KSJ A;  1FS0 E;  4WB4 A;  5AVV B;  5C39 A;  2C0W A;  4PD4 E;  1RF0 A;  1SQB K;  2Q1K A;  5KAF E;  1DD3 A;  3R2P A;  2Y9Y A;  5AVU B;  1YQ3 C;  2FYN C;  1PL5 A;  4IFF A;  2G8Y A;  4HH2 A;  1SQX G;  2ZXE B;  3CX5 I;  1RE4 C;  1W5C E;  2Q9I B;  3H1K J;  3V2P A;  2Q9I A;  3VP9 A;  1VQ7 P;  2RMZ A;  1JY3 N;  1VF5 C;  3AE6 C;  1PGQ A;  3CXH D;  2BCC E;  1MFZ A;  1FIB A;  1U7J A;  1L0L D;  2FY8 A;  3BCC D;  3OA7 A;  3M9B A;  4AUW A;  1KB9 I;  1RF1 C;  4U3F E;  4NYT A;  2H43 C;  1BCC G;  2HOD A;  3HD7 A;  3H1K E;  4NPD A;  1Q86 Q;  4H13 D;  1S5L E;  4OVN F;  2M5A A;  4EDF A;  1LT9 B;  1P84 D;  2YNY A;  1Y9B A;  3MD0 A;  1SVF A;  1FZA C;  2R5B A;  4YTP C;  1SQX D;  2H88 C;  2CPS A;  3H1K G;  1SQP J;  5AVW B;  3CCR P;  3TF5 A;  2BCC D;  4DZO A;  3H32 B;  1FOS F;  2K88 A;  3V6I A;  2B87 B;  1BDD A;  1W2B O;  3CI9 A;  4UB8 H;  1H0T A;  4WVZ A;  2E76 B;  1NTZ D;  2OTL P;  2YIU C;  3H1I G;  1N7S B;  3PLN A;  3RK3 E;  1BDC A;  4C7N A;  2FYU G;  1NTZ J;  1IFI A;  2ZYA A;  1T3U A;  1NKZ B;  1SQX E;  3AEA C;  2WWW A;  5H2F H;  2KZJ A;  1M1K Q;  1DX7 A;  1LP1 B;  3FXE A;  2WPV B;  2WPR A;  5BU5 A;  5AW1 B;  1M1J C;  3VN0 A;  2WNP F;  1JOC A;  3BVH A;  2O1K A;  3M0D A;  1LTI C;  4M3L A;  1NWQ A;  5CHX A;  2KOG A;  4TT3 H;  1QX8 A;  2W8Z A;  3RK3 D;  1JB0 J;  2KNC B;  1JTH B;  1RHZ B;  1USD A;  2KNC A;  3NFQ A;  3CPW O;  2IBZ I;  2O1J A;  3A0H E;  4I7Z C;  2QE7 H;  3M9H A;  2YO3 A;  2WPS A;  3G71 P;  3QWO C;  3USS A;  1RF1 A;  1PV3 A;  3BRV B;  3MIW A;  2AXT E;  1NAF A;  2J0Y A;  4WY4 A;  5B66 H;  1EC5 A;  2CPB A;  4ZFG A;  3GLM A;  2FYU D;  2XND H;  3EWK A;  3MUD A;  4HB1 A;  4IOI H;  4LLH A;  2GY7 A;  3V4W A;  2DW3 A;  2HPC A;  1HGZ A;  1OXZ A;  1YIT P;  1LTJ C;  4WY4 B;  2A45 G;  4UB6 E;  2A06 G;  1LT1 A;  3W67 A;  2BCC G;  1KC8 Q;  3U1A A;  5TJH A;  2P1J A;  1GZL A;  4C7N B;  1YI2 P;  3H25 A;  1U7M A;  1FJP A;  3A0H H;  4EOT A;  2OYH B;  2D2C B;  1U57 A;  1BE3 E;  2IX7 C;  3QH9 A;  2QM8 A;  2OYH A;  1XTC C;  4HYT B;  5KKZ C;  3RL0 g;  1PFI A;  5AVT B;  2NRG A;  3L74 E;  1EDK A;  1L0N D;  4JBZ A;  2H43 B;  2Z5I A;  2L5G B;  3OW2 O;  1L0L G;  3A0B H;  1KIL E;  1GW4 A;  3PP5 A;  1NTK E;  1GK6 A;  2R32 A;  1VQN P;  2QIW A;  3H1L D;  2KZI A;  1NTZ E;  2J61 B;  3H1H G;  3VYI A;  5AW5 B;  4UB6 H;  1N7S D;  5B5E H;  2NPS C;  1VQ8 P;  3HD7 D;  4NPF X;  3HTK B;  1GD2 E;  1LTG C;  2JWD A;  2ZYG A;  3C8V A;  3GW6 A;  1QL1 A;  1IFM A;  3B71 A;  2R3S A;  3WU2 E;  4RKU J;  1TU3 F;  5APQ A;  1EZV E;  1PPJ E;  3CX5 H;  3AEB C;  4TLF A;  4R4M A;  1H89 A;  1FBM A;  4LGD E;  3SFE C;  1K05 A;  3RK3 B;  1Z3U A;  5TIS E;  2W6A A;  1OVR A;  2OYI B;  5KKZ B;  4BRY B;  3RL0 C;  2N9Y B;  1LWU B;  1S2E A;  1FZC B;  3KPE A;  2O01 H;  3WUU A;  4L75 A;  4PJ0 E;  1JY2 N;  1SS1 A;  2J3F D;  3A2A A;  1S4X A;  1G1J A;  2ZT9 B;  2FFD B;  4GOE A;  3KYQ A;  2OTK E;  1EDL A;  2FXM A;  2NZ2 A;  2J64 A;  1FIC A;  5B5E E;  1ZR4 A;  3IF4 A;  3K5B A;  2KS1 A;  2N9B A;  3PHL A;  1Q82 Q;  4D6T E;  1AFO A;  5GTH H;  3TNU A;  1FZA B;  1HGV A;  2ZYD A;  1N86 A;  1EZV I;  3CCM P;  1QVF O;  3AED C;  5KJ7 C;  1N73 B;  4H0L B;  4C7R A;  3I55 P;  3VOP A;  2RKL A;  2JHH C;  1BGY G;  1N73 C;  3LW5 H;  2Y0D A;  4IL6 E;  5E79 E;  2AEM A;  2Z4E C;  1KD1 Q;  4IFD K;  4BWN A;  1YTZ I;  3L73 D;  1AQ5 A;  3V2R A;  1SFC C;  1G2C A;  3H1J D;  3R4Y A;  1RY3 A;  1OVU A;  3L74 D;  5APY A;  1SQX J;  1L0N E;  2JO1 A;  3B5N A;  3L36 A;  2Q3I A;  1T3J A;  1NTK D;  2H43 A;  2H8P D;  3P7K A;  5KAF H;  4BXL A;  2K37 A;  1R8E A;  2IBZ D;  3SFD C;  1S9K E;  3BVH C;  2JWA A;  2M3E A;  4JF7 A;  3OAK A;  3TGU G;  1Q7Y Q;  1L4A D;  4L73 A;  2XNX A;  2HOD C;  1NTK K;  4IFM A;  1CW5 A;  2AXT H;  2B88 A;  2HOD B;  2UWJ E;  5AW7 B;  2J5Z A;  3GF7 A;  3FWL A;  2KS1 B;  3F5H A;  1LT9 A;  1PPJ D;  4Y99 B;  4H13 C;  1X9V A;  3G6E P;  1RE3 A;  2Q6Q A;  3M0A A;  1IFP A;  3L72 D;  2J3F A;  2WZ7 A;  3W68 A;  4W7Z A;  3S1K A;  4YXW H;  1SQP E;  5TIS H;  1AJY A;  1KOR A;  2Y0E A;  4BRY A;  3AEE C;  1PGP A;  2P10 A;  5EFW B;  1RE3 C;  3M9Q A;  3RK2 B;  1DIP A;  2WSE H;  5AVX B;  1RE3 B;  2QVA A;  4A7P A;  1XTG B;  1YTZ T;  2O01 N;  4GDO A;  2IYP A;  2QSI A;  1FZC C;  1E5W A;  4O9B A;  3HUS A;  1EXI A;  3L72 E;  3ITK A;  2KB7 P;  1NTM D;  3A0B E;  3L70 E;  3T97 A;  1L2P A;  1AVY A;  2MKV A;  1JMB A;  3V4Q A;  1N7S A;  1WMK A;  2OYI C;  1PGO A;  3H1H E;  3L73 J;  1UIX A;  1KMI Z;  3FX0 A;  2W83 C;  1HBW A;  2P67 A;  1L0L E;  2NPS D;  3TGU D;  1L0N K;  2K9J B;  2OTJ P;  3VP8 A;  2ZVO B;  3CCL P;  4R9T A;  3LID A;  2W6J H;  1VF5 D;  2N1T B;  3VMA A;  1NOH A;  2N1T A;  1PIX A;  5CCH D;  3H1J G;  3MUD C;  2IBZ E;  4XFJ A;  2LR2 A;  1SLQ A;  1VQM P;  2A06 E;  1L4A A;  4M7F A;  1DEB A;  4Z1M H;  1HH0 A;  4OGQ C;  2M5A B;  1FZG C;  3TSI A;  2I1J A;  1VL2 A;  1ZRT E;  1USE A;  1LTS C;  1SQQ E;  3CXH H;  3S9O A;  1VQ5 P;  1D7M A;  1LTJ B;  1W2E A;  1JCD A;  2WSF J;  3G9R A;  4NPE A;  2YKO A;  5DJT B;  5KAI H;  1ZR2 A;  3E1R A;  3CL3 D;  2O01 J;  1RF0 C;  3U59 A;  1KIL D;  2AEF A;  1KYO E;  3BAT A;  3PTZ A;  1FOS E;  1URQ B;  4MN4 C;  2R5D A;  3L35 A;  3HE5 A;  1NTM G;  2HLO A;  3RGU A;  3TYY A;  4L74 A;  1CI6 A;  1ZW0 A;  5AW9 B;  2QM7 A;  2KP8 A;  4C46 A;  5GTI H;  1EXJ A;  4N6J A;  3L37 A;  2V7Q H;  2P58 A;  3PRJ A;  3TDK A;  5KLI B;  3CMA P;  2FYU E;  1CI6 B;  1M90 Q;  1RF0 B;  1YBK A;  2JDI H;  1SQB E;  3WUV A;  3CCV P;  3GHG C;  1CSB A;  2OYH C;  3KDP B;  5CBN A;  2I1K A;  1NO4 A;  3L71 J;  3E7K A;  2OAR A;  1RE4 B;  3H1L G;  1JO5 A;  1SQV D;  1JY3 P;  4PD4 D;  1M56 D;  1Q2N A;  1T6A A;  3N4X A;  1NU1 E;  1LTJ A;  1PP9 E;  3L75 J;  5AVQ B;  2KUB A;  2B89 A;  3Q2Y A;  1EDI A;  5CBO A;  2XU6 A;  4KHX A;  4KT0 J;  4ASW A;  5AW6 B;  2IFM A;  2Z4E A;  4GOF A;  2M0B A;  3VMZ A;  5GTH E;  3CWB G;  3IAO A;  2Q3E A;  1NVO A;  1PP9 D;  2QG4 A;  1KTM A;  1N86 C;  2QJK C;  1VQ9 P;  1UII A;  5KJ7 D;  1VF5 B;  1N86 B;  5KLV E;  2E43 A;  2D2C D;  3MGN A;  2E76 C;  1FZG B;  1T2K D;  3CD6 P;  2J3U A;  1GL2 C;  2XNX C;  5K5G B;  1JY2 O;  2A45 H;  2NPS A;  1BGY D;  4QMA A;  4Y28 J;  1PZQ A;  3FGA D;  1G1I A;  1AQT A;  1M57 D;  4D6T J;  4W80 A;  1LP1 A;  1J1E C;  1T8Z A;  2MJZ A;  1L0L K;  3SWY A;  1JUN A;  1FID A;  1CZQ A;  4H44 D;  2JHM F;  3O6Q A;  1P84 H;  3AE8 C;  1NTM K;  2HPC C;  5L8R J;  3L71 G;  1BSN A;  3A3Y B;  3MHV A;  3O6Q B;  5CCG D;  4JYB A;  3B5N D;  1ZP0 C;  2XV5 A;  3Q1M A;  1KFM A;  2V7Q J;  1N8R Q;  1X22 A;  2E74 C;  1NJI Q;  2QJY C;  2ZJS E;  1HUC A;  4U7J A;  4EI2 A;  1SQX K;  1FC2 C;  1VQL P;  3CCJ P;  4W7Y A;  1KIL A;  1URQ C;  2QA4 P;  1IJD B;  1RE4 A;  3TNU B;  2LXC B;  2JHL F;  1FZA A;  5CJ4 A;  1LGH B;  2FYZ A;  5CMZ A;  4Y99 C;  1J1E B;  3H1I D;  2KI7 B;  2KXP B;  1Q81 Q;  1SQP G;  2SPZ A;  2WT7 A;  3IN6 A;  1K73 Q;  3BCC J;  3JCU H;  1J1D B;  4IL6 H;  2FYN B;  1FZB A;  3H6P A;  4ZNC A;  5CCH A;  4RJT A;  3H1H J;  3L73 E;  2GM4 A;  2N1T D;  3H1K D;  2Q9I C;  1GTW A;  1OW8 A;  3RK2 C;  2J0H A;  3G4S P;  1N2D C;  2QJP C;  1VPC A;  2LKM A;  3Q3D A;  3H1H D;  1URQ D;  3Q5P A;  2PRR A;  1E79 H;  5APX A;  1Y8A A;  1IZN B;  3E1I C;  2YIU B;  3NTN A;  3PH0 A;  3WUT A;  2WIT A;  5H2F E;  2PAJ A;  3BCC G;  4M7H A;  2HG5 D;  1VQK P;  3N7N A;  2HR3 A;  3AE1 C;  5KTB A;  3B5N B;  4PD4 I;  4B86 A;  1ZOY C;  1KQF B;  4PD4 H;  3AE2 C;  2IZ0 A;  4JQ0 D;  2E5T A;  5E79 H;  3UIA A;  1KFN A;  3H1J J;  2WVR A;  3H1I J;  3BCC E;  2R3C A;  2ITA A;  1NH4 A;  2ZVN B;  3IFM A;  1SQP K;  1KYO H;  1JTH A;  3RBX A;  3U1C A;  3CCQ P;  1SQP D;  1EQ7 A;  2Z5H A;  1SQB J;  4N78 D;  3AEC C;  5APT A;  1KYO I;  2QJP B;  1S1C X;  5KJ7 A;  3L70 J;  1VQP P;  2J2P A;  5AW0 B;  1X79 B;  3RK3 C;  1YIJ P;  1GW3 A;  1AA0 A;  1Q90 D;  1K04 A;  1FZC A;  2BCC J;  1LWU C;  3CC7 P;  1SQQ K;  2IYO A;  2YMY A;  2JHI F;  1EZV D;  2OYO A;  1OZH A;  2WT7 B;  4WBA A;  1LWU A;  1R5L A;  2E74 B;  2AXC A;  1YJN P;  3AE5 C;  1FDM A;  1R5S A;  2LXB A;  4GOD A;  2YKQ A;  3A5T A;  1GU5 A;  4HKZ H;  5BVZ A;  1FDO A;  1VDF A;  4UB8 E;  4WY4 D;  3M91 A;  2RN0 A;  2IDB A;  3JC2 2;  5AVR B;  2D2C C;  3BRT B;  3JCU E;  3CC2 P;  2JKV A;  2K1A A;  1OVV A;  3AE7 C;  1T2K C;  3D6Y A;  2JHK F;  1VQ4 P;  1FU1 A;  3A7O A;  3HRN A;  4RES B;  1KN7 A;  2Y9Z A;  2B9B A;  2KIK A;  1JMM A;  1PGJ A;  1GL2 A;  4JYC A;  4U3F J;  3IR9 A;  2JEE A;  1SQV J;  1LT9 C;  1HTL C;  4I6M C;  1BSH A;  1K8A Q;  3CWB D;  3I56 P;  2D39 A;  2J59 M;  2JP3 A;  3CLQ A;  2BEQ D;  1OFC X;  1OWA A;  1IFN A;  2FIB A;  4JZC A;  2ZT9 D;  4H44 B;  1KQL A;  2PFX A;  1BCC D;  3RBZ A;  1QGK B;  1N7S C;  1LTA C;  2KLU A;  3L75 E;  1JCC A;  4EPU A;  1ZV8 A;  1MKM A;  2E76 D;  1JY2 P;  1MUU A;  3AE9 C;  1SQV G;  1KZU B;  2WPQ A;  4YPC A;  3C9I A;  3MP7 B;  2C9N Y;  2CK3 H;  1VQ6 P;  2I8D A;  1VQO P;  2V4H A;  5M1B A;  4JPZ B;  3H32 A;  3HD7 B;  2K3R A;  5CCG C;  2J1G A;  3HE4 A;  1GDT A;  2N1T C;  3HE5 B;  1OX3 A;  1IFJ A;  3HUS B;  4H0L C;  5BU8 B;  1MZ9 A;  1PP9 J;  2GA1 A;  4WWI A;  4DJG A;  3JSV C;  4N3Y B;  5AW2 B;  3H1L E;  3H32 C;  2E74 D;  2A45 I;  1FZE B;  1SP4 A;  3KZI E;  3V2Q A;  3L71 E;  4PV1 B;  3CCS P;  4GIF A;  2H89 C;  1SQB G;  2J58 A;  2FYU K;  4L76 A;  1KIL C;  1URQ A;  1QL2 A;  3FWN A;  3T97 B;  1FZE A;  3V2N A;  1OIP A;  2GUS A;  2YXR B;  2FXO A;  2P2U A;  1MFT A;  2J60 A;  3L71 D;  3II6 A;  2YXQ B;  5KLV G;  1NGM B;  1NU1 J;  2RH0 A;  3VMX A;  3BVH B;  3SWK A;  1A02 J;  3KXD A;  4PV1 C;  3SWF A;  3H1I E;  1JY3 O;  1H8A A;  3CWB E;  5AW4 B;  2OQQ A;  1S72 P;  1L4A B;  4D6T D;  3VTP C;  3ABV C; 
#chains in the Genus database with same CATH homology
 3B5N D;  5CJ0 A;  3TK1 A;  2IFN A;  2XV5 A;  1ZLL A;  1AQ5 A;  2Q7C A;  1KFM A;  3V2R A;  1SFC C;  1G2C A;  3EQ2 A;  3G3Z A;  2PP6 A;  1RY3 A;  1HUC A;  1Z3S A;  2YKP A;  5APY A;  4I2L C;  4ZKU A;  1ZN5 A;  5APS A;  3B5N A;  1SQX K;  1NKN A;  3L36 A;  2Q3I A;  1T3J A;  2Q5U A;  4LC1 A;  2H43 A;  2H8P D;  4W7Y A;  1KIL A;  1URQ C;  1Z56 A;  3P7K A;  1IJD B;  1S9K E;  2HLO B;  3BVH C;  4AYC A;  1RE4 A;  3RL0 D;  3TNU B;  2JHL F;  1FZA A;  5CJ4 A;  4JF7 A;  1SFC D;  2VRS A;  3OAK A;  3O8Z A;  1LGH B;  2FYZ A;  3B8E B;  1MV8 A;  5CMZ A;  1M7L A;  4Y99 C;  1J1E B;  1JNM A;  2J61 A;  1GL2 B;  1L4A D;  5CCH C;  1FZB C;  2KSJ A;  2WT7 A;  2XNX A;  4WB4 A;  2HOD C;  5AVV B;  2C0W A;  1RF0 A;  1NTK K;  1SQB K;  5AW8 B;  4IFM A;  1YYC A;  1J1D B;  1CW5 A;  2HOD B;  5AW7 B;  1FZB A;  3H6P A;  5CCH A;  2J5Z A;  2GM4 A;  3R2P A;  5AVU B;  2N1T D;  3V5B A;  4IFF A;  4HH2 A;  1LT9 A;  4Y99 B;  2Q9I C;  1GTW A;  2ZXE B;  2J0H A;  3RK2 C;  1X9V A;  1RE4 C;  1N2D C;  2M3B A;  2Q9I B;  3V2P A;  1RE3 A;  1VPC A;  3M0A A;  3HD7 C;  2LKM A;  2Q9I A;  4XE5 B;  1URQ D;  3VP9 A;  2J3F A;  2WZ7 A;  5APX A;  3I5C A;  4W7Z A;  1JY3 N;  3NXS A;  4JYO X;  5AW3 B;  3GHG B;  1MFZ A;  1FIB A;  3E1I C;  3NTN A;  3OA7 A;  2WIT A;  3M9B A;  2NPS B;  2PAJ A;  1RE3 C;  3M9Q A;  4AUW A;  3RK2 B;  1RF1 C;  2IPP A;  2HG5 D;  4M7H A;  4NYT A;  2H43 C;  2HOD A;  2WSE H;  3N7N A;  3HD7 A;  3KQG A;  4XA4 A;  5AVX B;  1RE3 B;  5APW A;  2WSF H;  5KTB A;  3HUS C;  3M06 A;  3B5N B;  1XTG B;  1YTZ T;  4B86 A;  1LT9 B;  2YNY A;  5AVY B;  3MD0 A;  2BAS A;  1SVF A;  1FZA C;  1FZC C;  3E1I B;  1E5W A;  2R5B A;  4O9B A;  3HUS A;  2WSC H;  2CPS A;  3UIA A;  2KB7 P;  1KFN A;  1KIL B;  1FZD A;  1RF1 B;  2E42 A;  1IC2 A;  1LTB C;  5AVW B;  3T97 A;  4DZO A;  5KLV K;  3H32 B;  1FOS F;  3V4Q A;  2R3C A;  3WMM 0;  1N7S A;  2OYI C;  1NH4 A;  3CI9 A;  3IFM A;  3LIE A;  1SQP K;  1WRG A;  1JTH A;  3E1I A;  3U1C A;  1NU1 K;  1EQ7 A;  2Z5H A;  2WTY A;  2FFD C;  4N78 D;  1HBW A;  1N7S B;  2P67 A;  5APT A;  2NPS D;  2HPC B;  1M1J B;  1L0N K;  4C7N A;  5KJ7 A;  4OH8 B;  1IFI A;  3VP8 A;  1M1J A;  2J2P A;  5AW0 B;  1T3U A;  2XKM A;  1NKZ B;  4R9T A;  1X79 B;  3LID A;  1IFD A;  3RK3 C;  2FFD A;  3NMD A;  1NHL A;  2WWW A;  2N1T B;  1GW3 A;  1NOH A;  1DX7 A;  1FZC A;  1GK4 A;  2N1T A;  1LWU C;  1G2C B;  2WPR A;  5BU5 A;  5CCH D;  5AW1 B;  1L4A C;  1M1J C;  1SQQ K;  3VN0 A;  2YMY A;  3VMY A;  2WNP F;  1JOC A;  3BVH A;  2JHI F;  2O1K A;  3M0D A;  1LTI C;  4M3L A;  1NWQ A;  1SLQ A;  5CHX A;  2KOG A;  5AVZ B;  2YO2 A;  1FZE C;  1HWT C;  2WT7 B;  1FZG A;  5AVS B;  4WBA A;  3RK3 D;  1LWU A;  1L4A A;  4M7F A;  1JTH B;  1J2J B;  1DEB A;  2J3G A;  1FDM A;  3NFQ A;  1HH0 A;  2YKQ A;  3RL0 B;  3A5T A;  1H88 A;  1FZG C;  3TSI A;  2P7J A;  2I1J A;  1GU5 A;  2O1J A;  1S9K D;  1HJB A;  1N7L A;  5BVZ A;  4N78 E;  1VDF A;  1LTS C;  3P8C D;  4WY4 D;  3M9H A;  1J1D C;  3M91 A;  2YO3 A;  2WPS A;  1FZF C;  5AVR B;  1RF1 A;  3BRT B;  1LTJ B;  1W2E A;  3BRV B;  1NAF A;  3MIW A;  2J0Y A;  4WY4 A;  1FZF B;  1JCD A;  1T2K C;  4GT1 A;  2GUV A;  2CPB A;  2J3O A;  2JHK F;  2YKO A;  1ZR2 A;  3P8M C;  4ZFG A;  1FZF A;  3CL3 D;  1FU1 A;  1RF0 C;  3U59 A;  1KIL D;  3MUD A;  4EIJ A;  3A7O A;  3HRN A;  4LLH A;  4RES B;  4AQR D;  1WT6 A;  2GY7 A;  1JMM A;  3BAT A;  3V4W A;  1FOS E;  1GL2 A;  2HPC A;  1HGZ A;  1OXZ A;  1URQ B;  4JYC A;  1LTJ C;  4WY4 B;  2R5D A;  3IR9 A;  3L35 A;  2JEE A;  2A45 G;  1LT9 C;  1HTL C;  4I6M C;  3GHG A;  1IO4 A;  2OYI A;  4DOJ A;  3HE5 A;  3U1A A;  3OJA B;  1A02 F;  2HLO A;  3TYY A;  2D39 A;  2J59 M;  3CLQ A;  1CI6 A;  2P1J A;  1GZL A;  5AW9 B;  2QM7 A;  1OWA A;  4C7N B;  2KP8 A;  3M0D C;  1FJP A;  4EOT A;  4C46 A;  1IFN A;  2FIB A;  4JZC A;  1GU4 A;  2OYH B;  4N6J A;  1KQL A;  2IX7 C;  4WY4 C;  1JC9 A;  3L37 A;  2QM8 A;  2OYH A;  1XTC C;  2POH A;  4HYT B;  1PFI A;  5AVT B;  2M8R A;  1FZB B;  2H43 B;  1CI6 B;  1N7S C;  2W27 A;  2Z5I A;  2L5G B;  1RF0 B;  1LTA C;  1JCC A;  4EPU A;  1ZV8 A;  2W6B A;  1GW4 A;  3PP5 A;  1GK6 A;  3FIB A;  2R32 A;  1JY2 P;  1MUU A;  3GHG C;  1CSB A;  1KZU B;  2OYH C;  2J61 B;  2WPQ A;  3C9I A;  2C9N Y;  3KDP B;  3VYI A;  2I1K A;  1DH3 A;  4I1L A;  1NO4 A;  5AW5 B;  3P32 A;  1N7S D;  2OAR A;  3BAS A;  1RE4 B;  2NPS C;  1JO5 A;  2HYN A;  2HFE D;  3HD7 D;  3H32 A;  1JY3 P;  3HD7 B;  5CCG C;  2J1G A;  3HE4 A;  1GDT A;  3HTK B;  1GD2 E;  2N1T C;  1LTG C;  3HE5 B;  1IFJ A;  5APV A;  3N4X A;  3HUS B;  5BU8 B;  1MZ9 A;  1LTJ A;  5AVQ B;  2JJL A;  1QL1 A;  1N73 A;  1IFM A;  5APQ A;  4N3Y B;  5AW2 B;  2XU6 A;  4KHX A;  3HTK A;  3H32 C;  5AW6 B;  2IFM A;  2Z4E A;  1H89 A;  2A45 I;  1FBM A;  1FZE B;  4LGD E;  1SP4 A;  3V2Q A;  2C9L Y;  3RK3 B;  1Z3U A;  2W6A A;  4GIF A;  3VMZ A;  2OYI B;  2FKW B;  2XZR A;  3RL0 C;  1LWU B;  1FZC B;  3KPE A;  2KLV A;  2O01 H;  2J58 A;  1JY2 N;  2FYU K;  3RK2 D;  2J3F D;  3A2A A;  1FAV A;  1KIL C;  1URQ A;  1QL2 A;  1G1J A;  5CCG A;  1IK9 A;  2FFD B;  1FZE A;  1N86 C;  1LTT C;  3KYQ A;  1NTZ K;  2FXM A;  3V2N A;  5KJ7 D;  2J64 A;  1FIC A;  2GUS A;  1N86 B;  1ZR4 A;  2J0G A;  3EFG A;  3L4F A;  2E43 A;  2N9B A;  3MTU E;  3MGN A;  2C0X A;  1AFO A;  3P8C E;  2P2U A;  2ZFC A;  3TNU A;  1FZA B;  1HGV A;  1SQV K;  2XDJ A;  1FZG B;  2J60 A;  1T2K D;  3II6 A;  2J3U A;  1N86 A;  1FJK A;  2Z4E B;  1GL2 C;  2XNX C;  2H7H A;  3B5N C;  4GKG A;  1JY2 O;  3VMX A;  1X8Y A;  2A45 H;  2NPS A;  2HLO C;  3BVH B;  1HVV A;  2KYV A;  5KJ7 C;  2XNX B;  1N73 B;  4C7R A;  1SFC B;  1G1I A;  3VOP A;  1A02 J;  2JHH C;  3SWF A;  4W80 A;  1N73 C;  1SFC A;  1J1E C;  4ZKP A;  1JY3 O;  1T8Z A;  1H8A A;  3HE4 B;  5AW4 B;  2MJZ A;  4R9J A;  1L0L K;  3SWY A;  1JUN A;  3LW5 H;  1FID A;  1CZQ A;  2JHM F;  1L4A B;  1GL2 D;  1NTM K;  2HPC C;  2Z4E C;  3VTP C;  5APU A;  4IFD K;  3A3Y B;  5CCG D;  1YTZ I;  4JYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...