2HODB

Crystal structure of fragment d from human fibrinogen complexed with gly-hydroxypro-arg-pro-amide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
307
structure length
307
Chain Sequence
b'LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
molecule tags Blood clotting/peptide
total genus 59
structure length 307
sequence length 307
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2006-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hodB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2hodB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2hodB03
1FZEB 2Z4EC 2JHKF 2J5ZA 4R9TA 1JY3N 2HODC 2OYHA 1N73A 2J3OA 3BVHA 3GHGA 3BVHB 1FZCA 1RF1C 1RF0C 2OYIC 2JHIF 2JHLF 4ZFGA 1JY2N 2FFDA 4M7HA 3H32C 2FFDB 1FIDA 3E1IC 1M1JC 1RE4C 2Z4EB 2J0HA 2JHHC 3HUSC 2HPCC 1FZEA 2HODB 2XNXC 1FZAC 2Q9IA 2J0GA 2Q9IB 2FIBA 1LWUC 1FZBA 1FZGA 1RE3A 1N73C 1FZBB 1FZGB 2OYIB 2J2PA 1RE3B 1Z3SA 1LT9A 3H32B 2JHMF 1LT9B 1FZCC 3E1IB 4M7FA 2A45G 2HLOC 4JYOX 1T3UA 1LTJA 3HUSB 2HPCB 1LTJB 2Z4EA 1Z3UA 2H43C 1FZFC 1JY2P 2D39A 2XNXB 1FZAB 2J0YA 4R9JA 2HODA 1N86C 2J3UA 2J61B 1RF1A 1RF1B 1RF0B 2OYIA 2OYHC 2J60A 1JY2O 3FIBA 3H32A 3BVHC 3GHGC 3E1IA 1FIBA 1JY3P 1M1JA 2J64A 2J3GA 1M1JB 2J3FA 4EPUA 1RE4B 2FFDC 1FZFB 1FZDA 3HUSA 2HPCA 1N86B 2XNXA 4JZCA 1FZAA 1JY3O 1W2EA 2J61A 2J3FD 1JC9A 1LWUA 2J1GA 1FZEC 1LWUB 2GY7A 2OYHB 1N73B 2Q9IC 1RF0A 3GHGB 1FZCB 4NYTA 1FZGC 1FZBC 1RE3C 2HLOA 1LT9C 1FICA 2HLOB 2A45H 1RE4A 2H43A 2A45I 1FZFA 2H43B 2WNPF 1N86A 1LTJC
chains in the Genus database with same CATH superfamily
3AEEC 3PJSK 1LTGC 1YTZI 3HTKA 3GMAA 2KXPB 4L75A 1JCDA 2FYUD 5B66E 1FZCA 1JM0A 3L74G 3V5BA 3HE5B 1DD3A 3H1LJ 1FE6A 3VYIA 2NRGA 1N8RQ 2Z5IA 2OYOA 1K9MQ 3PP5A 1QLED 3L72E 1YITP 1FZBA 2R3SA 5AVRB 1OW7A 1NJIQ 3S1KA 2ZVOB 2W90A 3II6A 1SQPJ 3L37A 3CMAP 3HUSB 4PD4E 1JTHA 3H1HJ 2G8YA 2HODA 1N2DC 2B9BA 2WSCH 3L74D 3SWKA 2ITAA 3EWKA 2W8ZA 2J60A 1SQVG 3RK2C 3H32A 1VQ9P 4GOFA 1ZW0A 3I56P 3L75G 1OXZA 1L0LD 1GK6A 3TNUB 3WUUA 1AQ5A 3G9RA 2ZT9B 1SFCA 4N78D 1NKZB 2IYPA 4YXWH 2Q9IC 1QL2A 1IFDA 3L73J 1G1IA 3CC7P 4OVNF 1H0TA 3LW5J 4H13B 3G4SP 1FZFA 2H43B 1AV1A 1T2KC 2QJKC 3KHUA 2BASA 3CWBE 1LGHB 1SQVD 2OYHA 3HTKB 4K35A 1T3JA 1OVVA 3BVHA 3SFEC 2R32A 1KYOE 1BSHA 1KILA 4WY4C 3RBZA 1UIIA 2WWWA 2JWDA 4C7RA 1P84I 5AW8B 3H1LE 3KZIH 2JHHC 4PJ0E 1BGYG 4I7ZC 5CJ0A 1DEEG 2J0GA 1IFIA 2FIBA 1LWUC 2M8RA 1FZBB 2IBZD 3RL0C 2QSIA 1FZCC 5C39A 4C7NA 4M7FA 1EDLA 1MZ9A 1IFPA 1NTMJ 2Z4EA 1JTHB 2P67A 1G1JA 3ZDMA 3BCCG 1LP1A 1NHLA 3H1IG 4IL6H 3SSUA 2QJPB 3D6ZA 4RJTA 3USSA 3HE4A 1BGYD 4AQRD 5CJ4A 4L76A 3VMYA 2AEFA 5KKZC 4JZCA 3F5HA 5E79H 1SFCB 4OWFA 2QM8A 1NWQA 2E76D 1Q81Q 3S9OA 1OVRA 1RE4A 1KILE 3HD7D 2BEZF 1D7MA 3BCCD 1LTJC 2M3BA 2RMZA 3KQGA 1NTZK 1AFOA 4ZMDA 3BVHB 2Q5UA 1IFJA 1BE3D 3L74J 2JHLF 1L0NE 4NPEA 1KILB 2N9YB 2WSSH 2UWJE 1VQMP 2O01H 4Z1MH 2J0HA 3QH9A 4UB6H 2XNXC 1ZMEC 3RK3C 4PV1B 4OGQD 4JYBA 3WMM0 1MFTA 2XKMA 1M7LA 4JYOX 3VP9A 1HJ0A 3L72G 1NTME 5KLVK 3BASA 2HFED 2C9NY 2WPQA 1IZNB 1NAFA 1Y9BA 1RF0B 4IFFA 2KSJA 3CI9A 1SQVJ 1FIBA 4TT3H 1NH4A 1VQOP 4BRYA 2FFDC 3O8ZA 2FYUE 2CK3H 3P7KA 1VQ8P 4WVZA 5B5EE 2KS1B 2Y9ZA 3RL0g 2WMMA 1FDOA 2ZXEB 1HH0A 3EFGA 1CI6B 1M1KQ 1XTCC 2K88A 3GHGB 2K9YA 2YXQB 1N7SC 3L72D 2V4HA 3IR9A 3Q2YA 5KJ7C 5APTA 2E74B 5BU5A 3MGNA 3ABVC 1NOHA 3T97A 4R9TA 1AA0A 4GOEA 2M0BA 1SQBD 1SQXK 3TYYA 1GZLA 3FX0A 5CBNA 2YMYA 2QIWA 2WITA 2ZT9D 1P84H 2QE7H 3PRJA 1RE4C 3L74E 3CWBG 3TF5A 1S9KD 1YJWP 4YTPC 1XTGB 2YIUC 1YTZT 1BGYJ 4H13D 2YKQA 2Q3IA 2YMKA 1RE3A 1K05A 4H44B 1GD2E 1LT9A 1Q2NA 1L0LE 2JHMF 4MN4C 3F89A 3M0AA 2A45G 3CLQA 3B4SA 1HBWA 2B87A 2KYVA 1J1DB 1HUCA 1KQLA 2ZYGA 2JR8A 1S72P 3BCCJ 2FYZA 1JY2O 3AE2C 1KFMA 2SPZA 3E1IA 3CWBD 1PZQA 4BRYB 2HPCA 1GU4A 2IZ0A 2NPSC 1J2JB 2RH0A 1VQLP 1AQTA 2KSEA 2W6JH 2ZJSE 3HD7A 2KB7P 1NO4A 1VQ7P 1PGPA 2CPSA 5CMZA 1HTLC 1CSBA 2PGDA 3G71P 3AEDC 2IBZE 1ZP0C 1N73A 3E1RA 2J3OA 2HR3A 3CCJP 2JHIF 4JYCA 2GM4A 1Y47A 2GUVA 2WQYC 1Q86Q 4AUWA 2JDIH 4WBAA 1L0NG 2OYIB 1BDCA 1RE3B 1PFIA 1LT9B 3HE5A 3CCVP 3PHLA 1SQQK 5CCHD 3C8VA 3TSIA 2WVRA 3P8CE 3NFQA 1GL2B 2B87B 3L72J 3AEAC 2XV5A 3AEGC 1URQD 2I1KA 1RF1A 2A06D 1USDA 1YYCA 2WTYA 5AVVB 1QX8A 3TGUE 1SQBJ 3HUSA 4PV1D 5AW1B 1L0ND 4IL6X 2E75B 1BE3E 2L91A 1H89A 4UB8H 1UIXA 1FZGC 3V2NA 2FYUG 3FGAD 4K3AA 3FXDA 1VF5C 3VTPC 3VP8A 1FZEB 2Q7CA 2N1TD 1BCCE 4I1LA 2K37A 3TK1A 4KHXA 1PP9D 3VMZA 5E79E 1KB9I 1VQ6P 1DD4A 3CWBJ 2QVAA 3M9HA 1A02J 3GLMA 5GTHH 2P2UA 1Q7YQ 1N73C 5AVZB 2E74D 2JO1A 2B89A 3A0BE 3CXHI 4W7YA 1N86A 3H1JD 1VPCA 1OWAA 2D2CC 2WT7A 2AEMA 1HVVA 5APVA 4OGQC 2J0YA 4R9JA 3Q1MA 1YIJP 1L0LG 4W80A 2O01N 4KT0J 4UB6E 1RF1B 5M1BA 2J64A 4DT0A 3MP7B 1W5CE 1U7JA 4H44D 2V7QJ 3VMAA 1SQBE 1S4XA 3CD6P 1PL5A 5KLIB 1NTZE 4AYCA 2K9JA 2Z5HA 1VQKP 3U1CA 1S9KE 2HLOA 2WZ7A 1WT6A 4HH2A 4ZNCA 3FXEA 3CCEP 1CZQA 1OZHA 1VDFA 3N7NA 3MHVA 1W2BO 5AVYB 2Y0DA 3L36A 5TISH 5AW9B 3BRVB 2IBZG 2QJKB 3B71A 1S2EA 5AVXB 3K5BA 4CPGA 1FZAC 1WMKA 5CCHA 1NTKK 2ZAEB 2OTLP 1L0NJ 5APUA 2Y0EA 1YJ9P 3CX5I 4R4MA 2KNCB 1KC8Q 1FJKA 2YO2A 1URQA 2H43C 2Q1KA 3B5NC 4I7ZB 2WT7B 1P84E 3JCUE 1N86C 2Y9YA 1GW4A 1OIPA 4RO0A 3RL0B 2FXMA 1KORA 1YQ3C 1ZV8A 4EYYQ 4ZKUA 4JPZB 5CHXA 2O1JA 3V6IA 1ZRTD 1PP9J 1AJYA 1T8ZA 5GTIH 2QEXP 1K04A 4EDFA 4ASWA 1JMMA 3MUDA 3CMEP 5AVWB 3V2RA 3M0DA 1M56D 3TGUG 1RF0A 2K9JB 1GL2D 1FZBC 2JEEA 3RBXA 2WSEJ 2HLOB 1K8AQ 1EDIA 2FYUJ 2N1TA 5KKZB 2CPBA 2R44A 1L4AB 1BE3G 3H1JJ 4BXLA 5CCGA 2WPVB 2KS1A 2OQQA 1OMIA 2HODC 1CI6A 5AVUB 2O3JA 3P8CD 3GHGA 2AXCA 4YXDC 2MJZA 2E75D 2JP3A 2FXPA 3V2PA 1KB9H 3H32C 1R5LA 1PV3A 1YHQP 2A06E 3L71D 4GT1A 1ZXGA 1BCCG 3TGUD 3PTZA 4EI2A 1EZVI 1S5LH 1SFCC 3CXHH 1NU1K 3FWNA 1KQSO 4EIJA 1FBMA 3A3YB 2KP8A 1HGZA 5KAIE 1PPJD 1URQB 1FZFC 1JY2P 2XNXB 5AVSB 4Y99C 3M9QA 3RK3B 3KPEA 1GW3A 3L4FA 1L0LJ 5CCHC 2OYHC 1LJ2A 1QVFO 3BVHC 2W83C 2PFXA 1ZR2A 1IFMA 1R8EA 1BCCD 1FZDA 1KILC 2ZXXA 1JNMA 1TU3F 1FAVA 5APSA 1GU5A 2H8PD 3MTUE 3UIAA 2DW3A 1PP9E 1W2EA 1JC9A 4EOTA 4DJGA 4KJMA 1CW5A 2QG4A 4NYTA 4PD4H 3H25A 1EQ7A 1KQGB 1NVOA 3VOPA 1SQBG 2N1TB 1MV8A 5EFWB 2LXBA 5AW6B 1Q90D 1NTZG 1QEXA 2OTKE 1FJPA 2Z4EC 3CXHD 5CBOA 2G3AA 3A0HH 3H1JE 2WSCJ 4A7PA 1G2CB 3AE5C 2WSFH 1RF0C 3SWFA 4ZFGA 4UB8E 3H6PA 1SQQE 2FXOA 1J1EB 5DJTB 5AW0B 3S4RA 3Q5PA 3TDKA 1DEBA 1L2PA 2NZ2A 5H2FH 4H0LC 4JF7A 3CX5H 3W68A 1KFNA 1SQPK 1NTZD 3OAKA 1N7LA 3L35A 1GDTA 3MZWB 2YIUB 1NU1D 5KLVG 2J61B 1JUNA 1T2KD 2QA4P 3H1KE 2OYIA 3JSVC 1M1JA 3U1AA 5GTHE 4EPUA 5APXA 3WU2H 2QJYC 1HJBA 2GA1A 1GL2A 4WY4D 2P58A 1JY3O 4RKUJ 1X22A 2GY7A 2IFNA 2K3RA 3L71J 3TGUJ 3CCLP 2M5AB 1AVYA 2H88C 1Y8AA 2BEQD 3M91A 2POHA 1JOCA 2VRSA 5KLVD 3RL0D 3CPWO 1FDMA 2NPSB 2AXTH 5BU8B 1BE3J 2IX7C 2J5UA 2FYNC 1GTWA 2JHKF 2J5ZA 1JY3N 2LXCB 3AE6C 1SQXG 1DX7A 1P84D 1MKMA 1NYHA 3A5TA 4IOIH 1JY2N 1RH5B 2RN0A 1FZEA 1BCCJ 2KZJA 1ZRTE 1L4AD 2H89C 4QMAA 3W67A 3R2PA 3D70A 2HYNA 3LW5H 3IAOA 2A06G 3KYQA 4ASVA 1NTMK 3CCRP 1ZOYC 5TISE 3N4XA 1PIXA 5K5GB 1SQXD 1SQPD 1OX3A 2HG5D 4DZOA 1ZN5A 4L74A 4XFJA 3ITKA 1LT1A 2WPSA 1M1JB 2OARA 3CC4P 2GUSA 2KUBA 4HKZH 3IF4A 4U3FG 2O01J 2KLVA 4GIFA 4LGDE 3KZIE 1FOSE 3BRTB 1NGMB 1RE3C 3RK3D 3L71E 4ZKPA 1LT9C 1PP9G 1USEA 1EDKA 3C1LA 4W7ZA 1EXIA 1U57A 1NTZJ 2ZFCA 3CCUP 1PPJE 1NTKE 2IDBA 1IFNA 4XA4A 5AVTB 1LTAC 3L70E 3E1IC 2YNYA 4U3FD 4IL6E 1VF5B 2OGUA 2HPCC 3H1JG 2E76C 2FBWC 4YPCA 1EXJA 2P1JA 2Q9IA 4IFDK 3A2AA 3HD7C 1SQQG 5CCGD 1Z3UA 1KB9E 2D39A 1S5LX 2J3UA 5KLVJ 2R3CA 1A02F 4R4LA 4NPFX 2I8DA 1MFZA 2MKVA 3FIBA 4WY4A 1SQVK 1JMBA 2KNCA 3V2QA 2D2CB 5KAFH 3AECC 3CXHE 1KV4A 3MD0A 4I2LC 2O1KA 3O6QA 3H1KG 2R5BA 2J3FD 1LWUA 2J1GA 1IK7A 1SQQD 2E5YA 2JJLA 1GMJA 3D71A 2W6BA 4HJGH 4D6TD 5APYA 1KTMA 1FS0E 2E42A 3A7OA 2LKMA 2WNPF 5AW5B 2KOGA 3B8EB 2E43A 5KTBA 1OFCX 4U7JA 3U59A 4O9BA 2JKVA 2YKPA 2Y0CA 5L8RJ 3RK2B 1SQXJ 1RF1C 1S3JA 2J58A 2L5GB 1NU1E 4PD4I 1FIDA 3HRNA 4WWIA 3H1KD 1IK9A 3MIWA 1L4AA 1OW6A 3HUSC 3AEFC 1KD1Q 2BCCG 1E79H 3M9BA 2Q6QA 3NMDA 5KLIC 3QWOC 2Q9IB 2XZRA 2ZYDA 2NPSD 2H7HA 3A0HE 2M3EA 3PH0A 1OVUA 1VL2A 1LTJA 1FZAB 2WPRA 3OW2O 2Q3EA 3IFMA 4LLHA 2ZT9C 3CCSP 5KLVE 3V4QA 4WY4B 1GK4A 5H2FE 3CX5E 2BCCD 3NTNA 3B5NB 4DCKA 4H13C 3R4YA 1N86B 2XNXA 5TJHA 2PP6A 3EFFK 1RY3A 1YBKA 1YQ4C 4U3FJ 1X79B 1SP4A 3O6QB 1LWUB 2W27A 1HWTC 3RGUA 1KYOI 2JWAA 2KI7B 1FZCB 3L75D 1YJNP 4L73A 1FICA 3WUVA 1M90Q 2A45I 2YXRB 1ZLLA 1RQUA 1X0TA 2IYOA 3AE3C 3WU2E 3KDPB 3L71G 2C0XA 2FFDA 1SQXE 5APWA 2E5TA 1SQPE 4I6MC 1HF9A 1H8AA 1OW8A 3D6YA 2KK7A 2W6AA 2HODB 3H1HE 1PPJG 3OA7A 1NTKG 2AXTE 4GODA 1G2CA 3L70G 1FC2C 1Z3SA 1SLQA 3H32B 1N7SA 1S1CX 1SQQJ 2QJPC 3NXSA 5KJ7A 2HLOC 2FKWB 3I5CA 1LTJB 4HYTB 4D6TJ 1L4AC 3E7KA 2P10A 2KLUA 3AE8C 3GF3A 3P32A 1MUUA 3RK3E 2IZ1A 1SS1A 1VF5D 4N6JA 1PGOA 3GG2A 1EZVE 2N9BA 5AW3B 1JY3P 5AW7B 1H0TB 3L73E 2J3FA 1FZFB 1SQBK 4Y99B 3OJAB 1NTKD 3H1ID 3A0BH 3L70D 5B66H 2J61A 3H1KJ 2OYHB 4U3FE 3I55P 1JO5A 1LTIC 1KMIZ 3CCMP 2P7JA 2KIKA 3AE9C 2KZIA 1LTTC 1URQC 4C46A 3Q5SA 2D2CD 4GDOA 4JBZA 2B88A 1KB9D 2FY8A 2M5AA 1IC2A 5AW4B 4PV1C 4N3YB 4DOJA 4C7NB 2FFDB 3V4WA 4LC1A 2Z4EB 2NPSA 1R5SA 2BCCJ 1LP1B 2YKOA 3MUDC 1NU1G 3M0DC 1N7SB 3BATA 1K73Q 2J59M 3HE4B 3L75J 3RK2D 2N1TC 1JEKA 1U7MA 1Z56A 4BWNA 1RHZB 3CCQP 4D6TE 5CCGC 2IPPA 4H0LB 1X9VA 1SVFA 1VQNP 4HB1A 4B86A 3PLNA 3GHGC 1LTSC 3SFDC 1RE4B 2PRRA 1J1EC 2E74C 1AVOA 1KYOH 4RESB 4PD4D 5AW2B 3AE4C 2LR2A 1PGJA 1QGKB 2A45H 1X8YA 3JCUH 4JQ0D 4PJ0H 2QJYB 1Q82Q 1M57D 3P8MC 1FOSF 1LNQA 5KAFE 3AE7C 2IFMA 2XU6A 3GF7A 1JB0J 3B5ND 3H1LG 4H44C 4M7HA 2V7QH 4N78E 2FYNB 2PAJA 1LTBC 1VQ5P 1J1DC 2OTJP 3CX5D 3CC2P 1NKNA 3LIEA 1NTKJ 2QRXA 1FZGA 4TLFA 3H1IJ 2R5DA 2BCCE 2J2PA 3L70J 1L0NK 4OH8B 1SQPG 1M8OB 1DH3A 1YI2P 3G6EP 3KXDA 1SQVE 3H1HG 3G3ZA 1KYOD 3L75E 2RKLA 2XNDH 3H1LD 2C0WA 3IN6A 2YO3A 1EDJA 3WUTA 2IBZI 1IJDB 1H88A 2K1AA 1VQ4P 1HGVA 2AEJA 1PGQA 3T97B 1EZVG 1KZUB 3L73G 2XDJA 5KAIH 2I1JA 1BSNA 3H1HD 1VQPP 5DJUB 1SFCD 2FYUK 1JCCA 3LIDA 2ZYAA 4IFMA 1FDIA 1BGYE 1EC5A 3Q5RA 2OYIC 1M1JC 4Y28J 1BDDA 1WRGA 4NPDA 1ZR4A 3GW6A 1EZVD 4M3LA 1QVGO 3L73D 1GL2C 1KILD 5GTIE 1KQFB 4XE5B 1FZGB 1NU1J 2WSEH 4WB4A 3BCCE 3E1IB 1IO4A 3H1IE 5B5EH 3JC22 1NTMG 4GKGA 1T3UA 2HPCB 1NAYA 2E76B 5APQA 1RQVA 2E75C 5BVZA 2C9LY 3VN0A 3HD7B 1E5WA 1L0LK 1KN7A 3Q3DA 1QL1A 3M06A 2WSFJ 2QM7A 3SWYA 2J3GA 1DIPA 3AEBC 1FU1A 4D6TG 5AVQB 3TNUA 1FZAA 1N7SD 3AE1C 1T6AA 1FZEC 3CL3D 3FWLA 5KJ7D 1N73B 3C9IA 3EQ2A 1NTMD 3VMXA 1S5LE 2H43A 4H0LD 2ZVNB 3B5NA 4OGQB
chains in the Genus database with same CATH topology
1FJPA 2Z4EC 1LTGC 3KDPB 1YTZI 3HTKA 1JCDA 1N73A 2J3OA 1G2CB 2WSFH 1FZCA 1RF0C 3V5BA 3HE5B 2JHIF 2C0XA 3SWFA 4ZFGA 4JYCA 2FFDA 2GM4A 5APWA 3VYIA 4I6MC 2GUVA 3H6PA 1J1EB 1H8AA 4AUWA 2W6AA 2HODB 5AW0B 2Z5IA 4WBAA 3OA7A 3PP5A 1DEBA 1FZBA 1G2CA 5AVRB 2OYIB 1RE3B 4JF7A 1Z3SA 1PFIA 1SLQA 3H32B 1N7SA 1LT9B 3HE5A 3II6A 1KFNA 1SQPK 3OAKA 1N7LA 3L35A 1SQQK 3L37A 3NXSA 5CCHD 5KJ7A 1GDTA 2HLOC 3TSIA 2FKWB 3I5CA 3HUSB 1LTJB 1JTHA 4HYTB 3P8CE 3NFQA 1GL2B 1L4AC 2HODA 3P32A 2J61B 1MUUA 1N2DC 2XV5A 2WSCH 1JUNA 1T2KD 1URQD 2I1KA 1RF1A 4N6JA 2OYIA 2J60A 3RK2C 3H32A 1YYCA 2N9BA 5AW3B 1JY3P 1M1JA 5AW7B 2WTYA 5AVVB 3U1AA 2J3FA 4EPUA 1FZFB 5APXA 1OXZA 1SQBK 3HUSA 1HJBA 4Y99B 3OJAB 1GK6A 1GL2A 4WY4D 3TNUB 5AW1B 1JY3O 1AQ5A 2J61A 1SFCA 2GY7A 2OYHB 2IFNA 1H89A 4N78D 1NKZB 2Q9IC 1QL2A 1JO5A 1LTIC 1IFDA 1FZGC 1G1IA 2P7JA 3V2NA 3M91A 2POHA 1JOCA 2VRSA 1FZFA 2H43B 3RL0D 1FDMA 1LTTC 2NPSB 5BU8B 1T2KC 1URQC 4C46A 2IX7C 3VTPC 3VP8A 2BASA 1FZEB 1GTWA 2JHKF 1LGHB 2Q7CA 2J5ZA 1JY3N 2N1TD 2OYHA 3HTKB 1T3JA 4I1LA 3BVHA 1DX7A 3TK1A 2R32A 1IC2A 5AW4B 4KHXA 3VMZA 3A5TA 4N3YB 4DOJA 1JY2N 4C7NB 1KILA 4WY4C 2FFDB 3V4WA 2WWWA 4C7RA 4LC1A 2Z4EB 5AW8B 2NPSA 2JHHC 1FZEA 3M9HA 5CJ0A 1A02J 2J0GA 1IFIA 2FIBA 2YKOA 1LWUC 2P2UA 1N73C 2M8RA 1FZBB 1L4AD 5AVZB 3R2PA 3RL0C 2HYNA 3M0DC 3LW5H 1FZCC 1N7SB 3BATA 4W7YA 4C7NA 4M7FA 1MZ9A 2J59M 3KYQA 1VPCA 3HE4B 1OWAA 3RK2D 1NTMK 2N1TC 2Z4EA 2WT7A 1JTHB 1HVVA 2P67A 3N4XA 1G1JA 1Z56A 5APVA 2J0YA 4R9JA 5CCGC 2HG5D 2IPPA 4W80A 1NHLA 4DZOA 1ZN5A 1X9VA 1SVFA 1RF1B 4B86A 2WPSA 3GHGC 2J64A 1LTSC 1M1JB 2OARA 2GUSA 1RE4B 3HE4A 4AQRD 5CJ4A 3VMYA 4JZCA 1J1EC 2KLVA 4GIFA 4LGDE 4RESB 1SFCB 4AYCA 2QM8A 1NWQA 1FOSE 5AW2B 3BRTB 2Z5HA 3U1CA 1S9KE 1RE3C 2HLOA 3RK3D 2WZ7A 1WT6A 1LT9C 4HH2A 4ZKPA 2A45H 1X8YA 1CZQA 1RE4A 3HD7D 1VDFA 3P8MC 4W7ZA 3N7NA 1LTJC 2M3BA 1FOSF 3KQGA 1NTZK 2ZFCA 2IFMA 2XU6A 1AFOA 5AVYB 3B5ND 3BVHB 2Q5UA 3L36A 1IFJA 1IFNA 4XA4A 2JHLF 5AVTB 1LTAC 4M7HA 3E1IC 1KILB 2YNYA 5AW9B 3BRVB 4N78E 5AVXB 2O01H 2J0HA 2PAJA 1LTBC 2HPCC 2XNXC 1J1DC 1FZAC 2P1JA 2Q9IA 1NKNA 5CCHA 3RK3C 4IFDK 3LIEA 1NTKK 1FZGA 2R5DA 2J2PA 3A2AA 4JYBA 5APUA 1L0NK 3HD7C 3WMM0 4OH8B 1DH3A 2XKMA 5CCGD 1M7LA 4JYOX 1FJKA 2YO2A 1URQA 3VP9A 2H43C 1Z3UA 3G3ZA 3B5NC 2WT7B 2D39A 1N86C 2J3UA 1A02F 2R3CA 5KLVK 3BASA 1GW4A 2HFED 2C9NY 2WPQA 3RL0B 1NAFA 2C0WA 2FXMA 1RF0B 4IFFA 1MFZA 2KSJA 3FIBA 3CI9A 4WY4A 1ZV8A 1FIBA 1SQVK 2YO3A 4ZKUA 1NH4A 5CHXA 2O1JA 3V2QA 2FFDC 3O8ZA 1T8ZA 3MD0A 1IJDB 3P7KA 1H88A 4I2LC 1HGVA 2O1KA 2R5BA 1JMMA 2J3FD 1LWUA 2J1GA 3MUDA 5AVWB 2ZXEB 3V2RA 1HH0A 3EFGA 1CI6B 3M0DA 1KZUB 1XTCC 1RF0A 2XDJA 3GHGB 1GL2D 1FZBC 2I1JA 2JJLA 2JEEA 2W6BA 2HLOB 5APYA 1N7SC 2E42A 1SFCD 2N1TA 2FYUK 3IR9A 3A7OA 2LKMA 2WNPF 5KJ7C 2CPBA 5AW5B 5APTA 1L4AB 2KOGA 3B8EB 5BU5A 2E43A 3MGNA 1JCCA 5CCGA 1NOHA 3LIDA 5KTBA 3T97A 3U59A 4R9TA 4IFMA 4O9BA 2HODC 1CI6A 2YKPA 5AVUB 3P8CD 3RK2B 3GHGA 1SQXK 3TYYA 1GZLA 1RF1C 2J58A 2MJZA 2OYIC 2L5GB 3V2PA 3H32C 2YMYA 2WITA 1FIDA 3HRNA 1M1JC 1RE4C 1WRGA 1IK9A 1ZR4A 3MIWA 1S9KD 1L4AA 4M3LA 3HUSC 4GT1A 1XTGB 1YTZT 3M9BA 1GL2C 1KILD 3NMDA 2YKQA 2Q9IB 2XZRA 2Q3IA 4XE5B 1RE3A 1SFCC 1FZGB 2NPSD 1GD2E 1LT9A 1NU1K 2WSEH 2H7HA 4WB4A 2JHMF 3E1IB 1IO4A 4EIJA 3M0AA 1FBMA 3A3YB 2A45G 2KP8A 3CLQA 1HGZA 4GKGA 1T3UA 1LTJA 1URQB 2HPCB 1HBWA 1FZFC 1JY2P 2KYVA 2XNXB 5AVSB 1J1DB 1HUCA 1FZAB 4Y99C 1KQLA 2WPRA 5APQA 3M9QA 3RK3B 3KPEA 3IFMA 5BVZA 2C9LY 1GW3A 3L4FA 3VN0A 3HD7B 1E5WA 1L0LK 4LLHA 5CCHC 2FYZA 2OYHC 1QL1A 1JY2O 3M06A 3BVHC 1KFMA 3V4QA 3E1IA 2QM7A 4WY4B 3SWYA 1GK4A 2J3GA 1ZR2A 1IFMA 3NTNA 1FZDA 3B5NB 1KILC 2HPCA 1JNMA 1FU1A 1GU4A 5AVQB 1N86B 3TNUA 2XNXA 2PP6A 1FZAA 1FAVA 1RY3A 1N7SD 2NPSC 5APSA 1GU5A 2H8PD 1X79B 1J2JB 3MTUE 3UIAA 1W2EA 1SP4A 1JC9A 1FZEC 4EOTA 1LWUB 2W27A 3CL3D 5KJ7D 1HWTC 1N73B 3HD7A 2KB7P 3C9IA 1CW5A 1FZCB 4NYTA 3EQ2A 1NO4A 2CPSA 1EQ7A 3VMXA 1FICA 5CMZA 1HTLC 2H43A 2A45I 1CSBA 3VOPA 2N1TB 1MV8A 3B5NA 5AW6B 1N86A 1ZLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZE B;  2Z4E C;  2JHK F;  2J5Z A;  4R9T A;  1JY3 N;  2HOD C;  2OYH A;  1N73 A;  2J3O A;  3BVH A;  3GHG A;  3BVH B;  1FZC A;  1RF1 C;  1RF0 C;  2OYI C;  2JHI F;  2JHL F;  4ZFG A;  1JY2 N;  2FFD A;  4M7H A;  3H32 C;  2FFD B;  1FID A;  3E1I C;  1M1J C;  1RE4 C;  2Z4E B;  2J0H A;  2JHH C;  3HUS C;  2HPC C;  1FZE A;  2HOD B;  2XNX C;  1FZA C;  2Q9I A;  2J0G A;  2Q9I B;  2FIB A;  1LWU C;  1FZB A;  1FZG A;  1RE3 A;  1N73 C;  1FZB B;  1FZG B;  2OYI B;  2J2P A;  1RE3 B;  1Z3S A;  1LT9 A;  3H32 B;  2JHM F;  1LT9 B;  1FZC C;  3E1I B;  4M7F A;  2A45 G;  2HLO C;  4JYO X;  1T3U A;  1LTJ A;  3HUS B;  2HPC B;  1LTJ B;  2Z4E A;  1Z3U A;  2H43 C;  1FZF C;  1JY2 P;  2D39 A;  2XNX B;  1FZA B;  2J0Y A;  4R9J A;  2HOD A;  1N86 C;  2J3U A;  2J61 B;  1RF1 A;  1RF1 B;  1RF0 B;  2OYI A;  2OYH C;  2J60 A;  1JY2 O;  3FIB A;  3H32 A;  3BVH C;  3GHG C;  3E1I A;  1FIB A;  1JY3 P;  1M1J A;  2J64 A;  2J3G A;  1M1J B;  2J3F A;  4EPU A;  1RE4 B;  2FFD C;  1FZF B;  1FZD A;  3HUS A;  2HPC A;  1N86 B;  2XNX A;  4JZC A;  1FZA A;  1JY3 O;  1W2E A;  2J61 A;  2J3F D;  1JC9 A;  1LWU A;  2J1G A;  1FZE C;  1LWU B;  2GY7 A;  2OYH B;  1N73 B;  2Q9I C;  1RF0 A;  3GHG B;  1FZC B;  4NYT A;  1FZG C;  1FZB C;  1RE3 C;  2HLO A;  1LT9 C;  1FIC A;  2HLO B;  2A45 H;  1RE4 A;  2H43 A;  2A45 I;  1FZF A;  2H43 B;  2WNP F;  1N86 A;  1LTJ C; 
#chains in the Genus database with same CATH topology
 3AEE C;  3PJS K;  1LTG C;  1YTZ I;  3HTK A;  3GMA A;  2KXP B;  4L75 A;  1JCD A;  2FYU D;  5B66 E;  1FZC A;  1JM0 A;  3L74 G;  3V5B A;  3HE5 B;  1DD3 A;  3H1L J;  1FE6 A;  3VYI A;  2NRG A;  1N8R Q;  2Z5I A;  2OYO A;  1K9M Q;  3PP5 A;  1QLE D;  3L72 E;  1YIT P;  1FZB A;  2R3S A;  5AVR B;  1OW7 A;  1NJI Q;  3S1K A;  2ZVO B;  2W90 A;  3II6 A;  1SQP J;  3L37 A;  3CMA P;  3HUS B;  4PD4 E;  1JTH A;  3H1H J;  2G8Y A;  2HOD A;  1N2D C;  2B9B A;  2WSC H;  3L74 D;  3SWK A;  2ITA A;  3EWK A;  2W8Z A;  2J60 A;  1SQV G;  3RK2 C;  3H32 A;  1VQ9 P;  4GOF A;  1ZW0 A;  3I56 P;  3L75 G;  1OXZ A;  1L0L D;  1GK6 A;  3TNU B;  3WUU A;  1AQ5 A;  3G9R A;  2ZT9 B;  1SFC A;  4N78 D;  1NKZ B;  2IYP A;  4YXW H;  2Q9I C;  1QL2 A;  1IFD A;  3L73 J;  1G1I A;  3CC7 P;  4OVN F;  1H0T A;  3LW5 J;  4H13 B;  3G4S P;  1FZF A;  2H43 B;  1AV1 A;  1T2K C;  2QJK C;  3KHU A;  2BAS A;  3CWB E;  1LGH B;  1SQV D;  2OYH A;  3HTK B;  4K35 A;  1T3J A;  1OVV A;  3BVH A;  3SFE C;  2R32 A;  1KYO E;  1BSH A;  1KIL A;  4WY4 C;  3RBZ A;  1UII A;  2WWW A;  2JWD A;  4C7R A;  1P84 I;  5AW8 B;  3H1L E;  3KZI H;  2JHH C;  4PJ0 E;  1BGY G;  4I7Z C;  5CJ0 A;  1DEE G;  2J0G A;  1IFI A;  2FIB A;  1LWU C;  2M8R A;  1FZB B;  2IBZ D;  3RL0 C;  2QSI A;  1FZC C;  5C39 A;  4C7N A;  4M7F A;  1EDL A;  1MZ9 A;  1IFP A;  1NTM J;  2Z4E A;  1JTH B;  2P67 A;  1G1J A;  3ZDM A;  3BCC G;  1LP1 A;  1NHL A;  3H1I G;  4IL6 H;  3SSU A;  2QJP B;  3D6Z A;  4RJT A;  3USS A;  3HE4 A;  1BGY D;  4AQR D;  5CJ4 A;  4L76 A;  3VMY A;  2AEF A;  5KKZ C;  4JZC A;  3F5H A;  5E79 H;  1SFC B;  4OWF A;  2QM8 A;  1NWQ A;  2E76 D;  1Q81 Q;  3S9O A;  1OVR A;  1RE4 A;  1KIL E;  3HD7 D;  2BEZ F;  1D7M A;  3BCC D;  1LTJ C;  2M3B A;  2RMZ A;  3KQG A;  1NTZ K;  1AFO A;  4ZMD A;  3BVH B;  2Q5U A;  1IFJ A;  1BE3 D;  3L74 J;  2JHL F;  1L0N E;  4NPE A;  1KIL B;  2N9Y B;  2WSS H;  2UWJ E;  1VQM P;  2O01 H;  4Z1M H;  2J0H A;  3QH9 A;  4UB6 H;  2XNX C;  1ZME C;  3RK3 C;  4PV1 B;  4OGQ D;  4JYB A;  3WMM 0;  1MFT A;  2XKM A;  1M7L A;  4JYO X;  3VP9 A;  1HJ0 A;  3L72 G;  1NTM E;  5KLV K;  3BAS A;  2HFE D;  2C9N Y;  2WPQ A;  1IZN B;  1NAF A;  1Y9B A;  1RF0 B;  4IFF A;  2KSJ A;  3CI9 A;  1SQV J;  1FIB A;  4TT3 H;  1NH4 A;  1VQO P;  4BRY A;  2FFD C;  3O8Z A;  2FYU E;  2CK3 H;  3P7K A;  1VQ8 P;  4WVZ A;  5B5E E;  2KS1 B;  2Y9Z A;  3RL0 g;  2WMM A;  1FDO A;  2ZXE B;  1HH0 A;  3EFG A;  1CI6 B;  1M1K Q;  1XTC C;  2K88 A;  3GHG B;  2K9Y A;  2YXQ B;  1N7S C;  3L72 D;  2V4H A;  3IR9 A;  3Q2Y A;  5KJ7 C;  5APT A;  2E74 B;  5BU5 A;  3MGN A;  3ABV C;  1NOH A;  3T97 A;  4R9T A;  1AA0 A;  4GOE A;  2M0B A;  1SQB D;  1SQX K;  3TYY A;  1GZL A;  3FX0 A;  5CBN A;  2YMY A;  2QIW A;  2WIT A;  2ZT9 D;  1P84 H;  2QE7 H;  3PRJ A;  1RE4 C;  3L74 E;  3CWB G;  3TF5 A;  1S9K D;  1YJW P;  4YTP C;  1XTG B;  2YIU C;  1YTZ T;  1BGY J;  4H13 D;  2YKQ A;  2Q3I A;  2YMK A;  1RE3 A;  1K05 A;  4H44 B;  1GD2 E;  1LT9 A;  1Q2N A;  1L0L E;  2JHM F;  4MN4 C;  3F89 A;  3M0A A;  2A45 G;  3CLQ A;  3B4S A;  1HBW A;  2B87 A;  2KYV A;  1J1D B;  1HUC A;  1KQL A;  2ZYG A;  2JR8 A;  1S72 P;  3BCC J;  2FYZ A;  1JY2 O;  3AE2 C;  1KFM A;  2SPZ A;  3E1I A;  3CWB D;  1PZQ A;  4BRY B;  2HPC A;  1GU4 A;  2IZ0 A;  2NPS C;  1J2J B;  2RH0 A;  1VQL P;  1AQT A;  2KSE A;  2W6J H;  2ZJS E;  3HD7 A;  2KB7 P;  1NO4 A;  1VQ7 P;  1PGP A;  2CPS A;  5CMZ A;  1HTL C;  1CSB A;  2PGD A;  3G71 P;  3AED C;  2IBZ E;  1ZP0 C;  1N73 A;  3E1R A;  2J3O A;  2HR3 A;  3CCJ P;  2JHI F;  4JYC A;  2GM4 A;  1Y47 A;  2GUV A;  2WQY C;  1Q86 Q;  4AUW A;  2JDI H;  4WBA A;  1L0N G;  2OYI B;  1BDC A;  1RE3 B;  1PFI A;  1LT9 B;  3HE5 A;  3CCV P;  3PHL A;  1SQQ K;  5CCH D;  3C8V A;  3TSI A;  2WVR A;  3P8C E;  3NFQ A;  1GL2 B;  2B87 B;  3L72 J;  3AEA C;  2XV5 A;  3AEG C;  1URQ D;  2I1K A;  1RF1 A;  2A06 D;  1USD A;  1YYC A;  2WTY A;  5AVV B;  1QX8 A;  3TGU E;  1SQB J;  3HUS A;  4PV1 D;  5AW1 B;  1L0N D;  4IL6 X;  2E75 B;  1BE3 E;  2L91 A;  1H89 A;  4UB8 H;  1UIX A;  1FZG C;  3V2N A;  2FYU G;  3FGA D;  4K3A A;  3FXD A;  1VF5 C;  3VTP C;  3VP8 A;  1FZE B;  2Q7C A;  2N1T D;  1BCC E;  4I1L A;  2K37 A;  3TK1 A;  4KHX A;  1PP9 D;  3VMZ A;  5E79 E;  1KB9 I;  1VQ6 P;  1DD4 A;  3CWB J;  2QVA A;  3M9H A;  1A02 J;  3GLM A;  5GTH H;  2P2U A;  1Q7Y Q;  1N73 C;  5AVZ B;  2E74 D;  2JO1 A;  2B89 A;  3A0B E;  3CXH I;  4W7Y A;  1N86 A;  3H1J D;  1VPC A;  1OWA A;  2D2C C;  2WT7 A;  2AEM A;  1HVV A;  5APV A;  4OGQ C;  2J0Y A;  4R9J A;  3Q1M A;  1YIJ P;  1L0L G;  4W80 A;  2O01 N;  4KT0 J;  4UB6 E;  1RF1 B;  5M1B A;  2J64 A;  4DT0 A;  3MP7 B;  1W5C E;  1U7J A;  4H44 D;  2V7Q J;  3VMA A;  1SQB E;  1S4X A;  3CD6 P;  1PL5 A;  5KLI B;  1NTZ E;  4AYC A;  2K9J A;  2Z5H A;  1VQK P;  3U1C A;  1S9K E;  2HLO A;  2WZ7 A;  1WT6 A;  4HH2 A;  4ZNC A;  3FXE A;  3CCE P;  1CZQ A;  1OZH A;  1VDF A;  3N7N A;  3MHV A;  1W2B O;  5AVY B;  2Y0D A;  3L36 A;  5TIS H;  5AW9 B;  3BRV B;  2IBZ G;  2QJK B;  3B71 A;  1S2E A;  5AVX B;  3K5B A;  4CPG A;  1FZA C;  1WMK A;  5CCH A;  1NTK K;  2ZAE B;  2OTL P;  1L0N J;  5APU A;  2Y0E A;  1YJ9 P;  3CX5 I;  4R4M A;  2KNC B;  1KC8 Q;  1FJK A;  2YO2 A;  1URQ A;  2H43 C;  2Q1K A;  3B5N C;  4I7Z B;  2WT7 B;  1P84 E;  3JCU E;  1N86 C;  2Y9Y A;  1GW4 A;  1OIP A;  4RO0 A;  3RL0 B;  2FXM A;  1KOR A;  1YQ3 C;  1ZV8 A;  4EYY Q;  4ZKU A;  4JPZ B;  5CHX A;  2O1J A;  3V6I A;  1ZRT D;  1PP9 J;  1AJY A;  1T8Z A;  5GTI H;  2QEX P;  1K04 A;  4EDF A;  4ASW A;  1JMM A;  3MUD A;  3CME P;  5AVW B;  3V2R A;  3M0D A;  1M56 D;  3TGU G;  1RF0 A;  2K9J B;  1GL2 D;  1FZB C;  2JEE A;  3RBX A;  2WSE J;  2HLO B;  1K8A Q;  1EDI A;  2FYU J;  2N1T A;  5KKZ B;  2CPB A;  2R44 A;  1L4A B;  1BE3 G;  3H1J J;  4BXL A;  5CCG A;  2WPV B;  2KS1 A;  2OQQ A;  1OMI A;  2HOD C;  1CI6 A;  5AVU B;  2O3J A;  3P8C D;  3GHG A;  2AXC A;  4YXD C;  2MJZ A;  2E75 D;  2JP3 A;  2FXP A;  3V2P A;  1KB9 H;  3H32 C;  1R5L A;  1PV3 A;  1YHQ P;  2A06 E;  3L71 D;  4GT1 A;  1ZXG A;  1BCC G;  3TGU D;  3PTZ A;  4EI2 A;  1EZV I;  1S5L H;  1SFC C;  3CXH H;  1NU1 K;  3FWN A;  1KQS O;  4EIJ A;  1FBM A;  3A3Y B;  2KP8 A;  1HGZ A;  5KAI E;  1PPJ D;  1URQ B;  1FZF C;  1JY2 P;  2XNX B;  5AVS B;  4Y99 C;  3M9Q A;  3RK3 B;  3KPE A;  1GW3 A;  3L4F A;  1L0L J;  5CCH C;  2OYH C;  1LJ2 A;  1QVF O;  3BVH C;  2W83 C;  2PFX A;  1ZR2 A;  1IFM A;  1R8E A;  1BCC D;  1FZD A;  1KIL C;  2ZXX A;  1JNM A;  1TU3 F;  1FAV A;  5APS A;  1GU5 A;  2H8P D;  3MTU E;  3UIA A;  2DW3 A;  1PP9 E;  1W2E A;  1JC9 A;  4EOT A;  4DJG A;  4KJM A;  1CW5 A;  2QG4 A;  4NYT A;  4PD4 H;  3H25 A;  1EQ7 A;  1KQG B;  1NVO A;  3VOP A;  1SQB G;  2N1T B;  1MV8 A;  5EFW B;  2LXB A;  5AW6 B;  1Q90 D;  1NTZ G;  1QEX A;  2OTK E;  1FJP A;  2Z4E C;  3CXH D;  5CBO A;  2G3A A;  3A0H H;  3H1J E;  2WSC J;  4A7P A;  1G2C B;  3AE5 C;  2WSF H;  1RF0 C;  3SWF A;  4ZFG A;  4UB8 E;  3H6P A;  1SQQ E;  2FXO A;  1J1E B;  5DJT B;  5AW0 B;  3S4R A;  3Q5P A;  3TDK A;  1DEB A;  1L2P A;  2NZ2 A;  5H2F H;  4H0L C;  4JF7 A;  3CX5 H;  3W68 A;  1KFN A;  1SQP K;  1NTZ D;  3OAK A;  1N7L A;  3L35 A;  1GDT A;  3MZW B;  2YIU B;  1NU1 D;  5KLV G;  2J61 B;  1JUN A;  1T2K D;  2QA4 P;  3H1K E;  2OYI A;  3JSV C;  1M1J A;  3U1A A;  5GTH E;  4EPU A;  5APX A;  3WU2 H;  2QJY C;  1HJB A;  2GA1 A;  1GL2 A;  4WY4 D;  2P58 A;  1JY3 O;  4RKU J;  1X22 A;  2GY7 A;  2IFN A;  2K3R A;  3L71 J;  3TGU J;  3CCL P;  2M5A B;  1AVY A;  2H88 C;  1Y8A A;  2BEQ D;  3M91 A;  2POH A;  1JOC A;  2VRS A;  5KLV D;  3RL0 D;  3CPW O;  1FDM A;  2NPS B;  2AXT H;  5BU8 B;  1BE3 J;  2IX7 C;  2J5U A;  2FYN C;  1GTW A;  2JHK F;  2J5Z A;  1JY3 N;  2LXC B;  3AE6 C;  1SQX G;  1DX7 A;  1P84 D;  1MKM A;  1NYH A;  3A5T A;  4IOI H;  1JY2 N;  1RH5 B;  2RN0 A;  1FZE A;  1BCC J;  2KZJ A;  1ZRT E;  1L4A D;  2H89 C;  4QMA A;  3W67 A;  3R2P A;  3D70 A;  2HYN A;  3LW5 H;  3IAO A;  2A06 G;  3KYQ A;  4ASV A;  1NTM K;  3CCR P;  1ZOY C;  5TIS E;  3N4X A;  1PIX A;  5K5G B;  1SQX D;  1SQP D;  1OX3 A;  2HG5 D;  4DZO A;  1ZN5 A;  4L74 A;  4XFJ A;  3ITK A;  1LT1 A;  2WPS A;  1M1J B;  2OAR A;  3CC4 P;  2GUS A;  2KUB A;  4HKZ H;  3IF4 A;  4U3F G;  2O01 J;  2KLV A;  4GIF A;  4LGD E;  3KZI E;  1FOS E;  3BRT B;  1NGM B;  1RE3 C;  3RK3 D;  3L71 E;  4ZKP A;  1LT9 C;  1PP9 G;  1USE A;  1EDK A;  3C1L A;  4W7Z A;  1EXI A;  1U57 A;  1NTZ J;  2ZFC A;  3CCU P;  1PPJ E;  1NTK E;  2IDB A;  1IFN A;  4XA4 A;  5AVT B;  1LTA C;  3L70 E;  3E1I C;  2YNY A;  4U3F D;  4IL6 E;  1VF5 B;  2OGU A;  2HPC C;  3H1J G;  2E76 C;  2FBW C;  4YPC A;  1EXJ A;  2P1J A;  2Q9I A;  4IFD K;  3A2A A;  3HD7 C;  1SQQ G;  5CCG D;  1Z3U A;  1KB9 E;  2D39 A;  1S5L X;  2J3U A;  5KLV J;  2R3C A;  1A02 F;  4R4L A;  4NPF X;  2I8D A;  1MFZ A;  2MKV A;  3FIB A;  4WY4 A;  1SQV K;  1JMB A;  2KNC A;  3V2Q A;  2D2C B;  5KAF H;  3AEC C;  3CXH E;  1KV4 A;  3MD0 A;  4I2L C;  2O1K A;  3O6Q A;  3H1K G;  2R5B A;  2J3F D;  1LWU A;  2J1G A;  1IK7 A;  1SQQ D;  2E5Y A;  2JJL A;  1GMJ A;  3D71 A;  2W6B A;  4HJG H;  4D6T D;  5APY A;  1KTM A;  1FS0 E;  2E42 A;  3A7O A;  2LKM A;  2WNP F;  5AW5 B;  2KOG A;  3B8E B;  2E43 A;  5KTB A;  1OFC X;  4U7J A;  3U59 A;  4O9B A;  2JKV A;  2YKP A;  2Y0C A;  5L8R J;  3RK2 B;  1SQX J;  1RF1 C;  1S3J A;  2J58 A;  2L5G B;  1NU1 E;  4PD4 I;  1FID A;  3HRN A;  4WWI A;  3H1K D;  1IK9 A;  3MIW A;  1L4A A;  1OW6 A;  3HUS C;  3AEF C;  1KD1 Q;  2BCC G;  1E79 H;  3M9B A;  2Q6Q A;  3NMD A;  5KLI C;  3QWO C;  2Q9I B;  2XZR A;  2ZYD A;  2NPS D;  2H7H A;  3A0H E;  2M3E A;  3PH0 A;  1OVU A;  1VL2 A;  1LTJ A;  1FZA B;  2WPR A;  3OW2 O;  2Q3E A;  3IFM A;  4LLH A;  2ZT9 C;  3CCS P;  5KLV E;  3V4Q A;  4WY4 B;  1GK4 A;  5H2F E;  3CX5 E;  2BCC D;  3NTN A;  3B5N B;  4DCK A;  4H13 C;  3R4Y A;  1N86 B;  2XNX A;  5TJH A;  2PP6 A;  3EFF K;  1RY3 A;  1YBK A;  1YQ4 C;  4U3F J;  1X79 B;  1SP4 A;  3O6Q B;  1LWU B;  2W27 A;  1HWT C;  3RGU A;  1KYO I;  2JWA A;  2KI7 B;  1FZC B;  3L75 D;  1YJN P;  4L73 A;  1FIC A;  3WUV A;  1M90 Q;  2A45 I;  2YXR B;  1ZLL A;  1RQU A;  1X0T A;  2IYO A;  3AE3 C;  3WU2 E;  3KDP B;  3L71 G;  2C0X A;  2FFD A;  1SQX E;  5APW A;  2E5T A;  1SQP E;  4I6M C;  1HF9 A;  1H8A A;  1OW8 A;  3D6Y A;  2KK7 A;  2W6A A;  2HOD B;  3H1H E;  1PPJ G;  3OA7 A;  1NTK G;  2AXT E;  4GOD A;  1G2C A;  3L70 G;  1FC2 C;  1Z3S A;  1SLQ A;  3H32 B;  1N7S A;  1S1C X;  1SQQ J;  2QJP C;  3NXS A;  5KJ7 A;  2HLO C;  2FKW B;  3I5C A;  1LTJ B;  4HYT B;  4D6T J;  1L4A C;  3E7K A;  2P10 A;  2KLU A;  3AE8 C;  3GF3 A;  3P32 A;  1MUU A;  3RK3 E;  2IZ1 A;  1SS1 A;  1VF5 D;  4N6J A;  1PGO A;  3GG2 A;  1EZV E;  2N9B A;  5AW3 B;  1JY3 P;  5AW7 B;  1H0T B;  3L73 E;  2J3F A;  1FZF B;  1SQB K;  4Y99 B;  3OJA B;  1NTK D;  3H1I D;  3A0B H;  3L70 D;  5B66 H;  2J61 A;  3H1K J;  2OYH B;  4U3F E;  3I55 P;  1JO5 A;  1LTI C;  1KMI Z;  3CCM P;  2P7J A;  2KIK A;  3AE9 C;  2KZI A;  1LTT C;  1URQ C;  4C46 A;  3Q5S A;  2D2C D;  4GDO A;  4JBZ A;  2B88 A;  1KB9 D;  2FY8 A;  2M5A A;  1IC2 A;  5AW4 B;  4PV1 C;  4N3Y B;  4DOJ A;  4C7N B;  2FFD B;  3V4W A;  4LC1 A;  2Z4E B;  2NPS A;  1R5S A;  2BCC J;  1LP1 B;  2YKO A;  3MUD C;  1NU1 G;  3M0D C;  1N7S B;  3BAT A;  1K73 Q;  2J59 M;  3HE4 B;  3L75 J;  3RK2 D;  2N1T C;  1JEK A;  1U7M A;  1Z56 A;  4BWN A;  1RHZ B;  3CCQ P;  4D6T E;  5CCG C;  2IPP A;  4H0L B;  1X9V A;  1SVF A;  1VQN P;  4HB1 A;  4B86 A;  3PLN A;  3GHG C;  1LTS C;  3SFD C;  1RE4 B;  2PRR A;  1J1E C;  2E74 C;  1AVO A;  1KYO H;  4RES B;  4PD4 D;  5AW2 B;  3AE4 C;  2LR2 A;  1PGJ A;  1QGK B;  2A45 H;  1X8Y A;  3JCU H;  4JQ0 D;  4PJ0 H;  2QJY B;  1Q82 Q;  1M57 D;  3P8M C;  1FOS F;  1LNQ A;  5KAF E;  3AE7 C;  2IFM A;  2XU6 A;  3GF7 A;  1JB0 J;  3B5N D;  3H1L G;  4H44 C;  4M7H A;  2V7Q H;  4N78 E;  2FYN B;  2PAJ A;  1LTB C;  1VQ5 P;  1J1D C;  2OTJ P;  3CX5 D;  3CC2 P;  1NKN A;  3LIE A;  1NTK J;  2QRX A;  1FZG A;  4TLF A;  3H1I J;  2R5D A;  2BCC E;  2J2P A;  3L70 J;  1L0N K;  4OH8 B;  1SQP G;  1M8O B;  1DH3 A;  1YI2 P;  3G6E P;  3KXD A;  1SQV E;  3H1H G;  3G3Z A;  1KYO D;  3L75 E;  2RKL A;  2XND H;  3H1L D;  2C0W A;  3IN6 A;  2YO3 A;  1EDJ A;  3WUT A;  2IBZ I;  1IJD B;  1H88 A;  2K1A A;  1VQ4 P;  1HGV A;  2AEJ A;  1PGQ A;  3T97 B;  1EZV G;  1KZU B;  3L73 G;  2XDJ A;  5KAI H;  2I1J A;  1BSN A;  3H1H D;  1VQP P;  5DJU B;  1SFC D;  2FYU K;  1JCC A;  3LID A;  2ZYA A;  4IFM A;  1FDI A;  1BGY E;  1EC5 A;  3Q5R A;  2OYI C;  1M1J C;  4Y28 J;  1BDD A;  1WRG A;  4NPD A;  1ZR4 A;  3GW6 A;  1EZV D;  4M3L A;  1QVG O;  3L73 D;  1GL2 C;  1KIL D;  5GTI E;  1KQF B;  4XE5 B;  1FZG B;  1NU1 J;  2WSE H;  4WB4 A;  3BCC E;  3E1I B;  1IO4 A;  3H1I E;  5B5E H;  3JC2 2;  1NTM G;  4GKG A;  1T3U A;  2HPC B;  1NAY A;  2E76 B;  5APQ A;  1RQV A;  2E75 C;  5BVZ A;  2C9L Y;  3VN0 A;  3HD7 B;  1E5W A;  1L0L K;  1KN7 A;  3Q3D A;  1QL1 A;  3M06 A;  2WSF J;  2QM7 A;  3SWY A;  2J3G A;  1DIP A;  3AEB C;  1FU1 A;  4D6T G;  5AVQ B;  3TNU A;  1FZA A;  1N7S D;  3AE1 C;  1T6A A;  1FZE C;  3CL3 D;  3FWL A;  5KJ7 D;  1N73 B;  3C9I A;  3EQ2 A;  1NTM D;  3VMX A;  1S5L E;  2H43 A;  4H0L D;  2ZVN B;  3B5N A;  4OGQ B; 
#chains in the Genus database with same CATH homology
 1FJP A;  2Z4E C;  1LTG C;  3KDP B;  1YTZ I;  3HTK A;  1JCD A;  1N73 A;  2J3O A;  1G2C B;  2WSF H;  1FZC A;  1RF0 C;  3V5B A;  3HE5 B;  2JHI F;  2C0X A;  3SWF A;  4ZFG A;  4JYC A;  2FFD A;  2GM4 A;  5APW A;  3VYI A;  4I6M C;  2GUV A;  3H6P A;  1J1E B;  1H8A A;  4AUW A;  2W6A A;  2HOD B;  5AW0 B;  2Z5I A;  4WBA A;  3OA7 A;  3PP5 A;  1DEB A;  1FZB A;  1G2C A;  5AVR B;  2OYI B;  1RE3 B;  4JF7 A;  1Z3S A;  1PFI A;  1SLQ A;  3H32 B;  1N7S A;  1LT9 B;  3HE5 A;  3II6 A;  1KFN A;  1SQP K;  3OAK A;  1N7L A;  3L35 A;  1SQQ K;  3L37 A;  3NXS A;  5CCH D;  5KJ7 A;  1GDT A;  2HLO C;  3TSI A;  2FKW B;  3I5C A;  3HUS B;  1LTJ B;  1JTH A;  4HYT B;  3P8C E;  3NFQ A;  1GL2 B;  1L4A C;  2HOD A;  3P32 A;  2J61 B;  1MUU A;  1N2D C;  2XV5 A;  2WSC H;  1JUN A;  1T2K D;  1URQ D;  2I1K A;  1RF1 A;  4N6J A;  2OYI A;  2J60 A;  3RK2 C;  3H32 A;  1YYC A;  2N9B A;  5AW3 B;  1JY3 P;  1M1J A;  5AW7 B;  2WTY A;  5AVV B;  3U1A A;  2J3F A;  4EPU A;  1FZF B;  5APX A;  1OXZ A;  1SQB K;  3HUS A;  1HJB A;  4Y99 B;  3OJA B;  1GK6 A;  1GL2 A;  4WY4 D;  3TNU B;  5AW1 B;  1JY3 O;  1AQ5 A;  2J61 A;  1SFC A;  2GY7 A;  2OYH B;  2IFN A;  1H89 A;  4N78 D;  1NKZ B;  2Q9I C;  1QL2 A;  1JO5 A;  1LTI C;  1IFD A;  1FZG C;  1G1I A;  2P7J A;  3V2N A;  3M91 A;  2POH A;  1JOC A;  2VRS A;  1FZF A;  2H43 B;  3RL0 D;  1FDM A;  1LTT C;  2NPS B;  5BU8 B;  1T2K C;  1URQ C;  4C46 A;  2IX7 C;  3VTP C;  3VP8 A;  2BAS A;  1FZE B;  1GTW A;  2JHK F;  1LGH B;  2Q7C A;  2J5Z A;  1JY3 N;  2N1T D;  2OYH A;  3HTK B;  1T3J A;  4I1L A;  3BVH A;  1DX7 A;  3TK1 A;  2R32 A;  1IC2 A;  5AW4 B;  4KHX A;  3VMZ A;  3A5T A;  4N3Y B;  4DOJ A;  1JY2 N;  4C7N B;  1KIL A;  4WY4 C;  2FFD B;  3V4W A;  2WWW A;  4C7R A;  4LC1 A;  2Z4E B;  5AW8 B;  2NPS A;  2JHH C;  1FZE A;  3M9H A;  5CJ0 A;  1A02 J;  2J0G A;  1IFI A;  2FIB A;  2YKO A;  1LWU C;  2P2U A;  1N73 C;  2M8R A;  1FZB B;  1L4A D;  5AVZ B;  3R2P A;  3RL0 C;  2HYN A;  3M0D C;  3LW5 H;  1FZC C;  1N7S B;  3BAT A;  4W7Y A;  4C7N A;  4M7F A;  1MZ9 A;  2J59 M;  3KYQ A;  1VPC A;  3HE4 B;  1OWA A;  3RK2 D;  1NTM K;  2N1T C;  2Z4E A;  2WT7 A;  1JTH B;  1HVV A;  2P67 A;  3N4X A;  1G1J A;  1Z56 A;  5APV A;  2J0Y A;  4R9J A;  5CCG C;  2HG5 D;  2IPP A;  4W80 A;  1NHL A;  4DZO A;  1ZN5 A;  1X9V A;  1SVF A;  1RF1 B;  4B86 A;  2WPS A;  3GHG C;  2J64 A;  1LTS C;  1M1J B;  2OAR A;  2GUS A;  1RE4 B;  3HE4 A;  4AQR D;  5CJ4 A;  3VMY A;  4JZC A;  1J1E C;  2KLV A;  4GIF A;  4LGD E;  4RES B;  1SFC B;  4AYC A;  2QM8 A;  1NWQ A;  1FOS E;  5AW2 B;  3BRT B;  2Z5H A;  3U1C A;  1S9K E;  1RE3 C;  2HLO A;  3RK3 D;  2WZ7 A;  1WT6 A;  1LT9 C;  4HH2 A;  4ZKP A;  2A45 H;  1X8Y A;  1CZQ A;  1RE4 A;  3HD7 D;  1VDF A;  3P8M C;  4W7Z A;  3N7N A;  1LTJ C;  2M3B A;  1FOS F;  3KQG A;  1NTZ K;  2ZFC A;  2IFM A;  2XU6 A;  1AFO A;  5AVY B;  3B5N D;  3BVH B;  2Q5U A;  3L36 A;  1IFJ A;  1IFN A;  4XA4 A;  2JHL F;  5AVT B;  1LTA C;  4M7H A;  3E1I C;  1KIL B;  2YNY A;  5AW9 B;  3BRV B;  4N78 E;  5AVX B;  2O01 H;  2J0H A;  2PAJ A;  1LTB C;  2HPC C;  2XNX C;  1J1D C;  1FZA C;  2P1J A;  2Q9I A;  1NKN A;  5CCH A;  3RK3 C;  4IFD K;  3LIE A;  1NTK K;  1FZG A;  2R5D A;  2J2P A;  3A2A A;  4JYB A;  5APU A;  1L0N K;  3HD7 C;  3WMM 0;  4OH8 B;  1DH3 A;  2XKM A;  5CCG D;  1M7L A;  4JYO X;  1FJK A;  2YO2 A;  1URQ A;  3VP9 A;  2H43 C;  1Z3U A;  3G3Z A;  3B5N C;  2WT7 B;  2D39 A;  1N86 C;  2J3U A;  1A02 F;  2R3C A;  5KLV K;  3BAS A;  1GW4 A;  2HFE D;  2C9N Y;  2WPQ A;  3RL0 B;  1NAF A;  2C0W A;  2FXM A;  1RF0 B;  4IFF A;  1MFZ A;  2KSJ A;  3FIB A;  3CI9 A;  4WY4 A;  1ZV8 A;  1FIB A;  1SQV K;  2YO3 A;  4ZKU A;  1NH4 A;  5CHX A;  2O1J A;  3V2Q A;  2FFD C;  3O8Z A;  1T8Z A;  3MD0 A;  1IJD B;  3P7K A;  1H88 A;  4I2L C;  1HGV A;  2O1K A;  2R5B A;  1JMM A;  2J3F D;  1LWU A;  2J1G A;  3MUD A;  5AVW B;  2ZXE B;  3V2R A;  1HH0 A;  3EFG A;  1CI6 B;  3M0D A;  1KZU B;  1XTC C;  1RF0 A;  2XDJ A;  3GHG B;  1GL2 D;  1FZB C;  2I1J A;  2JJL A;  2JEE A;  2W6B A;  2HLO B;  5APY A;  1N7S C;  2E42 A;  1SFC D;  2N1T A;  2FYU K;  3IR9 A;  3A7O A;  2LKM A;  2WNP F;  5KJ7 C;  2CPB A;  5AW5 B;  5APT A;  1L4A B;  2KOG A;  3B8E B;  5BU5 A;  2E43 A;  3MGN A;  1JCC A;  5CCG A;  1NOH A;  3LID A;  5KTB A;  3T97 A;  3U59 A;  4R9T A;  4IFM A;  4O9B A;  2HOD C;  1CI6 A;  2YKP A;  5AVU B;  3P8C D;  3RK2 B;  3GHG A;  1SQX K;  3TYY A;  1GZL A;  1RF1 C;  2J58 A;  2MJZ A;  2OYI C;  2L5G B;  3V2P A;  3H32 C;  2YMY A;  2WIT A;  1FID A;  3HRN A;  1M1J C;  1RE4 C;  1WRG A;  1IK9 A;  1ZR4 A;  3MIW A;  1S9K D;  1L4A A;  4M3L A;  3HUS C;  4GT1 A;  1XTG B;  1YTZ T;  3M9B A;  1GL2 C;  1KIL D;  3NMD A;  2YKQ A;  2Q9I B;  2XZR A;  2Q3I A;  4XE5 B;  1RE3 A;  1SFC C;  1FZG B;  2NPS D;  1GD2 E;  1LT9 A;  1NU1 K;  2WSE H;  2H7H A;  4WB4 A;  2JHM F;  3E1I B;  1IO4 A;  4EIJ A;  3M0A A;  1FBM A;  3A3Y B;  2A45 G;  2KP8 A;  3CLQ A;  1HGZ A;  4GKG A;  1T3U A;  1LTJ A;  1URQ B;  2HPC B;  1HBW A;  1FZF C;  1JY2 P;  2KYV A;  2XNX B;  5AVS B;  1J1D B;  1HUC A;  1FZA B;  4Y99 C;  1KQL A;  2WPR A;  5APQ A;  3M9Q A;  3RK3 B;  3KPE A;  3IFM A;  5BVZ A;  2C9L Y;  1GW3 A;  3L4F A;  3VN0 A;  3HD7 B;  1E5W A;  1L0L K;  4LLH A;  5CCH C;  2FYZ A;  2OYH C;  1QL1 A;  1JY2 O;  3M06 A;  3BVH C;  1KFM A;  3V4Q A;  3E1I A;  2QM7 A;  4WY4 B;  3SWY A;  1GK4 A;  2J3G A;  1ZR2 A;  1IFM A;  3NTN A;  1FZD A;  3B5N B;  1KIL C;  2HPC A;  1JNM A;  1FU1 A;  1GU4 A;  5AVQ B;  1N86 B;  3TNU A;  2XNX A;  2PP6 A;  1FZA A;  1FAV A;  1RY3 A;  1N7S D;  2NPS C;  5APS A;  1GU5 A;  2H8P D;  1X79 B;  1J2J B;  3MTU E;  3UIA A;  1W2E A;  1SP4 A;  1JC9 A;  1FZE C;  4EOT A;  1LWU B;  2W27 A;  3CL3 D;  5KJ7 D;  1HWT C;  1N73 B;  3HD7 A;  2KB7 P;  3C9I A;  1CW5 A;  1FZC B;  4NYT A;  3EQ2 A;  1NO4 A;  2CPS A;  1EQ7 A;  3VMX A;  1FIC A;  5CMZ A;  1HTL C;  2H43 A;  2A45 I;  1CSB A;  3VOP A;  2N1T B;  1MV8 A;  3B5N A;  5AW6 B;  1N86 A;  1ZLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...