2HODB

Crystal structure of fragment d from human fibrinogen complexed with gly-hydroxypro-arg-pro-amide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
307
structure length
307
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
molecule tags Blood clotting/peptide
total genus 59
structure length 307
sequence length 307
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2006-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hodB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2hodB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2hodB03
2J3GA 1LWUA 3HUSB 1RF1B 3GHGA 2Q9IB 2J61B 1LT9B 1FZEC 2H43B 1RE3A 1FZGA 2OYIA 2JHMF 1RE4A 2HLOC 1FZAA 1N86A 2HODA 2A45G 2XNXC 4R9JA 2J60A 1RF0B 2FFDB 3BVHB 2Z4EC 1JY3N 1FIBA 4M7HA 1N73C 2J5ZA 1M1JC 1FZFA 1JY3P 2J1GA 4EPUA 1RE3B 1FZGB 2OYIB 1FZEA 1RE4B 1FZCC 1LTJC 3E1IA 1FZAB 1N86B 1T3UA 2J0GA 2HODB 2J64A 2HLOA 1FICA 3FIBA 1JY3O 4NYTA 2JHKF 2XNXA 1FIDA 2OYHA 2Z4EA 2J0YA 1FZFB 2Q9IC 2HPCC 2FIBA 2H43C 1FZBC 3E1IB 1LWUB 3H32A 3GHGB 1LTJA 2J3FA 2XNXB 1RF0C 2FFDC 2OYHB 1JY2P 1Z3SA 2A45I 2JHHC 1RE3C 1FZGC 2OYIC 2J61A 2HPCA 2H43A 3H32B 1FZAC 1FZBA 1LTJB 1N86C 3HUSC 2HODC 1RF1C 1N73A 2GY7A 4JZCA 1LT9C 1M1JA 2A45H 1FZEB 2J2PA 2FFDA 2HLOB 1FZCA 2J3UA 1JY2N 1FZFC 4JYOX 2J0HA 2HPCB 3BVHC 2Z4EB 3E1IC 4ZFGA 1LWUC 1FZBB 1N73B 4M7FA 3GHGC 2JHLF 2D39A 3HUSA 1M1JB 1RF1A 2Q9IA 2WNPF 1LT9A 1RE4C 2OYHC 2JHIF 1FZCB 2J3FD 1JY2O 1W2EA 1Z3UA 1FZDA 1RF0A 1JC9A 3BVHA 4R9TA 3H32C 2J3OA
chains in the Genus database with same CATH superfamily
2M8RA 2M0BA 5KLIC 2N1TA 3B5ND 4Y28J 1OWAA 1NWQA 1MFZA 2H43B 1RE3A 2NPSC 4JYCA 1BSNA 1R8EA 2A45G 1Q2NA 4AYCA 3BATA 4M7HA 1NTZJ 3CWBD 2JEEA 3S4RA 3M0DA 3RBZA 1CW5A 3GG2A 1S4XA 1USDA 1RE4B 3AEFC 3P7KA 1RQUA 2C9LY 3H1HG 4DOJA 4N6JA 1FZFB 4N78E 3A2AA 1PPJE 1M57D 2A06D 1LTJA 3H1KD 4R4LA 3RK3D 3GW6A 1NGMB 2KXPB 1AQTA 3JC22 1NAYA 3NTNA 1YITP 3U1AA 3HE4A 3RBXA 2P67A 2ZYDA 2AEFA 1UIIA 2AXTH 3BASA 3CC4P 1NKZB 1S1CX 5CCGA 1PGQA 2W90A 4O9BA 1FDOA 1QGKB 2Q7CA 3L74D 1X79B 2POHA 1JC9A 2ZVOB 1NTKK 2K3RA 3RL0C 1D7MA 2FYNB 2D2CB 5TISH 3G6EP 1WT6A 3V2NA 4YPCA 1IFDA 1KFNA 2K88A 5KJ7D 2FYUD 1VQ5P 2K9JB 3RL0g 3D6YA 4OGQB 2BEQD 5KLVG 3M9HA 1M1JC 2C0WA 1N2DC 4PJ0H 2H8PD 3AECC 3Q5RA 1BGYJ 1L0NE 2WITA 2XNXA 2R5DA 5KAFH 2Z4EA 2QE7H 3W67A 4U3FE 2QM7A 3LW5H 1N7LA 2J59M 3CLQA 1AFOA 1KILD 1ZW0A 1MUUA 2Y9YA 1ZOYC 1ZR4A 2YKOA 2WTYA 2HPCA 1L0NJ 3CXHH 1GK6A 1JMBA 1SQBG 2O1KA 3TNUB 5KAIH 3CCJP 1Q82Q 5AW3B 1FZCA 1G2CB 3K5BA 4W7ZA 1NTMD 2WSFH 1CI6B 3L73D 1DEBA 1KQFB 2ZJSE 3OJAB 4IL6H 1SQQK 3VMYA 2KK7A 1AA0A 2Z5IA 2ZXXA 1A02F 3SSUA 1J1DB 2Q9IB 3AE4C 2V4HA 3A0BH 1N86A 2HODA 4D6TE 1H0TB 2ZT9B 1RF0B 1BGYG 1VQNP 1SQPJ 3O8ZA 1FU1A 2WPSA 2BCCE 2N1TB 1QVFO 1RE3B 2L91A 1FZEA 3AE7C 1T3UA 3IFMA 2JHKF 2E43A 3HE5A 1ZR2A 5C39A 1X0TA 3CWBG 3L70D 1U57A 4OH8B 3B5NC 2H89C 4D6TJ 1E79H 3NXSA 2QJPC 4GODA 2E76C 1LGHB 2OYIC 1Q86Q 1LTJB 2AXTE 1N73A 3B71A 3H1KG 1SQVD 3CCQP 3RK2C 3P8MC 3BVHC 1R5LA 4Z1MH 3M91A 1Q81Q 2GUSA 3L71E 4UB8H 1N8RQ 2WPVB 1JY2O 1VQOP 2NPSD 3SFEC 3MZWB 3LIDA 3HTKA 3BRVB 1SQPG 3L75E 5AVXB 2HLOC 2P10A 5AW4B 3H1LE 2DW3A 4PJ0E 2C9NY 5BU8B 1EZVE 1EDLA 1HTLC 2Y0CA 1FAVA 1LTSC 1Y9BA 2FYUG 5APVA 1VQKP 3L75J 3TSIA 1JEKA 2XU6A 2JR8A 2H43C 3H1HD 1FZBC 3G3ZA 2Y9ZA 1NKNA 5AVWB 3L35A 4L74A 2XNXB 2QA4P 1FDMA 1SQXD 4RESB 1GL2A 3V2PA 5KAIE 2IX7C 2R32A 2N9BA 1YJ9P 1FZFC 2R5BA 1NTKE 3VP9A 3LW5J 2HPCB 3VYIA 1VQPP 2P1JA 1YQ3C 1AVYA 3CL3D 4YTPC 3RL0D 1FZCB 2ZYAA 2J58A 2SPZA 2JWAA 1NO4A 1KILC 3AE1C 5GTHH 4R9TA 1OW7A 3FX0A 2W8ZA 1URQA 3CCLP 1SS1A 1MV8A 1YHQP 1AVOA 1SQVJ 5APXA 3A0BE 3L73G 1PFIA 1OW8A 1NTZD 4NPEA 1S2EA 2WSFJ 1HJBA 1VDFA 2FKWB 4IL6X 3E1IA 4K3AA 1N86B 2HODB 1JY3O 4NYTA 4NPFX 3VN0A 1IK7A 1JM0A 3GLMA 2HR3A 2KIKA 2O01N 2OTJP 4GKGA 3TDKA 2NRGA 1L2PA 3Q5PA 4RO0A 3HE5B 4WBAA 3BCCJ 1PL5A 3HUSC 1L0LK 2H7HA 1SQQE 1PPJD 2E75B 2FFDA 3H1IJ 3CX5I 1VQ7P 1FDIA 3KYQA 1N73B 4UB8E 4XE5B 2YO2A 2M3EA 4XA4A 4DT0A 1KTMA 2WNPF 1OFCX 1SQVG 2FYUK 4C46A 1P84I 1SQXJ 2E74B 2O01H 1HH0A 4I1LA 2XZRA 1HF9A 5CMZA 3AEDC 1SFCA 3CX5D 3HD7B 1FOSF 3HTKB 1BCCE 1VQ4P 1VF5B 1NU1K 4H44B 1BGYD 3H6PA 1JY3P 4KT0J 2P2UA 2K9YA 2ITAA 2NPSA 1K73Q 1P84D 2ZFCA 1AV1A 3AEAC 1ZMEC 1S3JA 2CK3H 3AE5C 3I55P 1CSBA 2KZJA 1J1DC 2Q9IC 3L36A 4XFJA 1YTZI 2E76D 3M0AA 1BCCJ 3H1JE 3TF5A 3G9RA 4PD4I 3BCCG 2J3FA 2ZT9C 1RF0C 1FJKA 1L0ND 4GOFA 3E7KA 1NTMK 1OIPA 1RE3C 3H1IG 3RK2D 2J5UA 4IFFA 1UIXA 3CI9A 2I1JA 1ZV8A 4C7RA 3CCSP 1PV3A 1LT9C 5BU5A 4EI2A 2YKPA 3IAOA 4DJGA 2KUBA 3A0HH 4H0LB 4MN4C 1GD2E 1JOCA 3H1JJ 3V6IA 4NPDA 3KXDA 1SQXG 4ASVA 1GL2B 4PD4D 1H8AA 3D6ZA 1QL1A 1YIJP 1VPCA 1JNMA 2KZIA 5AW6B 3CC2P 5GTHE 2J3GA 2J61B 1M56D 4ZKUA 3WU2H 3HD7D 1SQPD 5E79H 2IZ1A 1HJ0A 1KC8Q 4BXLA 1URQB 2CPBA 3Q3DA 1PP9E 3O6QA 4YXWH 3NFQA 4H13B 2J0GA 1FICA 5CCGC 1NTZG 5AW5B 5AW8B 4PV1B 4Y99B 1G1IA 4D6TD 4UB6E 2WZ7A 1MFTA 4EOTA 3E1IB 1LWUB 3F5HA 3FWNA 3OAKA 3GHGB 3CC7P 1M1KQ 2NZ2A 3VP8A 4RKUJ 2RMZA 1LT1A 1Z56A 2WSEH 4WY4B 2PGDA 1K8AQ 4LC1A 2H88C 2KNCA 2WSSH 3TGUE 1RF1C 5AVTB 3CWBE 1FS0E 2CPSA 3PRJA 1K04A 4ZFGA 1NAFA 2KLVA 1VQ9P 1PPJG 1L4AB 5KKZC 1EDKA 1KMIZ 2A06E 3WMM0 1FZDA 5AVVB 4WWIA 4U3FJ 3MP7B 3RK3E 4LGDE 5B66H 4B86A 5AW2B 3WUUA 4ZNCA 1NVOA 1N7SA 1RHZB 1SFCB 1IC2A 5CHXA 1FZCC 2ZXEB 1KYOH 2D2CD 3L75D 3JCUH 3VOPA 1ZRTD 3P8CE 3FIBA 5GTIH 3QWOC 2BASA 1IFIA 1L0LE 5KLIB 3L74E 4OGQD 3USSA 2WT7A 1W5CE 3H32A 1GW4A 1WRGA 3CXHI 2ZVNB 1QL2A 3WUTA 1Z3SA 2Q3IA 4A7PA 4GT1A 1WMKA 4ASWA 1KB9H 3B5NA 1N86C 2HODC 1BSHA 3ZDMA 2A45H 3QH9A 3A0HE 2J3UA 1GW3A 5BVZA 1L0NG 2BCCJ 3M9QA 4JQ0D 5AVYB 1DIPA 3CXHD 4U3FG 3AE9C 2YXRB 3S9OA 1NU1E 1Z3UA 1U7MA 3BVHA 1DH3A 2IBZE 5KLVK 4HB1A 2M3BA 3EFGA 3HE4B 2Q1KA 2E75C 3WU2E 3Q1MA 1Y47A 2QG4A 5E79E 4K35A 1GU5A 1M8OB 1SVFA 1NYHA 4JF7A 3GF7A 2JP3A 2B88A 2WVRA 1N73C 2JKVA 3L72E 1E5WA 1JB0J 1NU1J 2OYOA 1T8ZA 1OXZA 3VMAA 2HLOA 1AJYA 2O1JA 1YJWP 3TK1A 1NTME 1S5LE 1Q7YQ 3L73E 4HKZH 2OYHA 2ZT9D 1FC2C 1OVUA 3O6QB 1XTGB 3L37A 3M9BA 3L71J 2N1TD 2M5AA 2YKQA 1MKMA 3HD7C 1SQBK 1HWTC 1VF5C 3L72J 3BCCD 4H44C 1R5SA 1BE3E 2JHHC 4D6TG 2B87A 4BRYA 2H43A 4OVNF 3ABVC 2JWDA 1FZBA 3AE3C 3A5TA 1JUNA 2BCCG 3H1ID 3PHLA 5H2FE 1LTIC 2J2PA 5APSA 5KJ7A 2WSCH 3H1LJ 2YMYA 3S1KA 2Z4EB 1RE4C 2WSEJ 1BE3J 2XDJA 3G71P 3L70E 3CCUP 1ZXGA 2W83C 1HBWA 4I2LC 3V2QA 5B66E 1FZGA 2C0XA 1FZAA 1FBMA 2ZAEB 2Q3EA 1AQ5A 3KZIE 5AVSB 3CCRP 5CCGD 1KILA 3PLNA 1FIBA 1OW6A 3CD6P 1GL2C 2J5ZA 3SFDC 1KYOE 1S9KE 3JCUE 3L71G 2V7QH 5GTIE 3WUVA 2RKLA 1NTKJ 1CZQA 1BCCD 2JJLA 1N7SB 2N9YB 1YTZT 1EC5A 2I1KA 1JCCA 1IO4A 2E5YA 2PP6A 3L75G 3V4WA 1URQC 2Q5UA 3W68A 2IPPA 1J1EB 2WT7B 2OTKE 1KB9E 2VRSA 3H1LG 1M90Q 3H32B 4H13C 1X22A 2FYNC 4UB6H 3SWFA 2D2CC 1FZEB 3H1JD 4JBZA 3CMAP 1LNQA 1TU3F 4Y99C 2K9JA 3P32A 1U7JA 1EXJA 3E1IC 3B5NB 1LWUC 4OGQC 4TT3H 3V2RA 4M7FA 3GHGC 1SQPK 3NMDA 2R3SA 3HUSA 3I56P 3PH0A 3VMZA 5CCHC 1VQ6P 4N78D 2QJPB 3MGNA 3H1HE 2O3JA 4WY4C 5AW0B 1DEEG 2YO3A 2JHMF 1Y8AA 2LKMA 2ZYGA 2QJYB 1SP4A 1JMMA 2Q6QA 1PIXA 2WPQA 3BVHB 1NTKG 2J1GA 1L4AC 3TNUA 1SQQJ 3IR9A 1YJNP 2B9BA 5APWA 3E1RA 3MUDC 3RK3B 4I7ZB 5CBNA 3R4YA 3G4SP 2KS1A 1VQ8P 1PP9D 1HVVA 3EQ2A 3Q2YA 2OYHB 1QX8A 1RH5B 4LLHA 1J2JB 2LXCB 2KOGA 1SFCC 2WMMA 2M5AB 3L4FA 3D71A 1LP1A 2KI7B 4R4MA 2OARA 1H88A 3VMXA 5KLVE 1JY2N 1KQLA 2B87B 4BRYB 2J0HA 2KYVA 1FZBB 2WWWA 2N1TC 5B5EH 3U59A 3CCMP 3PP5A 1LT9A 5AVRB 3TGUD 2JHIF 2E75D 4U3FD 1W2EA 2HG5D 1OVRA 1YBKA 2Y0EA 2RN0A 2IFMA 3M0DC 2WSCJ 5KLVJ 1JO5A 2R44A 1RY3A 1GTWA 2XNDH 2XV5A 1HUCA 1HGZA 1SQQG 2J60A 3AEBC 1JTHA 2KP8A 2P58A 2E74D 3ITKA 1IFNA 1SQBE 1KFMA 1FZGB 1T3JA 3AE2C 1LTJC 1FZAB 1H89A 4W80A 5TJHA 1ZP0C 1KILB 1LTAC 3PTZA 2YIUB 5AW9B 2QJKB 2J0YA 1VF5D 3IN6A 2QVAA 4H44D 1PGJA 4DCKA 3AE8C 1QVGO 5APTA 2GA1A 3SWKA 3P8CD 2PAJA 1SQBJ 3MD0A 2W27A 1BCCG 1ZLLA 3N7NA 4QMAA 2V7QJ 3CX5E 1VQLP 1S5LH 1L0LD 2AEMA 4JZCA 1M1JA 1SQVK 1BGYE 3T97A 2BCCD 5CBOA 2PFXA 1P84E 3AEGC 2KSJA 1PP9J 3TYYA 1KZUB 4GIFA 1M7LA 5AVUB 1RF1A 2IBZI 4AUWA 4HH2A 3H1JG 1BDCA 3EFFK 3HRNA 4H0LD 5H2FH 1SLQA 4BWNA 1T2KD 3HUSB 1QEXA 3H25A 1GL2D 1NJIQ 2FBWC 2G3AA 2FXMA 2XNXC 2FYZA 2BEZF 1GMJA 2FFDB 2Z4EC 3GMAA 1JY3N 1NU1D 1IZNB 4KJMA 3C1LA 3R2PA 3U1CA 3H1KE 2IBZD 3TGUJ 1KN7A 3CWBJ 3L71D 4PD4E 1FIDA 2QRXA 4EDFA 4YXDC 1EZVI 1URQD 2HPCC 3EWKA 3KZIH 3A3YB 3L72D 2IDBA 2RH0A 4EIJA 1RQVA 3B4SA 3FXEA 4H13D 3H1KJ 2O01J 3II6A 1SQPE 5EFWB 4PV1D 2KS1B 2UWJE 1SQXK 1PP9G 2K37A 3H1LD 3UIAA 4I6MC 2NPSB 1LTBC 4ZKPA 1EZVD 1X9VA 5CCHD 4JYOX 1N7SC 2W6JH 4IFMA 1FOSE 1BDDA 1BE3D 4WY4D 5B5EE 3FWLA 1LP1B 2I8DA 2D39A 1GZLA 3RGUA 2IFNA 1PGPA 2FYUE 2FY8A 1OZHA 1J1EC 1YI2P 5M1BA 1L0LJ 3H32C 3L74J 1OMIA 1LT9B 1EDIA 1FZEC 2OYIA 1S72P 3KDPB 3TGUG 1L4AD 1NTZK 1K05A 1DD3A 3CCVP 1KYOI 1IK9A 1X8YA 3M06A 1NHLA 2GM4A 1LTGC 3MHVA 2WPRA 4C7NA 4EPUA 2FYUJ 3N4XA 1NTKD 5APUA 3A7OA 2YNYA 3V5BA 2J64A 1KILE 1JTHB 1IFMA 2A06G 4JPZB 2MKVA 2HYNA 5CJ0A 2AEJA 1SFCD 3PJSK 2QJYC 2L5GB 4HJGH 3MTUE 5K5GB 3JSVC 1KB9I 1KYOD 4JYBA 1S9KD 3IF4A 1USEA 2A45I 2W6BA 2E74C 1YYCA 3CCEP 3RK3C 3RL0B 4I7ZC 3KHUA 3HD7A 1GDTA 5TISE 1ZRTE 3C9IA 2E42A 4GOEA 1L0LG 1M1JB 1KB9D 3CMEP 3L74G 4AQRD 3T97B 4RJTA 2E5TA 2OYHC 2J3FD 3OW2O 1NTMJ 1HGVA 5AVQB 3L73J 1S5LX 2G8YA 1RF1B 4CPGA 3FGAD 3CPWO 2KNCB 5KAFE 1RE4A 4R9JA 4U7JA 1G1JA 3Q5SA 1SQQD 4KHXA 4WVZA 2Y0DA 3LIEA 4M3LA 1FZFA 2QIWA 5KJ7C 5KKZB 4EYYQ 4L75A 2IYOA 3CXHE 4H0LC 1NU1G 1FE6A 2PRRA 2LXBA 1IJDB 1T2KC 1NOHA 1SQVE 2IBZG 3FXDA 3MIWA 2MJZA 1ZN5A 1IFJA 3L70J 3D70A 3OA7A 1OX3A 1JY2P 4W7YA 1QLED 3AE6C 1L0NK 1FZGC 3BRTB 2J61A 4IL6E 1FJPA 1EQ7A 2FXPA 2XKMA 1FZAC 2GY7A 3L72G 2FXOA 2YIUC 1EDJA 2QJKC 1DD4A 1NTMG 5AVZB 4ZMDA 4N3YB 3KPEA 3C8VA 1XTCC 3KQGA 3CX5H 2OQQA 2K1AA 2JDIH 2YMKA 4GDOA 1DX7A 1EZVG 2QSIA 1EXIA 3AEEC 4PV1C 5KLVD 2J3OA 2QM8A 1LWUA 1VL2A 3VTPC 1BE3G 3GHGA 1KQSO 3BCCE 1P84H 3F89A 5AW1B 5CCHA 1KD1Q 5AW7B 5CJ4A 4WY4A 3H1IE 1W2BO 1GU4A 2B89A 1MZ9A 3SWYA 2KSEA 4HYTB 2E76B 3I5CA 2OYIB 1T6AA 5APYA 1A02J 1NH4A 4WB4A 1Q90D 4IOIH 2JO1A 5L8RJ 5APQA 2P7JA 4L73A 2Z5HA 5KTBA 1KQGB 3L70G 1SQXE 3RK2B 2W6AA 4C7NB 2GUVA 3V4QA 4DZOA 4L76A 2WQYC 1L4AA 1GK4A 1SQBD 3MUDA 1JCDA 2KB7P 5DJUB 3H1HJ 2FFDC 1YQ4C 4OWFA 1K9MQ 2IYPA 2IZ0A 1OVVA 2OGUA 1KORA 1G2CA 1IFPA 4PD4H 3B8EB 1N7SD 2HFED 1KV4A 1PZQA 5DJTB 1CI6A 2QEXP 2OTLP 1LTTC 4TLFA 2HLOB 2LR2A 3GF3A 2KLUA 2JHLF 2AXCA 1LJ2A 1NTZE 2Q9IA 2R3CA 1PGOA 1H0TA 2YXQB 1RF0A 2FIBA 1VQMP 4IFDK
chains in the Genus database with same CATH topology
2M3BA 3EFGA 1T2KD 2M8RA 1MV8A 3HUSB 3HE4B 2N1TA 3B5ND 5APXA 1OWAA 1NWQA 1MFZA 2H43B 1RE3A 1GL2D 2NPSC 4JYCA 1PFIA 2FXMA 1GU5A 1SVFA 2A45G 2XNXC 2FYZA 4JF7A 4AYCA 1HJBA 2FFDB 2Z4EC 3BATA 1JY3N 1VDFA 4M7HA 1N73C 2JEEA 3R2PA 3M0DA 3U1CA 1CW5A 2FKWB 1E5WA 1RE4B 3E1IA 1T8ZA 3P7KA 1N86B 2HODB 1OXZA 2HLOA 2O1JA 1JY3O 3TK1A 4NYTA 1FIDA 3VN0A 2C9LY 2OYHA 4DOJA 4N6JA 1XTGB 1FZFB 1URQD 4N78E 3A2AA 2HPCC 3L37A 3M9BA 2N1TD 3A3YB 2YKQA 1LTJA 4GKGA 3HD7C 4EIJA 1SQBK 1HWTC 3RK3D 3HE5B 3II6A 4WBAA 2JHHC 3NTNA 3U1AA 3HE4A 2P67A 1SQXK 2H43A 1FZBA 3A5TA 3HUSC 1JUNA 1L0LK 2H7HA 3UIAA 4I6MC 2NPSB 1LTIC 3BASA 2J2PA 2FFDA 1LTBC 5APSA 4ZKPA 5KJ7A 2WSCH 5CCHD 1NKZB 1X9VA 4JYOX 1N7SC 5CCGA 2YMYA 4IFMA 1FOSE 2Z4EB 3KYQA 4WY4D 1N73B 2D39A 1GZLA 4XE5B 2YO2A 4O9BA 4XA4A 2WNPF 1RE4C 2XDJA 2Q7CA 2FYUK 2IFNA 4C46A 1J1EC 1HBWA 1X79B 2POHA 1JC9A 2O01H 3H32C 4I2LC 1HH0A 4I1LA 2XZRA 1NTKK 5CMZA 3RL0C 3V2QA 1LT9B 1FZEC 1SFCA 1FZGA 2OYIA 3KDPB 1WT6A 2C0XA 3V2NA 1FZAA 1FBMA 1IFDA 1L4AD 3HD7B 1NTZK 1FOSF 1AQ5A 3HTKB 1KFNA 5AVSB 5KJ7D 1IK9A 1X8YA 5CCGD 3M06A 1KILA 1NHLA 1FIBA 2GM4A 1LTGC 1NU1K 2WPRA 3M9HA 1GL2C 2J5ZA 1M1JC 2C0WA 3H6PA 1JY3P 4C7NA 1N2DC 4EPUA 2H8PD 3N4XA 2P2UA 5APUA 2NPSA 2YNYA 3A7OA 1S9KE 3V5BA 2J64A 2ZFCA 2WITA 1JTHB 2XNXA 2R5DA 1CZQA 1IFMA 2Z4EA 1CSBA 1J1DC 2JJLA 1N7SB 2Q9IC 1YTZT 2HYNA 3L36A 2I1KA 1JCCA 2QM7A 1YTZI 1IO4A 5CJ0A 3M0AA 1SFCD 3LW5H 1N7LA 2L5GB 2PP6A 3MTUE 2J59M 2J3FA 3V4WA 3CLQA 1RF0C 4JYBA 1S9KD 1URQC 2Q5UA 1AFOA 1FJKA 2IPPA 2A45I 1J1EB 1KILD 1MUUA 1NTMK 2W6BA 1ZR4A 1RE3C 2YKOA 2WTYA 3RK2D 2WT7B 2HPCA 2VRSA 4IFFA 1YYCA 3H32B 3CI9A 2I1JA 3RK3C 3RL0B 1ZV8A 4C7RA 1GK6A 1LT9C 5BU5A 2O1KA 3HD7A 3SWFA 3TNUB 1FZEB 2YKPA 5AW3B 4Y99C 1FZCA 1GD2E 1JOCA 1GDTA 1G2CB 3P32A 3E1IC 4W7ZA 3B5NB 1LWUC 3C9IA 3V2RA 4M7FA 3GHGC 1SQPK 3NMDA 2WSFH 1GL2B 2E42A 1CI6B 3HUSA 1M1JB 1H8AA 1DEBA 4AQRD 3VMZA 1QL1A 5CCHC 3OJAB 2OYHC 4N78D 1VPCA 2J3FD 1JNMA 3MGNA 1SQQK 1HGVA 5AVQB 3VMYA 4WY4C 5AW6B 2Z5IA 5AW0B 2J3GA 1A02F 1RF1B 1J1DB 2Q9IB 2J61B 2YO3A 4ZKUA 2JHMF 3HD7D 1RE4A 2LKMA 1N86A 1SP4A 2HODA 1JMMA 4R9JA 2WPQA 1RF0B 1G1JA 3BVHB 1URQB 3O8ZA 4KHXA 1FU1A 2WPSA 3LIEA 2N1TB 2CPBA 4M3LA 1FZFA 3NFQA 2J1GA 1RE3B 1L4AC 3TNUA 1FZEA 3IR9A 5APWA 5KJ7C 2J0GA 1T3UA 3RK3B 1FICA 5CCGC 3IFMA 5AW5B 5AW8B 2JHKF 2E43A 4Y99B 1G1IA 3HE5A 1ZR2A 2WZ7A 1IJDB 1T2KC 2FIBA 4OH8B 4EOTA 3B5NC 3E1IB 1NOHA 1LWUB 3OAKA 3MIWA 3GHGB 2MJZA 1ZN5A 1IFJA 1HVVA 3OA7A 3EQ2A 3NXSA 3VP8A 2OYHB 1JY2P 4W7YA 4LLHA 1L0NK 1J2JB 1Z56A 1LGHB 2KOGA 2WSEH 4WY4B 1SFCC 1FZGC 2OYIC 3BRTB 2J61A 1FJPA 1EQ7A 3L4FA 4LC1A 2XKMA 1FZAC 1LTJB 1RF1C 1N73A 2GY7A 5AVTB 2OARA 1H88A 1DH3A 3VMXA 2CPSA 3RK2C 1JY2N 1KQLA 3P8MC 2J0HA 3BVHC 5AVZB 2KYVA 3M91A 4ZFGA 1FZBB 2WWWA 2GUSA 1NAFA 2N1TC 4N3YB 3KPEA 3U59A 2KLVA 3PP5A 1LT9A 1XTCC 3KQGA 1L4AB 5AVRB 2JHIF 1JY2O 1W2EA 2NPSD 2HG5D 3WMM0 3LIDA 3HTKA 1DX7A 1FZDA 5AVVB 2J3OA 2QM8A 1LWUA 3BRVB 3M0DC 2IFMA 4LGDE 3VTPC 3GHGA 1JO5A 5AVXB 5AW1B 4B86A 1RY3A 5CCHA 1GTWA 2HLOC 5AW2B 2XV5A 1HUCA 1HGZA 5AW7B 5CJ4A 2J60A 4WY4A 1JTHA 5AW4B 1GU4A 2KP8A 1MZ9A 3SWYA 4HYTB 3I5CA 1IFNA 2C9NY 1KFMA 1SFCB 1N7SA 2OYIB 5BU8B 1IC2A 1FZGB 1T3JA 5APYA 5CHXA 1HTLC 1FZCC 1LTJC 1FZAB 2ZXEB 1A02J 1FAVA 1LTSC 1NH4A 4WB4A 1H89A 3VOPA 3P8CE 3FIBA 4W80A 5APQA 2P7JA 2Z5HA 1KILB 5KTBA 1LTAC 5APVA 5AW9B 3TSIA 3RK2B 2W6AA 2BASA 2J0YA 4C7NB 1IFIA 2GUVA 3V4QA 2XU6A 4DZOA 2H43C 1FZBC 3G3ZA 2WT7A 1L4AA 1GK4A 3H32A 1GW4A 1WRGA 1NKNA 5AVWB 3MUDA 1JCDA 2KB7P 3L35A 5APTA 2XNXB 1QL2A 2FFDC 3P8CD 1Z3SA 1FDMA 2Q3IA 2PAJA 3MD0A 2W27A 3N7NA 1ZLLA 1G2CA 4GT1A 4RESB 3B8EB 1N7SD 3B5NA 2HFED 1N86C 2HODC 4JZCA 1GL2A 1CI6A 3V2PA 1M1JA 2A45H 2IX7C 1SQVK 2R32A 3T97A 2N9BA 1LTTC 2HLOB 2J3UA 1GW3A 5BVZA 1FZFC 2R5BA 3VP9A 2HPCB 3VYIA 2KSJA 2P1JA 3TYYA 1KZUB 3M9QA 5AVYB 2JHLF 3CL3D 4GIFA 1M7LA 5AVUB 1RF1A 2Q9IA 2R3CA 3RL0D 4AUWA 4HH2A 1FZCB 2J58A 1Z3UA 1NO4A 1KILC 3HRNA 1RF0A 1SLQA 3BVHA 4R9TA 1URQA 4IFDK 5KLVK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3G A;  1LWU A;  3HUS B;  1RF1 B;  3GHG A;  2Q9I B;  2J61 B;  1LT9 B;  1FZE C;  2H43 B;  1RE3 A;  1FZG A;  2OYI A;  2JHM F;  1RE4 A;  2HLO C;  1FZA A;  1N86 A;  2HOD A;  2A45 G;  2XNX C;  4R9J A;  2J60 A;  1RF0 B;  2FFD B;  3BVH B;  2Z4E C;  1JY3 N;  1FIB A;  4M7H A;  1N73 C;  2J5Z A;  1M1J C;  1FZF A;  1JY3 P;  2J1G A;  4EPU A;  1RE3 B;  1FZG B;  2OYI B;  1FZE A;  1RE4 B;  1FZC C;  1LTJ C;  3E1I A;  1FZA B;  1N86 B;  1T3U A;  2J0G A;  2HOD B;  2J64 A;  2HLO A;  1FIC A;  3FIB A;  1JY3 O;  4NYT A;  2JHK F;  2XNX A;  1FID A;  2OYH A;  2Z4E A;  2J0Y A;  1FZF B;  2Q9I C;  2HPC C;  2FIB A;  2H43 C;  1FZB C;  3E1I B;  1LWU B;  3H32 A;  3GHG B;  1LTJ A;  2J3F A;  2XNX B;  1RF0 C;  2FFD C;  2OYH B;  1JY2 P;  1Z3S A;  2A45 I;  2JHH C;  1RE3 C;  1FZG C;  2OYI C;  2J61 A;  2HPC A;  2H43 A;  3H32 B;  1FZA C;  1FZB A;  1LTJ B;  1N86 C;  3HUS C;  2HOD C;  1RF1 C;  1N73 A;  2GY7 A;  4JZC A;  1LT9 C;  1M1J A;  2A45 H;  1FZE B;  2J2P A;  2FFD A;  2HLO B;  1FZC A;  2J3U A;  1JY2 N;  1FZF C;  4JYO X;  2J0H A;  2HPC B;  3BVH C;  2Z4E B;  3E1I C;  4ZFG A;  1LWU C;  1FZB B;  1N73 B;  4M7F A;  3GHG C;  2JHL F;  2D39 A;  3HUS A;  1M1J B;  1RF1 A;  2Q9I A;  2WNP F;  1LT9 A;  1RE4 C;  2OYH C;  2JHI F;  1FZC B;  2J3F D;  1JY2 O;  1W2E A;  1Z3U A;  1FZD A;  1RF0 A;  1JC9 A;  3BVH A;  4R9T A;  3H32 C;  2J3O A; 
#chains in the Genus database with same CATH topology
 2M8R A;  2M0B A;  5KLI C;  2N1T A;  3B5N D;  4Y28 J;  1OWA A;  1NWQ A;  1MFZ A;  2H43 B;  1RE3 A;  2NPS C;  4JYC A;  1BSN A;  1R8E A;  2A45 G;  1Q2N A;  4AYC A;  3BAT A;  4M7H A;  1NTZ J;  3CWB D;  2JEE A;  3S4R A;  3M0D A;  3RBZ A;  1CW5 A;  3GG2 A;  1S4X A;  1USD A;  1RE4 B;  3AEF C;  3P7K A;  1RQU A;  2C9L Y;  3H1H G;  4DOJ A;  4N6J A;  1FZF B;  4N78 E;  3A2A A;  1PPJ E;  1M57 D;  2A06 D;  1LTJ A;  3H1K D;  4R4L A;  3RK3 D;  3GW6 A;  1NGM B;  2KXP B;  1AQT A;  3JC2 2;  1NAY A;  3NTN A;  1YIT P;  3U1A A;  3HE4 A;  3RBX A;  2P67 A;  2ZYD A;  2AEF A;  1UII A;  2AXT H;  3BAS A;  3CC4 P;  1NKZ B;  1S1C X;  5CCG A;  1PGQ A;  2W90 A;  4O9B A;  1FDO A;  1QGK B;  2Q7C A;  3L74 D;  1X79 B;  2POH A;  1JC9 A;  2ZVO B;  1NTK K;  2K3R A;  3RL0 C;  1D7M A;  2FYN B;  2D2C B;  5TIS H;  3G6E P;  1WT6 A;  3V2N A;  4YPC A;  1IFD A;  1KFN A;  2K88 A;  5KJ7 D;  2FYU D;  1VQ5 P;  2K9J B;  3RL0 g;  3D6Y A;  4OGQ B;  2BEQ D;  5KLV G;  3M9H A;  1M1J C;  2C0W A;  1N2D C;  4PJ0 H;  2H8P D;  3AEC C;  3Q5R A;  1BGY J;  1L0N E;  2WIT A;  2XNX A;  2R5D A;  5KAF H;  2Z4E A;  2QE7 H;  3W67 A;  4U3F E;  2QM7 A;  3LW5 H;  1N7L A;  2J59 M;  3CLQ A;  1AFO A;  1KIL D;  1ZW0 A;  1MUU A;  2Y9Y A;  1ZOY C;  1ZR4 A;  2YKO A;  2WTY A;  2HPC A;  1L0N J;  3CXH H;  1GK6 A;  1JMB A;  1SQB G;  2O1K A;  3TNU B;  5KAI H;  3CCJ P;  1Q82 Q;  5AW3 B;  1FZC A;  1G2C B;  3K5B A;  4W7Z A;  1NTM D;  2WSF H;  1CI6 B;  3L73 D;  1DEB A;  1KQF B;  2ZJS E;  3OJA B;  4IL6 H;  1SQQ K;  3VMY A;  2KK7 A;  1AA0 A;  2Z5I A;  2ZXX A;  1A02 F;  3SSU A;  1J1D B;  2Q9I B;  3AE4 C;  2V4H A;  3A0B H;  1N86 A;  2HOD A;  4D6T E;  1H0T B;  2ZT9 B;  1RF0 B;  1BGY G;  1VQN P;  1SQP J;  3O8Z A;  1FU1 A;  2WPS A;  2BCC E;  2N1T B;  1QVF O;  1RE3 B;  2L91 A;  1FZE A;  3AE7 C;  1T3U A;  3IFM A;  2JHK F;  2E43 A;  3HE5 A;  1ZR2 A;  5C39 A;  1X0T A;  3CWB G;  3L70 D;  1U57 A;  4OH8 B;  3B5N C;  2H89 C;  4D6T J;  1E79 H;  3NXS A;  2QJP C;  4GOD A;  2E76 C;  1LGH B;  2OYI C;  1Q86 Q;  1LTJ B;  2AXT E;  1N73 A;  3B71 A;  3H1K G;  1SQV D;  3CCQ P;  3RK2 C;  3P8M C;  3BVH C;  1R5L A;  4Z1M H;  3M91 A;  1Q81 Q;  2GUS A;  3L71 E;  4UB8 H;  1N8R Q;  2WPV B;  1JY2 O;  1VQO P;  2NPS D;  3SFE C;  3MZW B;  3LID A;  3HTK A;  3BRV B;  1SQP G;  3L75 E;  5AVX B;  2HLO C;  2P10 A;  5AW4 B;  3H1L E;  2DW3 A;  4PJ0 E;  2C9N Y;  5BU8 B;  1EZV E;  1EDL A;  1HTL C;  2Y0C A;  1FAV A;  1LTS C;  1Y9B A;  2FYU G;  5APV A;  1VQK P;  3L75 J;  3TSI A;  1JEK A;  2XU6 A;  2JR8 A;  2H43 C;  3H1H D;  1FZB C;  3G3Z A;  2Y9Z A;  1NKN A;  5AVW B;  3L35 A;  4L74 A;  2XNX B;  2QA4 P;  1FDM A;  1SQX D;  4RES B;  1GL2 A;  3V2P A;  5KAI E;  2IX7 C;  2R32 A;  2N9B A;  1YJ9 P;  1FZF C;  2R5B A;  1NTK E;  3VP9 A;  3LW5 J;  2HPC B;  3VYI A;  1VQP P;  2P1J A;  1YQ3 C;  1AVY A;  3CL3 D;  4YTP C;  3RL0 D;  1FZC B;  2ZYA A;  2J58 A;  2SPZ A;  2JWA A;  1NO4 A;  1KIL C;  3AE1 C;  5GTH H;  4R9T A;  1OW7 A;  3FX0 A;  2W8Z A;  1URQ A;  3CCL P;  1SS1 A;  1MV8 A;  1YHQ P;  1AVO A;  1SQV J;  5APX A;  3A0B E;  3L73 G;  1PFI A;  1OW8 A;  1NTZ D;  4NPE A;  1S2E A;  2WSF J;  1HJB A;  1VDF A;  2FKW B;  4IL6 X;  3E1I A;  4K3A A;  1N86 B;  2HOD B;  1JY3 O;  4NYT A;  4NPF X;  3VN0 A;  1IK7 A;  1JM0 A;  3GLM A;  2HR3 A;  2KIK A;  2O01 N;  2OTJ P;  4GKG A;  3TDK A;  2NRG A;  1L2P A;  3Q5P A;  4RO0 A;  3HE5 B;  4WBA A;  3BCC J;  1PL5 A;  3HUS C;  1L0L K;  2H7H A;  1SQQ E;  1PPJ D;  2E75 B;  2FFD A;  3H1I J;  3CX5 I;  1VQ7 P;  1FDI A;  3KYQ A;  1N73 B;  4UB8 E;  4XE5 B;  2YO2 A;  2M3E A;  4XA4 A;  4DT0 A;  1KTM A;  2WNP F;  1OFC X;  1SQV G;  2FYU K;  4C46 A;  1P84 I;  1SQX J;  2E74 B;  2O01 H;  1HH0 A;  4I1L A;  2XZR A;  1HF9 A;  5CMZ A;  3AED C;  1SFC A;  3CX5 D;  3HD7 B;  1FOS F;  3HTK B;  1BCC E;  1VQ4 P;  1VF5 B;  1NU1 K;  4H44 B;  1BGY D;  3H6P A;  1JY3 P;  4KT0 J;  2P2U A;  2K9Y A;  2ITA A;  2NPS A;  1K73 Q;  1P84 D;  2ZFC A;  1AV1 A;  3AEA C;  1ZME C;  1S3J A;  2CK3 H;  3AE5 C;  3I55 P;  1CSB A;  2KZJ A;  1J1D C;  2Q9I C;  3L36 A;  4XFJ A;  1YTZ I;  2E76 D;  3M0A A;  1BCC J;  3H1J E;  3TF5 A;  3G9R A;  4PD4 I;  3BCC G;  2J3F A;  2ZT9 C;  1RF0 C;  1FJK A;  1L0N D;  4GOF A;  3E7K A;  1NTM K;  1OIP A;  1RE3 C;  3H1I G;  3RK2 D;  2J5U A;  4IFF A;  1UIX A;  3CI9 A;  2I1J A;  1ZV8 A;  4C7R A;  3CCS P;  1PV3 A;  1LT9 C;  5BU5 A;  4EI2 A;  2YKP A;  3IAO A;  4DJG A;  2KUB A;  3A0H H;  4H0L B;  4MN4 C;  1GD2 E;  1JOC A;  3H1J J;  3V6I A;  4NPD A;  3KXD A;  1SQX G;  4ASV A;  1GL2 B;  4PD4 D;  1H8A A;  3D6Z A;  1QL1 A;  1YIJ P;  1VPC A;  1JNM A;  2KZI A;  5AW6 B;  3CC2 P;  5GTH E;  2J3G A;  2J61 B;  1M56 D;  4ZKU A;  3WU2 H;  3HD7 D;  1SQP D;  5E79 H;  2IZ1 A;  1HJ0 A;  1KC8 Q;  4BXL A;  1URQ B;  2CPB A;  3Q3D A;  1PP9 E;  3O6Q A;  4YXW H;  3NFQ A;  4H13 B;  2J0G A;  1FIC A;  5CCG C;  1NTZ G;  5AW5 B;  5AW8 B;  4PV1 B;  4Y99 B;  1G1I A;  4D6T D;  4UB6 E;  2WZ7 A;  1MFT A;  4EOT A;  3E1I B;  1LWU B;  3F5H A;  3FWN A;  3OAK A;  3GHG B;  3CC7 P;  1M1K Q;  2NZ2 A;  3VP8 A;  4RKU J;  2RMZ A;  1LT1 A;  1Z56 A;  2WSE H;  4WY4 B;  2PGD A;  1K8A Q;  4LC1 A;  2H88 C;  2KNC A;  2WSS H;  3TGU E;  1RF1 C;  5AVT B;  3CWB E;  1FS0 E;  2CPS A;  3PRJ A;  1K04 A;  4ZFG A;  1NAF A;  2KLV A;  1VQ9 P;  1PPJ G;  1L4A B;  5KKZ C;  1EDK A;  1KMI Z;  2A06 E;  3WMM 0;  1FZD A;  5AVV B;  4WWI A;  4U3F J;  3MP7 B;  3RK3 E;  4LGD E;  5B66 H;  4B86 A;  5AW2 B;  3WUU A;  4ZNC A;  1NVO A;  1N7S A;  1RHZ B;  1SFC B;  1IC2 A;  5CHX A;  1FZC C;  2ZXE B;  1KYO H;  2D2C D;  3L75 D;  3JCU H;  3VOP A;  1ZRT D;  3P8C E;  3FIB A;  5GTI H;  3QWO C;  2BAS A;  1IFI A;  1L0L E;  5KLI B;  3L74 E;  4OGQ D;  3USS A;  2WT7 A;  1W5C E;  3H32 A;  1GW4 A;  1WRG A;  3CXH I;  2ZVN B;  1QL2 A;  3WUT A;  1Z3S A;  2Q3I A;  4A7P A;  4GT1 A;  1WMK A;  4ASW A;  1KB9 H;  3B5N A;  1N86 C;  2HOD C;  1BSH A;  3ZDM A;  2A45 H;  3QH9 A;  3A0H E;  2J3U A;  1GW3 A;  5BVZ A;  1L0N G;  2BCC J;  3M9Q A;  4JQ0 D;  5AVY B;  1DIP A;  3CXH D;  4U3F G;  3AE9 C;  2YXR B;  3S9O A;  1NU1 E;  1Z3U A;  1U7M A;  3BVH A;  1DH3 A;  2IBZ E;  5KLV K;  4HB1 A;  2M3B A;  3EFG A;  3HE4 B;  2Q1K A;  2E75 C;  3WU2 E;  3Q1M A;  1Y47 A;  2QG4 A;  5E79 E;  4K35 A;  1GU5 A;  1M8O B;  1SVF A;  1NYH A;  4JF7 A;  3GF7 A;  2JP3 A;  2B88 A;  2WVR A;  1N73 C;  2JKV A;  3L72 E;  1E5W A;  1JB0 J;  1NU1 J;  2OYO A;  1T8Z A;  1OXZ A;  3VMA A;  2HLO A;  1AJY A;  2O1J A;  1YJW P;  3TK1 A;  1NTM E;  1S5L E;  1Q7Y Q;  3L73 E;  4HKZ H;  2OYH A;  2ZT9 D;  1FC2 C;  1OVU A;  3O6Q B;  1XTG B;  3L37 A;  3M9B A;  3L71 J;  2N1T D;  2M5A A;  2YKQ A;  1MKM A;  3HD7 C;  1SQB K;  1HWT C;  1VF5 C;  3L72 J;  3BCC D;  4H44 C;  1R5S A;  1BE3 E;  2JHH C;  4D6T G;  2B87 A;  4BRY A;  2H43 A;  4OVN F;  3ABV C;  2JWD A;  1FZB A;  3AE3 C;  3A5T A;  1JUN A;  2BCC G;  3H1I D;  3PHL A;  5H2F E;  1LTI C;  2J2P A;  5APS A;  5KJ7 A;  2WSC H;  3H1L J;  2YMY A;  3S1K A;  2Z4E B;  1RE4 C;  2WSE J;  1BE3 J;  2XDJ A;  3G71 P;  3L70 E;  3CCU P;  1ZXG A;  2W83 C;  1HBW A;  4I2L C;  3V2Q A;  5B66 E;  1FZG A;  2C0X A;  1FZA A;  1FBM A;  2ZAE B;  2Q3E A;  1AQ5 A;  3KZI E;  5AVS B;  3CCR P;  5CCG D;  1KIL A;  3PLN A;  1FIB A;  1OW6 A;  3CD6 P;  1GL2 C;  2J5Z A;  3SFD C;  1KYO E;  1S9K E;  3JCU E;  3L71 G;  2V7Q H;  5GTI E;  3WUV A;  2RKL A;  1NTK J;  1CZQ A;  1BCC D;  2JJL A;  1N7S B;  2N9Y B;  1YTZ T;  1EC5 A;  2I1K A;  1JCC A;  1IO4 A;  2E5Y A;  2PP6 A;  3L75 G;  3V4W A;  1URQ C;  2Q5U A;  3W68 A;  2IPP A;  1J1E B;  2WT7 B;  2OTK E;  1KB9 E;  2VRS A;  3H1L G;  1M90 Q;  3H32 B;  4H13 C;  1X22 A;  2FYN C;  4UB6 H;  3SWF A;  2D2C C;  1FZE B;  3H1J D;  4JBZ A;  3CMA P;  1LNQ A;  1TU3 F;  4Y99 C;  2K9J A;  3P32 A;  1U7J A;  1EXJ A;  3E1I C;  3B5N B;  1LWU C;  4OGQ C;  4TT3 H;  3V2R A;  4M7F A;  3GHG C;  1SQP K;  3NMD A;  2R3S A;  3HUS A;  3I56 P;  3PH0 A;  3VMZ A;  5CCH C;  1VQ6 P;  4N78 D;  2QJP B;  3MGN A;  3H1H E;  2O3J A;  4WY4 C;  5AW0 B;  1DEE G;  2YO3 A;  2JHM F;  1Y8A A;  2LKM A;  2ZYG A;  2QJY B;  1SP4 A;  1JMM A;  2Q6Q A;  1PIX A;  2WPQ A;  3BVH B;  1NTK G;  2J1G A;  1L4A C;  3TNU A;  1SQQ J;  3IR9 A;  1YJN P;  2B9B A;  5APW A;  3E1R A;  3MUD C;  3RK3 B;  4I7Z B;  5CBN A;  3R4Y A;  3G4S P;  2KS1 A;  1VQ8 P;  1PP9 D;  1HVV A;  3EQ2 A;  3Q2Y A;  2OYH B;  1QX8 A;  1RH5 B;  4LLH A;  1J2J B;  2LXC B;  2KOG A;  1SFC C;  2WMM A;  2M5A B;  3L4F A;  3D71 A;  1LP1 A;  2KI7 B;  4R4M A;  2OAR A;  1H88 A;  3VMX A;  5KLV E;  1JY2 N;  1KQL A;  2B87 B;  4BRY B;  2J0H A;  2KYV A;  1FZB B;  2WWW A;  2N1T C;  5B5E H;  3U59 A;  3CCM P;  3PP5 A;  1LT9 A;  5AVR B;  3TGU D;  2JHI F;  2E75 D;  4U3F D;  1W2E A;  2HG5 D;  1OVR A;  1YBK A;  2Y0E A;  2RN0 A;  2IFM A;  3M0D C;  2WSC J;  5KLV J;  1JO5 A;  2R44 A;  1RY3 A;  1GTW A;  2XND H;  2XV5 A;  1HUC A;  1HGZ A;  1SQQ G;  2J60 A;  3AEB C;  1JTH A;  2KP8 A;  2P58 A;  2E74 D;  3ITK A;  1IFN A;  1SQB E;  1KFM A;  1FZG B;  1T3J A;  3AE2 C;  1LTJ C;  1FZA B;  1H89 A;  4W80 A;  5TJH A;  1ZP0 C;  1KIL B;  1LTA C;  3PTZ A;  2YIU B;  5AW9 B;  2QJK B;  2J0Y A;  1VF5 D;  3IN6 A;  2QVA A;  4H44 D;  1PGJ A;  4DCK A;  3AE8 C;  1QVG O;  5APT A;  2GA1 A;  3SWK A;  3P8C D;  2PAJ A;  1SQB J;  3MD0 A;  2W27 A;  1BCC G;  1ZLL A;  3N7N A;  4QMA A;  2V7Q J;  3CX5 E;  1VQL P;  1S5L H;  1L0L D;  2AEM A;  4JZC A;  1M1J A;  1SQV K;  1BGY E;  3T97 A;  2BCC D;  5CBO A;  2PFX A;  1P84 E;  3AEG C;  2KSJ A;  1PP9 J;  3TYY A;  1KZU B;  4GIF A;  1M7L A;  5AVU B;  1RF1 A;  2IBZ I;  4AUW A;  4HH2 A;  3H1J G;  1BDC A;  3EFF K;  3HRN A;  4H0L D;  5H2F H;  1SLQ A;  4BWN A;  1T2K D;  3HUS B;  1QEX A;  3H25 A;  1GL2 D;  1NJI Q;  2FBW C;  2G3A A;  2FXM A;  2XNX C;  2FYZ A;  2BEZ F;  1GMJ A;  2FFD B;  2Z4E C;  3GMA A;  1JY3 N;  1NU1 D;  1IZN B;  4KJM A;  3C1L A;  3R2P A;  3U1C A;  3H1K E;  2IBZ D;  3TGU J;  1KN7 A;  3CWB J;  3L71 D;  4PD4 E;  1FID A;  2QRX A;  4EDF A;  4YXD C;  1EZV I;  1URQ D;  2HPC C;  3EWK A;  3KZI H;  3A3Y B;  3L72 D;  2IDB A;  2RH0 A;  4EIJ A;  1RQV A;  3B4S A;  3FXE A;  4H13 D;  3H1K J;  2O01 J;  3II6 A;  1SQP E;  5EFW B;  4PV1 D;  2KS1 B;  2UWJ E;  1SQX K;  1PP9 G;  2K37 A;  3H1L D;  3UIA A;  4I6M C;  2NPS B;  1LTB C;  4ZKP A;  1EZV D;  1X9V A;  5CCH D;  4JYO X;  1N7S C;  2W6J H;  4IFM A;  1FOS E;  1BDD A;  1BE3 D;  4WY4 D;  5B5E E;  3FWL A;  1LP1 B;  2I8D A;  2D39 A;  1GZL A;  3RGU A;  2IFN A;  1PGP A;  2FYU E;  2FY8 A;  1OZH A;  1J1E C;  1YI2 P;  5M1B A;  1L0L J;  3H32 C;  3L74 J;  1OMI A;  1LT9 B;  1EDI A;  1FZE C;  2OYI A;  1S72 P;  3KDP B;  3TGU G;  1L4A D;  1NTZ K;  1K05 A;  1DD3 A;  3CCV P;  1KYO I;  1IK9 A;  1X8Y A;  3M06 A;  1NHL A;  2GM4 A;  1LTG C;  3MHV A;  2WPR A;  4C7N A;  4EPU A;  2FYU J;  3N4X A;  1NTK D;  5APU A;  3A7O A;  2YNY A;  3V5B A;  2J64 A;  1KIL E;  1JTH B;  1IFM A;  2A06 G;  4JPZ B;  2MKV A;  2HYN A;  5CJ0 A;  2AEJ A;  1SFC D;  3PJS K;  2QJY C;  2L5G B;  4HJG H;  3MTU E;  5K5G B;  3JSV C;  1KB9 I;  1KYO D;  4JYB A;  1S9K D;  3IF4 A;  1USE A;  2A45 I;  2W6B A;  2E74 C;  1YYC A;  3CCE P;  3RK3 C;  3RL0 B;  4I7Z C;  3KHU A;  3HD7 A;  1GDT A;  5TIS E;  1ZRT E;  3C9I A;  2E42 A;  4GOE A;  1L0L G;  1M1J B;  1KB9 D;  3CME P;  3L74 G;  4AQR D;  3T97 B;  4RJT A;  2E5T A;  2OYH C;  2J3F D;  3OW2 O;  1NTM J;  1HGV A;  5AVQ B;  3L73 J;  1S5L X;  2G8Y A;  1RF1 B;  4CPG A;  3FGA D;  3CPW O;  2KNC B;  5KAF E;  1RE4 A;  4R9J A;  4U7J A;  1G1J A;  3Q5S A;  1SQQ D;  4KHX A;  4WVZ A;  2Y0D A;  3LIE A;  4M3L A;  1FZF A;  2QIW A;  5KJ7 C;  5KKZ B;  4EYY Q;  4L75 A;  2IYO A;  3CXH E;  4H0L C;  1NU1 G;  1FE6 A;  2PRR A;  2LXB A;  1IJD B;  1T2K C;  1NOH A;  1SQV E;  2IBZ G;  3FXD A;  3MIW A;  2MJZ A;  1ZN5 A;  1IFJ A;  3L70 J;  3D70 A;  3OA7 A;  1OX3 A;  1JY2 P;  4W7Y A;  1QLE D;  3AE6 C;  1L0N K;  1FZG C;  3BRT B;  2J61 A;  4IL6 E;  1FJP A;  1EQ7 A;  2FXP A;  2XKM A;  1FZA C;  2GY7 A;  3L72 G;  2FXO A;  2YIU C;  1EDJ A;  2QJK C;  1DD4 A;  1NTM G;  5AVZ B;  4ZMD A;  4N3Y B;  3KPE A;  3C8V A;  1XTC C;  3KQG A;  3CX5 H;  2OQQ A;  2K1A A;  2JDI H;  2YMK A;  4GDO A;  1DX7 A;  1EZV G;  2QSI A;  1EXI A;  3AEE C;  4PV1 C;  5KLV D;  2J3O A;  2QM8 A;  1LWU A;  1VL2 A;  3VTP C;  1BE3 G;  3GHG A;  1KQS O;  3BCC E;  1P84 H;  3F89 A;  5AW1 B;  5CCH A;  1KD1 Q;  5AW7 B;  5CJ4 A;  4WY4 A;  3H1I E;  1W2B O;  1GU4 A;  2B89 A;  1MZ9 A;  3SWY A;  2KSE A;  4HYT B;  2E76 B;  3I5C A;  2OYI B;  1T6A A;  5APY A;  1A02 J;  1NH4 A;  4WB4 A;  1Q90 D;  4IOI H;  2JO1 A;  5L8R J;  5APQ A;  2P7J A;  4L73 A;  2Z5H A;  5KTB A;  1KQG B;  3L70 G;  1SQX E;  3RK2 B;  2W6A A;  4C7N B;  2GUV A;  3V4Q A;  4DZO A;  4L76 A;  2WQY C;  1L4A A;  1GK4 A;  1SQB D;  3MUD A;  1JCD A;  2KB7 P;  5DJU B;  3H1H J;  2FFD C;  1YQ4 C;  4OWF A;  1K9M Q;  2IYP A;  2IZ0 A;  1OVV A;  2OGU A;  1KOR A;  1G2C A;  1IFP A;  4PD4 H;  3B8E B;  1N7S D;  2HFE D;  1KV4 A;  1PZQ A;  5DJT B;  1CI6 A;  2QEX P;  2OTL P;  1LTT C;  4TLF A;  2HLO B;  2LR2 A;  3GF3 A;  2KLU A;  2JHL F;  2AXC A;  1LJ2 A;  1NTZ E;  2Q9I A;  2R3C A;  1PGO A;  1H0T A;  2YXQ B;  1RF0 A;  2FIB A;  1VQM P;  4IFD K; 
#chains in the Genus database with same CATH homology
 2M3B A;  3EFG A;  1T2K D;  2M8R A;  1MV8 A;  3HUS B;  3HE4 B;  2N1T A;  3B5N D;  5APX A;  1OWA A;  1NWQ A;  1MFZ A;  2H43 B;  1RE3 A;  1GL2 D;  2NPS C;  4JYC A;  1PFI A;  2FXM A;  1GU5 A;  1SVF A;  2A45 G;  2XNX C;  2FYZ A;  4JF7 A;  4AYC A;  1HJB A;  2FFD B;  2Z4E C;  3BAT A;  1JY3 N;  1VDF A;  4M7H A;  1N73 C;  2JEE A;  3R2P A;  3M0D A;  3U1C A;  1CW5 A;  2FKW B;  1E5W A;  1RE4 B;  3E1I A;  1T8Z A;  3P7K A;  1N86 B;  2HOD B;  1OXZ A;  2HLO A;  2O1J A;  1JY3 O;  3TK1 A;  4NYT A;  1FID A;  3VN0 A;  2C9L Y;  2OYH A;  4DOJ A;  4N6J A;  1XTG B;  1FZF B;  1URQ D;  4N78 E;  3A2A A;  2HPC C;  3L37 A;  3M9B A;  2N1T D;  3A3Y B;  2YKQ A;  1LTJ A;  4GKG A;  3HD7 C;  4EIJ A;  1SQB K;  1HWT C;  3RK3 D;  3HE5 B;  3II6 A;  4WBA A;  2JHH C;  3NTN A;  3U1A A;  3HE4 A;  2P67 A;  1SQX K;  2H43 A;  1FZB A;  3A5T A;  3HUS C;  1JUN A;  1L0L K;  2H7H A;  3UIA A;  4I6M C;  2NPS B;  1LTI C;  3BAS A;  2J2P A;  2FFD A;  1LTB C;  5APS A;  4ZKP A;  5KJ7 A;  2WSC H;  5CCH D;  1NKZ B;  1X9V A;  4JYO X;  1N7S C;  5CCG A;  2YMY A;  4IFM A;  1FOS E;  2Z4E B;  3KYQ A;  4WY4 D;  1N73 B;  2D39 A;  1GZL A;  4XE5 B;  2YO2 A;  4O9B A;  4XA4 A;  2WNP F;  1RE4 C;  2XDJ A;  2Q7C A;  2FYU K;  2IFN A;  4C46 A;  1J1E C;  1HBW A;  1X79 B;  2POH A;  1JC9 A;  2O01 H;  3H32 C;  4I2L C;  1HH0 A;  4I1L A;  2XZR A;  1NTK K;  5CMZ A;  3RL0 C;  3V2Q A;  1LT9 B;  1FZE C;  1SFC A;  1FZG A;  2OYI A;  3KDP B;  1WT6 A;  2C0X A;  3V2N A;  1FZA A;  1FBM A;  1IFD A;  1L4A D;  3HD7 B;  1NTZ K;  1FOS F;  1AQ5 A;  3HTK B;  1KFN A;  5AVS B;  5KJ7 D;  1IK9 A;  1X8Y A;  5CCG D;  3M06 A;  1KIL A;  1NHL A;  1FIB A;  2GM4 A;  1LTG C;  1NU1 K;  2WPR A;  3M9H A;  1GL2 C;  2J5Z A;  1M1J C;  2C0W A;  3H6P A;  1JY3 P;  4C7N A;  1N2D C;  4EPU A;  2H8P D;  3N4X A;  2P2U A;  5APU A;  2NPS A;  2YNY A;  3A7O A;  1S9K E;  3V5B A;  2J64 A;  2ZFC A;  2WIT A;  1JTH B;  2XNX A;  2R5D A;  1CZQ A;  1IFM A;  2Z4E A;  1CSB A;  1J1D C;  2JJL A;  1N7S B;  2Q9I C;  1YTZ T;  2HYN A;  3L36 A;  2I1K A;  1JCC A;  2QM7 A;  1YTZ I;  1IO4 A;  5CJ0 A;  3M0A A;  1SFC D;  3LW5 H;  1N7L A;  2L5G B;  2PP6 A;  3MTU E;  2J59 M;  2J3F A;  3V4W A;  3CLQ A;  1RF0 C;  4JYB A;  1S9K D;  1URQ C;  2Q5U A;  1AFO A;  1FJK A;  2IPP A;  2A45 I;  1J1E B;  1KIL D;  1MUU A;  1NTM K;  2W6B A;  1ZR4 A;  1RE3 C;  2YKO A;  2WTY A;  3RK2 D;  2WT7 B;  2HPC A;  2VRS A;  4IFF A;  1YYC A;  3H32 B;  3CI9 A;  2I1J A;  3RK3 C;  3RL0 B;  1ZV8 A;  4C7R A;  1GK6 A;  1LT9 C;  5BU5 A;  2O1K A;  3HD7 A;  3SWF A;  3TNU B;  1FZE B;  2YKP A;  5AW3 B;  4Y99 C;  1FZC A;  1GD2 E;  1JOC A;  1GDT A;  1G2C B;  3P32 A;  3E1I C;  4W7Z A;  3B5N B;  1LWU C;  3C9I A;  3V2R A;  4M7F A;  3GHG C;  1SQP K;  3NMD A;  2WSF H;  1GL2 B;  2E42 A;  1CI6 B;  3HUS A;  1M1J B;  1H8A A;  1DEB A;  4AQR D;  3VMZ A;  1QL1 A;  5CCH C;  3OJA B;  2OYH C;  4N78 D;  1VPC A;  2J3F D;  1JNM A;  3MGN A;  1SQQ K;  1HGV A;  5AVQ B;  3VMY A;  4WY4 C;  5AW6 B;  2Z5I A;  5AW0 B;  2J3G A;  1A02 F;  1RF1 B;  1J1D B;  2Q9I B;  2J61 B;  2YO3 A;  4ZKU A;  2JHM F;  3HD7 D;  1RE4 A;  2LKM A;  1N86 A;  1SP4 A;  2HOD A;  1JMM A;  4R9J A;  2WPQ A;  1RF0 B;  1G1J A;  3BVH B;  1URQ B;  3O8Z A;  4KHX A;  1FU1 A;  2WPS A;  3LIE A;  2N1T B;  2CPB A;  4M3L A;  1FZF A;  3NFQ A;  2J1G A;  1RE3 B;  1L4A C;  3TNU A;  1FZE A;  3IR9 A;  5APW A;  5KJ7 C;  2J0G A;  1T3U A;  3RK3 B;  1FIC A;  5CCG C;  3IFM A;  5AW5 B;  5AW8 B;  2JHK F;  2E43 A;  4Y99 B;  1G1I A;  3HE5 A;  1ZR2 A;  2WZ7 A;  1IJD B;  1T2K C;  2FIB A;  4OH8 B;  4EOT A;  3B5N C;  3E1I B;  1NOH A;  1LWU B;  3OAK A;  3MIW A;  3GHG B;  2MJZ A;  1ZN5 A;  1IFJ A;  1HVV A;  3OA7 A;  3EQ2 A;  3NXS A;  3VP8 A;  2OYH B;  1JY2 P;  4W7Y A;  4LLH A;  1L0N K;  1J2J B;  1Z56 A;  1LGH B;  2KOG A;  2WSE H;  4WY4 B;  1SFC C;  1FZG C;  2OYI C;  3BRT B;  2J61 A;  1FJP A;  1EQ7 A;  3L4F A;  4LC1 A;  2XKM A;  1FZA C;  1LTJ B;  1RF1 C;  1N73 A;  2GY7 A;  5AVT B;  2OAR A;  1H88 A;  1DH3 A;  3VMX A;  2CPS A;  3RK2 C;  1JY2 N;  1KQL A;  3P8M C;  2J0H A;  3BVH C;  5AVZ B;  2KYV A;  3M91 A;  4ZFG A;  1FZB B;  2WWW A;  2GUS A;  1NAF A;  2N1T C;  4N3Y B;  3KPE A;  3U59 A;  2KLV A;  3PP5 A;  1LT9 A;  1XTC C;  3KQG A;  1L4A B;  5AVR B;  2JHI F;  1JY2 O;  1W2E A;  2NPS D;  2HG5 D;  3WMM 0;  3LID A;  3HTK A;  1DX7 A;  1FZD A;  5AVV B;  2J3O A;  2QM8 A;  1LWU A;  3BRV B;  3M0D C;  2IFM A;  4LGD E;  3VTP C;  3GHG A;  1JO5 A;  5AVX B;  5AW1 B;  4B86 A;  1RY3 A;  5CCH A;  1GTW A;  2HLO C;  5AW2 B;  2XV5 A;  1HUC A;  1HGZ A;  5AW7 B;  5CJ4 A;  2J60 A;  4WY4 A;  1JTH A;  5AW4 B;  1GU4 A;  2KP8 A;  1MZ9 A;  3SWY A;  4HYT B;  3I5C A;  1IFN A;  2C9N Y;  1KFM A;  1SFC B;  1N7S A;  2OYI B;  5BU8 B;  1IC2 A;  1FZG B;  1T3J A;  5APY A;  5CHX A;  1HTL C;  1FZC C;  1LTJ C;  1FZA B;  2ZXE B;  1A02 J;  1FAV A;  1LTS C;  1NH4 A;  4WB4 A;  1H89 A;  3VOP A;  3P8C E;  3FIB A;  4W80 A;  5APQ A;  2P7J A;  2Z5H A;  1KIL B;  5KTB A;  1LTA C;  5APV A;  5AW9 B;  3TSI A;  3RK2 B;  2W6A A;  2BAS A;  2J0Y A;  4C7N B;  1IFI A;  2GUV A;  3V4Q A;  2XU6 A;  4DZO A;  2H43 C;  1FZB C;  3G3Z A;  2WT7 A;  1L4A A;  1GK4 A;  3H32 A;  1GW4 A;  1WRG A;  1NKN A;  5AVW B;  3MUD A;  1JCD A;  2KB7 P;  3L35 A;  5APT A;  2XNX B;  1QL2 A;  2FFD C;  3P8C D;  1Z3S A;  1FDM A;  2Q3I A;  2PAJ A;  3MD0 A;  2W27 A;  3N7N A;  1ZLL A;  1G2C A;  4GT1 A;  4RES B;  3B8E B;  1N7S D;  3B5N A;  2HFE D;  1N86 C;  2HOD C;  4JZC A;  1GL2 A;  1CI6 A;  3V2P A;  1M1J A;  2A45 H;  2IX7 C;  1SQV K;  2R32 A;  3T97 A;  2N9B A;  1LTT C;  2HLO B;  2J3U A;  1GW3 A;  5BVZ A;  1FZF C;  2R5B A;  3VP9 A;  2HPC B;  3VYI A;  2KSJ A;  2P1J A;  3TYY A;  1KZU B;  3M9Q A;  5AVY B;  2JHL F;  3CL3 D;  4GIF A;  1M7L A;  5AVU B;  1RF1 A;  2Q9I A;  2R3C A;  3RL0 D;  4AUW A;  4HH2 A;  1FZC B;  2J58 A;  1Z3U A;  1NO4 A;  1KIL C;  3HRN A;  1RF0 A;  1SLQ A;  3BVH A;  4R9T A;  1URQ A;  4IFD K;  5KLV K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...