2HODB

Crystal structure of fragment d from human fibrinogen complexed with gly-hydroxypro-arg-pro-amide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
307
structure length
307
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting/peptide
molecule keywords Fibrinogen alpha chain
total genus 59
structure length 307
sequence length 307
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2006-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hodB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2hodB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2hodB03
3E1IA 3GHGC 2OYIC 2J3GA 1JY2P 1M1JB 1N73B 4JYOX 1FICA 2Z4EB 1FZFA 1FZAC 1LT9C 1RE3B 3HUSB 3H32A 1LT9A 1JY3O 1LTJC 2FFDB 2XNXC 2Z4EC 1LWUB 2JHKF 3BVHC 2Q9IC 1LT9B 2JHMF 1FZEB 2J64A 1RE4B 2HODA 1RF1B 2H43A 1LWUA 1M1JC 1N73C 1FZCC 2J1GA 2J3UA 3BVHB 2J5ZA 2Q9IA 2FIBA 1RE4A 2OYIA 3H32B 1LTJB 1FIBA 2A45H 2J0HA 2HPCB 2H43B 2A45I 2GY7A 1FZGA 2OYHC 1JY3N 1N86A 1FZAA 1N86B 2WNPF 1FZEC 1LTJA 4R9TA 2OYIB 2JHLF 2XNXB 1FZBC 2J0YA 2A45G 1Z3SA 1RF1C 1RF0C 2OYHB 2J0GA 1RF1A 2JHIF 1FZAB 4JZCA 1RE3A 3E1IB 3HUSC 2D39A 2J2PA 1W2EA 2FFDC 1LWUC 1FZDA 1FZGB 1FZFB 2J60A 1RF0B 1FZCA 2HLOA 1T3UA 1FZEA 4R9JA 2HLOC 2JHHC 1N86C 3GHGA 3E1IC 2HODC 3GHGB 1JC9A 1FIDA 1FZBB 2J3OA 2Z4EA 1JY2O 2XNXA 1RF0A 1JY2N 1FZCB 3BVHA 4ZFGA 1M1JA 1N73A 2J61B 4M7HA 2J3FD 4NYTA 2HODB 3H32C 2J3FA 2HPCC 2H43C 1FZBA 2HPCA 1JY3P 2FFDA 2J61A 1FZFC 2OYHA 3FIBA 1FZGC 2Q9IB 4M7FA 3HUSA 1RE3C 4EPUA 2HLOB 1RE4C 1Z3UA
chains in the Genus database with same CATH superfamily
3E1IA 1LTGC 1FICA 2Z4EB 1FZFA 1L0NK 2KI7B 1IK7A 2P58A 2FYZA 1LTAC 1JY3O 2E42A 2M8RA 1KQGB 2CK3H 1L0LD 1P84I 3TYYA 3KZIH 1FZEB 2B88A 1EXIA 3EFFK 2QG4A 2YIUB 3D6ZA 1M1JC 1N73C 2J3UA 3LIEA 3E7KA 4EI2A 2OYIA 2Y0EA 5KKZC 5AW0B 1SQQE 4DZOA 1JY3N 2WNPF 2FYUE 1MKMA 2YKQA 2KYVA 4C7NA 4NPFX 1RF1C 1KV4A 2M5AA 2LR2A 3S1KA 5APSA 2OQQA 4M3LA 1H89A 2K3RA 3AE7C 3CXHE 1YYCA 2H89C 3M9BA 4TT3H 1SFCC 1L4AA 1LJ2A 1T3JA 4JYBA 2JHHC 2Y9ZA 2QM8A 3HE4A 2ZJSE 2WVRA 1ZR4A 4ZFGA 3HRNA 3MUDC 2Z5HA 3H1HE 1LTIC 1HGVA 1KQFB 1VQOP 2FYUJ 2V7QH 2WSFH 1IK9A 4IFMA 5GTIE 3QWOC 2J59M 5M1BA 2QIWA 1VF5B 3EFGA 1IFIA 1CZQA 2P7JA 1LTBC 4XFJA 5KLVJ 3AE9C 2XNXC 2Z4EC 3VMAA 3AE1C 3RL0g 3MZWB 1AQ5A 1RY3A 2N1TD 2O01H 1K04A 1DX7A 3TGUD 3FWLA 4GODA 2QSIA 3C8VA 1SQPJ 1IFNA 2FYUG 1NVOA 1OXZA 2KZIA 5APWA 1N2DC 3NFQA 4BRYB 1SQXD 3GF3A 3L36A 1NTZJ 3H1JD 1VQ5P 1IFJA 3AE2C 1RHZB 1FZBC 2MJZA 3L72J 4ZKUA 1BDDA 4H44C 2FYUD 3A0BH 1RH5B 4H0LB 4EIJA 3HTKB 1N7SD 1RF0B 2YXRB 2IBZI 4R9JA 3AE3C 2KSJA 1NJIQ 4GIFA 2GUVA 3PJSK 4W80A 3RL0B 2KS1B 3BATA 1NWQA 5B5EH 4XE5B 3G3ZA 4WVZA 2IBZG 3GHGC 4HYTB 4OGQD 1LT9C 2KUBA 3HUSB 3H32A 3HD7A 3N4XA 1QL1A 1OW7A 1LT9B 1NU1K 2JHMF 1KZUB 2J64A 2NPSC 4H0LD 1BE3G 5DJTB 3L75G 3CPWO 1SFCD 1LTJB 4BXLA 3FXDA 3PLNA 4YTPC 1FZGA 1URQC 1KTMA 3IN6A 4UB8E 3Q5SA 3CCSP 1BCCE 1S3JA 1X22A 1RF0C 2G3AA 3CCMP 3HE5A 3E1IB 1OVVA 2ZAEB 4Y99C 1FZFB 2Q1KA 1EDIA 2B87B 5CCGC 1X0TA 1WT6A 1HH0A 1G1IA 2J3FA 1VPCA 1HBWA 3FIBA 5CMZA 1PIXA 1NAFA 2WMMA 1OFCX 4U7JA 1JNMA 2IYOA 1OW8A 1LTTC 1KILC 2WSCH 3TNUB 4JBZA 4A7PA 4NPDA 2M3EA 1L0NG 3BVHC 5AVXB 4UB8H 3AE4C 4K35A 1RE4B 2UWJE 3AE5C 2WPQA 3BVHB 1UIXA 2N9YB 4R4LA 1OW6A 2Q9IA 3KYQA 3WMM0 1HGZA 4RKUJ 1AV1A 2LXBA 2ZXEB 2WSSH 1PGJA 1GZLA 3GLMA 4PD4I 1R5SA 1SQBE 1JUNA 3ZDMA 1BCCG 3MD0A 1SQQJ 1K8AQ 4Y99B 1L0LE 3CX5H 4DOJA 2H8PD 1BSNA 4N78D 2JWAA 3VP8A 2J60A 3H25A 1NGMB 1TU3F 3BRVB 2HODC 1SQQK 4PV1D 3SFDC 3CCRP 2OGUA 3B5NA 1BGYD 2XNXA 3V5BA 5APYA 1G1JA 1SQVE 2O01J 5CCHC 3L73D 1LP1B 4OVNF 2IDBA 4M7FA 2L91A 3I56P 1VQ9P 4LC1A 1DH3A 3WU2H 3P8CD 3K5BA 2W6AA 5KTBA 2AXTH 3OW2O 4WY4C 1KYOE 1VQ6P 5EFWB 3RK2B 3B4SA 4EDFA 5KLIB 4H0LC 4PD4D 4GOEA 2JHKF 2K88A 3HD7D 1WMKA 2Y0DA 2JEEA 1VF5D 3L37A 1NTME 3UIAA 3H1JE 2H43A 2I1JA 2KNCA 2FIBA 5AW2B 2IFNA 3H32B 2A45H 5GTHH 3AECC 4L74A 2M3BA 1BGYG 1L0LJ 2KK7A 4D6TG 5GTIH 2YNYA 4GDOA 1BE3E 3H1LJ 2PP6A 2OYIB 1CI6A 1H0TB 3NMDA 3L75D 2A45G 3S9OA 1Z3SA 1G2CA 3HTKA 1VL2A 1EZVG 3GW6A 3HUSC 1NH4A 2BCCE 4BRYA 2IFMA 4C46A 1LWUC 2QJKC 1BGYE 3FGAD 3V6IA 1N7SB 1WRGA 1SQVK 1YJWP 4U3FJ 4QMAA 2I8DA 1LGHB 1FIDA 1KYOD 1FZBB 3D6YA 1EZVI 2IX7C 4M7HA 1L0NJ 2PGDA 2YMKA 3L74E 5BVZA 1SQVJ 4IL6X 1JM0A 1IFDA 1FZGC 4GT1A 2PAJA 3H1KD 3H1IG 1W5CE 3LW5J 1SQBD 3NXSA 1YQ3C 1M1JB 1N73B 4JYOX 1FZAC 1AVYA 4L76A 1URQA 1NO4A 3CXHI 2B89A 3L74G 2WSCJ 1Q82Q 2K9JB 4IFDK 1KYOH 1P84D 1MFTA 1DD3A 5CCHA 2W8ZA 1VQLP 1QX8A 1GL2D 3GMAA 3VN0A 3V2RA 2IZ1A 1Q90D 2O01N 1FIBA 4W7YA 2QA4P 2OYHC 4U3FG 5CBNA 1GK4A 3P32A 1SS1A 1PPJE 4AUWA 2QM7A 3W68A 1EZVD 4DCKA 3G9RA 3R4YA 2W90A 2N1TC 4N78E 2C0XA 1SQBG 2ZT9C 4KHXA 4Z1MH 3V4WA 4U3FD 2E74C 1JOCA 3D70A 1S4XA 1YJNP 3CXHD 3TGUG 3KZIE 2JKVA 3KPEA 2IBZD 2J5UA 2HPCA 2FY8A 2BEZF 5KKZB 5KJ7D 2AEFA 3HUSA 2D2CD 1NTKE 1SQPK 3H6PA 1JY2P 4MN4C 2XU6A 3OAKA 1PGPA 1VQKP 3M9QA 1DEEG 1J2JB 2FFDB 5CCGD 3H1KG 1EDJA 5TISH 1GMJA 1NAYA 2WTYA 1KB9I 2Q9IC 5AVTB 5AW3B 2R5DA 3CC4P 3W67A 2YMYA 3CXHH 1FZCC 2ZVNB 2QJPB 5BU8B 4PD4E 5AVZB 5AVYB 2RN0A 2HPCB 2M0BA 1M7LA 3SSUA 1R5LA 1FJKA 4I7ZC 3PTZA 2JJLA 2KLUA 2E43A 2Q7CA 2OYHB 2IBZE 4GOFA 1NOHA 3RBZA 4I7ZB 4PJ0E 3CCLP 3SWFA 2BASA 1ZRTE 2ZFCA 4PJ0H 1FS0E 1Y47A 1IC2A 3VP9A 3TK1A 1M57D 1JY2N 3I5CA 2XKMA 5KJ7C 2V4HA 4NYTA 3L72G 1FU1A 4PV1B 1NTKJ 2MKVA 3CWBG 2WT7A 2XZRA 2WITA 4IL6E 3A0HE 2E76D 3O8ZA 1YQ4C 2VRSA 1RE4C 2OTJP 2J3GA 1QEXA 3H1JG 3CX5E 2HYNA 2IPPA 4WB4A 1KILE 3L71J 3MUDA 1CI6B 1YTZI 3JSVC 2XV5A 3H1KE 1SQPE 1OVUA 1NTMJ 2FYUK 1L0NE 1E5WA 1BDCA 2KB7P 2ZYGA 1LWUA 1YJ9P 3CWBJ 1EZVE 3CCQP 1H8AA 2KLVA 3L70G 1NTMK 1UIIA 1NYHA 1CW5A 3L71E 5C39A 3TGUJ 1KQSO 1PP9D 2QE7H 3JCUE 2KP8A 4R4MA 1SQXG 3CMEP 1OMIA 5APTA 3TSIA 1S72P 1JTHA 1X79B 1SQXJ 3LIDA 1BE3D 1SQQG 4I6MC 3H1HD 2D2CC 3M9HA 1K73Q 1YTZT 1AA0A 2BCCJ 3CWBE 1Q7YQ 5DJUB 2JWDA 1MFZA 3R2PA 3PH0A 5AVUB 2Q3EA 3RK3D 3RK2C 2YO3A 2JP3A 4OGQC 1S1CX 4WY4D 1BCCJ 5BU5A 3PP5A 4KJMA 1Z3UA 1YI2P 4ASWA 3A2AA 1OZHA 4EYYQ 2OARA 1BSHA 3GG2A 1L4AC 2AEJA 3G4SP 2YO2A 1T8ZA 1CSBA 3IFMA 3AEGC 2KSEA 2JDIH 1DD4A 1L4AD 2YXQB 2W27A 3KQGA 4N6JA 2WT7B 1MUUA 2CPBA 3KXDA 3II6A 1RE4A 2J0HA 4LLHA 4C7NB 5KLIC 3L73J 1Y8AA 1KQLA 1FC2C 3RK2D 2I1KA 2D2CB 2J0YA 2NPSA 4H13C 5KAIE 1KILB 4D6TJ 2V7QJ 2BEQD 1RQVA 2KIKA 5AVQB 1JMMA 1D7MA 4N3YB 2D39A 3D71A 1YIJP 2A06G 1W2EA 2FFDC 4LGDE 1FZEA 2B87A 2C0WA 1JC9A 1J1EC 1T6AA 4OH8B 1NTZG 2J3OA 2GUSA 3QH9A 1SQQD 4RO0A 1FDIA 2P1JA 3C9IA 2J61B 3L35A 2FYNB 3NTNA 3CMAP 1NTMG 2H43C 2WWWA 2B9BA 1JY3P 3L72E 3M0AA 3A0HH 2Q5UA 1KYOI 3MIWA 1RE3C 1M56D 1IFPA 1NTZE 1M8OB 1ZMEC 1XTCC 1RE3B 1N8RQ 2CPSA 1HVVA 3WU2E 1Q2NA 2E76B 1ZOYC 1VF5C 1SQBJ 3M06A 3GF7A 3L73G 1VQPP 1Z56A 2W6BA 2O3JA 4O9BA 2K37A 1HF9A 2Q6QA 1OIPA 1ZR2A 1L0ND 2J1GA 1HTLC 1SVFA 1KILA 1HUCA 3VMYA 4HB1A 1U57A 1KB9E 5KLVD 2N1TB 1S5LX 1BE3J 1VQ8P 2A45I 2QJKB 3AE6C 4BWNA 1NTKG 1NU1E 3IR9A 1N86A 2R3SA 4H44B 1AFOA 1KD1Q 2XNXB 3H1IE 1A02J 4WY4B 1FZAB 3Q1MA 1GW4A 5APQA 5KAFE 1SQVG 1EQ7A 1YITP 3G71P 1FZDA 1FZGB 5CBOA 1S5LE 1NU1G 1FOSE 4L73A 2HLOC 4HKZH 3E1IC 2P2UA 1X9VA 3E1RA 1IO4A 2Z4EA 1JY2O 1N7LA 3H1HG 4JYCA 3A0BE 4RJTA 5CJ4A 2A06D 2J3FD 2G8YA 3OJAB 3H32C 2NZ2A 4RESB 1M1KQ 2NPSB 2XNDH 2J61A 5AW4B 2Q9IB 4OWFA 1IZNB 1T2KC 3RK3C 5B5EE 1PZQA 3SWKA 3CCEP 1S9KE 1PPJD 3PHLA 4PV1C 3T97B 1NTKK 2QJYB 2HFED 2JR8A 4IFFA 2W83C 3H1KJ 1NTZK 2H7HA 4TLFA 2OYOA 1LT1A 1JEKA 1YBKA 1BGYJ 1PGOA 2FXOA 4OGQB 1T2KD 1KC8Q 1P84E 2JHLF 2C9LY 2DW3A 1J1DB 1GL2A 4HJGH 4AQRD 1PL5A 2JHIF 1OWAA 2HG5D 3ITKA 2J2PA 1N7SA 1LNQA 1S5LH 3L74D 3BCCG 3WUTA 1ZN5A 1FZCB 3L72D 1URQB 2N9BA 3L70J 2HPCC 2R44A 2R5BA 2KS1A 2K9YA 5E79H 1EDKA 1AJYA 3RGUA 5APXA 1S2EA 3RK3E 2OTKE 3CL3D 1Q81Q 1PP9J 2QJYC 1QLED 2RH0A 2BCCD 1ZV8A 1QGKB 5KAIH 3Q3DA 3CC7P 3H1HJ 1USDA 4YPCA 1USEA 1OVRA 2OTLP 4I1LA 3KDPB 3BASA 3VTPC 3L70D 3M0DC 2WPVB 3Q2YA 1NTMD 2ZYAA 3KHUA 2NPSD 2QRXA 2KXPB 5CCGA 2O1JA 1SQXK 1KILD 3VMXA 3PRJA 1QL2A 1GW3A 1SLQA 4R9TA 3CWBD 2YIUC 2KNCB 1R8EA 4C7RA 4JZCA 1JMBA 3FX0A 1L4AB 2POHA 5L8RJ 2IYPA 3B5NB 1J1DC 3HE4B 3BCCE 3A7OA 2E75D 4WWIA 5CHXA 1N86C 2ZYDA 2R3CA 3MP7B 2FXMA 1DIPA 1OX3A 1PP9G 1SQVD 5KJ7A 3BVHA 5AW7B 5KLVG 1N7SC 4WY4A 2HODB 1HJ0A 3HD7C 3WUUA 2KOGA 3H1LG 4EOTA 2OYHA 1DEBA 1HJBA 1S9KD 1GTWA 3MTUE 1FE6A 1H88A 1U7MA 1YHQP 3B5NC 2R32A 3P8CE 1VQ7P 1L2PA 2E75C 5H2FH 3SWYA 3V2QA 1KN7A 2Y0CA 1NU1D 2WSFJ 3L75J 1JCCA 1NHLA 3O6QA 3VMZA 1Y9BA 3AEFC 1K9MQ 3H1LD 1FDMA 5KLVE 1QVFO 2XDJA 1KB9H 2H88C 3O6QB 4IL6H 1FAVA 3CD6P 5KLVK 5AW5B 2YKOA 2Q3IA 3P8MC 4Y28J 3M91A 3AEEC 3VYIA 1P84H 1FDOA 1FZAA 1FZEC 3L74J 2E75B 3LW5H 1J1EB 2K1AA 2J58A 3AEDC 1NU1J 3RK3B 1PPJG 3SFEC 1VDFA 3L73E 2WSEH 3B5ND 2ZT9B 3VOPA 4DJGA 1FOSF 2A06E 4L75A 3H1JJ 1NTZD 1BCCD 1KB9D 5APUA 3HD7B 3MGNA 5AVRB 2LXCB 2WPSA 1ZLLA 5E79E 1FZBA 2PRRA 3V4QA 2C9NY 1GK6A 1GDTA 2HLOB 5CJ0A 5CCHD 1XTGB 4ZMDA 3B71A 3V2PA 2ZVOB 3L75E 1LT9A 4UB6E 5AVVB 5TISE 3RL0D 3USSA 3L70E 3EWKA 1GL2C 3CCUP 3AE8C 1X8YA 3BCCD 5B66H 1L0LK 2HODA 4H13B 2ZXXA 2O1KA 4IOIH 1RF1B 3BCCJ 2J5ZA 4GKGA 1URQD 5TJHA 2E76C 1NKNA 1PP9E 2H43B 1PFIA 5AW9B 1GD2E 2GY7A 4D6TE 5AW8B 2AEMA 4WBAA 5AW6B 1KMIZ 5AW1B 4JQ0D 2J0GA 2BCCG 1RE3A 1LTSC 1PGQA 3ABVC 3A3YB 1IJDB 1SP4A 2K9JA 2E74B 1FZCA 5B66E 3GHGB 1L0LG 3BRTB 3MHVA 3U1AA 3G6EP 3CX5D 1M1JA 1W2BO 1N73A 3B8EB 3CC2P 3I55P 4UB6H 3L71G 3CCVP 2N1TA 3JC22 4H13D 1G2CB 4EPUA 3C1LA 5K5GB 1VQ4P 1GL2B 2FKWB 1LTJC 4B86A 4ASVA 2YKPA 4ZNCA 1VQNP 1JB0J 4H44D 1GU4A 2P10A 1KFMA 3CI9A 2ITAA 2LKMA 2L5GB 2JO1A 2RMZA 5KAFH 4K3AA 4PD4H 2QVAA 3H1IJ 5APVA 1VQMP 1JTHB 2Y9YA 3OA7A 3CLQA 1H0TA 4AYCA 2IZ0A 3CX5I 1E79H 4W7ZA 1ZXGA 1MZ9A 4HH2A 1A02F 3RBXA 4D6TD 3V2NA 1K05A 1SQXE 3IF4A 1FJPA 2HLOA 2NRGA 1T3UA 2WZ7A 2GA1A 1NKZB 5AVWB 1ZW0A 1SQPG 3S4RA 1RF0A 3Q5RA 1EC5A 1LP1A 3TGUE 1IFMA 2WQYC 1JCDA 2E74D 2FFDA 1FZFC 1AVOA 1RQUA 3T97A 3N7NA 3P7KA 3F89A 2Z5IA 2WPRA 4KT0J 2QEXP 4YXWH 4JF7A 2OYIC 4XA4A 1ZRTD 2P67A 3L71D 3M0DA 4U3FE 3HE5B 1KFNA 1PV3A 1GU5A 3F5HA 3WUVA 1EDLA 1EXJA 3FWNA 3TDKA 1LWUB 2E5TA 1JO5A 1NTKD 2AXTE 2WSEJ 1KORA 4DT0A 3RL0C 2HR3A 1HWTC 2W6JH 2KZJA 2RKLA 3CCJP 3EQ2A 5AVSB 3FXEA 2QJPC 4CPGA 2M5AB 3A5TA 1QVGO 1N86B 2FXPA 1LTJA 4ZKPA 1AQTA 3AEBC 4JPZB 1RF1A 1SFCB 2AXCA 1Q86Q 2PFXA 4I2LC 1FBMA 3JCUH 3U59A 3H1ID 5H2FE 1SFCA 1SQPD 3AEAC 1ZP0C 3GHGA 2GM4A 1U7JA 1MV8A 2FBWC 1SQBK 3L4FA 3IAOA 3H1LE 2ZT9D 2E5YA 3U1CA 3TNUA 2SPZA 1M90Q 4NPEA 3TF5A 2FYNC 4YXDC 5GTHE 3Q5PA
chains in the Genus database with same CATH topology
3E1IA 3B5NC 4LC1A 1DH3A 3A2AA 3P8CD 2W6AA 2R32A 2OARA 5KTBA 1LTGC 3P8CE 1FICA 1FZFA 1L0NK 2Z4EB 4WY4C 2FYZA 1L4AC 1LTAC 1JY3O 2E42A 3SWYA 2M8RA 3RK2B 3V2QA 2YO2A 2JHKF 1JCCA 1CSBA 1NHLA 1T8ZA 3VMZA 3TYYA 3HD7D 3IFMA 1FDMA 1FZEB 2JEEA 1Z3UA 2XDJA 3L37A 1L4AD 3UIAA 2W27A 2H43A 1M1JC 1N73C 2J3UA 3KQGA 4N6JA 2WT7B 1FAVA 2I1JA 1MUUA 2CPBA 3LIEA 5KLVK 2FIBA 5AW5B 3II6A 1RE4A 2YKOA 5AW2B 2IFNA 2Q3IA 2OYIA 3H32B 2A45H 2J0HA 4LLHA 4C7NB 3P8MC 2M3BA 5AW0B 4DZOA 1KQLA 3M91A 1JY3N 3VYIA 1FZAA 2WNPF 1FZEC 2YNYA 3LW5H 3RK2D 1J1EB 2PP6A 2I1KA 1CI6A 2OYIB 2YKQA 2J0YA 2J58A 2KYVA 2NPSA 3NMDA 4C7NA 3RK3B 2A45G 1KILB 1Z3SA 1RF1C 1G2CA 3HTKA 1VDFA 5APSA 5AVQB 1JMMA 4N3YB 3HUSC 2WSEH 3B5ND 2D39A 3VOPA 1NH4A 4M3LA 1H89A 2IFMA 1FOSF 4C46A 1W2EA 2FFDC 1LWUC 4LGDE 1YYCA 3M9BA 1SFCC 1L4AA 4JYBA 1T3JA 1FZEA 1N7SB 2JHHC 1WRGA 5APUA 3HD7B 1SQVK 2C0WA 2QM8A 1J1EC 1JC9A 3HE4A 4OH8B 1LGHB 1FIDA 1FZBB 2J3OA 2GUSA 2P1JA 3C9IA 3MGNA 1ZR4A 5AVRB 2J61B 3L35A 4ZFGA 3HRNA 2IX7C 2Z5HA 3NTNA 4M7HA 2WPSA 1LTIC 1HGVA 1ZLLA 2H43C 5BVZA 1FZBA 2WWWA 3V4QA 1JY3P 2WSFH 3M0AA 1IFDA 2Q5UA 1FZGC 4GT1A 2PAJA 2C9NY 1GK6A 3MIWA 1RE3C 1GDTA 1IK9A 4IFMA 2HLOB 2J59M 5CJ0A 5CCHD 1XTGB 3EFGA 3NXSA 1M1JB 1IFIA 1N73B 1CZQA 2P7JA 4JYOX 1XTCC 1FZAC 3V2PA 1LTBC 1RE3B 2CPSA 1HVVA 1LT9A 1URQA 1NO4A 5AVVB 3M06A 2XNXC 3RL0D 2Z4EC 1GL2C 4IFDK 1X8YA 1AQ5A 1Z56A 1RY3A 2W6BA 2N1TD 1L0LK 2O01H 4O9BA 2HODA 5CCHA 1DX7A 1ZR2A 2O1KA 1RF1B 1IFNA 2J1GA 1HTLC 1SVFA 2J5ZA 1KILA 1OXZA 1GL2D 1HUCA 4GKGA 3VMYA 3VN0A 1URQD 3V2RA 1NKNA 5APWA 1FIBA 1N2DC 2H43B 2N1TB 1PFIA 2A45I 3NFQA 3L36A 4W7YA 5AW9B 1GD2E 2GY7A 2OYHC 3IR9A 5AW8B 1N86A 1IFJA 1GK4A 3P32A 1AFOA 4WBAA 2XNXB 5AW6B 1FZBC 2MJZA 5AW1B 4AUWA 2QM7A 4ZKUA 1A02J 2J0GA 4WY4B 1FZAB 1RE3A 1LTSC 3A3YB 1GW4A 5APQA 1IJDB 1EQ7A 4EIJA 2N1TC 4N78E 3HTKB 1FZDA 1FZGB 1SP4A 1N7SD 2C0XA 1RF0B 1FZCA 1FOSE 4R9JA 2HLOC 3E1IC 2KSJA 4KHXA 2P2UA 3GHGB 3V4WA 1X9VA 4GIFA 1IO4A 2GUVA 2Z4EA 1JY2O 1N7LA 3BRTB 4W80A 3U1AA 4JYCA 3RL0B 1JOCA 1M1JA 1N73A 3B8EB 5CJ4A 3BATA 1NWQA 2J3FD 3OJAB 3H32C 4RESB 2N1TA 2NPSB 3KPEA 2HPCA 4XE5B 5KJ7D 2J61A 1G2CB 5AW4B 2Q9IB 3G3ZA 3HUSA 4EPUA 3GHGC 1SQPK 1T2KC 3H6PA 3RK3C 1JY2P 2XU6A 3OAKA 4HYTB 1GL2B 1LT9C 3HUSB 3M9QA 3H32A 2FKWB 1S9KE 1J2JB 1LTJC 4B86A 3HD7A 2FFDB 5CCGD 3N4XA 1QL1A 2YKPA 1NTKK 2WTYA 2HFED 4IFFA 2Q9IC 1LT9B 1NU1K 2JHMF 5AVTB 5AW3B 1KZUB 2R5DA 1GU4A 2J64A 2NPSC 1NTZK 2YMYA 2H7HA 1FZCC 1KFMA 3CI9A 5BU8B 5AVZB 5AVYB 2LKMA 2L5GB 1SFCD 1LTJB 2HPCB 1M7LA 1T2KD 5APVA 1FZGA 1FJKA 1JTHB 1URQC 3OA7A 2JHLF 2JJLA 3CLQA 4AYCA 2C9LY 2E43A 1J1DB 1GL2A 2Q7CA 4AQRD 1RF0C 4W7ZA 2OYHB 2JHIF 1MZ9A 1NOHA 3HE5A 1OWAA 3E1IB 2HG5D 4HH2A 1A02F 2J2PA 3SWFA 2BASA 4Y99C 3V2NA 1FZFB 1FJPA 2HLOA 1N7SA 1T3UA 2ZFCA 2WZ7A 1NKZB 5AVWB 1IC2A 5CCGC 3VP9A 3TK1A 1ZN5A 1RF0A 1JY2N 1WT6A 1FZCB 3I5CA 2XKMA 5KJ7C 1URQB 2N9BA 1HH0A 4NYTA 1IFMA 1G1IA 2J3FA 1FU1A 2HPCC 1VPCA 2R5BA 1JCDA 2WT7A 2XZRA 2FFDA 1HBWA 1FZFC 3FIBA 2WITA 3T97A 5CMZA 3N7NA 3P7KA 5APXA 3O8ZA 2VRSA 1NAFA 2Z5IA 2WPRA 1RE4C 3CL3D 4JF7A 1JNMA 2OYIC 2J3GA 4XA4A 1LTTC 2P67A 2HYNA 1KILC 2IPPA 3M0DA 4WB4A 3HE5B 2WSCH 3MUDA 1CI6B 1YTZI 1KFNA 1GU5A 3TNUB 2XV5A 1ZV8A 1LWUB 2FYUK 3BVHC 1E5WA 5AVXB 1JO5A 1RE4B 2KB7P 4I1LA 3KDPB 3RL0C 3BASA 1LWUA 2WPQA 3VTPC 3M0DC 3BVHB 1HWTC 2Q9IA 3KYQA 3EQ2A 2NPSD 5AVSB 5CCGA 3WMM0 2KLVA 1HGZA 1H8AA 2O1JA 1SQXK 1NTMK 1KILD 3VMXA 2ZXEB 1CW5A 1GZLA 1QL2A 1GW3A 3A5TA 1N86B 1SLQA 1LTJA 1JUNA 2KP8A 4ZKPA 4R9TA 3MD0A 4Y99B 4DOJA 2H8PD 5APTA 3TSIA 4C7RA 1RF1A 4JZCA 1JTHA 4N78D 1SFCB 1X79B 1L4AB 3LIDA 4I6MC 2POHA 3B5NB 3M9HA 1J1DC 3HE4B 4I2LC 1FBMA 3VP8A 3U59A 2J60A 1YTZT 3A7OA 5CHXA 1SFCA 1N86C 3BRVB 2R3CA 3GHGA 2HODC 1SQQK 2FXMA 2GM4A 3B5NA 2XNXA 1MV8A 3V5BA 5KJ7A 5APYA 3BVHA 3L4FA 1G1JA 1SQBK 5AW7B 1MFZA 3R2PA 1N7SC 4WY4A 5AVUB 2HODB 3HD7C 3RK3D 3RK2C 2KOGA 2YO3A 5CCHC 3U1CA 3TNUA 4WY4D 4EOTA 2OYHA 5BU5A 1DEBA 4M7FA 3PP5A 1HJBA 1S9KD 1GTWA 3MTUE 1H88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1I A;  3GHG C;  2OYI C;  2J3G A;  1JY2 P;  1M1J B;  1N73 B;  4JYO X;  1FIC A;  2Z4E B;  1FZF A;  1FZA C;  1LT9 C;  1RE3 B;  3HUS B;  3H32 A;  1LT9 A;  1JY3 O;  1LTJ C;  2FFD B;  2XNX C;  2Z4E C;  1LWU B;  2JHK F;  3BVH C;  2Q9I C;  1LT9 B;  2JHM F;  1FZE B;  2J64 A;  1RE4 B;  2HOD A;  1RF1 B;  2H43 A;  1LWU A;  1M1J C;  1N73 C;  1FZC C;  2J1G A;  2J3U A;  3BVH B;  2J5Z A;  2Q9I A;  2FIB A;  1RE4 A;  2OYI A;  3H32 B;  1LTJ B;  1FIB A;  2A45 H;  2J0H A;  2HPC B;  2H43 B;  2A45 I;  2GY7 A;  1FZG A;  2OYH C;  1JY3 N;  1N86 A;  1FZA A;  1N86 B;  2WNP F;  1FZE C;  1LTJ A;  4R9T A;  2OYI B;  2JHL F;  2XNX B;  1FZB C;  2J0Y A;  2A45 G;  1Z3S A;  1RF1 C;  1RF0 C;  2OYH B;  2J0G A;  1RF1 A;  2JHI F;  1FZA B;  4JZC A;  1RE3 A;  3E1I B;  3HUS C;  2D39 A;  2J2P A;  1W2E A;  2FFD C;  1LWU C;  1FZD A;  1FZG B;  1FZF B;  2J60 A;  1RF0 B;  1FZC A;  2HLO A;  1T3U A;  1FZE A;  4R9J A;  2HLO C;  2JHH C;  1N86 C;  3GHG A;  3E1I C;  2HOD C;  3GHG B;  1JC9 A;  1FID A;  1FZB B;  2J3O A;  2Z4E A;  1JY2 O;  2XNX A;  1RF0 A;  1JY2 N;  1FZC B;  3BVH A;  4ZFG A;  1M1J A;  1N73 A;  2J61 B;  4M7H A;  2J3F D;  4NYT A;  2HOD B;  3H32 C;  2J3F A;  2HPC C;  2H43 C;  1FZB A;  2HPC A;  1JY3 P;  2FFD A;  2J61 A;  1FZF C;  2OYH A;  3FIB A;  1FZG C;  2Q9I B;  4M7F A;  3HUS A;  1RE3 C;  4EPU A;  2HLO B;  1RE4 C;  1Z3U A; 
#chains in the Genus database with same CATH topology
 3E1I A;  1LTG C;  1FIC A;  2Z4E B;  1FZF A;  1L0N K;  2KI7 B;  1IK7 A;  2P58 A;  2FYZ A;  1LTA C;  1JY3 O;  2E42 A;  2M8R A;  1KQG B;  2CK3 H;  1L0L D;  1P84 I;  3TYY A;  3KZI H;  1FZE B;  2B88 A;  1EXI A;  3EFF K;  2QG4 A;  2YIU B;  3D6Z A;  1M1J C;  1N73 C;  2J3U A;  3LIE A;  3E7K A;  4EI2 A;  2OYI A;  2Y0E A;  5KKZ C;  5AW0 B;  1SQQ E;  4DZO A;  1JY3 N;  2WNP F;  2FYU E;  1MKM A;  2YKQ A;  2KYV A;  4C7N A;  4NPF X;  1RF1 C;  1KV4 A;  2M5A A;  2LR2 A;  3S1K A;  5APS A;  2OQQ A;  4M3L A;  1H89 A;  2K3R A;  3AE7 C;  3CXH E;  1YYC A;  2H89 C;  3M9B A;  4TT3 H;  1SFC C;  1L4A A;  1LJ2 A;  1T3J A;  4JYB A;  2JHH C;  2Y9Z A;  2QM8 A;  3HE4 A;  2ZJS E;  2WVR A;  1ZR4 A;  4ZFG A;  3HRN A;  3MUD C;  2Z5H A;  3H1H E;  1LTI C;  1HGV A;  1KQF B;  1VQO P;  2FYU J;  2V7Q H;  2WSF H;  1IK9 A;  4IFM A;  5GTI E;  3QWO C;  2J59 M;  5M1B A;  2QIW A;  1VF5 B;  3EFG A;  1IFI A;  1CZQ A;  2P7J A;  1LTB C;  4XFJ A;  5KLV J;  3AE9 C;  2XNX C;  2Z4E C;  3VMA A;  3AE1 C;  3RL0 g;  3MZW B;  1AQ5 A;  1RY3 A;  2N1T D;  2O01 H;  1K04 A;  1DX7 A;  3TGU D;  3FWL A;  4GOD A;  2QSI A;  3C8V A;  1SQP J;  1IFN A;  2FYU G;  1NVO A;  1OXZ A;  2KZI A;  5APW A;  1N2D C;  3NFQ A;  4BRY B;  1SQX D;  3GF3 A;  3L36 A;  1NTZ J;  3H1J D;  1VQ5 P;  1IFJ A;  3AE2 C;  1RHZ B;  1FZB C;  2MJZ A;  3L72 J;  4ZKU A;  1BDD A;  4H44 C;  2FYU D;  3A0B H;  1RH5 B;  4H0L B;  4EIJ A;  3HTK B;  1N7S D;  1RF0 B;  2YXR B;  2IBZ I;  4R9J A;  3AE3 C;  2KSJ A;  1NJI Q;  4GIF A;  2GUV A;  3PJS K;  4W80 A;  3RL0 B;  2KS1 B;  3BAT A;  1NWQ A;  5B5E H;  4XE5 B;  3G3Z A;  4WVZ A;  2IBZ G;  3GHG C;  4HYT B;  4OGQ D;  1LT9 C;  2KUB A;  3HUS B;  3H32 A;  3HD7 A;  3N4X A;  1QL1 A;  1OW7 A;  1LT9 B;  1NU1 K;  2JHM F;  1KZU B;  2J64 A;  2NPS C;  4H0L D;  1BE3 G;  5DJT B;  3L75 G;  3CPW O;  1SFC D;  1LTJ B;  4BXL A;  3FXD A;  3PLN A;  4YTP C;  1FZG A;  1URQ C;  1KTM A;  3IN6 A;  4UB8 E;  3Q5S A;  3CCS P;  1BCC E;  1S3J A;  1X22 A;  1RF0 C;  2G3A A;  3CCM P;  3HE5 A;  3E1I B;  1OVV A;  2ZAE B;  4Y99 C;  1FZF B;  2Q1K A;  1EDI A;  2B87 B;  5CCG C;  1X0T A;  1WT6 A;  1HH0 A;  1G1I A;  2J3F A;  1VPC A;  1HBW A;  3FIB A;  5CMZ A;  1PIX A;  1NAF A;  2WMM A;  1OFC X;  4U7J A;  1JNM A;  2IYO A;  1OW8 A;  1LTT C;  1KIL C;  2WSC H;  3TNU B;  4JBZ A;  4A7P A;  4NPD A;  2M3E A;  1L0N G;  3BVH C;  5AVX B;  4UB8 H;  3AE4 C;  4K35 A;  1RE4 B;  2UWJ E;  3AE5 C;  2WPQ A;  3BVH B;  1UIX A;  2N9Y B;  4R4L A;  1OW6 A;  2Q9I A;  3KYQ A;  3WMM 0;  1HGZ A;  4RKU J;  1AV1 A;  2LXB A;  2ZXE B;  2WSS H;  1PGJ A;  1GZL A;  3GLM A;  4PD4 I;  1R5S A;  1SQB E;  1JUN A;  3ZDM A;  1BCC G;  3MD0 A;  1SQQ J;  1K8A Q;  4Y99 B;  1L0L E;  3CX5 H;  4DOJ A;  2H8P D;  1BSN A;  4N78 D;  2JWA A;  3VP8 A;  2J60 A;  3H25 A;  1NGM B;  1TU3 F;  3BRV B;  2HOD C;  1SQQ K;  4PV1 D;  3SFD C;  3CCR P;  2OGU A;  3B5N A;  1BGY D;  2XNX A;  3V5B A;  5APY A;  1G1J A;  1SQV E;  2O01 J;  5CCH C;  3L73 D;  1LP1 B;  4OVN F;  2IDB A;  4M7F A;  2L91 A;  3I56 P;  1VQ9 P;  4LC1 A;  1DH3 A;  3WU2 H;  3P8C D;  3K5B A;  2W6A A;  5KTB A;  2AXT H;  3OW2 O;  4WY4 C;  1KYO E;  1VQ6 P;  5EFW B;  3RK2 B;  3B4S A;  4EDF A;  5KLI B;  4H0L C;  4PD4 D;  4GOE A;  2JHK F;  2K88 A;  3HD7 D;  1WMK A;  2Y0D A;  2JEE A;  1VF5 D;  3L37 A;  1NTM E;  3UIA A;  3H1J E;  2H43 A;  2I1J A;  2KNC A;  2FIB A;  5AW2 B;  2IFN A;  3H32 B;  2A45 H;  5GTH H;  3AEC C;  4L74 A;  2M3B A;  1BGY G;  1L0L J;  2KK7 A;  4D6T G;  5GTI H;  2YNY A;  4GDO A;  1BE3 E;  3H1L J;  2PP6 A;  2OYI B;  1CI6 A;  1H0T B;  3NMD A;  3L75 D;  2A45 G;  3S9O A;  1Z3S A;  1G2C A;  3HTK A;  1VL2 A;  1EZV G;  3GW6 A;  3HUS C;  1NH4 A;  2BCC E;  4BRY A;  2IFM A;  4C46 A;  1LWU C;  2QJK C;  1BGY E;  3FGA D;  3V6I A;  1N7S B;  1WRG A;  1SQV K;  1YJW P;  4U3F J;  4QMA A;  2I8D A;  1LGH B;  1FID A;  1KYO D;  1FZB B;  3D6Y A;  1EZV I;  2IX7 C;  4M7H A;  1L0N J;  2PGD A;  2YMK A;  3L74 E;  5BVZ A;  1SQV J;  4IL6 X;  1JM0 A;  1IFD A;  1FZG C;  4GT1 A;  2PAJ A;  3H1K D;  3H1I G;  1W5C E;  3LW5 J;  1SQB D;  3NXS A;  1YQ3 C;  1M1J B;  1N73 B;  4JYO X;  1FZA C;  1AVY A;  4L76 A;  1URQ A;  1NO4 A;  3CXH I;  2B89 A;  3L74 G;  2WSC J;  1Q82 Q;  2K9J B;  4IFD K;  1KYO H;  1P84 D;  1MFT A;  1DD3 A;  5CCH A;  2W8Z A;  1VQL P;  1QX8 A;  1GL2 D;  3GMA A;  3VN0 A;  3V2R A;  2IZ1 A;  1Q90 D;  2O01 N;  1FIB A;  4W7Y A;  2QA4 P;  2OYH C;  4U3F G;  5CBN A;  1GK4 A;  3P32 A;  1SS1 A;  1PPJ E;  4AUW A;  2QM7 A;  3W68 A;  1EZV D;  4DCK A;  3G9R A;  3R4Y A;  2W90 A;  2N1T C;  4N78 E;  2C0X A;  1SQB G;  2ZT9 C;  4KHX A;  4Z1M H;  3V4W A;  4U3F D;  2E74 C;  1JOC A;  3D70 A;  1S4X A;  1YJN P;  3CXH D;  3TGU G;  3KZI E;  2JKV A;  3KPE A;  2IBZ D;  2J5U A;  2HPC A;  2FY8 A;  2BEZ F;  5KKZ B;  5KJ7 D;  2AEF A;  3HUS A;  2D2C D;  1NTK E;  1SQP K;  3H6P A;  1JY2 P;  4MN4 C;  2XU6 A;  3OAK A;  1PGP A;  1VQK P;  3M9Q A;  1DEE G;  1J2J B;  2FFD B;  5CCG D;  3H1K G;  1EDJ A;  5TIS H;  1GMJ A;  1NAY A;  2WTY A;  1KB9 I;  2Q9I C;  5AVT B;  5AW3 B;  2R5D A;  3CC4 P;  3W67 A;  2YMY A;  3CXH H;  1FZC C;  2ZVN B;  2QJP B;  5BU8 B;  4PD4 E;  5AVZ B;  5AVY B;  2RN0 A;  2HPC B;  2M0B A;  1M7L A;  3SSU A;  1R5L A;  1FJK A;  4I7Z C;  3PTZ A;  2JJL A;  2KLU A;  2E43 A;  2Q7C A;  2OYH B;  2IBZ E;  4GOF A;  1NOH A;  3RBZ A;  4I7Z B;  4PJ0 E;  3CCL P;  3SWF A;  2BAS A;  1ZRT E;  2ZFC A;  4PJ0 H;  1FS0 E;  1Y47 A;  1IC2 A;  3VP9 A;  3TK1 A;  1M57 D;  1JY2 N;  3I5C A;  2XKM A;  5KJ7 C;  2V4H A;  4NYT A;  3L72 G;  1FU1 A;  4PV1 B;  1NTK J;  2MKV A;  3CWB G;  2WT7 A;  2XZR A;  2WIT A;  4IL6 E;  3A0H E;  2E76 D;  3O8Z A;  1YQ4 C;  2VRS A;  1RE4 C;  2OTJ P;  2J3G A;  1QEX A;  3H1J G;  3CX5 E;  2HYN A;  2IPP A;  4WB4 A;  1KIL E;  3L71 J;  3MUD A;  1CI6 B;  1YTZ I;  3JSV C;  2XV5 A;  3H1K E;  1SQP E;  1OVU A;  1NTM J;  2FYU K;  1L0N E;  1E5W A;  1BDC A;  2KB7 P;  2ZYG A;  1LWU A;  1YJ9 P;  3CWB J;  1EZV E;  3CCQ P;  1H8A A;  2KLV A;  3L70 G;  1NTM K;  1UII A;  1NYH A;  1CW5 A;  3L71 E;  5C39 A;  3TGU J;  1KQS O;  1PP9 D;  2QE7 H;  3JCU E;  2KP8 A;  4R4M A;  1SQX G;  3CME P;  1OMI A;  5APT A;  3TSI A;  1S72 P;  1JTH A;  1X79 B;  1SQX J;  3LID A;  1BE3 D;  1SQQ G;  4I6M C;  3H1H D;  2D2C C;  3M9H A;  1K73 Q;  1YTZ T;  1AA0 A;  2BCC J;  3CWB E;  1Q7Y Q;  5DJU B;  2JWD A;  1MFZ A;  3R2P A;  3PH0 A;  5AVU B;  2Q3E A;  3RK3 D;  3RK2 C;  2YO3 A;  2JP3 A;  4OGQ C;  1S1C X;  4WY4 D;  1BCC J;  5BU5 A;  3PP5 A;  4KJM A;  1Z3U A;  1YI2 P;  4ASW A;  3A2A A;  1OZH A;  4EYY Q;  2OAR A;  1BSH A;  3GG2 A;  1L4A C;  2AEJ A;  3G4S P;  2YO2 A;  1T8Z A;  1CSB A;  3IFM A;  3AEG C;  2KSE A;  2JDI H;  1DD4 A;  1L4A D;  2YXQ B;  2W27 A;  3KQG A;  4N6J A;  2WT7 B;  1MUU A;  2CPB A;  3KXD A;  3II6 A;  1RE4 A;  2J0H A;  4LLH A;  4C7N B;  5KLI C;  3L73 J;  1Y8A A;  1KQL A;  1FC2 C;  3RK2 D;  2I1K A;  2D2C B;  2J0Y A;  2NPS A;  4H13 C;  5KAI E;  1KIL B;  4D6T J;  2V7Q J;  2BEQ D;  1RQV A;  2KIK A;  5AVQ B;  1JMM A;  1D7M A;  4N3Y B;  2D39 A;  3D71 A;  1YIJ P;  2A06 G;  1W2E A;  2FFD C;  4LGD E;  1FZE A;  2B87 A;  2C0W A;  1JC9 A;  1J1E C;  1T6A A;  4OH8 B;  1NTZ G;  2J3O A;  2GUS A;  3QH9 A;  1SQQ D;  4RO0 A;  1FDI A;  2P1J A;  3C9I A;  2J61 B;  3L35 A;  2FYN B;  3NTN A;  3CMA P;  1NTM G;  2H43 C;  2WWW A;  2B9B A;  1JY3 P;  3L72 E;  3M0A A;  3A0H H;  2Q5U A;  1KYO I;  3MIW A;  1RE3 C;  1M56 D;  1IFP A;  1NTZ E;  1M8O B;  1ZME C;  1XTC C;  1RE3 B;  1N8R Q;  2CPS A;  1HVV A;  3WU2 E;  1Q2N A;  2E76 B;  1ZOY C;  1VF5 C;  1SQB J;  3M06 A;  3GF7 A;  3L73 G;  1VQP P;  1Z56 A;  2W6B A;  2O3J A;  4O9B A;  2K37 A;  1HF9 A;  2Q6Q A;  1OIP A;  1ZR2 A;  1L0N D;  2J1G A;  1HTL C;  1SVF A;  1KIL A;  1HUC A;  3VMY A;  4HB1 A;  1U57 A;  1KB9 E;  5KLV D;  2N1T B;  1S5L X;  1BE3 J;  1VQ8 P;  2A45 I;  2QJK B;  3AE6 C;  4BWN A;  1NTK G;  1NU1 E;  3IR9 A;  1N86 A;  2R3S A;  4H44 B;  1AFO A;  1KD1 Q;  2XNX B;  3H1I E;  1A02 J;  4WY4 B;  1FZA B;  3Q1M A;  1GW4 A;  5APQ A;  5KAF E;  1SQV G;  1EQ7 A;  1YIT P;  3G71 P;  1FZD A;  1FZG B;  5CBO A;  1S5L E;  1NU1 G;  1FOS E;  4L73 A;  2HLO C;  4HKZ H;  3E1I C;  2P2U A;  1X9V A;  3E1R A;  1IO4 A;  2Z4E A;  1JY2 O;  1N7L A;  3H1H G;  4JYC A;  3A0B E;  4RJT A;  5CJ4 A;  2A06 D;  2J3F D;  2G8Y A;  3OJA B;  3H32 C;  2NZ2 A;  4RES B;  1M1K Q;  2NPS B;  2XND H;  2J61 A;  5AW4 B;  2Q9I B;  4OWF A;  1IZN B;  1T2K C;  3RK3 C;  5B5E E;  1PZQ A;  3SWK A;  3CCE P;  1S9K E;  1PPJ D;  3PHL A;  4PV1 C;  3T97 B;  1NTK K;  2QJY B;  2HFE D;  2JR8 A;  4IFF A;  2W83 C;  3H1K J;  1NTZ K;  2H7H A;  4TLF A;  2OYO A;  1LT1 A;  1JEK A;  1YBK A;  1BGY J;  1PGO A;  2FXO A;  4OGQ B;  1T2K D;  1KC8 Q;  1P84 E;  2JHL F;  2C9L Y;  2DW3 A;  1J1D B;  1GL2 A;  4HJG H;  4AQR D;  1PL5 A;  2JHI F;  1OWA A;  2HG5 D;  3ITK A;  2J2P A;  1N7S A;  1LNQ A;  1S5L H;  3L74 D;  3BCC G;  3WUT A;  1ZN5 A;  1FZC B;  3L72 D;  1URQ B;  2N9B A;  3L70 J;  2HPC C;  2R44 A;  2R5B A;  2KS1 A;  2K9Y A;  5E79 H;  1EDK A;  1AJY A;  3RGU A;  5APX A;  1S2E A;  3RK3 E;  2OTK E;  3CL3 D;  1Q81 Q;  1PP9 J;  2QJY C;  1QLE D;  2RH0 A;  2BCC D;  1ZV8 A;  1QGK B;  5KAI H;  3Q3D A;  3CC7 P;  3H1H J;  1USD A;  4YPC A;  1USE A;  1OVR A;  2OTL P;  4I1L A;  3KDP B;  3BAS A;  3VTP C;  3L70 D;  3M0D C;  2WPV B;  3Q2Y A;  1NTM D;  2ZYA A;  3KHU A;  2NPS D;  2QRX A;  2KXP B;  5CCG A;  2O1J A;  1SQX K;  1KIL D;  3VMX A;  3PRJ A;  1QL2 A;  1GW3 A;  1SLQ A;  4R9T A;  3CWB D;  2YIU C;  2KNC B;  1R8E A;  4C7R A;  4JZC A;  1JMB A;  3FX0 A;  1L4A B;  2POH A;  5L8R J;  2IYP A;  3B5N B;  1J1D C;  3HE4 B;  3BCC E;  3A7O A;  2E75 D;  4WWI A;  5CHX A;  1N86 C;  2ZYD A;  2R3C A;  3MP7 B;  2FXM A;  1DIP A;  1OX3 A;  1PP9 G;  1SQV D;  5KJ7 A;  3BVH A;  5AW7 B;  5KLV G;  1N7S C;  4WY4 A;  2HOD B;  1HJ0 A;  3HD7 C;  3WUU A;  2KOG A;  3H1L G;  4EOT A;  2OYH A;  1DEB A;  1HJB A;  1S9K D;  1GTW A;  3MTU E;  1FE6 A;  1H88 A;  1U7M A;  1YHQ P;  3B5N C;  2R32 A;  3P8C E;  1VQ7 P;  1L2P A;  2E75 C;  5H2F H;  3SWY A;  3V2Q A;  1KN7 A;  2Y0C A;  1NU1 D;  2WSF J;  3L75 J;  1JCC A;  1NHL A;  3O6Q A;  3VMZ A;  1Y9B A;  3AEF C;  1K9M Q;  3H1L D;  1FDM A;  5KLV E;  1QVF O;  2XDJ A;  1KB9 H;  2H88 C;  3O6Q B;  4IL6 H;  1FAV A;  3CD6 P;  5KLV K;  5AW5 B;  2YKO A;  2Q3I A;  3P8M C;  4Y28 J;  3M91 A;  3AEE C;  3VYI A;  1P84 H;  1FDO A;  1FZA A;  1FZE C;  3L74 J;  2E75 B;  3LW5 H;  1J1E B;  2K1A A;  2J58 A;  3AED C;  1NU1 J;  3RK3 B;  1PPJ G;  3SFE C;  1VDF A;  3L73 E;  2WSE H;  3B5N D;  2ZT9 B;  3VOP A;  4DJG A;  1FOS F;  2A06 E;  4L75 A;  3H1J J;  1NTZ D;  1BCC D;  1KB9 D;  5APU A;  3HD7 B;  3MGN A;  5AVR B;  2LXC B;  2WPS A;  1ZLL A;  5E79 E;  1FZB A;  2PRR A;  3V4Q A;  2C9N Y;  1GK6 A;  1GDT A;  2HLO B;  5CJ0 A;  5CCH D;  1XTG B;  4ZMD A;  3B71 A;  3V2P A;  2ZVO B;  3L75 E;  1LT9 A;  4UB6 E;  5AVV B;  5TIS E;  3RL0 D;  3USS A;  3L70 E;  3EWK A;  1GL2 C;  3CCU P;  3AE8 C;  1X8Y A;  3BCC D;  5B66 H;  1L0L K;  2HOD A;  4H13 B;  2ZXX A;  2O1K A;  4IOI H;  1RF1 B;  3BCC J;  2J5Z A;  4GKG A;  1URQ D;  5TJH A;  2E76 C;  1NKN A;  1PP9 E;  2H43 B;  1PFI A;  5AW9 B;  1GD2 E;  2GY7 A;  4D6T E;  5AW8 B;  2AEM A;  4WBA A;  5AW6 B;  1KMI Z;  5AW1 B;  4JQ0 D;  2J0G A;  2BCC G;  1RE3 A;  1LTS C;  1PGQ A;  3ABV C;  3A3Y B;  1IJD B;  1SP4 A;  2K9J A;  2E74 B;  1FZC A;  5B66 E;  3GHG B;  1L0L G;  3BRT B;  3MHV A;  3U1A A;  3G6E P;  3CX5 D;  1M1J A;  1W2B O;  1N73 A;  3B8E B;  3CC2 P;  3I55 P;  4UB6 H;  3L71 G;  3CCV P;  2N1T A;  3JC2 2;  4H13 D;  1G2C B;  4EPU A;  3C1L A;  5K5G B;  1VQ4 P;  1GL2 B;  2FKW B;  1LTJ C;  4B86 A;  4ASV A;  2YKP A;  4ZNC A;  1VQN P;  1JB0 J;  4H44 D;  1GU4 A;  2P10 A;  1KFM A;  3CI9 A;  2ITA A;  2LKM A;  2L5G B;  2JO1 A;  2RMZ A;  5KAF H;  4K3A A;  4PD4 H;  2QVA A;  3H1I J;  5APV A;  1VQM P;  1JTH B;  2Y9Y A;  3OA7 A;  3CLQ A;  1H0T A;  4AYC A;  2IZ0 A;  3CX5 I;  1E79 H;  4W7Z A;  1ZXG A;  1MZ9 A;  4HH2 A;  1A02 F;  3RBX A;  4D6T D;  3V2N A;  1K05 A;  1SQX E;  3IF4 A;  1FJP A;  2HLO A;  2NRG A;  1T3U A;  2WZ7 A;  2GA1 A;  1NKZ B;  5AVW B;  1ZW0 A;  1SQP G;  3S4R A;  1RF0 A;  3Q5R A;  1EC5 A;  1LP1 A;  3TGU E;  1IFM A;  2WQY C;  1JCD A;  2E74 D;  2FFD A;  1FZF C;  1AVO A;  1RQU A;  3T97 A;  3N7N A;  3P7K A;  3F89 A;  2Z5I A;  2WPR A;  4KT0 J;  2QEX P;  4YXW H;  4JF7 A;  2OYI C;  4XA4 A;  1ZRT D;  2P67 A;  3L71 D;  3M0D A;  4U3F E;  3HE5 B;  1KFN A;  1PV3 A;  1GU5 A;  3F5H A;  3WUV A;  1EDL A;  1EXJ A;  3FWN A;  3TDK A;  1LWU B;  2E5T A;  1JO5 A;  1NTK D;  2AXT E;  2WSE J;  1KOR A;  4DT0 A;  3RL0 C;  2HR3 A;  1HWT C;  2W6J H;  2KZJ A;  2RKL A;  3CCJ P;  3EQ2 A;  5AVS B;  3FXE A;  2QJP C;  4CPG A;  2M5A B;  3A5T A;  1QVG O;  1N86 B;  2FXP A;  1LTJ A;  4ZKP A;  1AQT A;  3AEB C;  4JPZ B;  1RF1 A;  1SFC B;  2AXC A;  1Q86 Q;  2PFX A;  4I2L C;  1FBM A;  3JCU H;  3U59 A;  3H1I D;  5H2F E;  1SFC A;  1SQP D;  3AEA C;  1ZP0 C;  3GHG A;  2GM4 A;  1U7J A;  1MV8 A;  2FBW C;  1SQB K;  3L4F A;  3IAO A;  3H1L E;  2ZT9 D;  2E5Y A;  3U1C A;  3TNU A;  2SPZ A;  1M90 Q;  4NPE A;  3TF5 A;  2FYN C;  4YXD C;  5GTH E;  3Q5P A; 
#chains in the Genus database with same CATH homology
 3E1I A;  3B5N C;  4LC1 A;  1DH3 A;  3A2A A;  3P8C D;  2W6A A;  2R32 A;  2OAR A;  5KTB A;  1LTG C;  3P8C E;  1FIC A;  1FZF A;  1L0N K;  2Z4E B;  4WY4 C;  2FYZ A;  1L4A C;  1LTA C;  1JY3 O;  2E42 A;  3SWY A;  2M8R A;  3RK2 B;  3V2Q A;  2YO2 A;  2JHK F;  1JCC A;  1CSB A;  1NHL A;  1T8Z A;  3VMZ A;  3TYY A;  3HD7 D;  3IFM A;  1FDM A;  1FZE B;  2JEE A;  1Z3U A;  2XDJ A;  3L37 A;  1L4A D;  3UIA A;  2W27 A;  2H43 A;  1M1J C;  1N73 C;  2J3U A;  3KQG A;  4N6J A;  2WT7 B;  1FAV A;  2I1J A;  1MUU A;  2CPB A;  3LIE A;  5KLV K;  2FIB A;  5AW5 B;  3II6 A;  1RE4 A;  2YKO A;  5AW2 B;  2IFN A;  2Q3I A;  2OYI A;  3H32 B;  2A45 H;  2J0H A;  4LLH A;  4C7N B;  3P8M C;  2M3B A;  5AW0 B;  4DZO A;  1KQL A;  3M91 A;  1JY3 N;  3VYI A;  1FZA A;  2WNP F;  1FZE C;  2YNY A;  3LW5 H;  3RK2 D;  1J1E B;  2PP6 A;  2I1K A;  1CI6 A;  2OYI B;  2YKQ A;  2J0Y A;  2J58 A;  2KYV A;  2NPS A;  3NMD A;  4C7N A;  3RK3 B;  2A45 G;  1KIL B;  1Z3S A;  1RF1 C;  1G2C A;  3HTK A;  1VDF A;  5APS A;  5AVQ B;  1JMM A;  4N3Y B;  3HUS C;  2WSE H;  3B5N D;  2D39 A;  3VOP A;  1NH4 A;  4M3L A;  1H89 A;  2IFM A;  1FOS F;  4C46 A;  1W2E A;  2FFD C;  1LWU C;  4LGD E;  1YYC A;  3M9B A;  1SFC C;  1L4A A;  4JYB A;  1T3J A;  1FZE A;  1N7S B;  2JHH C;  1WRG A;  5APU A;  3HD7 B;  1SQV K;  2C0W A;  2QM8 A;  1J1E C;  1JC9 A;  3HE4 A;  4OH8 B;  1LGH B;  1FID A;  1FZB B;  2J3O A;  2GUS A;  2P1J A;  3C9I A;  3MGN A;  1ZR4 A;  5AVR B;  2J61 B;  3L35 A;  4ZFG A;  3HRN A;  2IX7 C;  2Z5H A;  3NTN A;  4M7H A;  2WPS A;  1LTI C;  1HGV A;  1ZLL A;  2H43 C;  5BVZ A;  1FZB A;  2WWW A;  3V4Q A;  1JY3 P;  2WSF H;  3M0A A;  1IFD A;  2Q5U A;  1FZG C;  4GT1 A;  2PAJ A;  2C9N Y;  1GK6 A;  3MIW A;  1RE3 C;  1GDT A;  1IK9 A;  4IFM A;  2HLO B;  2J59 M;  5CJ0 A;  5CCH D;  1XTG B;  3EFG A;  3NXS A;  1M1J B;  1IFI A;  1N73 B;  1CZQ A;  2P7J A;  4JYO X;  1XTC C;  1FZA C;  3V2P A;  1LTB C;  1RE3 B;  2CPS A;  1HVV A;  1LT9 A;  1URQ A;  1NO4 A;  5AVV B;  3M06 A;  2XNX C;  3RL0 D;  2Z4E C;  1GL2 C;  4IFD K;  1X8Y A;  1AQ5 A;  1Z56 A;  1RY3 A;  2W6B A;  2N1T D;  1L0L K;  2O01 H;  4O9B A;  2HOD A;  5CCH A;  1DX7 A;  1ZR2 A;  2O1K A;  1RF1 B;  1IFN A;  2J1G A;  1HTL C;  1SVF A;  2J5Z A;  1KIL A;  1OXZ A;  1GL2 D;  1HUC A;  4GKG A;  3VMY A;  3VN0 A;  1URQ D;  3V2R A;  1NKN A;  5APW A;  1FIB A;  1N2D C;  2H43 B;  2N1T B;  1PFI A;  2A45 I;  3NFQ A;  3L36 A;  4W7Y A;  5AW9 B;  1GD2 E;  2GY7 A;  2OYH C;  3IR9 A;  5AW8 B;  1N86 A;  1IFJ A;  1GK4 A;  3P32 A;  1AFO A;  4WBA A;  2XNX B;  5AW6 B;  1FZB C;  2MJZ A;  5AW1 B;  4AUW A;  2QM7 A;  4ZKU A;  1A02 J;  2J0G A;  4WY4 B;  1FZA B;  1RE3 A;  1LTS C;  3A3Y B;  1GW4 A;  5APQ A;  1IJD B;  1EQ7 A;  4EIJ A;  2N1T C;  4N78 E;  3HTK B;  1FZD A;  1FZG B;  1SP4 A;  1N7S D;  2C0X A;  1RF0 B;  1FZC A;  1FOS E;  4R9J A;  2HLO C;  3E1I C;  2KSJ A;  4KHX A;  2P2U A;  3GHG B;  3V4W A;  1X9V A;  4GIF A;  1IO4 A;  2GUV A;  2Z4E A;  1JY2 O;  1N7L A;  3BRT B;  4W80 A;  3U1A A;  4JYC A;  3RL0 B;  1JOC A;  1M1J A;  1N73 A;  3B8E B;  5CJ4 A;  3BAT A;  1NWQ A;  2J3F D;  3OJA B;  3H32 C;  4RES B;  2N1T A;  2NPS B;  3KPE A;  2HPC A;  4XE5 B;  5KJ7 D;  2J61 A;  1G2C B;  5AW4 B;  2Q9I B;  3G3Z A;  3HUS A;  4EPU A;  3GHG C;  1SQP K;  1T2K C;  3H6P A;  3RK3 C;  1JY2 P;  2XU6 A;  3OAK A;  4HYT B;  1GL2 B;  1LT9 C;  3HUS B;  3M9Q A;  3H32 A;  2FKW B;  1S9K E;  1J2J B;  1LTJ C;  4B86 A;  3HD7 A;  2FFD B;  5CCG D;  3N4X A;  1QL1 A;  2YKP A;  1NTK K;  2WTY A;  2HFE D;  4IFF A;  2Q9I C;  1LT9 B;  1NU1 K;  2JHM F;  5AVT B;  5AW3 B;  1KZU B;  2R5D A;  1GU4 A;  2J64 A;  2NPS C;  1NTZ K;  2YMY A;  2H7H A;  1FZC C;  1KFM A;  3CI9 A;  5BU8 B;  5AVZ B;  5AVY B;  2LKM A;  2L5G B;  1SFC D;  1LTJ B;  2HPC B;  1M7L A;  1T2K D;  5APV A;  1FZG A;  1FJK A;  1JTH B;  1URQ C;  3OA7 A;  2JHL F;  2JJL A;  3CLQ A;  4AYC A;  2C9L Y;  2E43 A;  1J1D B;  1GL2 A;  2Q7C A;  4AQR D;  1RF0 C;  4W7Z A;  2OYH B;  2JHI F;  1MZ9 A;  1NOH A;  3HE5 A;  1OWA A;  3E1I B;  2HG5 D;  4HH2 A;  1A02 F;  2J2P A;  3SWF A;  2BAS A;  4Y99 C;  3V2N A;  1FZF B;  1FJP A;  2HLO A;  1N7S A;  1T3U A;  2ZFC A;  2WZ7 A;  1NKZ B;  5AVW B;  1IC2 A;  5CCG C;  3VP9 A;  3TK1 A;  1ZN5 A;  1RF0 A;  1JY2 N;  1WT6 A;  1FZC B;  3I5C A;  2XKM A;  5KJ7 C;  1URQ B;  2N9B A;  1HH0 A;  4NYT A;  1IFM A;  1G1I A;  2J3F A;  1FU1 A;  2HPC C;  1VPC A;  2R5B A;  1JCD A;  2WT7 A;  2XZR A;  2FFD A;  1HBW A;  1FZF C;  3FIB A;  2WIT A;  3T97 A;  5CMZ A;  3N7N A;  3P7K A;  5APX A;  3O8Z A;  2VRS A;  1NAF A;  2Z5I A;  2WPR A;  1RE4 C;  3CL3 D;  4JF7 A;  1JNM A;  2OYI C;  2J3G A;  4XA4 A;  1LTT C;  2P67 A;  2HYN A;  1KIL C;  2IPP A;  3M0D A;  4WB4 A;  3HE5 B;  2WSC H;  3MUD A;  1CI6 B;  1YTZ I;  1KFN A;  1GU5 A;  3TNU B;  2XV5 A;  1ZV8 A;  1LWU B;  2FYU K;  3BVH C;  1E5W A;  5AVX B;  1JO5 A;  1RE4 B;  2KB7 P;  4I1L A;  3KDP B;  3RL0 C;  3BAS A;  1LWU A;  2WPQ A;  3VTP C;  3M0D C;  3BVH B;  1HWT C;  2Q9I A;  3KYQ A;  3EQ2 A;  2NPS D;  5AVS B;  5CCG A;  3WMM 0;  2KLV A;  1HGZ A;  1H8A A;  2O1J A;  1SQX K;  1NTM K;  1KIL D;  3VMX A;  2ZXE B;  1CW5 A;  1GZL A;  1QL2 A;  1GW3 A;  3A5T A;  1N86 B;  1SLQ A;  1LTJ A;  1JUN A;  2KP8 A;  4ZKP A;  4R9T A;  3MD0 A;  4Y99 B;  4DOJ A;  2H8P D;  5APT A;  3TSI A;  4C7R A;  1RF1 A;  4JZC A;  1JTH A;  4N78 D;  1SFC B;  1X79 B;  1L4A B;  3LID A;  4I6M C;  2POH A;  3B5N B;  3M9H A;  1J1D C;  3HE4 B;  4I2L C;  1FBM A;  3VP8 A;  3U59 A;  2J60 A;  1YTZ T;  3A7O A;  5CHX A;  1SFC A;  1N86 C;  3BRV B;  2R3C A;  3GHG A;  2HOD C;  1SQQ K;  2FXM A;  2GM4 A;  3B5N A;  2XNX A;  1MV8 A;  3V5B A;  5KJ7 A;  5APY A;  3BVH A;  3L4F A;  1G1J A;  1SQB K;  5AW7 B;  1MFZ A;  3R2P A;  1N7S C;  4WY4 A;  5AVU B;  2HOD B;  3HD7 C;  3RK3 D;  3RK2 C;  2KOG A;  2YO3 A;  5CCH C;  3U1C A;  3TNU A;  4WY4 D;  4EOT A;  2OYH A;  5BU5 A;  1DEB A;  4M7F A;  3PP5 A;  1HJB A;  1S9K D;  1GTW A;  3MTU E;  1H88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...