2HOHA

Ribonuclease t1 (n9a mutant) complexed with 2'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSACYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Dissection of the structural and functional role of a conserved hydration site in RNase T1.
pubmed rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 25
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2hohA00
3A5EA 1I2FA 1DE3A 1BNRA 1RCKA 1RGKA 2BU4A 1I2EA 6GSPA 1CH0A 2RBIA 1B2ZA 1YNVX 1RNTA 1BRJA 1B27A 4BIRA 1I0VA 1LOWA 1AQZA 1BAOA 1G02A 1PY3A 1FYSA 1PYLA 3URPA 1RN1A 2KF5A 1B2MA 1FZUA 1YGWA 1RGGA 1TRQA 1RGEA 1T2HA 2KF4A 1I2GA 1R4YA 1RDSA 1BSDA 2F4YA 3D5IA 1UCIA 1BRGA 4HAAA 1BNIA 5HOHA 5RNTA 1BANA 4GHOA 3SYUA 1B3SA 1BNEA 1GSPA 4J5GA 7GSPA 1YVSA 4RNTA 1X1UA 2F56A 1I3FA 1JBRA 3GSPA 1RGFA 2F5MA 3D5GA 1GOUA 3HOHA 7RNTA 5GSPA 1GMPA 3DGYA 1B2UA 1BVIA 1LNIA 1TTOA 9RNTA 1RLSA 1IYYA 2HOHA 1BNSA 2SARA 1I8VA 1MGWA 1BSBA 3AGNA 1BSAA 1X1XA 1B20A 1BRIA 1GOYA 1GOVA 3AHSA 1BUJA 1C54A 1BGSA 3AGOA 1LRAA 1RGLA 1FUSA 1JBSA 1RCLA 1RSNA 2AAEA 5BU4A 2AADA 1TRPA 1BRSA 1B21A 1RHLA 1JBTA 1RNBA 3AHWA 1BSCA 1BSEA 1GMQA 3RNTA 1MGRA 3DH2A 1FW7A 5BIRA 1I70A 1B2XA 1RTUA 1BNJA 1ZGXA 1A2PA 2ZA4A 1X1WA 1FUTA 1RN4A 1BRHA 4HOHA 1BOXA 1BIRA 1DETA 1LOVA 1Q9EA 1RGAA 2KF6A 4GSPA 1UCLA 2C4BA 1BRNL 1UCJA 2BIRA 2KAAA 1GMRA 3BU4A 1T2IA 1RGHA 3KCHA 2F5WA 1BRKA 6RNTA 1HZ1A 4BU4A 3Q3FA 1UCKA 3WHOA 1RGCA 1HYFA 1BNFA 1BNGA 1AY7A 1B2SA 3BIRA 1X1YA 1I3IA 1BU4A 3WR2A 2KF3A 1RMSA 2GSPA 2RNTA 1SARA 8RNTA 1I0XA 1LOYA 4J5KA 3D4AA
chains in the Genus database with same CATH superfamily
3KSPA 3A5EA 4NPBA 2W04A 3K7CA 3J7Yd 1WMNA 2H0GA 3GZYB 1BNRA 3X41A 3HK4A 1W2ZA 3IJEB 1OHOA 1W00A 1OGZA 1RRHA 2GU1A 3I563 1TP6A 5IEPA 1YNVX 1RNTA 4HM7B 4HJLB 4R9KA 1LOWA 1GY5A 1W6GA 5M19A 1BAOA 4AKZA 1O7MB 2HMNB 2Z6BA 1A2KA 2CHCA 4LYLB 5BXQA 1Y4KA 3DZLA 1AR0A 1B2MA 3CCR3 3DGNA 5IERA 2FGTA 4XBTA 3SLUA 5CF2A 3X42A 2CIUA 1Q7HA 3KZTA 1RGGA 2JDIH 5AIIA 5G2GA 1RDSA 1F8NA 3STDA 5KP4A 2XEPA 1UUVB 1MWTA 3GAXA 5LC7A 5HOHA 1EKMA 3K0ZA 3NV0B 1OUNA 1QJGA 1A2VA 4GHOA 2CFGA 3BNDA 4O3VA 1VQO3 3B7CA 4JRFA 4R4KA 4XDVA 2C11A 3H51A 1CYVA 1UUWB 4FMBA 2RGQA 4OVMA 1IT7A 4RNTA 4HVNA 1W02A 2F56A 1V74A 2CWUA 5IG5A 3OXAA 4O02B 1QAKA 4R1KA 2IA7A 3Q2PA 4XB5A 2F5MA 3HOHA 4HM4B 3NV0A 3LT8A 5GSPA 3PZWA 5IG4A 1VQ63 1B2UA 3CU3A 1FGMA 1BVIA 1UI7A 1LQMB 1UUGB 3ZG0A 3CPW2 3UL6A 1JZOA 1YI23 1OGXA 1JKGB 3DY5A 2IUJA 2XRXB 1WTHA 1IU7A 4DKIA 1D6YA 3WDGB 2CG1A 3LTCA 3X3YA 1BSAA 1GS3A 1VQL3 3IMAB 2JQ5A 4WYKA 2BT3A 1BRIA 3MPHA 3FLJA 3T8UA 3BLZA 1GOVA 3D79A 3BNBA 1BGSA 2GEYA 3WMDA 3WA2X 1M9GA 2AAEA 2HMKB 1J2BA 4AEQA 5BU4A 1SJWA 1UW1A 2Y73A 2LYXA 1JBTA 1VQN3 2O3OA 1BSEA 4HYZA 1GMQA 2ZHXB 3RNTA 4PEJA 4HM1B 4HBRA 5BIRA 2OTL3 4EYCA 1G96A 2UX0A 4RZMA 1ZGXA 2H0HA 2IMJA 3B4OA 3D9RA 1ROAA 5FW5A 5CXOA 1JV2B 1OPYA 4ILFA 3WOEB 3RGAA 3CC23 1BIRA 3JUMA 1Q9EA 1GY6A 1UDII 3X3ZA 4GSPA 3S67A 3FKAA 1UCLA 2C4BA 3RDEA 3OW22 1GMRA 1T2IA 4RNYA 8CHOA 3FCSB 3EC9A 4HM0B 3LZAA 1RKYA 3DGMA 1VQM3 1WMOA 2OQEA 3Q3FA 1UCKA 3OWSA 1CQSA 1NB3I 2HMLB 4X2OA 5FGOA 4STDA 1BNFA 2LQVA 3BIRA 1G0TA 2BHMA 4KFFA 1HU9A 1X1YA 2V1LA 4IT7A 1I3IA 1TJDA 2F99A 1YIJ3 3MG1A 1VZZA 3HX8A 3AMOB 3NX0A 2KF3A 1RMSA 2OOVC 2RNTA 2GU3A 1IVXA 1MOLA 1I0XA 1EUIC 2Y74A 1IQ8A 1M1K4 4FCMA 1RJOA 2F86B 4HM3B 4U13A 3CPOA 1I2FA 2P05A 3GZBA 2QEX3 2RBIA 1PFPA 1NWWA 3AMOA 3PXMA 3KFQC 3V92A 3B8LA 4CPKA 2W0QA 3G6E3 4BTYA 3K5TA 5AYRB 1JJ22 3EN8A 3DXOA 3NUVA 4HM6B 2R4IA 3QRDA 1Q42A 4R9LA 4TX4A 1ROVA 2RFRA 1AV4A 1JB5A 3H3HA 1AVKA 5AIGA 1RGEA 2WOHA 3NBRA 3UB1A 1JN5B 1FGOA 1STDA 1SPUA 2WGQA 3LOYA 2CFWA 2XR8B 2Z76A 4HKVB 3T8NA 2K0MA 1LQGC 1BANA 1D6ZA 4KFEA 4GB5A 5AYSC 3CCV3 4EXRA 2P0MA 4N6UA 2SBLA 3N54B 4N3VA 4EV5A 3FZWA 3G713 1BUQA 3S29A 4BL3A 3OV4A 4H3UA 4XDWA 1JBRA 3CCM3 3V99A 2QGUA 2CC3A 3D5GA 1GOUA 1N8R4 2OTJ3 1D6UA 4KVHA 5BVBA 4IPBA 2Q07A 1SIIA 3DMCA 1VQP3 1US1A 4MJDA 2R41A 1LNIA 4MMZB 4N6V0 1TTOA 5IW9A 3MG3A 1VQ93 1RLSA 3CD63 2HOHA 1Q814 2W6JH 1BSBA 1EEJA 1C7HA 3NHXA 5CF1A 4N6OB 1STFI 1Z1SA 1IQYA 4GL6A 1M904 2CW9A 1B20A 4H61A 3EF8A 1TFKA 2FNQA 3AHSA 4FCZA 3SEDA 1BUJA 1UGIA 3AGOA 5G1KA 1RGLA 1C54A 3EE1A 3JUPA 3O8YA 3SOYA 1T5YA 2CX1A 4L8OA 4I5QA 1TRPA 4FCJA 1RHLA 2CFDA 3HIGA 1YJN3 5A0OB 3AHWA 1TIJA 3DGLA 3MKIA 4FMAA 1MGRA 1NO3A 1YJW3 3PCRA 1I70A 4AKYA 2KXGA 3Q1CA 4K90B 5DREA 1OF5B 2L1SA 3JUQA 1VQ73 1BNJA 2ZL8A 3EX9A 1Q7Y4 2FXTA 3B4PA 4J8TA 4FMDA 4MMXB 1A2PA 1ULIB 3GZRA 2ZA4A 1X1WA 5I97A 3F40A 3IPTA 1FUTA 1DMNA 3F7XA 3PCSA 1IVUA 1N5HA 2KCDA 3MYTA 1LVNA 1DETA 3PGBA 3PYJA 4K1UA 4MEIA 4HM8B 2BMRB 1BRNL 3BU4A 1Q40B 1WNHA 2WOFA 3D3LA 3KCHA 2OWPA 1MWUA 5AI1A 5G1LA 1JKGA 1EG9B 1FGRA 1OH0A 1N9EA 4EV2A 2QA43 1QVF2 1W4NA 2OOVA 2I9WA 4O2HA 1K28A 4N6LA 2CFKA 5ELUA 1IV9A 3LTDA 1RGCA 1KWIA 3Q90A 1U5OA 1AY7A 3LYGA 3S5CA 5JPPA 1IK3A 1Q40A 2Z77A 4ZM8A 1O7HB 3WR2A 2OCTA 2BMQB 1FGQA 4LMIA 8RNTA 4EW5A 4J5KA 3HI7A 3I553 1CYUA 2MC8A 1DVDA 5M1AA 3UNLA 2CFLA 4K1VA 1RGKA 3SVAA 1I2EA 1W7CA 3BNCA 1B2ZA 3FG1A 2UUGC 3GRDA 5IF6A 4BIRA 4MMYB 2XGNA 4BL2A 3G16A 3SX1A 1G02A 1PY3A 2CX0A 3URPA 1R4CA 1RN1A 4FMCA 3N9HA 3OWYA 4KZ1A 2PZVA 3HIIA 3CC73 1UGHI 1FZUA 4J9AA 1GD3A 1JB4A 2B1XB 1RN7A 1N9JA 3JUOA 1RRLA 2KF4A 3K63A 1OCVA 1R4YA 1BSDA 4O8SA 3D5IA 5KP1A 5EVHA 2GBXB 1UCIA 3FF0A 3U1WA 4K61A 4LEHA 4HAAA 2P09A 5IG3A 5RNTA 3G8ZA 1ASKA 3CCQ3 1BNEA 3MHEA 1GSPA 4J5GA 7GSPA 3SXXA 4JF8A 3KIIA 3TDGA 2M7OA 1I3FA 4BTWA 2RCDA 2XF3A 1V58A 3CC43 1RGFA 4LSOA 3CCJ3 3QK9A 4HZ9B 3SOAA 2P38A 1DMMA 2HMOB 1MWRA 2UGIA 3EBYA 3N8BA 4Q53A 3CCS3 1VQ43 2P0XA 1IV7A 1MGWA 1O7NB 1YHQ3 3AGNA 3G4S3 3JUNA 2C10A 5AEUB 3CNXA 3LTAA 1X1XA 5ELJA 1TFOA 1KSIA 3S27A 4NREA 5IEOA 5STDA 2GXFA 5DRVA 1WQLB 1EA2A 1LRAA 3NQYA 1Q824 1MWSA 1JBSA 1JB2A 3E99A 1RCLA 1VQ53 1RSNA 1CEWI 3FSDA 3NM2A 2CWTA 5HGRA 4EBGA 1E97A 3CMA3 1JN5A 1IT8A 3U97A 2AADA 3KE7A 1FA3A 3JVCA 3K9MC 1BRSA 1OHSA 4XBXA 4WHAA 1ZO2A 2W9PA 1KC84 3CXC2 1ZX2A 1FW7A 1SQWA 2IUKA 5AIFA 3ZFZA 5D82A 3F9SA 5EQLA 1DMQA 2YFJB 3HZPA 5D81A 3RGRA 1E3VA 1RN4A 2WO0A 2ZDJA 3F7SA 2KF6A 3ECFA 3F8XA 1W5ZA 2BNGA 1YVBI 3FG4A 1NB5I 1UCJA 2BIRA 4QWTA 1QAFA 5AEWB 1PU4A 1RGHA 3T0UA 3LXUX 3GWRA 3VF1A 2F5WA 2W2CA 1BRKA 2YX9A 2CK3H 2ML5A 6RNTA 1K8A4 1DYUA 2XSHB 1E3RA 1DVCA 3ER7A 2GEXA 4L7KA 4LZIA 4WFOA 3ROBA 2GBWB 1HYFA 1IQXA 2K54A 1B2SA 1O7GB 3ALAA 1W2B2 1BU4A 1EQKA 3BNEA 3CCL3 1JNQA 3G0KA 2GSPA 1VQ83 1SARA 1A67A 1LXEA 1LOYA 1IDPA 1JZDA 2ML6A 1IVVA 2XFTA 3MWZA 2CH9A 1LNHA 1DE3A 1W01A 5JBSA 1YJ93 1RCKA 5IG0A 4IIAA 6GSPA 1YIT3 1CH0A 1OF5A 2XGLA 1BRJA 1B27A 2INXA 1AVLA 4OK0A 1K9M4 2BO9B 1SIHA 1I0VA 3KSED 3FGYA 1AQZA 1M1XB 3LMLA 4WYKB 2E2UA 1FYSA 1PYLA 1W6YA 3EB8A 2KF5A 3F14A 2BMOB 2W9QA 3BB9A 4G1MB 1QMAA 1UI8A 1YGWA 1WMPA 4NHFA 4RNZA 5LC6A 1TRQA 1T2HA 1L5GB 1A90A 2W03A 4HM2B 3VGNA 1I2GA 1O7WB 4L8PA 1GYBA 2F4YA 2KRTA 5CK6A 4XM4A 1BRGA 4KFDA 5EEOA 1BNIA 3NXJA 3UL5A 4WWUC 3FF2A 4R80A 3SYUA 4FR9A 3L0RA 1B3SA 4XBYA 3EQQB 1YVSA 1O7PB 1X1UA 1MNLA 1ULJB 1K734 3GSPA 1T3BA 1QALA 2RSXA 3NM7A 2IYJA 2YFLB 1KD14 1N5PA 1FGTA 4ORLA 2O9UX 5CLKA 7RNTA 1N8QA 3OWUA 1GMPA 2YFIB 3DGYA 5TGNA 3X3XA 4I4KA 4BTXA 1JRQA 3F8HA 3MSOA 1IVWA 9RNTA 1IYYA 3FG3A 1BNSA 4X2HA 3WODG 2SARA 4CCVA 2W56B 1I8VA 3EN1B 5D83A 3NBBA 1GD4A 1V57A 4N6TA 1FUWA 3WA3A 5IENA 3M8CA 3CNMA 2CKFB 1GOYA 1NDOB 2E2VA 3A76A 3I0YA 2D1WA 2J8XB 1FUSA 5JPUA 1U8CB 2W56A 2E2TA 3UJMA 2XFSA 2K3DA 2IY2A 2Z7AA 2B24B 3LTBA 1B21A 3WOFB 1OHPA 1NNVA 2CG0A 4LGQA 2HMMB 1RNBA 1BSCA 4HZBB 3DH2A 3EBTA 3LT9A 3DM8A 1HKXA 2F98A 3S28A 2WGOA 4HM5B 2A15A 3DGOA 1B2XA 1RTUA 1KQS2 5AIHA 4CDLA 3EJVA 1NU3A 2L4VA 1TU5A 1Q864 4N6MA 1S5AA 5KP3A 4KT3B 1BRHA 4HOHA 1BOXA 4OUQA 1GY7A 4RBNA 1LOVA 1RGAA 2HMJB 3X40A 2QIYA 7STDA 3CCE3 3CCU3 1YGEA 2KAAA 2D42A 2XSOB 3PS8A 1ISKA 3KKGA 2H0IA 3KN4A 3EHCA 4WP5A 3MG2A 1LOXA 2STDA 3ZG5A 1NJI4 1OACA 1ZS7A 2XH9A 3GZXB 2MF7A 3LH4A 1HZ1A 5M18A 6STDA 4BU4A 1K41A 1W6CA 3WHOA 4N6NB 1S723 1BNGA 3DUKA 3NQZA 3V98A 4CJNA 1QVG2 1TUHA 1VQK3 3FH1A 3NBJA 2CWVA 1VQQA 4EC6A 3CME3 2PNCA 2BU4A 2OQEC 3VSYA 3OX9A 3D4AA
chains in the Genus database with same CATH topology
3A5EA 1I2FA 1DE3A 1BNRA 1RCKA 1RGKA 2BU4A 1I2EA 6GSPA 1CH0A 2RBIA 1B2ZA 1YNVX 1RNTA 1BRJA 1B27A 4BIRA 1I0VA 1LOWA 1AQZA 1BAOA 1G02A 1PY3A 1FYSA 1PYLA 3URPA 1RN1A 2KF5A 1B2MA 1FZUA 1YGWA 1RGGA 1TRQA 1RGEA 1T2HA 2KF4A 1I2GA 1R4YA 1RDSA 1BSDA 2F4YA 3D5IA 1UCIA 1BRGA 4HAAA 1BNIA 5HOHA 5RNTA 1BANA 4GHOA 3SYUA 1B3SA 1BNEA 1GSPA 4J5GA 7GSPA 1YVSA 4RNTA 1X1UA 2F56A 1I3FA 1JBRA 3GSPA 1RGFA 2F5MA 3D5GA 1GOUA 3HOHA 7RNTA 5GSPA 1GMPA 3DGYA 1B2UA 1BVIA 1LNIA 1TTOA 9RNTA 1RLSA 1IYYA 2HOHA 1BNSA 2SARA 1I8VA 1MGWA 1BSBA 3AGNA 1BSAA 1X1XA 1B20A 1BRIA 1GOYA 1GOVA 3AHSA 1BUJA 1C54A 1BGSA 3AGOA 1LRAA 1RGLA 1FUSA 1JBSA 1RCLA 1RSNA 2AAEA 5BU4A 2AADA 1TRPA 1BRSA 1B21A 1RHLA 1JBTA 1RNBA 3AHWA 1BSCA 1BSEA 1GMQA 3RNTA 1MGRA 3DH2A 1FW7A 5BIRA 1I70A 1B2XA 1RTUA 1BNJA 1ZGXA 1A2PA 2ZA4A 1X1WA 1FUTA 1RN4A 1BRHA 4HOHA 1BOXA 1BIRA 1DETA 1LOVA 1Q9EA 1RGAA 2KF6A 4GSPA 1UCLA 2C4BA 1BRNL 1UCJA 2BIRA 2KAAA 1GMRA 3BU4A 1T2IA 1RGHA 3KCHA 2F5WA 1BRKA 6RNTA 1HZ1A 4BU4A 3Q3FA 1UCKA 3WHOA 1RGCA 1HYFA 1BNFA 1BNGA 1AY7A 1B2SA 3BIRA 1X1YA 1I3IA 1BU4A 3WR2A 2KF3A 1RMSA 2GSPA 2RNTA 1SARA 8RNTA 1I0XA 1LOYA 4J5KA 3D4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A5E A;  1I2F A;  1DE3 A;  1BNR A;  1RCK A;  1RGK A;  2BU4 A;  1I2E A;  6GSP A;  1CH0 A;  2RBI A;  1B2Z A;  1YNV X;  1RNT A;  1BRJ A;  1B27 A;  4BIR A;  1I0V A;  1LOW A;  1AQZ A;  1BAO A;  1G02 A;  1PY3 A;  1FYS A;  1PYL A;  3URP A;  1RN1 A;  2KF5 A;  1B2M A;  1FZU A;  1YGW A;  1RGG A;  1TRQ A;  1RGE A;  1T2H A;  2KF4 A;  1I2G A;  1R4Y A;  1RDS A;  1BSD A;  2F4Y A;  3D5I A;  1UCI A;  1BRG A;  4HAA A;  1BNI A;  5HOH A;  5RNT A;  1BAN A;  4GHO A;  3SYU A;  1B3S A;  1BNE A;  1GSP A;  4J5G A;  7GSP A;  1YVS A;  4RNT A;  1X1U A;  2F56 A;  1I3F A;  1JBR A;  3GSP A;  1RGF A;  2F5M A;  3D5G A;  1GOU A;  3HOH A;  7RNT A;  5GSP A;  1GMP A;  3DGY A;  1B2U A;  1BVI A;  1LNI A;  1TTO A;  9RNT A;  1RLS A;  1IYY A;  2HOH A;  1BNS A;  2SAR A;  1I8V A;  1MGW A;  1BSB A;  3AGN A;  1BSA A;  1X1X A;  1B20 A;  1BRI A;  1GOY A;  1GOV A;  3AHS A;  1BUJ A;  1C54 A;  1BGS A;  3AGO A;  1LRA A;  1RGL A;  1FUS A;  1JBS A;  1RCL A;  1RSN A;  2AAE A;  5BU4 A;  2AAD A;  1TRP A;  1BRS A;  1B21 A;  1RHL A;  1JBT A;  1RNB A;  3AHW A;  1BSC A;  1BSE A;  1GMQ A;  3RNT A;  1MGR A;  3DH2 A;  1FW7 A;  5BIR A;  1I70 A;  1B2X A;  1RTU A;  1BNJ A;  1ZGX A;  1A2P A;  2ZA4 A;  1X1W A;  1FUT A;  1RN4 A;  1BRH A;  4HOH A;  1BOX A;  1BIR A;  1DET A;  1LOV A;  1Q9E A;  1RGA A;  2KF6 A;  4GSP A;  1UCL A;  2C4B A;  1BRN L;  1UCJ A;  2BIR A;  2KAA A;  1GMR A;  3BU4 A;  1T2I A;  1RGH A;  3KCH A;  2F5W A;  1BRK A;  6RNT A;  1HZ1 A;  4BU4 A;  3Q3F A;  1UCK A;  3WHO A;  1RGC A;  1HYF A;  1BNF A;  1BNG A;  1AY7 A;  1B2S A;  3BIR A;  1X1Y A;  1I3I A;  1BU4 A;  3WR2 A;  2KF3 A;  1RMS A;  2GSP A;  2RNT A;  1SAR A;  8RNT A;  1I0X A;  1LOY A;  4J5K A;  3D4A A; 
#chains in the Genus database with same CATH topology
 3KSP A;  3A5E A;  4NPB A;  2W04 A;  3K7C A;  3J7Y d;  1WMN A;  2H0G A;  3GZY B;  1BNR A;  3X41 A;  3HK4 A;  1W2Z A;  3IJE B;  1OHO A;  1W00 A;  1OGZ A;  1RRH A;  2GU1 A;  3I56 3;  1TP6 A;  5IEP A;  1YNV X;  1RNT A;  4HM7 B;  4HJL B;  4R9K A;  1LOW A;  1GY5 A;  1W6G A;  5M19 A;  1BAO A;  4AKZ A;  1O7M B;  2HMN B;  2Z6B A;  1A2K A;  2CHC A;  4LYL B;  5BXQ A;  1Y4K A;  3DZL A;  1AR0 A;  1B2M A;  3CCR 3;  3DGN A;  5IER A;  2FGT A;  4XBT A;  3SLU A;  5CF2 A;  3X42 A;  2CIU A;  1Q7H A;  3KZT A;  1RGG A;  2JDI H;  5AII A;  5G2G A;  1RDS A;  1F8N A;  3STD A;  5KP4 A;  2XEP A;  1UUV B;  1MWT A;  3GAX A;  5LC7 A;  5HOH A;  1EKM A;  3K0Z A;  3NV0 B;  1OUN A;  1QJG A;  1A2V A;  4GHO A;  2CFG A;  3BND A;  4O3V A;  1VQO 3;  3B7C A;  4JRF A;  4R4K A;  4XDV A;  2C11 A;  3H51 A;  1CYV A;  1UUW B;  4FMB A;  2RGQ A;  4OVM A;  1IT7 A;  4RNT A;  4HVN A;  1W02 A;  2F56 A;  1V74 A;  2CWU A;  5IG5 A;  3OXA A;  4O02 B;  1QAK A;  4R1K A;  2IA7 A;  3Q2P A;  4XB5 A;  2F5M A;  3HOH A;  4HM4 B;  3NV0 A;  3LT8 A;  5GSP A;  3PZW A;  5IG4 A;  1VQ6 3;  1B2U A;  3CU3 A;  1FGM A;  1BVI A;  1UI7 A;  1LQM B;  1UUG B;  3ZG0 A;  3CPW 2;  3UL6 A;  1JZO A;  1YI2 3;  1OGX A;  1JKG B;  3DY5 A;  2IUJ A;  2XRX B;  1WTH A;  1IU7 A;  4DKI A;  1D6Y A;  3WDG B;  2CG1 A;  3LTC A;  3X3Y A;  1BSA A;  1GS3 A;  1VQL 3;  3IMA B;  2JQ5 A;  4WYK A;  2BT3 A;  1BRI A;  3MPH A;  3FLJ A;  3T8U A;  3BLZ A;  1GOV A;  3D79 A;  3BNB A;  1BGS A;  2GEY A;  3WMD A;  3WA2 X;  1M9G A;  2AAE A;  2HMK B;  1J2B A;  4AEQ A;  5BU4 A;  1SJW A;  1UW1 A;  2Y73 A;  2LYX A;  1JBT A;  1VQN 3;  2O3O A;  1BSE A;  4HYZ A;  1GMQ A;  2ZHX B;  3RNT A;  4PEJ A;  4HM1 B;  4HBR A;  5BIR A;  2OTL 3;  4EYC A;  1G96 A;  2UX0 A;  4RZM A;  1ZGX A;  2H0H A;  2IMJ A;  3B4O A;  3D9R A;  1ROA A;  5FW5 A;  5CXO A;  1JV2 B;  1OPY A;  4ILF A;  3WOE B;  3RGA A;  3CC2 3;  1BIR A;  3JUM A;  1Q9E A;  1GY6 A;  1UDI I;  3X3Z A;  4GSP A;  3S67 A;  3FKA A;  1UCL A;  2C4B A;  3RDE A;  3OW2 2;  1GMR A;  1T2I A;  4RNY A;  8CHO A;  3FCS B;  3EC9 A;  4HM0 B;  3LZA A;  1RKY A;  3DGM A;  1VQM 3;  1WMO A;  2OQE A;  3Q3F A;  1UCK A;  3OWS A;  1CQS A;  1NB3 I;  2HML B;  4X2O A;  5FGO A;  4STD A;  1BNF A;  2LQV A;  3BIR A;  1G0T A;  2BHM A;  4KFF A;  1HU9 A;  1X1Y A;  2V1L A;  4IT7 A;  1I3I A;  1TJD A;  2F99 A;  1YIJ 3;  3MG1 A;  1VZZ A;  3HX8 A;  3AMO B;  3NX0 A;  2KF3 A;  1RMS A;  2OOV C;  2RNT A;  2GU3 A;  1IVX A;  1MOL A;  1I0X A;  1EUI C;  2Y74 A;  1IQ8 A;  1M1K 4;  4FCM A;  1RJO A;  2F86 B;  4HM3 B;  4U13 A;  3CPO A;  1I2F A;  2P05 A;  3GZB A;  2QEX 3;  2RBI A;  1PFP A;  1NWW A;  3AMO A;  3PXM A;  3KFQ C;  3V92 A;  3B8L A;  4CPK A;  2W0Q A;  3G6E 3;  4BTY A;  3K5T A;  5AYR B;  1JJ2 2;  3EN8 A;  3DXO A;  3NUV A;  4HM6 B;  2R4I A;  3QRD A;  1Q42 A;  4R9L A;  4TX4 A;  1ROV A;  2RFR A;  1AV4 A;  1JB5 A;  3H3H A;  1AVK A;  5AIG A;  1RGE A;  2WOH A;  3NBR A;  3UB1 A;  1JN5 B;  1FGO A;  1STD A;  1SPU A;  2WGQ A;  3LOY A;  2CFW A;  2XR8 B;  2Z76 A;  4HKV B;  3T8N A;  2K0M A;  1LQG C;  1BAN A;  1D6Z A;  4KFE A;  4GB5 A;  5AYS C;  3CCV 3;  4EXR A;  2P0M A;  4N6U A;  2SBL A;  3N54 B;  4N3V A;  4EV5 A;  3FZW A;  3G71 3;  1BUQ A;  3S29 A;  4BL3 A;  3OV4 A;  4H3U A;  4XDW A;  1JBR A;  3CCM 3;  3V99 A;  2QGU A;  2CC3 A;  3D5G A;  1GOU A;  1N8R 4;  2OTJ 3;  1D6U A;  4KVH A;  5BVB A;  4IPB A;  2Q07 A;  1SII A;  3DMC A;  1VQP 3;  1US1 A;  4MJD A;  2R41 A;  1LNI A;  4MMZ B;  4N6V 0;  1TTO A;  5IW9 A;  3MG3 A;  1VQ9 3;  1RLS A;  3CD6 3;  2HOH A;  1Q81 4;  2W6J H;  1BSB A;  1EEJ A;  1C7H A;  3NHX A;  5CF1 A;  4N6O B;  1STF I;  1Z1S A;  1IQY A;  4GL6 A;  1M90 4;  2CW9 A;  1B20 A;  4H61 A;  3EF8 A;  1TFK A;  2FNQ A;  3AHS A;  4FCZ A;  3SED A;  1BUJ A;  1UGI A;  3AGO A;  5G1K A;  1RGL A;  1C54 A;  3EE1 A;  3JUP A;  3O8Y A;  3SOY A;  1T5Y A;  2CX1 A;  4L8O A;  4I5Q A;  1TRP A;  4FCJ A;  1RHL A;  2CFD A;  3HIG A;  1YJN 3;  5A0O B;  3AHW A;  1TIJ A;  3DGL A;  3MKI A;  4FMA A;  1MGR A;  1NO3 A;  1YJW 3;  3PCR A;  1I70 A;  4AKY A;  2KXG A;  3Q1C A;  4K90 B;  5DRE A;  1OF5 B;  2L1S A;  3JUQ A;  1VQ7 3;  1BNJ A;  2ZL8 A;  3EX9 A;  1Q7Y 4;  2FXT A;  3B4P A;  4J8T A;  4FMD A;  4MMX B;  1A2P A;  1ULI B;  3GZR A;  2ZA4 A;  1X1W A;  5I97 A;  3F40 A;  3IPT A;  1FUT A;  1DMN A;  3F7X A;  3PCS A;  1IVU A;  1N5H A;  2KCD A;  3MYT A;  1LVN A;  1DET A;  3PGB A;  3PYJ A;  4K1U A;  4MEI A;  4HM8 B;  2BMR B;  1BRN L;  3BU4 A;  1Q40 B;  1WNH A;  2WOF A;  3D3L A;  3KCH A;  2OWP A;  1MWU A;  5AI1 A;  5G1L A;  1JKG A;  1EG9 B;  1FGR A;  1OH0 A;  1N9E A;  4EV2 A;  2QA4 3;  1QVF 2;  1W4N A;  2OOV A;  2I9W A;  4O2H A;  1K28 A;  4N6L A;  2CFK A;  5ELU A;  1IV9 A;  3LTD A;  1RGC A;  1KWI A;  3Q90 A;  1U5O A;  1AY7 A;  3LYG A;  3S5C A;  5JPP A;  1IK3 A;  1Q40 A;  2Z77 A;  4ZM8 A;  1O7H B;  3WR2 A;  2OCT A;  2BMQ B;  1FGQ A;  4LMI A;  8RNT A;  4EW5 A;  4J5K A;  3HI7 A;  3I55 3;  1CYU A;  2MC8 A;  1DVD A;  5M1A A;  3UNL A;  2CFL A;  4K1V A;  1RGK A;  3SVA A;  1I2E A;  1W7C A;  3BNC A;  1B2Z A;  3FG1 A;  2UUG C;  3GRD A;  5IF6 A;  4BIR A;  4MMY B;  2XGN A;  4BL2 A;  3G16 A;  3SX1 A;  1G02 A;  1PY3 A;  2CX0 A;  3URP A;  1R4C A;  1RN1 A;  4FMC A;  3N9H A;  3OWY A;  4KZ1 A;  2PZV A;  3HII A;  3CC7 3;  1UGH I;  1FZU A;  4J9A A;  1GD3 A;  1JB4 A;  2B1X B;  1RN7 A;  1N9J A;  3JUO A;  1RRL A;  2KF4 A;  3K63 A;  1OCV A;  1R4Y A;  1BSD A;  4O8S A;  3D5I A;  5KP1 A;  5EVH A;  2GBX B;  1UCI A;  3FF0 A;  3U1W A;  4K61 A;  4LEH A;  4HAA A;  2P09 A;  5IG3 A;  5RNT A;  3G8Z A;  1ASK A;  3CCQ 3;  1BNE A;  3MHE A;  1GSP A;  4J5G A;  7GSP A;  3SXX A;  4JF8 A;  3KII A;  3TDG A;  2M7O A;  1I3F A;  4BTW A;  2RCD A;  2XF3 A;  1V58 A;  3CC4 3;  1RGF A;  4LSO A;  3CCJ 3;  3QK9 A;  4HZ9 B;  3SOA A;  2P38 A;  1DMM A;  2HMO B;  1MWR A;  2UGI A;  3EBY A;  3N8B A;  4Q53 A;  3CCS 3;  1VQ4 3;  2P0X A;  1IV7 A;  1MGW A;  1O7N B;  1YHQ 3;  3AGN A;  3G4S 3;  3JUN A;  2C10 A;  5AEU B;  3CNX A;  3LTA A;  1X1X A;  5ELJ A;  1TFO A;  1KSI A;  3S27 A;  4NRE A;  5IEO A;  5STD A;  2GXF A;  5DRV A;  1WQL B;  1EA2 A;  1LRA A;  3NQY A;  1Q82 4;  1MWS A;  1JBS A;  1JB2 A;  3E99 A;  1RCL A;  1VQ5 3;  1RSN A;  1CEW I;  3FSD A;  3NM2 A;  2CWT A;  5HGR A;  4EBG A;  1E97 A;  3CMA 3;  1JN5 A;  1IT8 A;  3U97 A;  2AAD A;  3KE7 A;  1FA3 A;  3JVC A;  3K9M C;  1BRS A;  1OHS A;  4XBX A;  4WHA A;  1ZO2 A;  2W9P A;  1KC8 4;  3CXC 2;  1ZX2 A;  1FW7 A;  1SQW A;  2IUK A;  5AIF A;  3ZFZ A;  5D82 A;  3F9S A;  5EQL A;  1DMQ A;  2YFJ B;  3HZP A;  5D81 A;  3RGR A;  1E3V A;  1RN4 A;  2WO0 A;  2ZDJ A;  3F7S A;  2KF6 A;  3ECF A;  3F8X A;  1W5Z A;  2BNG A;  1YVB I;  3FG4 A;  1NB5 I;  1UCJ A;  2BIR A;  4QWT A;  1QAF A;  5AEW B;  1PU4 A;  1RGH A;  3T0U A;  3LXU X;  3GWR A;  3VF1 A;  2F5W A;  2W2C A;  1BRK A;  2YX9 A;  2CK3 H;  2ML5 A;  6RNT A;  1K8A 4;  1DYU A;  2XSH B;  1E3R A;  1DVC A;  3ER7 A;  2GEX A;  4L7K A;  4LZI A;  4WFO A;  3ROB A;  2GBW B;  1HYF A;  1IQX A;  2K54 A;  1B2S A;  1O7G B;  3ALA A;  1W2B 2;  1BU4 A;  1EQK A;  3BNE A;  3CCL 3;  1JNQ A;  3G0K A;  2GSP A;  1VQ8 3;  1SAR A;  1A67 A;  1LXE A;  1LOY A;  1IDP A;  1JZD A;  2ML6 A;  1IVV A;  2XFT A;  3MWZ A;  2CH9 A;  1LNH A;  1DE3 A;  1W01 A;  5JBS A;  1YJ9 3;  1RCK A;  5IG0 A;  4IIA A;  6GSP A;  1YIT 3;  1CH0 A;  1OF5 A;  2XGL A;  1BRJ A;  1B27 A;  2INX A;  1AVL A;  4OK0 A;  1K9M 4;  2BO9 B;  1SIH A;  1I0V A;  3KSE D;  3FGY A;  1AQZ A;  1M1X B;  3LML A;  4WYK B;  2E2U A;  1FYS A;  1PYL A;  1W6Y A;  3EB8 A;  2KF5 A;  3F14 A;  2BMO B;  2W9Q A;  3BB9 A;  4G1M B;  1QMA A;  1UI8 A;  1YGW A;  1WMP A;  4NHF A;  4RNZ A;  5LC6 A;  1TRQ A;  1T2H A;  1L5G B;  1A90 A;  2W03 A;  4HM2 B;  3VGN A;  1I2G A;  1O7W B;  4L8P A;  1GYB A;  2F4Y A;  2KRT A;  5CK6 A;  4XM4 A;  1BRG A;  4KFD A;  5EEO A;  1BNI A;  3NXJ A;  3UL5 A;  4WWU C;  3FF2 A;  4R80 A;  3SYU A;  4FR9 A;  3L0R A;  1B3S A;  4XBY A;  3EQQ B;  1YVS A;  1O7P B;  1X1U A;  1MNL A;  1ULJ B;  1K73 4;  3GSP A;  1T3B A;  1QAL A;  2RSX A;  3NM7 A;  2IYJ A;  2YFL B;  1KD1 4;  1N5P A;  1FGT A;  4ORL A;  2O9U X;  5CLK A;  7RNT A;  1N8Q A;  3OWU A;  1GMP A;  2YFI B;  3DGY A;  5TGN A;  3X3X A;  4I4K A;  4BTX A;  1JRQ A;  3F8H A;  3MSO A;  1IVW A;  9RNT A;  1IYY A;  3FG3 A;  1BNS A;  4X2H A;  3WOD G;  2SAR A;  4CCV A;  2W56 B;  1I8V A;  3EN1 B;  5D83 A;  3NBB A;  1GD4 A;  1V57 A;  4N6T A;  1FUW A;  3WA3 A;  5IEN A;  3M8C A;  3CNM A;  2CKF B;  1GOY A;  1NDO B;  2E2V A;  3A76 A;  3I0Y A;  2D1W A;  2J8X B;  1FUS A;  5JPU A;  1U8C B;  2W56 A;  2E2T A;  3UJM A;  2XFS A;  2K3D A;  2IY2 A;  2Z7A A;  2B24 B;  3LTB A;  1B21 A;  3WOF B;  1OHP A;  1NNV A;  2CG0 A;  4LGQ A;  2HMM B;  1RNB A;  1BSC A;  4HZB B;  3DH2 A;  3EBT A;  3LT9 A;  3DM8 A;  1HKX A;  2F98 A;  3S28 A;  2WGO A;  4HM5 B;  2A15 A;  3DGO A;  1B2X A;  1RTU A;  1KQS 2;  5AIH A;  4CDL A;  3EJV A;  1NU3 A;  2L4V A;  1TU5 A;  1Q86 4;  4N6M A;  1S5A A;  5KP3 A;  4KT3 B;  1BRH A;  4HOH A;  1BOX A;  4OUQ A;  1GY7 A;  4RBN A;  1LOV A;  1RGA A;  2HMJ B;  3X40 A;  2QIY A;  7STD A;  3CCE 3;  3CCU 3;  1YGE A;  2KAA A;  2D42 A;  2XSO B;  3PS8 A;  1ISK A;  3KKG A;  2H0I A;  3KN4 A;  3EHC A;  4WP5 A;  3MG2 A;  1LOX A;  2STD A;  3ZG5 A;  1NJI 4;  1OAC A;  1ZS7 A;  2XH9 A;  3GZX B;  2MF7 A;  3LH4 A;  1HZ1 A;  5M18 A;  6STD A;  4BU4 A;  1K41 A;  1W6C A;  3WHO A;  4N6N B;  1S72 3;  1BNG A;  3DUK A;  3NQZ A;  3V98 A;  4CJN A;  1QVG 2;  1TUH A;  1VQK 3;  3FH1 A;  3NBJ A;  2CWV A;  1VQQ A;  4EC6 A;  3CME 3;  2PNC A;  2BU4 A;  2OQE C;  3VSY A;  3OX9 A;  3D4A A; 
#chains in the Genus database with same CATH homology
 3A5E A;  1I2F A;  1DE3 A;  1BNR A;  1RCK A;  1RGK A;  2BU4 A;  1I2E A;  6GSP A;  1CH0 A;  2RBI A;  1B2Z A;  1YNV X;  1RNT A;  1BRJ A;  1B27 A;  4BIR A;  1I0V A;  1LOW A;  1AQZ A;  1BAO A;  1G02 A;  1PY3 A;  1FYS A;  1PYL A;  3URP A;  1RN1 A;  2KF5 A;  1B2M A;  1FZU A;  1YGW A;  1RGG A;  1TRQ A;  1RGE A;  1T2H A;  2KF4 A;  1I2G A;  1R4Y A;  1RDS A;  1BSD A;  2F4Y A;  3D5I A;  1UCI A;  1BRG A;  4HAA A;  1BNI A;  5HOH A;  5RNT A;  1BAN A;  4GHO A;  3SYU A;  1B3S A;  1BNE A;  1GSP A;  4J5G A;  7GSP A;  1YVS A;  4RNT A;  1X1U A;  2F56 A;  1I3F A;  1JBR A;  3GSP A;  1RGF A;  2F5M A;  3D5G A;  1GOU A;  3HOH A;  7RNT A;  5GSP A;  1GMP A;  3DGY A;  1B2U A;  1BVI A;  1LNI A;  1TTO A;  9RNT A;  1RLS A;  1IYY A;  2HOH A;  1BNS A;  2SAR A;  1I8V A;  1MGW A;  1BSB A;  3AGN A;  1BSA A;  1X1X A;  1B20 A;  1BRI A;  1GOY A;  1GOV A;  3AHS A;  1BUJ A;  1C54 A;  1BGS A;  3AGO A;  1LRA A;  1RGL A;  1FUS A;  1JBS A;  1RCL A;  1RSN A;  2AAE A;  5BU4 A;  2AAD A;  1TRP A;  1BRS A;  1B21 A;  1RHL A;  1JBT A;  1RNB A;  3AHW A;  1BSC A;  1BSE A;  1GMQ A;  3RNT A;  1MGR A;  3DH2 A;  1FW7 A;  5BIR A;  1I70 A;  1B2X A;  1RTU A;  1BNJ A;  1ZGX A;  1A2P A;  2ZA4 A;  1X1W A;  1FUT A;  1RN4 A;  1BRH A;  4HOH A;  1BOX A;  1BIR A;  1DET A;  1LOV A;  1Q9E A;  1RGA A;  2KF6 A;  4GSP A;  1UCL A;  2C4B A;  1BRN L;  1UCJ A;  2BIR A;  2KAA A;  1GMR A;  3BU4 A;  1T2I A;  1RGH A;  3KCH A;  2F5W A;  1BRK A;  6RNT A;  1HZ1 A;  4BU4 A;  3Q3F A;  1UCK A;  3WHO A;  1RGC A;  1HYF A;  1BNF A;  1BNG A;  1AY7 A;  1B2S A;  3BIR A;  1X1Y A;  1I3I A;  1BU4 A;  3WR2 A;  2KF3 A;  1RMS A;  2GSP A;  2RNT A;  1SAR A;  8RNT A;  1I0X A;  1LOY A;  4J5K A;  3D4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...