2HODB

Crystal structure of fragment d from human fibrinogen complexed with gly-hydroxypro-arg-pro-amide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
307
structure length
307
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
molecule tags Blood clotting/peptide
total genus 59
structure length 307
sequence length 307
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2006-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hodB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2hodB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2hodB03
1JY2O 3H32B 1FIBA 1Z3UA 2Q9IB 1N73C 3BVHA 1RF1B 1RF0A 2A45I 2OYHC 1FZAC 3HUSA 1JC9A 1FZFC 1RE4B 3GHGA 1FZCB 2HODA 4NYTA 2Z4EB 2J3FA 3BVHC 1RF0C 2XNXA 3HUSC 2HPCC 1LWUC 2J61B 1JY2P 1FZGA 4JZCA 1RE3A 3GHGC 2A45H 3E1IC 2J0GA 2H43A 1M1JB 2XNXC 2J5ZA 1N73B 1FZDA 1W2EA 2OYHB 1FIDA 1FZAB 1FZGC 1LTJA 2FIBA 1RE3C 1FZFB 2OYIA 2H43C 1Z3SA 1RF0B 2D39A 3HUSB 2FFDA 1LTJC 1LWUB 2HPCB 2Q9IA 1FZBB 1N86A 1RF1A 2A45G 1LT9A 3GHGB 1T3UA 2JHMF 3E1IB 3FIBA 2HLOA 4JYOX 2XNXB 2HODC 1FZEA 2FFDC 2JHHC 1JY3N 2J60A 1FZGB 2Q9IC 1N86C 1LT9C 1RE3B 2JHLF 4R9JA 2J61A 1JY2N 2H43B 2HLOC 1FICA 2J3OA 1FZEC 3BVHB 1LTJB 4M7HA 2J2PA 4EPUA 3H32A 2OYHA 4M7FA 1FZAA 2GY7A 2OYIC 1FZFA 4R9TA 2J3UA 2HODB 2J0HA 2FFDB 2JHKF 1RE4A 1FZCA 1N86B 4ZFGA 1LT9B 3H32C 2Z4EA 2HPCA 1LWUA 1RF1C 2J64A 1FZBA 2HLOB 2J3GA 3E1IA 1JY3P 1FZEB 1RE4C 1FZCC 2J3FD 2WNPF 2JHIF 2Z4EC 1M1JA 2J0YA 1N73A 1FZBC 2OYIB 1JY3O 2J1GA 1M1JC
chains in the Genus database with same CATH superfamily
1Z3UA 3L70D 1GL2C 2FYUG 1BE3E 3MD0A 1NTZG 4NYTA 2XU6A 2FYUD 1L0NJ 3P32A 1L0LK 3PTZA 1NTZD 3A0HE 1N7LA 2J0GA 1KV4A 1K73Q 1HGZA 4L74A 2ITAA 1ZR2A 2PP6A 2XNDH 1EC5A 4KHXA 3RK2B 2D39A 2FFDA 1X9VA 1BE3J 3LW5J 5KKZC 2QEXP 2Q7CA 2K88A 2YKQA 2JHMF 2WZ7A 1W2BO 3HE5B 1YIJP 2G8YA 3H1LJ 3NFQA 2JO1A 4R9JA 2YNYA 2ZYGA 5GTIE 2Y0EA 4OGQB 1L0LG 4I2LC 1PZQA 3TYYA 5TJHA 1L0LD 1NTMG 1LTGC 1GW4A 3H32C 1BGYE 3KXDA 1NTMD 5KAFH 1U7JA 4H0LD 2J3FD 3HE5A 2OYIB 3H1IG 5L8RJ 2ZAEB 1LP1B 1J1EC 5AVWB 2W27A 1VQ4P 2YO3A 3H1ID 5CJ0A 1SQBE 3MUDC 4N3YB 2A06G 1QVGO 1NGMB 1YJ9P 1LTAC 5AW2B 3F89A 3FX0A 2A06D 3KQGA 1VQLP 3CC2P 2XNXC 3RGUA 1JMBA 2GM4A 1SQPJ 5CMZA 3CMAP 1FIDA 4DJGA 5CCHC 1QL1A 2OYIA 1AQTA 2B89A 2QM8A 3FWLA 2H43C 5AW7B 3V2NA 1SQBJ 3CCSP 1YJWP 4GT1A 4DCKA 1YQ4C 1T6AA 1T3UA 3OJAB 3SFEC 3AE5C 4UB6H 2Q3EA 1KQSO 1OFCX 1VPCA 2OQQA 1N86C 1SQXK 2HR3A 1PP9G 2FYUJ 4RKUJ 2IZ0A 2J3OA 1NTZJ 2WPQA 2KYVA 5H2FH 1PP9D 2NPSC 3H32A 3WU2H 1VQ8P 1S5LH 2J3UA 2LXBA 4KT0J 1VQOP 3LIDA 3BATA 1EZVD 1JTHA 4XFJA 2K1AA 1VQ9P 1JY3P 3M0DC 3AE7C 4UB6E 3UIAA 4OVNF 4U3FG 2ZFCA 2JP3A 3MUDA 3HE4B 1FJPA 4EYYQ 2C9LY 3U59A 3WMM0 1Q90D 3EFFK 3FXDA 4U3FD 3KHUA 2ZJSE 2YIUC 1K04A 1RE4B 1S5LE 3L72G 1PL5A 1K9MQ 1RF0C 2N9YB 2XNXA 4UB8H 2NPSB 1MZ9A 5CCHA 2Y0CA 3L72D 4H0LC 2H43A 1M1JB 3AEEC 5KLIC 4D6TG 5AW6B 3O8ZA 1NTMJ 1KORA 2XDJA 3P8MC 3CXHD 4D6TD 4ZMDA 4N78E 2W6JH 1LNQA 1KMIZ 4OH8B 3SWKA 1VQMP 4DZOA 1N86A 1S9KD 4QMAA 3CX5I 5AW9B 5GTHE 1SFCD 1NOHA 1JY3N 2WQYC 3C1LA 4WVZA 2Q9IC 3KYQA 2NPSA 1T3JA 3B71A 3RBZA 3NTNA 2WSSH 4IFFA 2IBZG 2C0XA 3M0DA 4U7JA 5CCGD 1EDLA 1L4AD 2R3SA 2IBZD 1FZCC 2WITA 3I55P 2WNPF 4BRYB 3T97B 2ZVOB 1J1DB 1HF9A 3E1RA 3V2PA 3CXHH 2Q9IB 2YXRB 1RF0A 3VYIA 4LC1A 2J59M 1FZFC 2YMKA 1PP9J 3L71G 1X79B 2Z4EB 2J3FA 2QE7H 2WSFH 1HH0A 3USSA 1QVFO 4DT0A 3N7NA 2PFXA 3L72E 3L75G 1XTGB 4IFMA 4BRYA 1USDA 1AVOA 1QLED 3RK3D 1J2JB 2FYZA 3H25A 2GA1A 3B8EB 3L75D 1Z3SA 2KIKA 4D6TE 1M90Q 1YITP 2Q9IA 4I7ZB 2AXTH 5APQA 2HODC 4AUWA 1G2CA 1NAFA 3I5CA 3CWBG 3FXEA 4GOFA 5BVZA 4NPEA 2YO2A 1FICA 4JBZA 3CWBD 3L72J 4EDFA 2WT7B 1CSBA 2QG4A 1P84I 3BCCE 5AVVB 3CCRP 3IF4A 3AE1C 1FZCA 1R8EA 4ZFGA 4D6TJ 3RK2D 1EQ7A 2AXTE 3G71P 2I1JA 2RH0A 1SFCC 2W8ZA 3KPEA 2ZYDA 2WSFJ 3B5NB 5CBOA 3AE4C 3JSVC 1JY2O 1NTKE 3A7OA 1TU3F 1RF1B 4OGQD 1H8AA 2KB7P 3O6QB 2I1KA 1RHZB 4GKGA 5CCGC 1EXJA 1EDKA 3HUSC 3TGUE 1L4AC 4IFDK 3CX5D 3L71E 2Y9YA 1JMMA 3ABVC 1NTKJ 1VQ6P 1RF1A 4YXWH 3L75E 4JYOX 1T2KD 2O1KA 2QRXA 2KZIA 2JHLF 4HYTB 2N1TB 4HB1A 3L71J 1LTJB 3CL3D 1M1KQ 2B87A 3RK3C 5B66H 1R5SA 1PPJE 2E43A 1YI2P 1GU5A 4LGDE 2JHKF 1SFCA 2BCCG 2FXOA 1JCDA 1IK9A 3L75J 4PJ0H 2HYNA 2BCCD 4JPZB 3CX5H 4C7NA 2B88A 2D2CB 1KQFB 3KDPB 3A0BH 3PLNA 4AYCA 1DIPA 3OAKA 1SVFA 1HUCA 1FIBA 4W80A 2AEFA 3CC4P 3WUUA 1L0NE 1LT1A 5B66E 3HUSA 1L4AA 2E75B 5APVA 1KQLA 2DW3A 3L4FA 2NRGA 3RK2C 1ZRTE 4JZCA 4GOEA 1VQ7P 4PJ0E 2IPPA 3Q1MA 3CX5E 4IL6H 1N73B 1FZAB 1EZVI 3MP7B 2KK7A 3SFDC 1VQPP 4HH2A 3JCUE 2OTKE 5AVXB 3WUVA 2C9NY 1SQQE 4OGQC 1H89A 5K5GB 3AEGC 1KYOE 2A45G 3H1LE 1P84D 2WPRA 4LLHA 3P7KA 2O01H 1ZV8A 2Q5UA 1XTCC 1MUUA 3GMAA 3D71A 1FZGB 3CPWO 2NPSD 2WPSA 2OYOA 2LKMA 5APYA 3TNUA 3S9OA 1OWAA 4IL6E 1VL2A 1NYHA 1FZAA 2GY7A 2OYIC 3H6PA 2POHA 1UIIA 1SQQJ 1VF5B 3PH0A 2H7HA 5APTA 3NXSA 2HLOB 3CXHI 1GTWA 5AVTB 1T2KC 1GZLA 1FJKA 1GMJA 2CK3H 1FOSF 4EIJA 2OARA 1FS0E 1RQUA 5AW0B 2XKMA 1IFDA 3U1CA 2QJPB 1YYCA 2V4HA 1OW8A 1DD4A 2M8RA 1PGOA 1P84H 3G4SP 1MFTA 1SQPE 2KS1B 1IC2A 3GLMA 1FU1A 2SPZA 2A45H 2O01J 1T8ZA 2O01N 5APSA 2BCCJ 1RH5B 4NPFX 2IBZI 1VQ5P 3VMZA 3L70E 2AEJA 2QSIA 2WSEH 3CD6P 3QH9A 1YJNP 1PGJA 3GHGB 2FYUE 1NWQA 5KAFE 1AFOA 3CCMP 2ZXXA 1P84E 1BSHA 1NTZE 2WWWA 3AE2C 5B5EH 3G6EP 1KFMA 3EQ2A 4WWIA 3RL0B 3GF7A 1LP1A 3L37A 2LXCB 1HVVA 1DEEG 2KSEA 4R9TA 1NKZB 1N8RQ 3L70J 4WY4B 3AE8C 1HJ0A 1LT9B 2M5AB 2YXQB 1RE4C 1FDMA 4IL6X 3Q5RA 5B5EE 3V2QA 4ZNCA 2R44A 1EZVG 4H13B 1M1JC 1ZP0C 1L0LE 1JO5A 2WSEJ 4WY4A 2AXCA 3BVHC 2WMMA 1NTME 2K9YA 3M06A 2OYHB 1SQXG 2BEQD 5H2FE 3CC7P 4MN4C 3WU2E 3B5ND 2OTLP 1DD3A 2KLVA 3HTKB 4HKZH 3H1IE 3TSIA 1SQXD 1LWUB 3FGAD 1NU1K 1L0LJ 5AVYB 2ZT9B 2KLUA 4JQ0D 4EI2A 4L76A 4W7ZA 2A06E 4TLFA 5AW4B 1JY2N 3HE4A 1URQB 1K8AQ 2QM7A 3H1HG 3CMEP 3BVHB 1HJBA 1ZMEC 2OYHA 4XE5B 1S2EA 1J1DC 4HJGH 1KB9I 1QL2A 3H1HD 3H1IJ 2Q1KA 2O1JA 1RE4A 1G1IA 4UB8E 1LWUA 1YQ3C 3ITKA 1FC2C 3M0AA 3MHVA 1QGKB 3GW6A 2Z4EC 1M1JA 2V7QH 1BCCG 2J1GA 1OW6A 1PP9E 2FKWB 2N1TD 1D7MA 3BVHA 3AE6C 1Q2NA 1BCCD 5C39A 5BU5A 1JC9A 1EZVE 4JYCA 2W6BA 1JB0J 2J61B 2H88C 2FXPA 4JF7A 5APXA 4I7ZC 2C0WA 4PV1B 1SQVK 1KD1Q 3EFGA 2D2CD 1S1CX 4U3FE 3AECC 2L91A 1KC8Q 2KOGA 1BDCA 4ASWA 3TK1A 1DEBA 1WRGA 4ZKUA 4K35A 1X8YA 3HD7B 2E75D 5E79H 2JJLA 1OXZA 3VN0A 5AVQB 5KLVK 3T97A 1AA0A 2J61A 2KXPB 1HBWA 4GDOA 2M0BA 1S5LX 3CXHE 1PGPA 1ZR4A 2V7QJ 2AEMA 3B5NC 4BXLA 4U3FJ 2J0HA 1YHQP 1S9KE 2IYOA 2ZXEB 3H1HE 2Z4EA 1RF1C 1SQXJ 1NO4A 4L73A 3HD7A 5E79E 2IDBA 2QVAA 3KZIH 3AEFC 1FZBC 5TISH 2I8DA 5CJ4A 2A45I 1ZLLA 4DOJA 1GW3A 2PRRA 2FY8A 2B9BA 3H1HJ 2IBZE 1VF5D 3P8CD 1MFZA 2HFED 2OGUA 2J5ZA 2WT7A 1DH3A 4I6MC 2N1TC 2KNCB 1NH4A 4JYBA 1CW5A 4R4MA 1LTJC 2HPCB 1FZBB 3L73G 1FAVA 1KB9D 3E1IB 2WTYA 1CI6B 1IJDB 1BCCJ 1U7MA 4WB4A 2M3BA 3VMXA 3L73D 3VP8A 1X22A 1RE3B 3H1KG 3B5NA 3M9HA 1LTTC 2Z5IA 1GU4A 1BE3G 3RK3E 2P1JA 3NMDA 2J2PA 2D2CC 3PRJA 3H1KD 2Y9ZA 1FBMA 1LTIC 3H1JG 1AV1A 2KUBA 3MTUE 3O6QA 1FOSE 1BE3D 1UIXA 2KNCA 2QJYB 1ZXGA 2G3AA 3G3ZA 3A3YB 3H1JD 2HPCA 1GD2E 1FZBA 5KAIH 1YTZI 2E75C 3E1IA 1FZEB 3AEBC 2E76C 3Q5SA 5AVUB 2XV5A 3CCLP 1OW7A 2E5TA 3GF3A 5DJUB 3CWBE 2QJKB 3RL0D 4O9BA 1RQVA 3V4QA 2GUSA 1N73C 1N7SB 3CCUP 1FZAC 2CPSA 3W67A 2QIWA 2FYNB 1JNMA 1SQBK 4WY4D 1KB9H 5AVZB 5KAIE 3G9RA 2N1TA 1E79H 3P8CE 1M57D 3Q2YA 1W2EA 4RO0A 2K37A 1KILB 1LTSC 1FZGC 2K3RA 1LTJA 2FIBA 2FYUK 2YKPA 3CWBJ 3S4RA 3OW2O 4H13D 4PD4I 4NPDA 2E76B 1Q81Q 1BGYG 1SS1A 1NJIQ 1PFIA 3LW5H 3V2RA 5AW3B 1N7SA 3SWYA 4C7RA 3CLQA 1BGYD 1FE6A 2W90A 1CZQA 4R4LA 3V4WA 1KB9E 1VF5C 2J5UA 4H44B 3A0BE 2HLOC 1SQBG 3D6ZA 4EPUA 1KILA 5KJ7A 3CCVP 1SQBD 2P10A 4L75A 2WVRA 2FFDB 1OIPA 3L36A 4N6JA 4TT3H 2QJPC 3Q5PA 1A02J 2J64A 4I1LA 1OX3A 1Z56A 2J3GA 3H1JE 4Y99B 2ZT9D 2FXMA 1M8OB 3JC22 1N73A 2E74B 2M3EA 3L73J 2WPVB 1H88A 5GTIH 1JCCA 1URQD 1HGVA 1NTMK 3EWKA 3BRVB 1EXIA 3LIEA 1JOCA 3H1KJ 3QWOC 4CPGA 2R5DA 4KJMA 2BCCE 1FZGA 1LJ2A 1G1JA 3GHGC 3AEAC 3H1JJ 4Y28J 1BDDA 3R4YA 2ZYAA 3FWNA 1GL2B 2H89C 2IFMA 1IFJA 2ZVNB 3AE3C 3RL0C 2N9BA 1ZOYC 4A7PA 2Z5HA 3FIBA 2HLOA 4WY4C 1LT9C 4GIFA 1U57A 4PV1D 4BWNA 5KKZB 1GL2A 1L2PA 4H13C 1WMKA 2IX7C 1NVOA 2RMZA 2FBWC 2P67A 3TF5A 1OZHA 2KS1A 2MKVA 3PP5A 1KN7A 3HD7D 3Q3DA 3IFMA 1IFPA 4RESB 1A02F 1BGYJ 2HG5D 3VOPA 1IFNA 2Y0DA 3PJSK 1JEKA 3H32B 1IK7A 2XZRA 4N78D 2OYHC 1LTBC 3I56P 3D70A 1HTLC 5DJTB 1JM0A 3GHGA 1FDOA 4PD4D 1JTHB 3HRNA 1LGHB 3PHLA 1LWUC 1JY2P 4EOTA 4M3LA 1J1EB 2L5GB 2ZT9C 1FZDA 1NKNA 1URQC 1IFMA 1YBKA 5CHXA 3OA7A 1GK6A 2J58A 1LT9A 1USEA 2M5AA 2PGDA 2K9JB 3CCQP 2XNXB 3S1KA 3B4SA 1BSNA 1OVUA 4C46A 2H43B 3K5BA 2JDIH 4RJTA 2IZ1A 2E5YA 1S3JA 2JEEA 1H0TB 3AEDC 1Y8AA 1NAYA 1S72P 3D6YA 1N86B 4PD4H 1KTMA 3N4XA 5GTHH 1S4XA 2WSCH 2K9JA 1PGQA 3C9IA 1AQ5A 3VMYA 1AVYA 5AVSB 4WBAA 3HTKA 4PV1C 3VP9A 2QA4P 3L74G 2E42A 2RN0A 1H0TA 2YMYA 1KQGB 3MIWA 3L74D 1NTKK 2Q6QA 2W6AA 3CI9A 1NU1G 4PD4E 1KFNA 3A5TA 3HD7C 3BRTB 1URQA 1NU1D 2YIUB 2RKLA 3BCCG 5M1BA 4IOIH 2JWDA 1W5CE 3AE9C 4ASVA 1PIXA 1KYOI 2O3JA 1IO4A 3BCCD 1Y47A 3IAOA 3MGNA 1RF0B 1QX8A 3WUTA 1N7SD 4H0LB 5KLIB 2JHHC 2J60A 2OTJP 2PAJA 3RL0g 5BU8B 4Z1MH 1NTKG 2WSCJ 1HWTC 3A2AA 5CBNA 4GODA 2P7JA 1KILD 4AQRD 1NTKD 5KJ7D 1SQXE 2JWAA 3TGUG 1RY3A 2LR2A 2BEZF 2E76D 2KP8A 3TGUD 1OMIA 1G2CB 1R5LA 1JUNA 3L71D 4H44D 1EDIA 1MKMA 1SQVG 1QEXA 1K05A 1SQVD 1YTZT 1FZCB 1AJYA 1L0NK 1IZNB 2HPCC 4K3AA 3L74E 2H8PD 3E1IC 4OWFA 1VQKP 3F5HA 2CPBA 1Y9BA 1PPJG 3W68A 5KTBA 5KLVG 3M91A 1RE3C 1FZFB 1KZUB 1NU1E 2E74D 3R2PA 1VDFA 1BCCE 1PPJD 5KLVD 1ZN5A 1Q86Q 1GDTA 1N2DC 2UWJE 1SQQK 3L35A 3KZIE 2QJYC 5AW5B 1Q7YQ 3L74J 1M56D 2IYPA 5TISE 3CCEP 2KI7B 1FZEC 1E5WA 1L0NG 3BASA 3SWFA 1DX7A 4M7HA 3ZDMA 1GL2D 1NU1J 3IN6A 1FZFA 1OVVA 2GUVA 1L0ND 1NHLA 2HODB 2P2UA 1KILE 2QJKC 3IR9A 3BCCJ 1N7SC 1ZRTD 2R5BA 4W7YA 3C8VA 2FYNC 1GK4A 1Q82Q 4XA4A 1JY3O 4B86A 1SQQG 5AVRB 2IFNA 3E7KA 3MZWB 2B87B 3CCJP 3H1LG 1KILC 1MV8A 5KJ7C 1SQQD 3SSUA 2MJZA 2Q3IA 1OVRA 1KYOD 1ZW0A 1SFCB 3H1LD 2R32A 2HODA 1CI6A 2KZJA 1SQVE 3VMAA 4ZKPA 5APWA 1RE3A 5EFWB 4C7NB 2VRSA 1SQPK 3II6A 3V5BA 3TGUJ 3RBXA 1WT6A 5AW1B 4H44C 5AW8B 2NZ2A 2R3CA 3M9QA 3GG2A 3U1AA 2P58A 3HUSB 1L4AB 4YTPC 5KLVE 1FZEA 2FFDC 1SQVJ 2KSJA 1PV3A 1M7LA 4Y99C 1NTZK 4M7FA 3M9BA 3JCUH 2E74C 3V6IA 4YPCA 1X0TA 4YXDC 2JR8A 1SP4A 1SQPG 1FDIA 5CCGA 3VTPC 1KYOH 1VQNP 2JKVA 3TDKA 1EDJA 5KLVJ 3A0HH 1SQPD 3L73E 2BASA 2JHIF 3RK3B 2J0YA 5APUA 1IFIA 2YKOA 3L70G 5CCHD 3TNUB 2W83C 3H1KE 1SLQA
chains in the Genus database with same CATH topology
1JY2O 3H32B 1Z3UA 3A7OA 3BVHA 2XZRA 1RF1B 1GL2C 4N78D 2OYHC 1LTBC 5BU5A 1H8AA 1HTLC 2KB7P 1JC9A 2I1KA 3MD0A 3GHGA 4NYTA 2XU6A 1JTHB 3HRNA 4GKGA 2W6BA 4JYCA 5CCGC 1LGHB 3HUSC 3P32A 1L0LK 1LWUC 2J61B 1JY2P 1L4AC 4JF7A 5APXA 4EOTA 4IFDK 4M3LA 2C0WA 1J1EB 2L5GB 1N7LA 2J0GA 1SQVK 1FZDA 1NKNA 3EFGA 1HGZA 1JMMA 1ZR2A 2PP6A 1URQC 1IFMA 2KOGA 3TK1A 4KHXA 3RK2B 2D39A 2FFDA 5CHXA 1DEBA 1WRGA 3OA7A 1GK6A 1X9VA 2J58A 1RF1A 1LT9A 2Q7CA 4ZKUA 1X8YA 2YKQA 3HD7B 2JHMF 2WZ7A 4JYOX 2JJLA 2XNXB 1T2KD 2O1KA 1OXZA 3VN0A 3HE5B 5AVQB 5KLVK 2JHLF 3NFQA 4C46A 3T97A 4R9JA 4HYTB 2J61A 2YNYA 1HBWA 2N1TB 2H43B 1LTJB 3CL3D 2JEEA 3RK3C 1ZR4A 3B5NC 4I2LC 2E43A 1GU5A 3TYYA 2J0HA 4LGDE 2JHKF 1SFCA 1LTGC 1GW4A 1S9KE 1N86B 2ZXEB 3H32C 2Z4EA 1JCDA 1RF1C 1IK9A 3N4XA 1NO4A 2HYNA 3HD7A 2WSCH 2J3FD 4C7NA 3C9IA 3HE5A 1AQ5A 1FZBC 2OYIB 3VMYA 3KDPB 5AVSB 4WBAA 1J1EC 5AVWB 2W27A 5CJ4A 3HTKA 4AYCA 3OAKA 3VP9A 1SVFA 1HUCA 2YO3A 1FIBA 5CJ0A 4W80A 2E42A 2A45I 4N3YB 3HUSA 1ZLLA 4DOJA 1L4AA 1GW3A 5APVA 2YMYA 1KQLA 3MIWA 3L4FA 1NTKK 2W6AA 3CI9A 1LTAC 3RK2C 5AW2B 4JZCA 1KFNA 3P8CD 1MFZA 3A5TA 2IPPA 3KQGA 3HD7C 3BRTB 2HFED 1URQA 2XNXC 2J5ZA 1N73B 2GM4A 5CMZA 1FIDA 1FZAB 5CCHC 1QL1A 2OYIA 2WT7A 1DH3A 2QM8A 4HH2A 4I6MC 2N1TC 2H43C 1IO4A 1NH4A 3MGNA 5AVXB 4JYBA 2C9NY 1RF0B 1CW5A 5AW7B 3V2NA 1LTJC 1H89A 2HPCB 4GT1A 1FZBB 2A45G 1FAVA 1N7SD 1T3UA 2WPRA 4LLHA 3E1IB 3P7KA 3OJAB 2WTYA 1CI6B 1IJDB 2O01H 1ZV8A 2Q5UA 4WB4A 1XTCC 1MUUA 1VPCA 2M3BA 3VMXA 2JHHC 2J60A 1FZGB 1N86C 3VP8A 1SQXK 1RE3B 2PAJA 2NPSD 2WPSA 5BU8B 3B5NA 2LKMA 3M9HA 2J3OA 1LTTC 2Z5IA 5APYA 3TNUA 1GU4A 1HWTC 1OWAA 2P1JA 2WPQA 2KYVA 3NMDA 3A2AA 2J2PA 2P7JA 2NPSC 3H32A 1FZAA 1KILD 2GY7A 2OYIC 1FBMA 1LTIC 4AQRD 5KJ7D 3MTUE 3H6PA 1FOSE 2POHA 2J3UA 1RY3A 3LIDA 3BATA 3G3ZA 3A3YB 2H7HA 1JTHA 5APTA 2HPCA 1GD2E 2KP8A 1FZBA 3NXSA 2HLOB 1GTWA 1YTZI 5AVTB 3E1IA 1JY3P 1G2CB 1FZEB 3M0DC 1T2KC 1GZLA 3UIAA 1FJKA 5AVUB 1JUNA 2XV5A 2ZFCA 3MUDA 3HE4B 1FOSF 4EIJA 1FJPA 2C9LY 2OARA 5AW0B 2XKMA 3RL0D 3U59A 3WMM0 4O9BA 1IFDA 3U1CA 3V4QA 2GUSA 1YYCA 1N73C 1N7SB 1FZAC 2CPSA 1YTZT 2M8RA 1RE4B 1FZCB 1JNMA 1SQBK 4WY4D 1RF0C 2XNXA 1L0NK 5AVZB 2NPSB 2HPCC 1IC2A 1MZ9A 5CCHA 1FU1A 2A45H 2H8PD 3E1IC 2N1TA 1M1JB 2H43A 2CPBA 1T8ZA 3P8CE 1W2EA 3O8ZA 5AW6B 2XDJA 5APSA 1KILB 5KTBA 1LTSC 1FZGC 3M91A 3P8MC 1LTJA 2FIBA 1RE3C 2FYUK 1FZFB 1KZUB 2YKPA 3R2PA 3VMZA 1VDFA 2WSEH 4N78E 4OH8B 1PFIA 1ZN5A 3LW5H 4DZOA 1N86A 3V2RA 1S9KD 1GDTA 1N2DC 3GHGB 1N7SA 5AW3B 3SWYA 5AW9B 4C7RA 1NWQA 3CLQA 1SFCD 1NOHA 1CZQA 1SQQK 3V4WA 1AFOA 3L35A 1JY3N 2Q9IC 2WWWA 5AW5B 3KYQA 2NPSA 1KFMA 3EQ2A 1T3JA 3RL0B 2HLOC 3NTNA 1FZEC 3L37A 1E5WA 3BASA 3SWFA 1DX7A 4M7HA 1HVVA 4IFFA 4EPUA 1GL2D 1KILA 5KJ7A 1FZFA 4R9TA 1NKZB 2GUVA 1NHLA 2HODB 4WY4B 2P2UA 2FFDB 2C0XA 3L36A 3M0DA 4N6JA 1LT9B 5CCGD 3IR9A 1A02J 2J64A 4I1LA 1L4AD 1N7SC 1Z56A 2J3GA 2R5BA 4W7YA 4Y99B 1RE4C 2FXMA 1FZCC 2WITA 2WNPF 1FDMA 3V2QA 1J1DB 1N73A 1GK4A 4XA4A 1JY3O 4B86A 1H88A 1JCCA 2IFNA 5AVRB 1URQD 1HGVA 1NTMK 3V2PA 1M1JC 2Q9IB 1RF0A 3VYIA 3BRVB 1KILC 4LC1A 1MV8A 3LIEA 5KJ7C 2MJZA 2J59M 1FZFC 2Q3IA 1JO5A 1JOCA 1SFCB 1X79B 2R32A 2HODA 4WY4A 2Z4EB 1CI6A 2J3FA 3BVHC 2R5DA 4ZKPA 2WSFH 1HH0A 1FZGA 5APWA 1RE3A 1G1JA 3GHGC 4C7NB 3N7NA 2VRSA 3M06A 1SQPK 3II6A 3V5BA 1GL2B 2OYHB 1XTGB 2IFMA 4IFMA 3RK3D 1WT6A 5AW1B 1J2JB 1IFJA 3B5ND 5AW8B 2FYZA 2KLVA 3HTKB 3B8EB 2R3CA 3RL0C 3M9QA 3TSIA 2N9BA 1Z3SA 3U1AA 3HUSB 1LWUB 1L4AB 2Q9IA 1NU1K 5AVYB 5APQA 2Z5HA 3FIBA 2HLOA 2HODC 4WY4C 4AUWA 1FZEA 2FFDC 1G2CA 4W7ZA 2KSJA 1LT9C 1NAFA 3I5CA 4GIFA 5BVZA 5AW4B 1JY2N 2YO2A 3HE4A 1URQB 2QM7A 1M7LA 1FICA 4Y99C 1NTZK 3BVHB 1HJBA 2WT7B 1GL2A 2OYHA 3M9BA 1CSBA 4XE5B 1J1DC 4M7FA 1QL2A 5AVVB 1SP4A 2O1JA 1RE4A 1FZCA 1G1IA 2IX7C 5CCGA 4ZFGA 3VTPC 2P67A 3RK2D 1LWUA 1EQ7A 2I1JA 3PP5A 3HD7D 3M0AA 1SFCC 2BASA 2JHIF 3IFMA 3KPEA 2Z4EC 4RESB 1A02F 1M1JA 3RK3B 2J0YA 5APUA 1IFIA 2YKOA 3B5NB 5CCHD 2HG5D 3VOPA 2J1GA 1IFNA 3TNUB 2FKWB 2N1TD 1SLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY2 O;  3H32 B;  1FIB A;  1Z3U A;  2Q9I B;  1N73 C;  3BVH A;  1RF1 B;  1RF0 A;  2A45 I;  2OYH C;  1FZA C;  3HUS A;  1JC9 A;  1FZF C;  1RE4 B;  3GHG A;  1FZC B;  2HOD A;  4NYT A;  2Z4E B;  2J3F A;  3BVH C;  1RF0 C;  2XNX A;  3HUS C;  2HPC C;  1LWU C;  2J61 B;  1JY2 P;  1FZG A;  4JZC A;  1RE3 A;  3GHG C;  2A45 H;  3E1I C;  2J0G A;  2H43 A;  1M1J B;  2XNX C;  2J5Z A;  1N73 B;  1FZD A;  1W2E A;  2OYH B;  1FID A;  1FZA B;  1FZG C;  1LTJ A;  2FIB A;  1RE3 C;  1FZF B;  2OYI A;  2H43 C;  1Z3S A;  1RF0 B;  2D39 A;  3HUS B;  2FFD A;  1LTJ C;  1LWU B;  2HPC B;  2Q9I A;  1FZB B;  1N86 A;  1RF1 A;  2A45 G;  1LT9 A;  3GHG B;  1T3U A;  2JHM F;  3E1I B;  3FIB A;  2HLO A;  4JYO X;  2XNX B;  2HOD C;  1FZE A;  2FFD C;  2JHH C;  1JY3 N;  2J60 A;  1FZG B;  2Q9I C;  1N86 C;  1LT9 C;  1RE3 B;  2JHL F;  4R9J A;  2J61 A;  1JY2 N;  2H43 B;  2HLO C;  1FIC A;  2J3O A;  1FZE C;  3BVH B;  1LTJ B;  4M7H A;  2J2P A;  4EPU A;  3H32 A;  2OYH A;  4M7F A;  1FZA A;  2GY7 A;  2OYI C;  1FZF A;  4R9T A;  2J3U A;  2HOD B;  2J0H A;  2FFD B;  2JHK F;  1RE4 A;  1FZC A;  1N86 B;  4ZFG A;  1LT9 B;  3H32 C;  2Z4E A;  2HPC A;  1LWU A;  1RF1 C;  2J64 A;  1FZB A;  2HLO B;  2J3G A;  3E1I A;  1JY3 P;  1FZE B;  1RE4 C;  1FZC C;  2J3F D;  2WNP F;  2JHI F;  2Z4E C;  1M1J A;  2J0Y A;  1N73 A;  1FZB C;  2OYI B;  1JY3 O;  2J1G A;  1M1J C; 
#chains in the Genus database with same CATH topology
 1Z3U A;  3L70 D;  1GL2 C;  2FYU G;  1BE3 E;  3MD0 A;  1NTZ G;  4NYT A;  2XU6 A;  2FYU D;  1L0N J;  3P32 A;  1L0L K;  3PTZ A;  1NTZ D;  3A0H E;  1N7L A;  2J0G A;  1KV4 A;  1K73 Q;  1HGZ A;  4L74 A;  2ITA A;  1ZR2 A;  2PP6 A;  2XND H;  1EC5 A;  4KHX A;  3RK2 B;  2D39 A;  2FFD A;  1X9V A;  1BE3 J;  3LW5 J;  5KKZ C;  2QEX P;  2Q7C A;  2K88 A;  2YKQ A;  2JHM F;  2WZ7 A;  1W2B O;  3HE5 B;  1YIJ P;  2G8Y A;  3H1L J;  3NFQ A;  2JO1 A;  4R9J A;  2YNY A;  2ZYG A;  5GTI E;  2Y0E A;  4OGQ B;  1L0L G;  4I2L C;  1PZQ A;  3TYY A;  5TJH A;  1L0L D;  1NTM G;  1LTG C;  1GW4 A;  3H32 C;  1BGY E;  3KXD A;  1NTM D;  5KAF H;  1U7J A;  4H0L D;  2J3F D;  3HE5 A;  2OYI B;  3H1I G;  5L8R J;  2ZAE B;  1LP1 B;  1J1E C;  5AVW B;  2W27 A;  1VQ4 P;  2YO3 A;  3H1I D;  5CJ0 A;  1SQB E;  3MUD C;  4N3Y B;  2A06 G;  1QVG O;  1NGM B;  1YJ9 P;  1LTA C;  5AW2 B;  3F89 A;  3FX0 A;  2A06 D;  3KQG A;  1VQL P;  3CC2 P;  2XNX C;  3RGU A;  1JMB A;  2GM4 A;  1SQP J;  5CMZ A;  3CMA P;  1FID A;  4DJG A;  5CCH C;  1QL1 A;  2OYI A;  1AQT A;  2B89 A;  2QM8 A;  3FWL A;  2H43 C;  5AW7 B;  3V2N A;  1SQB J;  3CCS P;  1YJW P;  4GT1 A;  4DCK A;  1YQ4 C;  1T6A A;  1T3U A;  3OJA B;  3SFE C;  3AE5 C;  4UB6 H;  2Q3E A;  1KQS O;  1OFC X;  1VPC A;  2OQQ A;  1N86 C;  1SQX K;  2HR3 A;  1PP9 G;  2FYU J;  4RKU J;  2IZ0 A;  2J3O A;  1NTZ J;  2WPQ A;  2KYV A;  5H2F H;  1PP9 D;  2NPS C;  3H32 A;  3WU2 H;  1VQ8 P;  1S5L H;  2J3U A;  2LXB A;  4KT0 J;  1VQO P;  3LID A;  3BAT A;  1EZV D;  1JTH A;  4XFJ A;  2K1A A;  1VQ9 P;  1JY3 P;  3M0D C;  3AE7 C;  4UB6 E;  3UIA A;  4OVN F;  4U3F G;  2ZFC A;  2JP3 A;  3MUD A;  3HE4 B;  1FJP A;  4EYY Q;  2C9L Y;  3U59 A;  3WMM 0;  1Q90 D;  3EFF K;  3FXD A;  4U3F D;  3KHU A;  2ZJS E;  2YIU C;  1K04 A;  1RE4 B;  1S5L E;  3L72 G;  1PL5 A;  1K9M Q;  1RF0 C;  2N9Y B;  2XNX A;  4UB8 H;  2NPS B;  1MZ9 A;  5CCH A;  2Y0C A;  3L72 D;  4H0L C;  2H43 A;  1M1J B;  3AEE C;  5KLI C;  4D6T G;  5AW6 B;  3O8Z A;  1NTM J;  1KOR A;  2XDJ A;  3P8M C;  3CXH D;  4D6T D;  4ZMD A;  4N78 E;  2W6J H;  1LNQ A;  1KMI Z;  4OH8 B;  3SWK A;  1VQM P;  4DZO A;  1N86 A;  1S9K D;  4QMA A;  3CX5 I;  5AW9 B;  5GTH E;  1SFC D;  1NOH A;  1JY3 N;  2WQY C;  3C1L A;  4WVZ A;  2Q9I C;  3KYQ A;  2NPS A;  1T3J A;  3B71 A;  3RBZ A;  3NTN A;  2WSS H;  4IFF A;  2IBZ G;  2C0X A;  3M0D A;  4U7J A;  5CCG D;  1EDL A;  1L4A D;  2R3S A;  2IBZ D;  1FZC C;  2WIT A;  3I55 P;  2WNP F;  4BRY B;  3T97 B;  2ZVO B;  1J1D B;  1HF9 A;  3E1R A;  3V2P A;  3CXH H;  2Q9I B;  2YXR B;  1RF0 A;  3VYI A;  4LC1 A;  2J59 M;  1FZF C;  2YMK A;  1PP9 J;  3L71 G;  1X79 B;  2Z4E B;  2J3F A;  2QE7 H;  2WSF H;  1HH0 A;  3USS A;  1QVF O;  4DT0 A;  3N7N A;  2PFX A;  3L72 E;  3L75 G;  1XTG B;  4IFM A;  4BRY A;  1USD A;  1AVO A;  1QLE D;  3RK3 D;  1J2J B;  2FYZ A;  3H25 A;  2GA1 A;  3B8E B;  3L75 D;  1Z3S A;  2KIK A;  4D6T E;  1M90 Q;  1YIT P;  2Q9I A;  4I7Z B;  2AXT H;  5APQ A;  2HOD C;  4AUW A;  1G2C A;  1NAF A;  3I5C A;  3CWB G;  3FXE A;  4GOF A;  5BVZ A;  4NPE A;  2YO2 A;  1FIC A;  4JBZ A;  3CWB D;  3L72 J;  4EDF A;  2WT7 B;  1CSB A;  2QG4 A;  1P84 I;  3BCC E;  5AVV B;  3CCR P;  3IF4 A;  3AE1 C;  1FZC A;  1R8E A;  4ZFG A;  4D6T J;  3RK2 D;  1EQ7 A;  2AXT E;  3G71 P;  2I1J A;  2RH0 A;  1SFC C;  2W8Z A;  3KPE A;  2ZYD A;  2WSF J;  3B5N B;  5CBO A;  3AE4 C;  3JSV C;  1JY2 O;  1NTK E;  3A7O A;  1TU3 F;  1RF1 B;  4OGQ D;  1H8A A;  2KB7 P;  3O6Q B;  2I1K A;  1RHZ B;  4GKG A;  5CCG C;  1EXJ A;  1EDK A;  3HUS C;  3TGU E;  1L4A C;  4IFD K;  3CX5 D;  3L71 E;  2Y9Y A;  1JMM A;  3ABV C;  1NTK J;  1VQ6 P;  1RF1 A;  4YXW H;  3L75 E;  4JYO X;  1T2K D;  2O1K A;  2QRX A;  2KZI A;  2JHL F;  4HYT B;  2N1T B;  4HB1 A;  3L71 J;  1LTJ B;  3CL3 D;  1M1K Q;  2B87 A;  3RK3 C;  5B66 H;  1R5S A;  1PPJ E;  2E43 A;  1YI2 P;  1GU5 A;  4LGD E;  2JHK F;  1SFC A;  2BCC G;  2FXO A;  1JCD A;  1IK9 A;  3L75 J;  4PJ0 H;  2HYN A;  2BCC D;  4JPZ B;  3CX5 H;  4C7N A;  2B88 A;  2D2C B;  1KQF B;  3KDP B;  3A0B H;  3PLN A;  4AYC A;  1DIP A;  3OAK A;  1SVF A;  1HUC A;  1FIB A;  4W80 A;  2AEF A;  3CC4 P;  3WUU A;  1L0N E;  1LT1 A;  5B66 E;  3HUS A;  1L4A A;  2E75 B;  5APV A;  1KQL A;  2DW3 A;  3L4F A;  2NRG A;  3RK2 C;  1ZRT E;  4JZC A;  4GOE A;  1VQ7 P;  4PJ0 E;  2IPP A;  3Q1M A;  3CX5 E;  4IL6 H;  1N73 B;  1FZA B;  1EZV I;  3MP7 B;  2KK7 A;  3SFD C;  1VQP P;  4HH2 A;  3JCU E;  2OTK E;  5AVX B;  3WUV A;  2C9N Y;  1SQQ E;  4OGQ C;  1H89 A;  5K5G B;  3AEG C;  1KYO E;  2A45 G;  3H1L E;  1P84 D;  2WPR A;  4LLH A;  3P7K A;  2O01 H;  1ZV8 A;  2Q5U A;  1XTC C;  1MUU A;  3GMA A;  3D71 A;  1FZG B;  3CPW O;  2NPS D;  2WPS A;  2OYO A;  2LKM A;  5APY A;  3TNU A;  3S9O A;  1OWA A;  4IL6 E;  1VL2 A;  1NYH A;  1FZA A;  2GY7 A;  2OYI C;  3H6P A;  2POH A;  1UII A;  1SQQ J;  1VF5 B;  3PH0 A;  2H7H A;  5APT A;  3NXS A;  2HLO B;  3CXH I;  1GTW A;  5AVT B;  1T2K C;  1GZL A;  1FJK A;  1GMJ A;  2CK3 H;  1FOS F;  4EIJ A;  2OAR A;  1FS0 E;  1RQU A;  5AW0 B;  2XKM A;  1IFD A;  3U1C A;  2QJP B;  1YYC A;  2V4H A;  1OW8 A;  1DD4 A;  2M8R A;  1PGO A;  1P84 H;  3G4S P;  1MFT A;  1SQP E;  2KS1 B;  1IC2 A;  3GLM A;  1FU1 A;  2SPZ A;  2A45 H;  2O01 J;  1T8Z A;  2O01 N;  5APS A;  2BCC J;  1RH5 B;  4NPF X;  2IBZ I;  1VQ5 P;  3VMZ A;  3L70 E;  2AEJ A;  2QSI A;  2WSE H;  3CD6 P;  3QH9 A;  1YJN P;  1PGJ A;  3GHG B;  2FYU E;  1NWQ A;  5KAF E;  1AFO A;  3CCM P;  2ZXX A;  1P84 E;  1BSH A;  1NTZ E;  2WWW A;  3AE2 C;  5B5E H;  3G6E P;  1KFM A;  3EQ2 A;  4WWI A;  3RL0 B;  3GF7 A;  1LP1 A;  3L37 A;  2LXC B;  1HVV A;  1DEE G;  2KSE A;  4R9T A;  1NKZ B;  1N8R Q;  3L70 J;  4WY4 B;  3AE8 C;  1HJ0 A;  1LT9 B;  2M5A B;  2YXQ B;  1RE4 C;  1FDM A;  4IL6 X;  3Q5R A;  5B5E E;  3V2Q A;  4ZNC A;  2R44 A;  1EZV G;  4H13 B;  1M1J C;  1ZP0 C;  1L0L E;  1JO5 A;  2WSE J;  4WY4 A;  2AXC A;  3BVH C;  2WMM A;  1NTM E;  2K9Y A;  3M06 A;  2OYH B;  1SQX G;  2BEQ D;  5H2F E;  3CC7 P;  4MN4 C;  3WU2 E;  3B5N D;  2OTL P;  1DD3 A;  2KLV A;  3HTK B;  4HKZ H;  3H1I E;  3TSI A;  1SQX D;  1LWU B;  3FGA D;  1NU1 K;  1L0L J;  5AVY B;  2ZT9 B;  2KLU A;  4JQ0 D;  4EI2 A;  4L76 A;  4W7Z A;  2A06 E;  4TLF A;  5AW4 B;  1JY2 N;  3HE4 A;  1URQ B;  1K8A Q;  2QM7 A;  3H1H G;  3CME P;  3BVH B;  1HJB A;  1ZME C;  2OYH A;  4XE5 B;  1S2E A;  1J1D C;  4HJG H;  1KB9 I;  1QL2 A;  3H1H D;  3H1I J;  2Q1K A;  2O1J A;  1RE4 A;  1G1I A;  4UB8 E;  1LWU A;  1YQ3 C;  3ITK A;  1FC2 C;  3M0A A;  3MHV A;  1QGK B;  3GW6 A;  2Z4E C;  1M1J A;  2V7Q H;  1BCC G;  2J1G A;  1OW6 A;  1PP9 E;  2FKW B;  2N1T D;  1D7M A;  3BVH A;  3AE6 C;  1Q2N A;  1BCC D;  5C39 A;  5BU5 A;  1JC9 A;  1EZV E;  4JYC A;  2W6B A;  1JB0 J;  2J61 B;  2H88 C;  2FXP A;  4JF7 A;  5APX A;  4I7Z C;  2C0W A;  4PV1 B;  1SQV K;  1KD1 Q;  3EFG A;  2D2C D;  1S1C X;  4U3F E;  3AEC C;  2L91 A;  1KC8 Q;  2KOG A;  1BDC A;  4ASW A;  3TK1 A;  1DEB A;  1WRG A;  4ZKU A;  4K35 A;  1X8Y A;  3HD7 B;  2E75 D;  5E79 H;  2JJL A;  1OXZ A;  3VN0 A;  5AVQ B;  5KLV K;  3T97 A;  1AA0 A;  2J61 A;  2KXP B;  1HBW A;  4GDO A;  2M0B A;  1S5L X;  3CXH E;  1PGP A;  1ZR4 A;  2V7Q J;  2AEM A;  3B5N C;  4BXL A;  4U3F J;  2J0H A;  1YHQ P;  1S9K E;  2IYO A;  2ZXE B;  3H1H E;  2Z4E A;  1RF1 C;  1SQX J;  1NO4 A;  4L73 A;  3HD7 A;  5E79 E;  2IDB A;  2QVA A;  3KZI H;  3AEF C;  1FZB C;  5TIS H;  2I8D A;  5CJ4 A;  2A45 I;  1ZLL A;  4DOJ A;  1GW3 A;  2PRR A;  2FY8 A;  2B9B A;  3H1H J;  2IBZ E;  1VF5 D;  3P8C D;  1MFZ A;  2HFE D;  2OGU A;  2J5Z A;  2WT7 A;  1DH3 A;  4I6M C;  2N1T C;  2KNC B;  1NH4 A;  4JYB A;  1CW5 A;  4R4M A;  1LTJ C;  2HPC B;  1FZB B;  3L73 G;  1FAV A;  1KB9 D;  3E1I B;  2WTY A;  1CI6 B;  1IJD B;  1BCC J;  1U7M A;  4WB4 A;  2M3B A;  3VMX A;  3L73 D;  3VP8 A;  1X22 A;  1RE3 B;  3H1K G;  3B5N A;  3M9H A;  1LTT C;  2Z5I A;  1GU4 A;  1BE3 G;  3RK3 E;  2P1J A;  3NMD A;  2J2P A;  2D2C C;  3PRJ A;  3H1K D;  2Y9Z A;  1FBM A;  1LTI C;  3H1J G;  1AV1 A;  2KUB A;  3MTU E;  3O6Q A;  1FOS E;  1BE3 D;  1UIX A;  2KNC A;  2QJY B;  1ZXG A;  2G3A A;  3G3Z A;  3A3Y B;  3H1J D;  2HPC A;  1GD2 E;  1FZB A;  5KAI H;  1YTZ I;  2E75 C;  3E1I A;  1FZE B;  3AEB C;  2E76 C;  3Q5S A;  5AVU B;  2XV5 A;  3CCL P;  1OW7 A;  2E5T A;  3GF3 A;  5DJU B;  3CWB E;  2QJK B;  3RL0 D;  4O9B A;  1RQV A;  3V4Q A;  2GUS A;  1N73 C;  1N7S B;  3CCU P;  1FZA C;  2CPS A;  3W67 A;  2QIW A;  2FYN B;  1JNM A;  1SQB K;  4WY4 D;  1KB9 H;  5AVZ B;  5KAI E;  3G9R A;  2N1T A;  1E79 H;  3P8C E;  1M57 D;  3Q2Y A;  1W2E A;  4RO0 A;  2K37 A;  1KIL B;  1LTS C;  1FZG C;  2K3R A;  1LTJ A;  2FIB A;  2FYU K;  2YKP A;  3CWB J;  3S4R A;  3OW2 O;  4H13 D;  4PD4 I;  4NPD A;  2E76 B;  1Q81 Q;  1BGY G;  1SS1 A;  1NJI Q;  1PFI A;  3LW5 H;  3V2R A;  5AW3 B;  1N7S A;  3SWY A;  4C7R A;  3CLQ A;  1BGY D;  1FE6 A;  2W90 A;  1CZQ A;  4R4L A;  3V4W A;  1KB9 E;  1VF5 C;  2J5U A;  4H44 B;  3A0B E;  2HLO C;  1SQB G;  3D6Z A;  4EPU A;  1KIL A;  5KJ7 A;  3CCV P;  1SQB D;  2P10 A;  4L75 A;  2WVR A;  2FFD B;  1OIP A;  3L36 A;  4N6J A;  4TT3 H;  2QJP C;  3Q5P A;  1A02 J;  2J64 A;  4I1L A;  1OX3 A;  1Z56 A;  2J3G A;  3H1J E;  4Y99 B;  2ZT9 D;  2FXM A;  1M8O B;  3JC2 2;  1N73 A;  2E74 B;  2M3E A;  3L73 J;  2WPV B;  1H88 A;  5GTI H;  1JCC A;  1URQ D;  1HGV A;  1NTM K;  3EWK A;  3BRV B;  1EXI A;  3LIE A;  1JOC A;  3H1K J;  3QWO C;  4CPG A;  2R5D A;  4KJM A;  2BCC E;  1FZG A;  1LJ2 A;  1G1J A;  3GHG C;  3AEA C;  3H1J J;  4Y28 J;  1BDD A;  3R4Y A;  2ZYA A;  3FWN A;  1GL2 B;  2H89 C;  2IFM A;  1IFJ A;  2ZVN B;  3AE3 C;  3RL0 C;  2N9B A;  1ZOY C;  4A7P A;  2Z5H A;  3FIB A;  2HLO A;  4WY4 C;  1LT9 C;  4GIF A;  1U57 A;  4PV1 D;  4BWN A;  5KKZ B;  1GL2 A;  1L2P A;  4H13 C;  1WMK A;  2IX7 C;  1NVO A;  2RMZ A;  2FBW C;  2P67 A;  3TF5 A;  1OZH A;  2KS1 A;  2MKV A;  3PP5 A;  1KN7 A;  3HD7 D;  3Q3D A;  3IFM A;  1IFP A;  4RES B;  1A02 F;  1BGY J;  2HG5 D;  3VOP A;  1IFN A;  2Y0D A;  3PJS K;  1JEK A;  3H32 B;  1IK7 A;  2XZR A;  4N78 D;  2OYH C;  1LTB C;  3I56 P;  3D70 A;  1HTL C;  5DJT B;  1JM0 A;  3GHG A;  1FDO A;  4PD4 D;  1JTH B;  3HRN A;  1LGH B;  3PHL A;  1LWU C;  1JY2 P;  4EOT A;  4M3L A;  1J1E B;  2L5G B;  2ZT9 C;  1FZD A;  1NKN A;  1URQ C;  1IFM A;  1YBK A;  5CHX A;  3OA7 A;  1GK6 A;  2J58 A;  1LT9 A;  1USE A;  2M5A A;  2PGD A;  2K9J B;  3CCQ P;  2XNX B;  3S1K A;  3B4S A;  1BSN A;  1OVU A;  4C46 A;  2H43 B;  3K5B A;  2JDI H;  4RJT A;  2IZ1 A;  2E5Y A;  1S3J A;  2JEE A;  1H0T B;  3AED C;  1Y8A A;  1NAY A;  1S72 P;  3D6Y A;  1N86 B;  4PD4 H;  1KTM A;  3N4X A;  5GTH H;  1S4X A;  2WSC H;  2K9J A;  1PGQ A;  3C9I A;  1AQ5 A;  3VMY A;  1AVY A;  5AVS B;  4WBA A;  3HTK A;  4PV1 C;  3VP9 A;  2QA4 P;  3L74 G;  2E42 A;  2RN0 A;  1H0T A;  2YMY A;  1KQG B;  3MIW A;  3L74 D;  1NTK K;  2Q6Q A;  2W6A A;  3CI9 A;  1NU1 G;  4PD4 E;  1KFN A;  3A5T A;  3HD7 C;  3BRT B;  1URQ A;  1NU1 D;  2YIU B;  2RKL A;  3BCC G;  5M1B A;  4IOI H;  2JWD A;  1W5C E;  3AE9 C;  4ASV A;  1PIX A;  1KYO I;  2O3J A;  1IO4 A;  3BCC D;  1Y47 A;  3IAO A;  3MGN A;  1RF0 B;  1QX8 A;  3WUT A;  1N7S D;  4H0L B;  5KLI B;  2JHH C;  2J60 A;  2OTJ P;  2PAJ A;  3RL0 g;  5BU8 B;  4Z1M H;  1NTK G;  2WSC J;  1HWT C;  3A2A A;  5CBN A;  4GOD A;  2P7J A;  1KIL D;  4AQR D;  1NTK D;  5KJ7 D;  1SQX E;  2JWA A;  3TGU G;  1RY3 A;  2LR2 A;  2BEZ F;  2E76 D;  2KP8 A;  3TGU D;  1OMI A;  1G2C B;  1R5L A;  1JUN A;  3L71 D;  4H44 D;  1EDI A;  1MKM A;  1SQV G;  1QEX A;  1K05 A;  1SQV D;  1YTZ T;  1FZC B;  1AJY A;  1L0N K;  1IZN B;  2HPC C;  4K3A A;  3L74 E;  2H8P D;  3E1I C;  4OWF A;  1VQK P;  3F5H A;  2CPB A;  1Y9B A;  1PPJ G;  3W68 A;  5KTB A;  5KLV G;  3M91 A;  1RE3 C;  1FZF B;  1KZU B;  1NU1 E;  2E74 D;  3R2P A;  1VDF A;  1BCC E;  1PPJ D;  5KLV D;  1ZN5 A;  1Q86 Q;  1GDT A;  1N2D C;  2UWJ E;  1SQQ K;  3L35 A;  3KZI E;  2QJY C;  5AW5 B;  1Q7Y Q;  3L74 J;  1M56 D;  2IYP A;  5TIS E;  3CCE P;  2KI7 B;  1FZE C;  1E5W A;  1L0N G;  3BAS A;  3SWF A;  1DX7 A;  4M7H A;  3ZDM A;  1GL2 D;  1NU1 J;  3IN6 A;  1FZF A;  1OVV A;  2GUV A;  1L0N D;  1NHL A;  2HOD B;  2P2U A;  1KIL E;  2QJK C;  3IR9 A;  3BCC J;  1N7S C;  1ZRT D;  2R5B A;  4W7Y A;  3C8V A;  2FYN C;  1GK4 A;  1Q82 Q;  4XA4 A;  1JY3 O;  4B86 A;  1SQQ G;  5AVR B;  2IFN A;  3E7K A;  3MZW B;  2B87 B;  3CCJ P;  3H1L G;  1KIL C;  1MV8 A;  5KJ7 C;  1SQQ D;  3SSU A;  2MJZ A;  2Q3I A;  1OVR A;  1KYO D;  1ZW0 A;  1SFC B;  3H1L D;  2R32 A;  2HOD A;  1CI6 A;  2KZJ A;  1SQV E;  3VMA A;  4ZKP A;  5APW A;  1RE3 A;  5EFW B;  4C7N B;  2VRS A;  1SQP K;  3II6 A;  3V5B A;  3TGU J;  3RBX A;  1WT6 A;  5AW1 B;  4H44 C;  5AW8 B;  2NZ2 A;  2R3C A;  3M9Q A;  3GG2 A;  3U1A A;  2P58 A;  3HUS B;  1L4A B;  4YTP C;  5KLV E;  1FZE A;  2FFD C;  1SQV J;  2KSJ A;  1PV3 A;  1M7L A;  4Y99 C;  1NTZ K;  4M7F A;  3M9B A;  3JCU H;  2E74 C;  3V6I A;  4YPC A;  1X0T A;  4YXD C;  2JR8 A;  1SP4 A;  1SQP G;  1FDI A;  5CCG A;  3VTP C;  1KYO H;  1VQN P;  2JKV A;  3TDK A;  1EDJ A;  5KLV J;  3A0H H;  1SQP D;  3L73 E;  2BAS A;  2JHI F;  3RK3 B;  2J0Y A;  5APU A;  1IFI A;  2YKO A;  3L70 G;  5CCH D;  3TNU B;  2W83 C;  3H1K E;  1SLQ A; 
#chains in the Genus database with same CATH homology
 1JY2 O;  3H32 B;  1Z3U A;  3A7O A;  3BVH A;  2XZR A;  1RF1 B;  1GL2 C;  4N78 D;  2OYH C;  1LTB C;  5BU5 A;  1H8A A;  1HTL C;  2KB7 P;  1JC9 A;  2I1K A;  3MD0 A;  3GHG A;  4NYT A;  2XU6 A;  1JTH B;  3HRN A;  4GKG A;  2W6B A;  4JYC A;  5CCG C;  1LGH B;  3HUS C;  3P32 A;  1L0L K;  1LWU C;  2J61 B;  1JY2 P;  1L4A C;  4JF7 A;  5APX A;  4EOT A;  4IFD K;  4M3L A;  2C0W A;  1J1E B;  2L5G B;  1N7L A;  2J0G A;  1SQV K;  1FZD A;  1NKN A;  3EFG A;  1HGZ A;  1JMM A;  1ZR2 A;  2PP6 A;  1URQ C;  1IFM A;  2KOG A;  3TK1 A;  4KHX A;  3RK2 B;  2D39 A;  2FFD A;  5CHX A;  1DEB A;  1WRG A;  3OA7 A;  1GK6 A;  1X9V A;  2J58 A;  1RF1 A;  1LT9 A;  2Q7C A;  4ZKU A;  1X8Y A;  2YKQ A;  3HD7 B;  2JHM F;  2WZ7 A;  4JYO X;  2JJL A;  2XNX B;  1T2K D;  2O1K A;  1OXZ A;  3VN0 A;  3HE5 B;  5AVQ B;  5KLV K;  2JHL F;  3NFQ A;  4C46 A;  3T97 A;  4R9J A;  4HYT B;  2J61 A;  2YNY A;  1HBW A;  2N1T B;  2H43 B;  1LTJ B;  3CL3 D;  2JEE A;  3RK3 C;  1ZR4 A;  3B5N C;  4I2L C;  2E43 A;  1GU5 A;  3TYY A;  2J0H A;  4LGD E;  2JHK F;  1SFC A;  1LTG C;  1GW4 A;  1S9K E;  1N86 B;  2ZXE B;  3H32 C;  2Z4E A;  1JCD A;  1RF1 C;  1IK9 A;  3N4X A;  1NO4 A;  2HYN A;  3HD7 A;  2WSC H;  2J3F D;  4C7N A;  3C9I A;  3HE5 A;  1AQ5 A;  1FZB C;  2OYI B;  3VMY A;  3KDP B;  5AVS B;  4WBA A;  1J1E C;  5AVW B;  2W27 A;  5CJ4 A;  3HTK A;  4AYC A;  3OAK A;  3VP9 A;  1SVF A;  1HUC A;  2YO3 A;  1FIB A;  5CJ0 A;  4W80 A;  2E42 A;  2A45 I;  4N3Y B;  3HUS A;  1ZLL A;  4DOJ A;  1L4A A;  1GW3 A;  5APV A;  2YMY A;  1KQL A;  3MIW A;  3L4F A;  1NTK K;  2W6A A;  3CI9 A;  1LTA C;  3RK2 C;  5AW2 B;  4JZC A;  1KFN A;  3P8C D;  1MFZ A;  3A5T A;  2IPP A;  3KQG A;  3HD7 C;  3BRT B;  2HFE D;  1URQ A;  2XNX C;  2J5Z A;  1N73 B;  2GM4 A;  5CMZ A;  1FID A;  1FZA B;  5CCH C;  1QL1 A;  2OYI A;  2WT7 A;  1DH3 A;  2QM8 A;  4HH2 A;  4I6M C;  2N1T C;  2H43 C;  1IO4 A;  1NH4 A;  3MGN A;  5AVX B;  4JYB A;  2C9N Y;  1RF0 B;  1CW5 A;  5AW7 B;  3V2N A;  1LTJ C;  1H89 A;  2HPC B;  4GT1 A;  1FZB B;  2A45 G;  1FAV A;  1N7S D;  1T3U A;  2WPR A;  4LLH A;  3E1I B;  3P7K A;  3OJA B;  2WTY A;  1CI6 B;  1IJD B;  2O01 H;  1ZV8 A;  2Q5U A;  4WB4 A;  1XTC C;  1MUU A;  1VPC A;  2M3B A;  3VMX A;  2JHH C;  2J60 A;  1FZG B;  1N86 C;  3VP8 A;  1SQX K;  1RE3 B;  2PAJ A;  2NPS D;  2WPS A;  5BU8 B;  3B5N A;  2LKM A;  3M9H A;  2J3O A;  1LTT C;  2Z5I A;  5APY A;  3TNU A;  1GU4 A;  1HWT C;  1OWA A;  2P1J A;  2WPQ A;  2KYV A;  3NMD A;  3A2A A;  2J2P A;  2P7J A;  2NPS C;  3H32 A;  1FZA A;  1KIL D;  2GY7 A;  2OYI C;  1FBM A;  1LTI C;  4AQR D;  5KJ7 D;  3MTU E;  3H6P A;  1FOS E;  2POH A;  2J3U A;  1RY3 A;  3LID A;  3BAT A;  3G3Z A;  3A3Y B;  2H7H A;  1JTH A;  5APT A;  2HPC A;  1GD2 E;  2KP8 A;  1FZB A;  3NXS A;  2HLO B;  1GTW A;  1YTZ I;  5AVT B;  3E1I A;  1JY3 P;  1G2C B;  1FZE B;  3M0D C;  1T2K C;  1GZL A;  3UIA A;  1FJK A;  5AVU B;  1JUN A;  2XV5 A;  2ZFC A;  3MUD A;  3HE4 B;  1FOS F;  4EIJ A;  1FJP A;  2C9L Y;  2OAR A;  5AW0 B;  2XKM A;  3RL0 D;  3U59 A;  3WMM 0;  4O9B A;  1IFD A;  3U1C A;  3V4Q A;  2GUS A;  1YYC A;  1N73 C;  1N7S B;  1FZA C;  2CPS A;  1YTZ T;  2M8R A;  1RE4 B;  1FZC B;  1JNM A;  1SQB K;  4WY4 D;  1RF0 C;  2XNX A;  1L0N K;  5AVZ B;  2NPS B;  2HPC C;  1IC2 A;  1MZ9 A;  5CCH A;  1FU1 A;  2A45 H;  2H8P D;  3E1I C;  2N1T A;  1M1J B;  2H43 A;  2CPB A;  1T8Z A;  3P8C E;  1W2E A;  3O8Z A;  5AW6 B;  2XDJ A;  5APS A;  1KIL B;  5KTB A;  1LTS C;  1FZG C;  3M91 A;  3P8M C;  1LTJ A;  2FIB A;  1RE3 C;  2FYU K;  1FZF B;  1KZU B;  2YKP A;  3R2P A;  3VMZ A;  1VDF A;  2WSE H;  4N78 E;  4OH8 B;  1PFI A;  1ZN5 A;  3LW5 H;  4DZO A;  1N86 A;  3V2R A;  1S9K D;  1GDT A;  1N2D C;  3GHG B;  1N7S A;  5AW3 B;  3SWY A;  5AW9 B;  4C7R A;  1NWQ A;  3CLQ A;  1SFC D;  1NOH A;  1CZQ A;  1SQQ K;  3V4W A;  1AFO A;  3L35 A;  1JY3 N;  2Q9I C;  2WWW A;  5AW5 B;  3KYQ A;  2NPS A;  1KFM A;  3EQ2 A;  1T3J A;  3RL0 B;  2HLO C;  3NTN A;  1FZE C;  3L37 A;  1E5W A;  3BAS A;  3SWF A;  1DX7 A;  4M7H A;  1HVV A;  4IFF A;  4EPU A;  1GL2 D;  1KIL A;  5KJ7 A;  1FZF A;  4R9T A;  1NKZ B;  2GUV A;  1NHL A;  2HOD B;  4WY4 B;  2P2U A;  2FFD B;  2C0X A;  3L36 A;  3M0D A;  4N6J A;  1LT9 B;  5CCG D;  3IR9 A;  1A02 J;  2J64 A;  4I1L A;  1L4A D;  1N7S C;  1Z56 A;  2J3G A;  2R5B A;  4W7Y A;  4Y99 B;  1RE4 C;  2FXM A;  1FZC C;  2WIT A;  2WNP F;  1FDM A;  3V2Q A;  1J1D B;  1N73 A;  1GK4 A;  4XA4 A;  1JY3 O;  4B86 A;  1H88 A;  1JCC A;  2IFN A;  5AVR B;  1URQ D;  1HGV A;  1NTM K;  3V2P A;  1M1J C;  2Q9I B;  1RF0 A;  3VYI A;  3BRV B;  1KIL C;  4LC1 A;  1MV8 A;  3LIE A;  5KJ7 C;  2MJZ A;  2J59 M;  1FZF C;  2Q3I A;  1JO5 A;  1JOC A;  1SFC B;  1X79 B;  2R32 A;  2HOD A;  4WY4 A;  2Z4E B;  1CI6 A;  2J3F A;  3BVH C;  2R5D A;  4ZKP A;  2WSF H;  1HH0 A;  1FZG A;  5APW A;  1RE3 A;  1G1J A;  3GHG C;  4C7N B;  3N7N A;  2VRS A;  3M06 A;  1SQP K;  3II6 A;  3V5B A;  1GL2 B;  2OYH B;  1XTG B;  2IFM A;  4IFM A;  3RK3 D;  1WT6 A;  5AW1 B;  1J2J B;  1IFJ A;  3B5N D;  5AW8 B;  2FYZ A;  2KLV A;  3HTK B;  3B8E B;  2R3C A;  3RL0 C;  3M9Q A;  3TSI A;  2N9B A;  1Z3S A;  3U1A A;  3HUS B;  1LWU B;  1L4A B;  2Q9I A;  1NU1 K;  5AVY B;  5APQ A;  2Z5H A;  3FIB A;  2HLO A;  2HOD C;  4WY4 C;  4AUW A;  1FZE A;  2FFD C;  1G2C A;  4W7Z A;  2KSJ A;  1LT9 C;  1NAF A;  3I5C A;  4GIF A;  5BVZ A;  5AW4 B;  1JY2 N;  2YO2 A;  3HE4 A;  1URQ B;  2QM7 A;  1M7L A;  1FIC A;  4Y99 C;  1NTZ K;  3BVH B;  1HJB A;  2WT7 B;  1GL2 A;  2OYH A;  3M9B A;  1CSB A;  4XE5 B;  1J1D C;  4M7F A;  1QL2 A;  5AVV B;  1SP4 A;  2O1J A;  1RE4 A;  1FZC A;  1G1I A;  2IX7 C;  5CCG A;  4ZFG A;  3VTP C;  2P67 A;  3RK2 D;  1LWU A;  1EQ7 A;  2I1J A;  3PP5 A;  3HD7 D;  3M0A A;  1SFC C;  2BAS A;  2JHI F;  3IFM A;  3KPE A;  2Z4E C;  4RES B;  1A02 F;  1M1J A;  3RK3 B;  2J0Y A;  5APU A;  1IFI A;  2YKO A;  3B5N B;  5CCH D;  2HG5 D;  3VOP A;  2J1G A;  1IFN A;  3TNU B;  2FKW B;  2N1T D;  1SLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...