2HOHA

Ribonuclease t1 (n9a mutant) complexed with 2'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSACYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Dissection of the structural and functional role of a conserved hydration site in RNase T1.
pubmed rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 25
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2hohA00
1GOVA 1BOXA 1BRGA 1BSEA 1RLSA 1R4YA 2BIRA 1B2MA 1B2XA 1B2SA 1X1YA 4RNTA 1X1XA 3AGNA 1I0VA 1BRSA 1LNIA 1UCIA 1JBTA 1DE3A 1BNGA 1PY3A 2SARA 1GOUA 1I2GA 9RNTA 1MGRA 1BNEA 1FUTA 1LOVA 1LRAA 4GHOA 3RNTA 1I3FA 1C54A 3AGOA 1RGCA 1BGSA 3WHOA 1RMSA 2RBIA 1BRIA 1GMQA 1MGWA 1BUJA 2HOHA 3D5GA 1B21A 1B3SA 5HOHA 1YVSA 2AAEA 2F56A 1X1WA 1RNBA 1TRQA 1RGGA 1BNSA 1FYSA 1SARA 3SYUA 1JBSA 1RNTA 2ZA4A 1RGEA 3KCHA 1JBRA 1I8VA 3DH2A 4BU4A 1ZGXA 2AADA 3D4AA 3GSPA 3HOHA 2F5MA 1B20A 1AY7A 1BRJA 5GSPA 1TTOA 1I3IA 1GOYA 3BU4A 7RNTA 1BANA 1DETA 1Q9EA 1TRPA 1BAOA 1GMPA 1BVIA 5BU4A 1BRKA 2GSPA 1B2ZA 3D5IA 1GSPA 1BU4A 6RNTA 1T2IA 4J5GA 1BRHA 2F4YA 3Q3FA 1LOWA 1BSAA 1BSDA 1RN4A 2KF6A 2BU4A 5RNTA 1RN1A 1BNIA 1BNJA 1LOYA 3A5EA 2KF4A 1G02A 4HAAA 4BIRA 1HYFA 1X1UA 1RDSA 1T2HA 1I70A 4HOHA 1YNVX 3DGYA 2KF5A 2KF3A 1BNRA 1UCLA 1PYLA 3AHWA 1A2PA 1I2FA 1AQZA 1I2EA 1RTUA 3URPA 5BIRA 2F5WA 6GSPA 1B27A 1RGKA 1BNFA 1RGHA 4GSPA 1RHLA 1HZ1A 1FUSA 1RSNA 1BIRA 2C4BA 1IYYA 1BSBA 2RNTA 1RGAA 1RCLA 1I0XA 4J5KA 3BIRA 3AHSA 1RGLA 1UCJA 1YGWA 1BRNL 1FW7A 1GMRA 1RGFA 1BSCA 8RNTA 1B2UA 3WR2A 1UCKA 2KAAA 7GSPA 1FZUA 1RCKA 1CH0A
chains in the Genus database with same CATH superfamily
1GOVA 5KP4A 3FH1A 5IW9A 4N6OB 1BOXA 1BRGA 1N8R4 1RLSA 1JKGA 1R4YA 1W01A 1OH0A 3WDGB 3LMLA 3MYTA 1VQ73 1STFI 3NQYA 1BRSA 1LNIA 2P38A 3G713 1K28A 1PY3A 2IYJA 1I2GA 1BNEA 1FUTA 1JV2B 3CPOA 3EJVA 2Z76A 5M18A 2XGLA 2OWPA 3RNTA 3AGOA 5KP1A 1PFPA 1WQLB 3GZXB 3MG1A 3NV0B 3OX9A 4N6UA 3WHOA 3ZG0A 3V92A 1KSIA 1LOXA 1Q42A 3EHCA 2HMLB 4HYZA 4XB5A 5D83A 3K63A 2H0HA 3EF8A 1EUIC 2HOHA 5AYRB 1Q7Y4 1YIT3 3DXOA 1EA2A 1DMQA 5CK6A 3J7Yd 2IUKA 3FKAA 1N9JA 4N6V0 4WYKA 4BTXA 4N6NB 1D6YA 3NM7A 1BUQA 1RNBA 1E3VA 5AIFA 1O7HB 4BL2A 4LYLB 1M1XB 1NJI4 1J2BA 3X3YA 2D1WA 3LTDA 3LH4A 3LT8A 2H0GA 3K5TA 1S5AA 2W9QA 2Q07A 1O7PB 3KSED 1BNSA 5DREA 1ISKA 1RRHA 1OPYA 1RNTA 1LVNA 3KN4A 1WTHA 5AEUB 3PYJA 3BNCA 1IVXA 1JRQA 3PXMA 4FMAA 4X2HA 3FG3A 3Q2PA 5G1KA 3DGMA 4CPKA 1JKGB 1I8VA 2XF3A 4G1MB 4HJLB 2Y73A 4LZIA 4LMIA 3UL5A 4KZ1A 3EN8A 1D6ZA 1OGXA 1C7HA 3EN1B 5M1AA 2Y74A 3CNXA 4NPBA 1IK3A 1W2ZA 3MHEA 3FSDA 2CK3H 4AEQA 1W5ZA 2SBLA 1UGHI 2YFJB 1DETA 1Q9EA 1RN7A 2CFGA 1TRPA 2RFRA 1GMPA 3L0RA 4BL3A 1BVIA 1FGOA 1Q814 1IVVA 3SOAA 2P05A 4HM4B 2C11A 4RBNA 3EE1A 3G0KA 3CC23 1Q824 1IQ8A 4FR9A 2XEPA 4R80A 1RN4A 1BSDA 2CFKA 2BU4A 5RNTA 3ZFZA 2CC3A 1UDII 3DGOA 4FMCA 1LOYA 2W56A 2KF4A 4FCMA 2ML5A 1JB4A 1JN5A 1G0TA 1QAFA 3HIIA 4HM0B 1M9GA 4EC6A 1K734 1RDSA 2YFIB 1WNHA 1CYVA 3DGYA 3CC43 1N5PA 2RCDA 3UB1A 5EVHA 1A2PA 2CX1A 4PEJA 3URPA 5BIRA 1UUGB 3GZBA 4L8OA 1GY6A 1HZ1A 4N3VA 3RDEA 4NHFA 1IYYA 2L4VA 2RNTA 3CMA3 2XR8B 3N54B 1RCLA 5BVBA 1UI7A 3LT9A 4J5KA 3I553 3AHSA 1IV7A 1AR0A 3PGBA 2K0MA 2W0QA 3LTAA 1YGWA 1SPUA 1K41A 1N8QA 2GU1A 1K9M4 3CNMA 4XBTA 3CCR3 5AEWB 1RKYA 1W7CA 1IVWA 3E99A 1A2KA 3UJMA 1VQ43 2IA7A 3A76A 1CH0A 1QAKA 2WOHA 4ZM8A 1NU3A 4KFEA 2W6JH 1OHPA 2E2TA 3B4OA 2PZVA 1B2XA 2JDIH 4R4KA 1B2SA 1FA3A 1X1YA 4N6MA 4RNTA 5IEOA 1WMPA 4HM6B 3K9MC 1I0VA 1JN5B 1STDA 2P0XA 2H0IA 1GOUA 3B7CA 1NDOB 5LC7A 1LOVA 3S5CA 1O7GB 3DGNA 1RGCA 1NB3I 1YJW3 3GAXA 1FGTA 3CU3A 1BRIA 1OF5A 5AYSC 1GMQA 1OHSA 1MGWA 4L7KA 1BUJA 3NBRA 3PS8A 4MMYB 1JZOA 2W04A 3F7XA 3MKIA 1B21A 1UUWB 2XFTA 2XH9A 3D3LA 4KFDA 5HOHA 2CWTA 2AAEA 1CQSA 5G2GA 3JUPA 1W02A 2CH9A 2F56A 2QGUA 1YGEA 3O8YA 2R4IA 3CCE3 3F8XA 2IY2A 3X3ZA 1IV9A 5CLKA 1TRQA 2KRTA 1UI8A 3NX0A 1QALA 1KQS2 1IU7A 1U5OA 2XSHB 4WFOA 5IG0A 3SEDA 3STDA 1U8CB 2ZA4A 2K54A 5HGRA 3V99A 2XGNA 3X40A 2UGIA 3BB9A 3KCHA 4DKIA 3T0UA 2F99A 1IQYA 3DH2A 2STDA 2BMRB 2R41A 4MMZB 3WOFB 4Q53A 1OCVA 3U1WA 4BU4A 1GY7A 3BNEA 3WOEB 3GSPA 4HVNA 4JF8A 1S723 2HMJB 3NXJA 1BRJA 3K7CA 4EW5A 2IMJA 2LQVA 3MG2A 5FW5A 3FGYA 3OWYA 3EC9A 4FCZA 1E97A 4FMBA 4JRFA 3X42A 1VQM3 1YJ93 1AVLA 3ROBA 5BU4A 1OF5B 2GEXA 5G1LA 1B2ZA 6RNTA 3F9SA 1W00A 1T2IA 2BMOB 4L8PA 1BRHA 3FLJA 2F4YA 1LOWA 2O3OA 3OXAA 1EQKA 2Z6BA 1RN1A 1VQK3 1BNIA 1ROAA 3NBBA 3KIIA 5FGOA 5IG4A 3S28A 3DZLA 4O2HA 3NHXA 4RNYA 4CCVA 3JUNA 2HMKB 1QVG2 1TFKA 2HMOB 3SXXA 1YI23 5AI1A 3CCU3 3CD63 3CCQ3 2KF3A 4J8TA 5LC6A 1UCLA 3X41A 1I2FA 1I2EA 1A90A 1FGQA 6GSPA 1RGKA 1BNFA 2CFWA 3KSPA 4GSPA 4STDA 1IT8A 2YFLB 1NWWA 2QA43 1M1K4 3PCSA 1BIRA 2C4BA 3NBJA 3GZRA 3KKGA 2B24B 4OUQA 1JJ22 2BT3A 2CG0A 1ASKA 1Q40A 5CXOA 3ALAA 5ELUA 3ZG5A 4H61A 1JB2A 2I9WA 1MWSA 4HZBB 3VF1A 1G96A 4HM1B 1O7NB 1RGLA 1UCJA 5CF1A 4K1VA 5STDA 3IJEB 4HKVB 3I0YA 3OV4A 1QMAA 1B2UA 2OOVA 1UCKA 3HX8A 2GXFA 1OGZA 1FZUA 3FCSB 3LOYA 4AKYA 1YIJ3 3DY5A 1BNRA 5IENA 1W4NA 2KXGA 3JVCA 3CXC2 4WHAA 1DMNA 1BSEA 4O02B 2XRXB 2D42A 1B2MA 3D9RA 4LSOA 1US1A 4WWUC 3T8UA 2GBWB 7STDA 2B1XB 1AVKA 1YHQ3 3S27A 1OUNA 4BTWA 4K90B 1JBTA 1VQO3 1BNGA 4R9KA 4RNZA 1NO3A 1D6UA 4GHOA 1VQ83 1ZO2A 1BGSA 2WGOA 4HM8B 4U13A 5D81A 2L1SA 4HM3B 5M19A 1TJDA 1LQGC 2RBIA 4IIAA 1A2VA 3HIGA 3DM8A 1Q864 4R9LA 3D5GA 3RGAA 1O7MB 3D79A 3DGLA 1VZZA 1YVSA 3VGNA 3CCV3 2WO0A 3I563 1Q40B 2IUJA 3ER7A 1X1WA 3F14A 3SX1A 1NB5I 4K1UA 4CJNA 1HU9A 2RSXA 2Z77A 1PU4A 3UL6A 3SLUA 1QVF2 3G8ZA 3NUVA 1W6GA 1MWTA 1SARA 1TIJA 3SYUA 1KD14 1VQ63 2CHCA 3G4S3 3IPTA 3EQQB 4HM5B 3FG1A 3NM2A 3AMOA 1SJWA 2OQEA 4KT3B 2P09A 2M7OA 3BLZA 3B4PA 4XM4A 2Z7AA 3LTBA 1ZGXA 3MSOA 3CCM3 1YVBI 2CFDA 1GS3A 5GSPA 5IG5A 5JBSA 1I3IA 3WODG 1GOYA 3SOYA 4X2OA 1BANA 3FG4A 1UGIA 3FZWA 3S67A 3KFQC 5EEOA 1BRKA 2KCDA 3D5IA 1SQWA 1TUHA 1BU4A 3EBYA 3GRDA 2INXA 4J5GA 4BTYA 1KWIA 4HBRA 3JUMA 1BSAA 3EB8A 4I5QA 4LEHA 4CDLA 3H51A 1GD4A 3A5EA 1W6YA 2JQ5A 3QK9A 3HI7A 1HYFA 1Q7HA 3ECFA 1L5GB 3CCS3 3B8LA 4H3UA 1T2HA 5JPUA 3OW22 4ORLA 1TP6A 2BHMA 1AV4A 2BO9B 4HOHA 1YNVX 1FGMA 1A67A 2KF5A 4HZ9B 4EBGA 2XSOB 3F7SA 1ZS7A 5AIGA 1PYLA 4XDVA 1R4CA 3H3HA 1AQZA 1ROVA 1RTUA 1VQN3 2F5WA 5IEPA 1B27A 4N6TA 4WP5A 5ELJA 1IVUA 1RGHA 1DYUA 1MWUA 3FF2A 1RHLA 3AMOB 3CPW2 2HMNB 1RSNA 2E2VA 4EYCA 3PCRA 4IT7A 4RZMA 1IT7A 5JPPA 1I0XA 3KZTA 3G16A 1Y4KA 1GY5A 3BIRA 2BNGA 3DMCA 5BXQA 1OACA 2CIUA 2ZHXB 5AIIA 4MMXB 4K61A 2PNCA 3DUKA 1RGFA 2MF7A 3WA3A 1BSCA 3MG3A 1N5HA 4HM2B 2LYXA 3WR2A 8RNTA 1MWRA 7GSPA 2FNQA 4XBXA 2ZDJA 1SIIA 5IG3A 1LXEA 3MWZA 1O7WB 1ZX2A 1M904 2GBXB 2ML6A 2BIRA 3HK4A 4I4KA 2P0MA 1UUVB 1X1XA 2CKFB 2OCTA 3AGNA 4AKZA 3JUQA 2QIYA 3UNLA 1UCIA 1DE3A 5TGNA 2SARA 1K8A4 3EX9A 1VQ93 9RNTA 1MGRA 1EKMA 1GD3A 1LRAA 1C54A 1I3FA 2W9PA 1VQP3 1KC84 1NNVA 1RMSA 3N9HA 3CCJ3 3GZYB 3OWUA 2GEYA 4N6LA 4QWTA 5KP3A 6STDA 1DVDA 1TU5A 3OWSA 1JZDA 4O3VA 1B3SA 3FF0A 3T8NA 1WMNA 1CEWI 3LZAA 1RRLA 2HMMB 2CG1A 4O8SA 3LXUX 1HKXA 1TFOA 1IQXA 2WGQA 2RGQA 5D82A 2V1LA 4EV5A 4FMDA 1RGGA 3PZWA 1FYSA 2QEX3 5IERA 1JBSA 1VQQA 4XBYA 3CC73 3GWRA 2O9UX 4WYKB 2OTJ3 3G6E3 3EBTA 1E3RA 4KFFA 1RGEA 2MC8A 1EG9B 1EEJA 1T3BA 3CME3 3HZPA 2OOVC 3U97A 1JBRA 4NREA 2OTL3 3KE7A 1V58A 3LTCA 4MJDA 3X3XA 2BMQB 1QJGA 2XFSA 2AADA 3NQZA 3D4AA 3HOHA 2CFLA 2F5MA 4XDWA 2ZL8A 5A0OB 1AY7A 1B20A 3JUOA 3WMDA 1TTOA 1F8NA 2J8XB 4KVHA 3BU4A 1JB5A 3K0ZA 7RNTA 1DMMA 2FXTA 4FCJA 2W2CA 1BAOA 1V57A 4HM7B 4MEIA 1JNQA 4J9AA 5AIHA 1YJN3 2F98A 2GSPA 1GSPA 3V98A 3VSYA 1N9EA 2K3DA 2UX0A 3M8CA 5CF2A 3CCL3 1DVCA 1Z1SA 1FUWA 3Q3FA 2KF6A 3F40A 3SVAA 2CW9A 4GB5A 3BNDA 1BNJA 3RGRA 1ULIB 1T5YA 1G02A 4HAAA 3S29A 4BIRA 1X1UA 2A15A 1ULJB 2YX9A 1VQ53 3Q90A 5EQLA 3N8BA 3MPHA 4TX4A 4EXRA 1MNLA 1I70A 2CX0A 3QRDA 2CWVA 2WOFA 3NV0A 3AHWA 5IF6A 2E2UA 2UUGC 1W2B2 2W03A 3IMAB 4EV2A 8CHOA 1IDPA 1WMOA 1GYBA 2GU3A 2W56B 2F86B 1FUSA 1FGRA 4GL6A 4OK0A 3WA2X 1BSBA 4ILFA 1RGAA 1OHOA 1LNHA 1VQL3 3F8HA 1UW1A 1V74A 4IPBA 2OQEC 1BRNL 1CYUA 4OVMA 2CWUA 1FW7A 3LYGA 1GMRA 5I97A 1MOLA 3TDGA 3Q1CA 1LQMB 1RJOA 1SIHA 3BNBA 2KAAA 4R1KA 2FGTA 1W6CA 5DRVA 1RCKA 4LGQA 2C10A
chains in the Genus database with same CATH topology
1GOVA 1BOXA 1BRGA 1BSEA 1RLSA 1R4YA 2BIRA 1B2MA 1B2XA 1B2SA 1X1YA 4RNTA 1X1XA 3AGNA 1I0VA 1BRSA 1LNIA 1UCIA 1JBTA 1DE3A 1BNGA 1PY3A 2SARA 1GOUA 1I2GA 9RNTA 1MGRA 1BNEA 1FUTA 1LOVA 1LRAA 4GHOA 3RNTA 1I3FA 1C54A 3AGOA 1RGCA 1BGSA 3WHOA 1RMSA 2RBIA 1BRIA 1GMQA 1MGWA 1BUJA 2HOHA 3D5GA 1B21A 1B3SA 5HOHA 1YVSA 2AAEA 2F56A 1X1WA 1RNBA 1TRQA 1RGGA 1BNSA 1FYSA 1SARA 3SYUA 1JBSA 1RNTA 2ZA4A 1RGEA 3KCHA 1JBRA 1I8VA 3DH2A 4BU4A 1ZGXA 2AADA 3D4AA 3GSPA 3HOHA 2F5MA 1B20A 1AY7A 1BRJA 5GSPA 1TTOA 1I3IA 1GOYA 3BU4A 7RNTA 1BANA 1DETA 1Q9EA 1TRPA 1BAOA 1GMPA 1BVIA 5BU4A 1BRKA 2GSPA 1B2ZA 3D5IA 1GSPA 1BU4A 6RNTA 1T2IA 4J5GA 1BRHA 2F4YA 3Q3FA 1LOWA 1BSAA 1BSDA 1RN4A 2KF6A 2BU4A 5RNTA 1RN1A 1BNIA 1BNJA 1LOYA 3A5EA 2KF4A 1G02A 4HAAA 4BIRA 1HYFA 1X1UA 1RDSA 1T2HA 1I70A 4HOHA 1YNVX 3DGYA 2KF5A 2KF3A 1BNRA 1UCLA 1PYLA 3AHWA 1A2PA 1I2FA 1AQZA 1I2EA 1RTUA 3URPA 5BIRA 2F5WA 6GSPA 1B27A 1RGKA 1BNFA 1RGHA 4GSPA 1RHLA 1HZ1A 1FUSA 1RSNA 1BIRA 2C4BA 1IYYA 1BSBA 2RNTA 1RGAA 1RCLA 1I0XA 4J5KA 3BIRA 3AHSA 1RGLA 1UCJA 1YGWA 1BRNL 1FW7A 1GMRA 1RGFA 1BSCA 8RNTA 1B2UA 3WR2A 1UCKA 2KAAA 7GSPA 1FZUA 1RCKA 1CH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GOV A;  1BOX A;  1BRG A;  1BSE A;  1RLS A;  1R4Y A;  2BIR A;  1B2M A;  1B2X A;  1B2S A;  1X1Y A;  4RNT A;  1X1X A;  3AGN A;  1I0V A;  1BRS A;  1LNI A;  1UCI A;  1JBT A;  1DE3 A;  1BNG A;  1PY3 A;  2SAR A;  1GOU A;  1I2G A;  9RNT A;  1MGR A;  1BNE A;  1FUT A;  1LOV A;  1LRA A;  4GHO A;  3RNT A;  1I3F A;  1C54 A;  3AGO A;  1RGC A;  1BGS A;  3WHO A;  1RMS A;  2RBI A;  1BRI A;  1GMQ A;  1MGW A;  1BUJ A;  2HOH A;  3D5G A;  1B21 A;  1B3S A;  5HOH A;  1YVS A;  2AAE A;  2F56 A;  1X1W A;  1RNB A;  1TRQ A;  1RGG A;  1BNS A;  1FYS A;  1SAR A;  3SYU A;  1JBS A;  1RNT A;  2ZA4 A;  1RGE A;  3KCH A;  1JBR A;  1I8V A;  3DH2 A;  4BU4 A;  1ZGX A;  2AAD A;  3D4A A;  3GSP A;  3HOH A;  2F5M A;  1B20 A;  1AY7 A;  1BRJ A;  5GSP A;  1TTO A;  1I3I A;  1GOY A;  3BU4 A;  7RNT A;  1BAN A;  1DET A;  1Q9E A;  1TRP A;  1BAO A;  1GMP A;  1BVI A;  5BU4 A;  1BRK A;  2GSP A;  1B2Z A;  3D5I A;  1GSP A;  1BU4 A;  6RNT A;  1T2I A;  4J5G A;  1BRH A;  2F4Y A;  3Q3F A;  1LOW A;  1BSA A;  1BSD A;  1RN4 A;  2KF6 A;  2BU4 A;  5RNT A;  1RN1 A;  1BNI A;  1BNJ A;  1LOY A;  3A5E A;  2KF4 A;  1G02 A;  4HAA A;  4BIR A;  1HYF A;  1X1U A;  1RDS A;  1T2H A;  1I70 A;  4HOH A;  1YNV X;  3DGY A;  2KF5 A;  2KF3 A;  1BNR A;  1UCL A;  1PYL A;  3AHW A;  1A2P A;  1I2F A;  1AQZ A;  1I2E A;  1RTU A;  3URP A;  5BIR A;  2F5W A;  6GSP A;  1B27 A;  1RGK A;  1BNF A;  1RGH A;  4GSP A;  1RHL A;  1HZ1 A;  1FUS A;  1RSN A;  1BIR A;  2C4B A;  1IYY A;  1BSB A;  2RNT A;  1RGA A;  1RCL A;  1I0X A;  4J5K A;  3BIR A;  3AHS A;  1RGL A;  1UCJ A;  1YGW A;  1BRN L;  1FW7 A;  1GMR A;  1RGF A;  1BSC A;  8RNT A;  1B2U A;  3WR2 A;  1UCK A;  2KAA A;  7GSP A;  1FZU A;  1RCK A;  1CH0 A; 
#chains in the Genus database with same CATH topology
 1GOV A;  5KP4 A;  3FH1 A;  5IW9 A;  4N6O B;  1BOX A;  1BRG A;  1N8R 4;  1RLS A;  1JKG A;  1R4Y A;  1W01 A;  1OH0 A;  3WDG B;  3LML A;  3MYT A;  1VQ7 3;  1STF I;  3NQY A;  1BRS A;  1LNI A;  2P38 A;  3G71 3;  1K28 A;  1PY3 A;  2IYJ A;  1I2G A;  1BNE A;  1FUT A;  1JV2 B;  3CPO A;  3EJV A;  2Z76 A;  5M18 A;  2XGL A;  2OWP A;  3RNT A;  3AGO A;  5KP1 A;  1PFP A;  1WQL B;  3GZX B;  3MG1 A;  3NV0 B;  3OX9 A;  4N6U A;  3WHO A;  3ZG0 A;  3V92 A;  1KSI A;  1LOX A;  1Q42 A;  3EHC A;  2HML B;  4HYZ A;  4XB5 A;  5D83 A;  3K63 A;  2H0H A;  3EF8 A;  1EUI C;  2HOH A;  5AYR B;  1Q7Y 4;  1YIT 3;  3DXO A;  1EA2 A;  1DMQ A;  5CK6 A;  3J7Y d;  2IUK A;  3FKA A;  1N9J A;  4N6V 0;  4WYK A;  4BTX A;  4N6N B;  1D6Y A;  3NM7 A;  1BUQ A;  1RNB A;  1E3V A;  5AIF A;  1O7H B;  4BL2 A;  4LYL B;  1M1X B;  1NJI 4;  1J2B A;  3X3Y A;  2D1W A;  3LTD A;  3LH4 A;  3LT8 A;  2H0G A;  3K5T A;  1S5A A;  2W9Q A;  2Q07 A;  1O7P B;  3KSE D;  1BNS A;  5DRE A;  1ISK A;  1RRH A;  1OPY A;  1RNT A;  1LVN A;  3KN4 A;  1WTH A;  5AEU B;  3PYJ A;  3BNC A;  1IVX A;  1JRQ A;  3PXM A;  4FMA A;  4X2H A;  3FG3 A;  3Q2P A;  5G1K A;  3DGM A;  4CPK A;  1JKG B;  1I8V A;  2XF3 A;  4G1M B;  4HJL B;  2Y73 A;  4LZI A;  4LMI A;  3UL5 A;  4KZ1 A;  3EN8 A;  1D6Z A;  1OGX A;  1C7H A;  3EN1 B;  5M1A A;  2Y74 A;  3CNX A;  4NPB A;  1IK3 A;  1W2Z A;  3MHE A;  3FSD A;  2CK3 H;  4AEQ A;  1W5Z A;  2SBL A;  1UGH I;  2YFJ B;  1DET A;  1Q9E A;  1RN7 A;  2CFG A;  1TRP A;  2RFR A;  1GMP A;  3L0R A;  4BL3 A;  1BVI A;  1FGO A;  1Q81 4;  1IVV A;  3SOA A;  2P05 A;  4HM4 B;  2C11 A;  4RBN A;  3EE1 A;  3G0K A;  3CC2 3;  1Q82 4;  1IQ8 A;  4FR9 A;  2XEP A;  4R80 A;  1RN4 A;  1BSD A;  2CFK A;  2BU4 A;  5RNT A;  3ZFZ A;  2CC3 A;  1UDI I;  3DGO A;  4FMC A;  1LOY A;  2W56 A;  2KF4 A;  4FCM A;  2ML5 A;  1JB4 A;  1JN5 A;  1G0T A;  1QAF A;  3HII A;  4HM0 B;  1M9G A;  4EC6 A;  1K73 4;  1RDS A;  2YFI B;  1WNH A;  1CYV A;  3DGY A;  3CC4 3;  1N5P A;  2RCD A;  3UB1 A;  5EVH A;  1A2P A;  2CX1 A;  4PEJ A;  3URP A;  5BIR A;  1UUG B;  3GZB A;  4L8O A;  1GY6 A;  1HZ1 A;  4N3V A;  3RDE A;  4NHF A;  1IYY A;  2L4V A;  2RNT A;  3CMA 3;  2XR8 B;  3N54 B;  1RCL A;  5BVB A;  1UI7 A;  3LT9 A;  4J5K A;  3I55 3;  3AHS A;  1IV7 A;  1AR0 A;  3PGB A;  2K0M A;  2W0Q A;  3LTA A;  1YGW A;  1SPU A;  1K41 A;  1N8Q A;  2GU1 A;  1K9M 4;  3CNM A;  4XBT A;  3CCR 3;  5AEW B;  1RKY A;  1W7C A;  1IVW A;  3E99 A;  1A2K A;  3UJM A;  1VQ4 3;  2IA7 A;  3A76 A;  1CH0 A;  1QAK A;  2WOH A;  4ZM8 A;  1NU3 A;  4KFE A;  2W6J H;  1OHP A;  2E2T A;  3B4O A;  2PZV A;  1B2X A;  2JDI H;  4R4K A;  1B2S A;  1FA3 A;  1X1Y A;  4N6M A;  4RNT A;  5IEO A;  1WMP A;  4HM6 B;  3K9M C;  1I0V A;  1JN5 B;  1STD A;  2P0X A;  2H0I A;  1GOU A;  3B7C A;  1NDO B;  5LC7 A;  1LOV A;  3S5C A;  1O7G B;  3DGN A;  1RGC A;  1NB3 I;  1YJW 3;  3GAX A;  1FGT A;  3CU3 A;  1BRI A;  1OF5 A;  5AYS C;  1GMQ A;  1OHS A;  1MGW A;  4L7K A;  1BUJ A;  3NBR A;  3PS8 A;  4MMY B;  1JZO A;  2W04 A;  3F7X A;  3MKI A;  1B21 A;  1UUW B;  2XFT A;  2XH9 A;  3D3L A;  4KFD A;  5HOH A;  2CWT A;  2AAE A;  1CQS A;  5G2G A;  3JUP A;  1W02 A;  2CH9 A;  2F56 A;  2QGU A;  1YGE A;  3O8Y A;  2R4I A;  3CCE 3;  3F8X A;  2IY2 A;  3X3Z A;  1IV9 A;  5CLK A;  1TRQ A;  2KRT A;  1UI8 A;  3NX0 A;  1QAL A;  1KQS 2;  1IU7 A;  1U5O A;  2XSH B;  4WFO A;  5IG0 A;  3SED A;  3STD A;  1U8C B;  2ZA4 A;  2K54 A;  5HGR A;  3V99 A;  2XGN A;  3X40 A;  2UGI A;  3BB9 A;  3KCH A;  4DKI A;  3T0U A;  2F99 A;  1IQY A;  3DH2 A;  2STD A;  2BMR B;  2R41 A;  4MMZ B;  3WOF B;  4Q53 A;  1OCV A;  3U1W A;  4BU4 A;  1GY7 A;  3BNE A;  3WOE B;  3GSP A;  4HVN A;  4JF8 A;  1S72 3;  2HMJ B;  3NXJ A;  1BRJ A;  3K7C A;  4EW5 A;  2IMJ A;  2LQV A;  3MG2 A;  5FW5 A;  3FGY A;  3OWY A;  3EC9 A;  4FCZ A;  1E97 A;  4FMB A;  4JRF A;  3X42 A;  1VQM 3;  1YJ9 3;  1AVL A;  3ROB A;  5BU4 A;  1OF5 B;  2GEX A;  5G1L A;  1B2Z A;  6RNT A;  3F9S A;  1W00 A;  1T2I A;  2BMO B;  4L8P A;  1BRH A;  3FLJ A;  2F4Y A;  1LOW A;  2O3O A;  3OXA A;  1EQK A;  2Z6B A;  1RN1 A;  1VQK 3;  1BNI A;  1ROA A;  3NBB A;  3KII A;  5FGO A;  5IG4 A;  3S28 A;  3DZL A;  4O2H A;  3NHX A;  4RNY A;  4CCV A;  3JUN A;  2HMK B;  1QVG 2;  1TFK A;  2HMO B;  3SXX A;  1YI2 3;  5AI1 A;  3CCU 3;  3CD6 3;  3CCQ 3;  2KF3 A;  4J8T A;  5LC6 A;  1UCL A;  3X41 A;  1I2F A;  1I2E A;  1A90 A;  1FGQ A;  6GSP A;  1RGK A;  1BNF A;  2CFW A;  3KSP A;  4GSP A;  4STD A;  1IT8 A;  2YFL B;  1NWW A;  2QA4 3;  1M1K 4;  3PCS A;  1BIR A;  2C4B A;  3NBJ A;  3GZR A;  3KKG A;  2B24 B;  4OUQ A;  1JJ2 2;  2BT3 A;  2CG0 A;  1ASK A;  1Q40 A;  5CXO A;  3ALA A;  5ELU A;  3ZG5 A;  4H61 A;  1JB2 A;  2I9W A;  1MWS A;  4HZB B;  3VF1 A;  1G96 A;  4HM1 B;  1O7N B;  1RGL A;  1UCJ A;  5CF1 A;  4K1V A;  5STD A;  3IJE B;  4HKV B;  3I0Y A;  3OV4 A;  1QMA A;  1B2U A;  2OOV A;  1UCK A;  3HX8 A;  2GXF A;  1OGZ A;  1FZU A;  3FCS B;  3LOY A;  4AKY A;  1YIJ 3;  3DY5 A;  1BNR A;  5IEN A;  1W4N A;  2KXG A;  3JVC A;  3CXC 2;  4WHA A;  1DMN A;  1BSE A;  4O02 B;  2XRX B;  2D42 A;  1B2M A;  3D9R A;  4LSO A;  1US1 A;  4WWU C;  3T8U A;  2GBW B;  7STD A;  2B1X B;  1AVK A;  1YHQ 3;  3S27 A;  1OUN A;  4BTW A;  4K90 B;  1JBT A;  1VQO 3;  1BNG A;  4R9K A;  4RNZ A;  1NO3 A;  1D6U A;  4GHO A;  1VQ8 3;  1ZO2 A;  1BGS A;  2WGO A;  4HM8 B;  4U13 A;  5D81 A;  2L1S A;  4HM3 B;  5M19 A;  1TJD A;  1LQG C;  2RBI A;  4IIA A;  1A2V A;  3HIG A;  3DM8 A;  1Q86 4;  4R9L A;  3D5G A;  3RGA A;  1O7M B;  3D79 A;  3DGL A;  1VZZ A;  1YVS A;  3VGN A;  3CCV 3;  2WO0 A;  3I56 3;  1Q40 B;  2IUJ A;  3ER7 A;  1X1W A;  3F14 A;  3SX1 A;  1NB5 I;  4K1U A;  4CJN A;  1HU9 A;  2RSX A;  2Z77 A;  1PU4 A;  3UL6 A;  3SLU A;  1QVF 2;  3G8Z A;  3NUV A;  1W6G A;  1MWT A;  1SAR A;  1TIJ A;  3SYU A;  1KD1 4;  1VQ6 3;  2CHC A;  3G4S 3;  3IPT A;  3EQQ B;  4HM5 B;  3FG1 A;  3NM2 A;  3AMO A;  1SJW A;  2OQE A;  4KT3 B;  2P09 A;  2M7O A;  3BLZ A;  3B4P A;  4XM4 A;  2Z7A A;  3LTB A;  1ZGX A;  3MSO A;  3CCM 3;  1YVB I;  2CFD A;  1GS3 A;  5GSP A;  5IG5 A;  5JBS A;  1I3I A;  3WOD G;  1GOY A;  3SOY A;  4X2O A;  1BAN A;  3FG4 A;  1UGI A;  3FZW A;  3S67 A;  3KFQ C;  5EEO A;  1BRK A;  2KCD A;  3D5I A;  1SQW A;  1TUH A;  1BU4 A;  3EBY A;  3GRD A;  2INX A;  4J5G A;  4BTY A;  1KWI A;  4HBR A;  3JUM A;  1BSA A;  3EB8 A;  4I5Q A;  4LEH A;  4CDL A;  3H51 A;  1GD4 A;  3A5E A;  1W6Y A;  2JQ5 A;  3QK9 A;  3HI7 A;  1HYF A;  1Q7H A;  3ECF A;  1L5G B;  3CCS 3;  3B8L A;  4H3U A;  1T2H A;  5JPU A;  3OW2 2;  4ORL A;  1TP6 A;  2BHM A;  1AV4 A;  2BO9 B;  4HOH A;  1YNV X;  1FGM A;  1A67 A;  2KF5 A;  4HZ9 B;  4EBG A;  2XSO B;  3F7S A;  1ZS7 A;  5AIG A;  1PYL A;  4XDV A;  1R4C A;  3H3H A;  1AQZ A;  1ROV A;  1RTU A;  1VQN 3;  2F5W A;  5IEP A;  1B27 A;  4N6T A;  4WP5 A;  5ELJ A;  1IVU A;  1RGH A;  1DYU A;  1MWU A;  3FF2 A;  1RHL A;  3AMO B;  3CPW 2;  2HMN B;  1RSN A;  2E2V A;  4EYC A;  3PCR A;  4IT7 A;  4RZM A;  1IT7 A;  5JPP A;  1I0X A;  3KZT A;  3G16 A;  1Y4K A;  1GY5 A;  3BIR A;  2BNG A;  3DMC A;  5BXQ A;  1OAC A;  2CIU A;  2ZHX B;  5AII A;  4MMX B;  4K61 A;  2PNC A;  3DUK A;  1RGF A;  2MF7 A;  3WA3 A;  1BSC A;  3MG3 A;  1N5H A;  4HM2 B;  2LYX A;  3WR2 A;  8RNT A;  1MWR A;  7GSP A;  2FNQ A;  4XBX A;  2ZDJ A;  1SII A;  5IG3 A;  1LXE A;  3MWZ A;  1O7W B;  1ZX2 A;  1M90 4;  2GBX B;  2ML6 A;  2BIR A;  3HK4 A;  4I4K A;  2P0M A;  1UUV B;  1X1X A;  2CKF B;  2OCT A;  3AGN A;  4AKZ A;  3JUQ A;  2QIY A;  3UNL A;  1UCI A;  1DE3 A;  5TGN A;  2SAR A;  1K8A 4;  3EX9 A;  1VQ9 3;  9RNT A;  1MGR A;  1EKM A;  1GD3 A;  1LRA A;  1C54 A;  1I3F A;  2W9P A;  1VQP 3;  1KC8 4;  1NNV A;  1RMS A;  3N9H A;  3CCJ 3;  3GZY B;  3OWU A;  2GEY A;  4N6L A;  4QWT A;  5KP3 A;  6STD A;  1DVD A;  1TU5 A;  3OWS A;  1JZD A;  4O3V A;  1B3S A;  3FF0 A;  3T8N A;  1WMN A;  1CEW I;  3LZA A;  1RRL A;  2HMM B;  2CG1 A;  4O8S A;  3LXU X;  1HKX A;  1TFO A;  1IQX A;  2WGQ A;  2RGQ A;  5D82 A;  2V1L A;  4EV5 A;  4FMD A;  1RGG A;  3PZW A;  1FYS A;  2QEX 3;  5IER A;  1JBS A;  1VQQ A;  4XBY A;  3CC7 3;  3GWR A;  2O9U X;  4WYK B;  2OTJ 3;  3G6E 3;  3EBT A;  1E3R A;  4KFF A;  1RGE A;  2MC8 A;  1EG9 B;  1EEJ A;  1T3B A;  3CME 3;  3HZP A;  2OOV C;  3U97 A;  1JBR A;  4NRE A;  2OTL 3;  3KE7 A;  1V58 A;  3LTC A;  4MJD A;  3X3X A;  2BMQ B;  1QJG A;  2XFS A;  2AAD A;  3NQZ A;  3D4A A;  3HOH A;  2CFL A;  2F5M A;  4XDW A;  2ZL8 A;  5A0O B;  1AY7 A;  1B20 A;  3JUO A;  3WMD A;  1TTO A;  1F8N A;  2J8X B;  4KVH A;  3BU4 A;  1JB5 A;  3K0Z A;  7RNT A;  1DMM A;  2FXT A;  4FCJ A;  2W2C A;  1BAO A;  1V57 A;  4HM7 B;  4MEI A;  1JNQ A;  4J9A A;  5AIH A;  1YJN 3;  2F98 A;  2GSP A;  1GSP A;  3V98 A;  3VSY A;  1N9E A;  2K3D A;  2UX0 A;  3M8C A;  5CF2 A;  3CCL 3;  1DVC A;  1Z1S A;  1FUW A;  3Q3F A;  2KF6 A;  3F40 A;  3SVA A;  2CW9 A;  4GB5 A;  3BND A;  1BNJ A;  3RGR A;  1ULI B;  1T5Y A;  1G02 A;  4HAA A;  3S29 A;  4BIR A;  1X1U A;  2A15 A;  1ULJ B;  2YX9 A;  1VQ5 3;  3Q90 A;  5EQL A;  3N8B A;  3MPH A;  4TX4 A;  4EXR A;  1MNL A;  1I70 A;  2CX0 A;  3QRD A;  2CWV A;  2WOF A;  3NV0 A;  3AHW A;  5IF6 A;  2E2U A;  2UUG C;  1W2B 2;  2W03 A;  3IMA B;  4EV2 A;  8CHO A;  1IDP A;  1WMO A;  1GYB A;  2GU3 A;  2W56 B;  2F86 B;  1FUS A;  1FGR A;  4GL6 A;  4OK0 A;  3WA2 X;  1BSB A;  4ILF A;  1RGA A;  1OHO A;  1LNH A;  1VQL 3;  3F8H A;  1UW1 A;  1V74 A;  4IPB A;  2OQE C;  1BRN L;  1CYU A;  4OVM A;  2CWU A;  1FW7 A;  3LYG A;  1GMR A;  5I97 A;  1MOL A;  3TDG A;  3Q1C A;  1LQM B;  1RJO A;  1SIH A;  3BNB A;  2KAA A;  4R1K A;  2FGT A;  1W6C A;  5DRV A;  1RCK A;  4LGQ A;  2C10 A; 
#chains in the Genus database with same CATH homology
 1GOV A;  1BOX A;  1BRG A;  1BSE A;  1RLS A;  1R4Y A;  2BIR A;  1B2M A;  1B2X A;  1B2S A;  1X1Y A;  4RNT A;  1X1X A;  3AGN A;  1I0V A;  1BRS A;  1LNI A;  1UCI A;  1JBT A;  1DE3 A;  1BNG A;  1PY3 A;  2SAR A;  1GOU A;  1I2G A;  9RNT A;  1MGR A;  1BNE A;  1FUT A;  1LOV A;  1LRA A;  4GHO A;  3RNT A;  1I3F A;  1C54 A;  3AGO A;  1RGC A;  1BGS A;  3WHO A;  1RMS A;  2RBI A;  1BRI A;  1GMQ A;  1MGW A;  1BUJ A;  2HOH A;  3D5G A;  1B21 A;  1B3S A;  5HOH A;  1YVS A;  2AAE A;  2F56 A;  1X1W A;  1RNB A;  1TRQ A;  1RGG A;  1BNS A;  1FYS A;  1SAR A;  3SYU A;  1JBS A;  1RNT A;  2ZA4 A;  1RGE A;  3KCH A;  1JBR A;  1I8V A;  3DH2 A;  4BU4 A;  1ZGX A;  2AAD A;  3D4A A;  3GSP A;  3HOH A;  2F5M A;  1B20 A;  1AY7 A;  1BRJ A;  5GSP A;  1TTO A;  1I3I A;  1GOY A;  3BU4 A;  7RNT A;  1BAN A;  1DET A;  1Q9E A;  1TRP A;  1BAO A;  1GMP A;  1BVI A;  5BU4 A;  1BRK A;  2GSP A;  1B2Z A;  3D5I A;  1GSP A;  1BU4 A;  6RNT A;  1T2I A;  4J5G A;  1BRH A;  2F4Y A;  3Q3F A;  1LOW A;  1BSA A;  1BSD A;  1RN4 A;  2KF6 A;  2BU4 A;  5RNT A;  1RN1 A;  1BNI A;  1BNJ A;  1LOY A;  3A5E A;  2KF4 A;  1G02 A;  4HAA A;  4BIR A;  1HYF A;  1X1U A;  1RDS A;  1T2H A;  1I70 A;  4HOH A;  1YNV X;  3DGY A;  2KF5 A;  2KF3 A;  1BNR A;  1UCL A;  1PYL A;  3AHW A;  1A2P A;  1I2F A;  1AQZ A;  1I2E A;  1RTU A;  3URP A;  5BIR A;  2F5W A;  6GSP A;  1B27 A;  1RGK A;  1BNF A;  1RGH A;  4GSP A;  1RHL A;  1HZ1 A;  1FUS A;  1RSN A;  1BIR A;  2C4B A;  1IYY A;  1BSB A;  2RNT A;  1RGA A;  1RCL A;  1I0X A;  4J5K A;  3BIR A;  3AHS A;  1RGL A;  1UCJ A;  1YGW A;  1BRN L;  1FW7 A;  1GMR A;  1RGF A;  1BSC A;  8RNT A;  1B2U A;  3WR2 A;  1UCK A;  2KAA A;  7GSP A;  1FZU A;  1RCK A;  1CH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...