2HOSA

Phage-selected homeodomain bound to unmodified dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
56
structure length
56
Chain Sequence
RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQVKGWFKNMRAKIKKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*CP*CP*CP*CP*
publication title Structure and properties of a re-engineered homeodomain protein-DNA interface.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 22
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hosA00
1D5YA 4AC0A 1OCTC 1VNDA 1RESA 2NVYJ 4XK4A 3Q0WA 3I4MJ 5F27A 2IBDA 2O7OA 1IDYA 2ECCA 1HDDC 2YS9A 2AO9A 3CMYA 4X1EA 3HGGA 2RAEA 5M5XJ 3S14J 4M3FA 5E3NA 1GUUA 2EZIA 2YU9J 5E3OA 2DA1A 4ABZA 2XGDA 1WH5A 1YRNA 1F43A 2DMTA 1O4XA 4DZJA 3ZQIA 1A5JA 2MW8A 5BNGA 2HQ5A 4A3JJ 3PO2J 3HEFA 2GLOA 1TWFJ 2Y30A 1Z77A 4DZPA 2E2JJ 5IP9J 4XIDA 4UUTA 4AYBN 1TC3C 1ZTRA 2OF7A 4C2MJ 3S16J 3BTLA 1H8AC 3S1QJ 5C3EJ 1QPIA 1XG1A 4DYRA 2NS7A 3HB9A 3MKLA 4XRSG 2X6OA 4UUSA 3D1NI 1AKHA 2B63J 4BY7J 5EGOA 1OCPA 3BR5A 3H0GJ 5DTDA 2JN6A 5JLWA 5IOZA 2NVXJ 4DYQA 3HDDA 2M34A 1MSEC 3BTIA 4MFDA 3ZQLA 1W0UA 1ZR2A 2WV1A 2W48A 2E2IJ 2HDDA 3L1PA 3IH2A 2DA5A 2R0QC 2HOSA 1WH7A 4A3LJ 3HOYJ 1IRZA 1TWHJ 3K7AJ 1ETWA 1OJLA 1IC8A 5FJ8J 4A93J 1MBGA 2ME0A 2JWTA 2ID6A 3VPRA 3W6VA 3ZOBA 5IP7J 1E3OC 1JTXA 4MFEA 2HI3A 4IHWA 2N8GA 1TWGJ 3GTQJ 3I4NJ 1WGXA 1JKPC 1NK3P 2EQRA 1R9TJ 1JUPA 1ETOA 2EH3A 3LOCA 3ZQHA 3S17J 5EG0A 1HDPA 5K7HA 3IH4A 2GBYA 1JKRC 5IYCJ 1IUFA 3RZOJ 3BR0A 4CYCA 3WHBA 4FISA 3JREA 1K83J 1JT0A 1B72A 4D5FA 3MVPA 4M6VA 4B3AA 2R5YA 1RPWA 3BG9A 2XGEA 3HOVJ 2Y31A 3IH3A 2D5VA 3LSPA 4DYCA 3TP0A 1MNMC 2Y9YA 2JMWA 1MBHA 4D7NA 1OFCX 2EZKA 2GM4A 1JTYA 3Q0VA 1GT0C 1FEXA 5J1YA 5IPAA 1ETQA 2WAQN 3BTJA 3DEWA 4M3GA 1MH3A 2EZHA 1TWCJ 2Y9ZA 2CQXA 2R7ZJ 2L7ZA 4A3FJ 1LFUP 1XC5A 3QPSA 5GP9A 3HM5A 4C3HJ 1ETKA 5K7FA 5GPAA 1RKWA 1ZR4A 1VF9A 1I3QJ 2NVTJ 4W97A 3MN2A 4RBOA 4IHYA 3TP3A 1B8IA 1H88C 3S1NJ 5J3LA 3BQYA 2KDZA 1T56A 1QRYA 2XSDC 3BR6A 1LE8A 1ENHA 4GFBA 4XRMA 1FIPA 3M4OJ 2COBA 3B6CA 2XB0X 2OPTA 1JJ6C 1YRNB 1MBKA 4EEFG 1NTCA 2WB1N 3GTGJ 2HOTA 1X2NA 1K61A 5DS9A 3K2AA 2O8KA 3A02A 4G12A 3UKGA 2XGCA 3F0CA 4QSHA 2JA7J 2I10A 5K7ZA 1G2HA 2E19A 2ID3A 2DMNA 2PMZN 4QTRA 3LSGA 2DJNA 3OOUA 4NDLA 4IHXA 5FKNA 3HOXJ 3TW7A 2VI6A 4UUSB 2KT0A 3FKIJ 1AKHB 5EGOB 4JP0A 2ME6A 2JJ7A 3S15J 1MH4A 1WPKA 2VKEA 3CDLA 2DMPA 1U8BA 3A01A 5J1RA 2L7FP 2R5ZA 4XICA 3HGYA 5FKKA 2LD5A 3LSJA 2R92J 2LVSA 2DTZA 1JUSA 1ZK8A 3ZQFA 3RKQA 4FE7A 4BKXA 2LP0A 1ZGWA 1Y1WJ 4MIMA 2K9NA 2LK2A 2XPUA 3BR1A 3M3YJ 4V2FA 3RZDJ 2DMUA 2XRLA 1Y1VJ 2MGQA 3JRGA 2DA3A 3Q0UA 1A6IA 4A69C 3ZQCA 3HOWJ 4HNVA 4S0HB 2TRTA 5FLVA 1FIAA 5EG0B 5IYDJ 1I50J 1MBFA 1ITYA 3TW6A 4CYCB 3G1OA 2HXIA 2FD5A 1B72B 4X6AJ 4C3IJ 3S1RJ 2E2HJ 1DU0A 2E1OA 2X48A 2H1KA 3QPLA 1IG7A 1ZKGA 2X9DA 1LFBA 1JKQC 2QF7A 4A3IJ 3GTKJ 1ETVA 1U9OA 1NK2P 4C3JJ 2ELKA 5F0FA 3JRFA 5C4JJ 4D7MA 1W0TA 1XS9A 1MSFC 5HODA 2CUFA 5F0CA 3QQAA 1BJZA 1SFOJ 5E3LA 4BXXJ 1GV2A 3S2HJ 1UG2A 1APLC 3BR3A 1Q1VA 1PUFA 4A3GJ 3A03A 1JJ8C 2M0CA 4IEJA 1ZQ3P 5M3MJ 1S7EA 4JX4A 2R93J 3OIOA 2CQQA 2M9HA 5EZGA 2NVQJ 4JYKA 2QCOA 4BBRJ 1IDZA 4W1UA 5EF6A 1B8IB 3PM1A 2O9LA 1ORKA 3JRHA 1GV5A 1RR7A 1POGA 2ZB9A 5FKMA 1LE8B 2DA2A 3SFIA 2IEKA 3FIWA 2LR8A 5EEAA 2K40A 2VKVA 5C44J 4QIWN 4JX6A 5IP6A 2JA5J 4M3DA 1VFCA 1BW6A 1SANA 1UMQA 5EDNA 2DA7A 2Y2ZA 5F08A 2NS8A 2HYJA 3DCFA 4MO7A 2ECBA 2L9RA 3BR2A 3O8GA 2K9SA 2LFBA 3IV5A 3GTJJ 1RETA 2CU7A 1MBJA 2M8GX 2AHQA 1FJLA 4A3BJ 4I76A 5M5WJ 2CUEA 2DA6A 4A3CJ 4B1RA 2NOGA 4A3KJ 3BT9A 3JRCA 3S1MJ 3LSRA 2FX0A 2XPVA 4BBSJ 2VPRA 3NAUA 3GBGA 3RQIA 2FQ4A 3SDGA 2TCTA 2LKXA 1IJWC 1I6HJ 2L7MP 4A3MJ 3A01B 1U78A 2R5ZB 3JRAA 4JX5A 1UHSA 5EZHA 1P7JA 1X2MA 4Y7NJ 1VI0A 1BA5A 1AHDP 4L5EA 4B4CA 3FK6A 3WHCA 4IHVA 3H3VK 3JR9A 4RDUA 5EYRA 3OSGA 1BL0A 2HXOA 2HOAA 4FTHA 3FISA 2DA4A 3E7LA 3O8HA 5GPCA 5M3FJ 5F04A 2MG4A 4XRSA 2M2EA 1GDTA 4DW6A 3JRIA 3OSFA 4J19A 5IOYA 1JT6A 2G0EA 2DMQA 1Z0XA 2H8RA 5M5YJ 3GTPJ 2YUSA 4M3EA 1JUMA 3GTMJ 5E3MA 2CRGA 5F1JA 3BQZA 4BY1J 1IV6A 3G1LA 2FJ1A 4A3DJ 1FTZA 3CCYA 1HOMA 2R5YB 3JRBA 3BTCA 2CJJA 3GTLJ 2XPWA 3NARA 3C2BA 3HKZN 1ETYA 5FKLA 4LOCA 2JA8J 1CQTA 1QVUA 1WI3A 2EBIA 3S2DJ 5J1UA 1IGNA 3JRDA 3CQZJ 2LY9A 4FCYA 4MLOA 3HOUJ 4A3EJ 1QVTA 4D5CA 1X58A 1HLVA 2L0KA 3HOZJ 4Y52J 1JKOC 1DU6A 4V2GA 1FTTA 1PUFB 1U9NA 5JLXA 3HBLA 2Y0SN 2VUMJ 1T33A 1RKTA 2K9QA 2LLKA 4I6ZA 4M3BA 2EZLA 5F0HA 3TEDA 1HCRA 3BG3A 1HF0A 3B6AA 4AUXA 2XB5A 1GVDA 1MBEA 1P7IA 2JK3A 3ZQGA 1H89C 3FK7A 5FLMJ 1TWAJ 3LNQA 2IAIA 2LTPA 1ETXA 1WCMJ 2JA6J 2DN0A 2MSYA 5FKOA 1JGGA 5C4XJ 2P81A 1BW5A 4FE4A 9ANTA 3Q3SA 1F36A 1AU7A 3G1MA 3BG5A 1EF4A 3GTOJ 5IYBJ 3SJMA 3PO3J
chains in the Genus database with same CATH superfamily
1T38A 2Z99A 1RESA 1X1AA 4FASD 3OWTA 1Y0NA 4PSWA 3BY6A 4A0YA 2PJPA 5F27A 2Z3YA 1UG0A 2IBDA 4LB6B 1TZLA 4N0BA 3OS0A 2AO9A 3AKZA 2VOPA 2FUG2 3HGGA 1S7OA 2WADA 2FOKA 3H3ZA 3MQ0A 4X1EA 1VZ0A 2OCCH 3IWZA 4M3FA 2GOMA 1VQ8I 5FB2A 3KLOA 3HL2A 1GUUA 3FF5A 2V1UA 3ERED 3DU6A 2JUCA 3VODA 2DA1A 4M6YA 4HLYA 1FP1D 2I8DA 4CICA 1X3ZB 1MDMB 1WQ2A 4DZJA 3OYAA 1A5JA 3HPGA 2F4OB 1J2XA 5BNGA 3PO2J 3M8FA 2R7RA 2XAJA 3K4BA 2XRNA 1TWFJ 2Y30A 4IKFA 1Z67A 1WJBA 1X1CA 2Z1DA 5IP9J 1S72I 2LOOA 2XAHA 1M1EB 4BHCA 4ZDPA 2HU9A 1HSJA 5L3GA 1EA3A 5FLXZ 1IW7F 3R0AA 3S16J 3S1QJ 4MQVA 2H09A 3HB9A 4UUSA 2TDXA 2X6OA 3D1NI 1EV7A 3DKXA 1OCPA 3BR5A 3H0GJ 3H3UA 3LA2A 4Y3OA 5IOZA 3E0JB 3DQVC 2V9KA 2VIXA 3HDDA 4LIVA 2O03A 2P6TA 1W0UA 1ZR2A 1SAXA 3IH2A 4A3LJ 1WH7A 1KU7A 1V5GA 1LDJA 1TWHJ 3PNYA 5H20A 3K7AJ 1ETWA 4FQGA 3K4JA 1IC8A 2DLLA 3FBIB 1UAAA 1MBGA 2DYRH 2JWTA 2AS5F 1U0JA 1GLNA 1XB4A 5E1ZB 3W6VA 2ICWG 2RVCA 3SEQA 1B6AA 1I1GA 4Q4ZF 2DFIA 4HX8A 2JUGA 5B3SH 2N8GA 2JPCA 2GQQA 3F8BA 1Y56A 3JSOA 2UWMA 2EWNA 3FXJA 4N9HA 4CO8A 2GBYA 3CCRI 3C2GA 2MD0A 3HSEA 3GMEA 3BR0A 4NC8A 2L7KA 3EUHA 5IYCJ 4CYCA 5BS6A 4FISA 4HPQA 3JREA 1JT0A 4GGGA 4D5FA 3K1PA 4KIFA 2Q1ZB 3LFKA 4OWRB 4XKVA 3N4MA 1RPWA 3BPVA 2XGEA 3K4CA 2ZXJA 3Q9VA 2IGOA 3F8CA 2Y9YA 3G4SI 3P9IA 3A1YA 3M1EA 1WJ5A 2X1EA 1OFCX 2EZKA 3H5RA 2HQNA 1F4KA 3HJEA 2BOLA 3TOBA 1FEXA 4RS8A 1YLFA 3BTJA 1UHMA 3F72A 3SZPA 5K1YA 4PJJA 2X51A 1D0YA 1TWCJ 2A69F 2Y9ZA 4HG2A 2V26A 1F5TA 2JPBA 3RYRA 2L7ZA 2M1BA 4MEYF 4A3FJ 1RUOA 3ELKA 2VN2A 3I58A 5IY5H 4C3HJ 1SEUA 2ZXIA 1ON2A 3FM5A 1ZR4A 1VF9A 2IGMA 4QLCU 3E5XA 4RBOA 4IHYA 3TP3A 3K2ZA 3S1NJ 5J3LA 1IO2A 4KN4X 3BR6A 2PI0A 5KNLA 4HYEA 2OQRA 2QM3A 1UELB 3QOEA 2E1MB 1FX7A 1XTAA 2QQ8A 2BHZA 3AG2H 4RB0A 1T95A 4HW0A 2KJCA 4HQEA 1UHWA 1NHAA 1I27A 1YRNB 2VC0A 1Z1DA 3E6MA 2UXXA 2HOTA 3H92A 4A0ZA 5L3CA 5CVVA 2CS3A 5AIQA 3H5NA 2MD5A 1H9GA 1DGRM 3HZJA 3AG3H 4ZZLA 1RR8C 1G2HA 1N78A 4IOCF 1PUEE 1P4WA 3B02A 4LK1F 3TO7A 5ILSA 5J4YA 4RB2C 4RB3C 1VQKI 5DM6F 4U0VA 1XSXA 2L9NA 1K4TA 1ZREA 3VYSB 4ZDLA 1TW2A 3GFLA 4HSTA 2VI6A 1D1CA 2RKHA 2KT0A 2HS5A 2BW3B 4QWQA 4U7DA 1KU9A 4JP0A 2ME6A 1MDMA 4J00A 1WPKA 2W00A 1YI2I 1LUJB 3RPUD 4BQQA 4ZYDA 4S04A 5L3DA 4MEXF 1D8JA 5LEJA 3ZMTA 2DMPA 3CCMI 4CCOA 3HGYA 2LD5A 3LSJA 2LVSA 2IA1A 3CJNA 4UV9A 1R36A 3RKQA 4FE7A 2YPRA 1Y1WJ 2EJRA 4AIJA 5GAHJ 2EFPA 2QQBA 4HF0A 2K9NA 2LG4A 4MIMA 4MTEA 4RB1A 3M3YJ 3K70D 1TQPA 1ZG5A 3LAJA 2WBMA 3OS2A 3RDIA 4AU7A 3IRRA 3MKZA 3CCVI 1SVOA 3JRGA 2X6XA 1ZRDA 3V8JA 3Q0UA 1YHQI 2EPFA 1A6IA 1WKMA 3ASNH 3ZQCA 3SDBA 4HNVA 5FGMA 4S0HB 4EM0B 2Y0SA 3V7RA 5EJCA 2VOOA 5J47A 1K78B 1XGSA 1FIAA 3CUQA 5EG0B 3D5LA 1I50J 4P9UA 3QYEA 1W5TA 4Z2YA 2IXSA 3VEPA 2DK8A 3QPTA 1FPQA 3UR3C 1R49A 1B72B 2ZO4A 2OTJI 4C3IJ 1S29A 1X4OA 4HRIA 4N9IA 1OKRA 2EFNA 4AVPA 1WJCA 4YFXF 2LY1A 3HOSA 1AA7A 3C3WA 3HRSA 1ETVA 1EKEA 1PDNC 1NK2P 2W24A 5F0FA 3JRFA 2NYXA 5C4JJ 4BDZA 5F0CA 3QQAA 2KIMA 3DXJF 3SYTA 2GA1A 1S5LC 1SFOJ 4KIGA 2BYVE 2CG4A 5ED4A 2AQFA 3CTAA 1UG2A 3FMSA 1L0OC 2FBIA 2VKHA 3EUAA 1YIJI 3CC7I 3A03A 2ZJQF 2GXAA 4WX9A 3K69A 1YITI 4IEJA 4I0AA 1ZQ3P 1VQPI 4JX4A 2K4JA 2CQQA 2LBFB 1TW3A 4G8XA 1SVLA 2IS1A 1J5YA 4BBRJ 5EF6A 3PM1A 4PFOA 1ORKA 3JRHA 2ZB9A 1HBXG 3NRVA 4GYIA 2DA2A 3SFIA 5BMZA 3W3CA 4M72A 4LG0A 4IX7A 4UY8I 2QENA 3GW2A 2H8WA 1SAUA 4LD5A 5EEAA 1QNTA 4BEHB 4UXNA 2K40A 2M4GA 5CQEA 2F5DA 4QIWN 3K1MA 4JX6A 1ZLKA 3LQQA 2L4AA 3C18A 3SFZA 1XDUA 2HOEA 1BW6A 1UMQA 5EDNA 2DA7A 2ZMEB 2XAGA 2HYJA 4I2OA 3FHNA 1G3WA 4MO7A 3K9TA 2LFBA 3D5RC 3IV5A 4G6TB 1KYWA 4ESJA 3MZ8A 2AHQA 5M5WJ 5HDNA 1R5ID 2DA6A 3DBRB 4IRGA 1X4PA 5TJJA 1R7JA 2X0LA 2NOGA 3WTZA 3S1MJ 4OIQF 2BVMA 2FX0A 5JVGF 4IO9F 2PG4A 3CF2A 4DBRA 2IP2A 4NUBA 4Z6YA 1N77A 2FQ3A 3RI4A 4F91B 5FROA 2X4HA 4G7HF 5HLHA 3BCAA 2R7FA 2L7MP 4P1WA 3BWGA 3PIPF 2Y69H 2M7AA 4E70A 3ROUA 1G3SA 2F48A 4A2UA 3FM3A 1I6XA 1BR2A 1VI0A 1Z91A 4GO1A 2ZXHA 3LSIA 3MMYB 2Y0MA 3BCBA 2L02A 3T8TA 4CH7A 3WHCA 3HSRA 5F64A 3H3VK 1PP7U 5EYRA 1MGTA 4ENMA 4LLNA 2HOAA 2RV8A 4HQMA 2DU9A 3ECHA 1J0RA 2G7HA 3WGHA 1YFHA 3E7LA 3J81Z 3H0DA 1KQ8A 3T8RA 5M3FJ 2EFQA 2LDUA 2HR3A 3M07A 1XMXA 2QGUA 3I59A 5D5XB 3GO5A 2P5KA 3L2VA 5B1BH 3CLOA 3EUKL 3OSFA 4J19A 4G9YA 3F6VA 4XSXF 1Y8RB 1YOVB 1H9TA 4F7ZA 2H27A 2H8RA 4NNJA 2CV1A 2YUSA 3D5SC 4B09A 5GTHC 2R7VA 2ZJRF 3GTMJ 3CF5F 4BH9A 3ISPA 4L0ZB 3DF8A 3CCYA 1A35A 2QKLB 3VSLA 3F9KA 4ASNA 4CYDA 2A5YB 3GXOA 2OCEA 4UHTA 3L2UA 2R5YB 3GVAA 3V7CA 1DQUA 3LSKA 1IN5A 4FETA 3WTUC 3NARA 1R58A 2DT7B 2WAQA 2JA8J 5LRSA 2Z33A 1QVUA 1BN5A 5J1UA 1TQIA 2BEOA 1IGNA 3JRDA 2VKDA 4FCYA 3GEZA 4Q47A 3VYUB 3R60A 4A3EJ 4IZZA 2GXBA 3I56I 1HLVA 1JKOC 5KHDA 1T0FC 1FYLA 2DPUA 4BACA 5JLXA 3NQOA 3HBLA 5FLXK 1BIBA 5JFRA 4OIOF 1FSHA 1RKTA 2K9QA 2LLKA 5CVUA 4M3BA 3MEXA 5J40A 2EZLA 5LHIA 1V55H 4KA4A 5IT9Z 3RCOA 4MHGA 2P5LC 3BG3A 3CDHA 1HF0A 3K1NA 4AUXA 3QRFF 1TNTA 3U21A 1LKXA 3L2WA 4ZTJA 1E17A 3DTKA 3HUGA 2IAIA 2QSGX 3KP7A 5HDGA 1S3JA 1P4AA 2JA6J 2DN0A 5FKOA 3QAHA 3WGIA 2WB1A 3B73A 3QPHA 2PJRB 2W25A 3ZPLA 4OINF 2K4BA 1Z21A 2B9SA 2IS4A 1R1UA 3HHGA 2X85A 4RA2A 2FE3A 2I5UA 2FBHA 2XKOA 1D5YA 5HVQC 1OCTC 4XRFA 1IN6A 4LK0F 3A0BC 2PMZA 1T8IA 2OUMA 1IUYA 3TGNA 4EJTA 2O7OA 4P55A 1SFKA 2FNAA 1HDDC 2YS9A 4WK8F 1U5TC 2UZKA 2CSOA 2XUBA 2GAUA 4ETSA 5M5XJ 4H0EA 3S14J 1OCZH 2EZIA 3N97A 1Z3YA 2DODA 3ZQQA 2OA4A 2R7TA 2QYOA 4L9JA 3JTGA 5JI6A 3HG9A 1XSVA 1W7PA 4C30A 1STZA 2CWEA 2ZMEA 1O4XA 3FMQA 3OV8A 3DKYA 1KQ0A 3H35A 2MW8A 4RGRA 4A3JJ 3HEFA 4P5OA 1Z77A 4BNCA 4B8XA 4PZJA 4YG2F 5ERIA 4WXCA 3LWFA 1WHUA 2ZNYA 2EFOA 4I09A 3PJRA 5HS8A 1UCRA 3OL4A 4TV7A 1ZTRA 1Z9CA 3LSHA 2OF7A 3E6DA 2F4IA 1P92A 2VB6A 5C3EJ 2GXGA 2QVOA 3MKLA 4XRSG 4BXFA 4YIRX 4HOBA 5CQGA 1AKHA 2B63J 4BY7J 1OCCH 5EGOA 5DTDA 4DBQA 2NVXJ 2J5OA 4DYQA 5LHGA 4U87A 1ZLJA 3BTIA 3S2WA 5ICCA 2P4WA 5E20A 4GDFA 4DGWB 3K6GA 2WV1A 2W48A 3AFHA 1PJRA 2R0QC 2WAEA 2HOSA 2K3PA 3WTVC 1IRZA 3HOYJ 1F1ZA 4CDGA 2PLYA 1OJLA 2LKPA 4KDPA 2HFHA 4RGSA 1ZN2A 4U0WA 4EVIA 1Z7UA 2ID6A 3WTYC 1Z7LA 2HVRA 1SD6A 5BQTA 3H36A 1O7LA 1E3OC 3TDZC 1JTXA 3A4CA 3DEUA 4MFEA 4YFKF 3W6KB 1LQ1A 3WG9A 3HPHA 1TWGJ 2YSRA 2YX4A 2EILH 2KRHA 3I4NJ 1NK3P 2FF4A 3R4KA 1R9TJ 2EH3A 2WWYA 3ZQHA 2CMPA 3TMOA 4BAYA 1XGNA 3S17J 1BOBA 3EYIA 2O3FA 5K7HA 3PIOF 1D5VA 4QPOA 5CLSA 4MQ9F 1HA8A 1ZELA 3IHUA 1I39A 3OY9A 1E2XA 1J7KA 2R5YA 3OYGA 3MWMA 3HOVJ 2KQRA 2D5VA 2A5WA 2HYFA 2L5QA 3IH3A 1LB2A 2OTLI 4M9ZA 3TP0A 2K9MA 4V19K 1FY7A 2RQPA 1ONVA 3RKXA 3RJPA 3KP3A 3JSPA 1F9NA 4D7NA 2MA3A 4CCJA 3M7GA 3H9JA 1JTYA 1HSTA 2NAZA 5GAEJ 5LGUA 3Q5FA 5IPAA 3DEWA 4KIBA 1MNDA 2UXNA 2VT3A 1MNEA 1QO0D 1P9QC 2K27A 3ZP5A 1KYZA 2CQXA 3DLAA 4XNFA 3I64A 3HTSB 2R7ZJ 1LFUP 2A6EF 3CP2A 3QPSA 1SC7A 3L00A 3HM5A 3IKVA 3L2QA 1ETKA 5K7FA 5GPAA 4RAFA 4EM2A 2CQ7A 5HNFA 1I3QJ 1IXSB 3HYIA 2PN6A 4ITVA 2G7UA 2NVUB 4DJAA 2VE9A 2VJIA 1T56A 4I98B 1QRYA 3BZCA 4IVNA 4II2A 4GFBA 4XRMA 3ABTA 2V7FA 3M4OJ 1V54H 3LMMA 3B6CA 1IN4A 1QA6A 1R4MB 2V6EA 2EIMH 2XB0X 2OPTA 2EINH 1FNNA 4OAYA 1NTCA 2QA4I 2QSFX 3TO9A 2JRTA 2FEZA 1K61A 3KP5A 1HXDA 1PVEA 3FXUA 1T08B 5HDKA 4EQQA 2Q2EB 4XLEA 3UKGA 2VT2A 3HC7A 3F0CA 4N4OB 3U2RA 2H1LA 1GXQA 4ZC3A 3JAMZ 5K7ZA 3RYPA 3S3OA 3CD6I 2DXIA 4OAZA 1LEBA 2EFWA 4XLCA 4QTRA 3DFGA 2F5VA 2X6WA 3BG7A 3PQJA 4M73A 3CCEI 2OU2A 4XBFA 2D45A 1BI1A 4CUGA 1WWXA 4RAGA 2XAFA 3HOXJ 4UUVA 1YYVA 1A6QA 3FKIJ 4ZYEA 1T2KA 3ZN0A 3TDUC 5DD8A 1K6YA 2JJ7A 3S15J 1I1SA 2VKEA 3CJTB 5GAGJ 3PNTA 2FNPA 3CDLA 3A01A 1YIOA 5E18F 3L7WA 3GUDA 3S93A 1IRGA 2VQGA 2R92J 2DTZA 1ZK8A 3ZQFA 2O0YA 1PYVA 4M71A 1B4AA 1D1BA 3PNVA 5EEHA 1YX3A 4U88A 3E5QA 3RZDJ 1R1VA 2XRLA 4LG3A 3DLLF 2VE8A 1D8KA 3KEQA 5TRDA 3EUHC 2MGQA 4XOTA 5CVIA 3DBLB 2E1NA 2DA3A 1NG7A 4A69C 3HOWJ 3S8PA 1FT9A 5HLTA 5FLVA 1JGSA 4RM3A 3FX3A 3WTWC 1MJ9A 1ITYA 1BR4A 2BV6A 2HXIA 1G6NA 1FMVA 2JSPA 2WV0A 1J59A 4Y4RA 1USSA 1O7FA 4X6AJ 4A5NA 1BC8C 4BUPA 1IG7A 1DUXC 2X9DA 1MJAA 4DIQA 5D8KB 1MIJA 3I9V2 3T0YA 4UB8C 4Y15A 1W0TA 4NBQA 3HRUA 1XS9A 2MC3A 4WXHA 4R79A 4E7JA 3E3VA 3BROA 3MZYA 2ZKZA 3OYDA 1QZYA 1BJZA 2XIGA 1Y39A 1X1PA 2FU4A 2A05A 4BXXJ 3S2HJ 2B7EA 2M3AA 2KKOA 1LJ9A 1APLC 4Q48A 2ELHA 5L3BA 2XV4S 2WY8Q 4AWXB 4A6DA 2M0CA 2E34A 3DTIA 2K7LA 4Y13A 2DI3A 3J81K 5JHUA 2JQ7A 2OZ6A 4ENNA 1G59A 2QCOA 4D0PA 1LDDA 1K6OA 5E79C 4I01A 1B8IB 5D5VB 3J80Z 2O9LA 1IDZA 4ENKA 2F5FA 1H0MA 1LE8B 2IEKA 2LR8A 1O3TA 1MKMA 3LA3A 3TL4X 2VKVA 4HLXA 4IXAA 3BJ6A 2JA5J 4AIDA 3L2CA 3SZTA 1VFCA 2HDCA 3IWFA 3O3KA 1SANA 4MNUA 2R7DA 5F08A 2NS8A 2HKOA 2MLKA 3DCFA 4AYBA 2XC7A 4XORA 3PL8A 3I0TA 2F6CA 2L9RA 1YJ9I 2CGPA 2K9SA 5ICEA 2J5PA 4OMYA 2WY7Q 3WGGA 3VSKA 3J7AY 2DDAA 1GHCA 4Y33A 1QU3A 3ZXSA 1YX5A 1WJFA 3J7ZI 1FSEA 3CC4I 2WAFA 4A3KJ 3BT9A 3JRCA 4BHPA 2F5EA 2VPRA 4L9NA 5IT9K 2KDOA 2DYSH 1R71A 1S9HA 2OAZA 3RQIA 3ML6A 4RLQA 2R7SA 3UNGC 1ACIA 4XKWA 2IPQX 1IJWC 3EPZA 1BOAA 1QHHD 4A3MJ 1U78A 3W2AA 2R5ZB 3JRAA 2HGCA 1QZZA 1P7JA 1IN7A 1KU2A 4KICA 1AHDP 1BA5A 4L5EA 2JTVA 2CV0A 4E6KG 3KZIC 3F3XA 3HKZA 1Y6IA 3CP8A 3CUQC 4O3MA 1BL0A 2A07F 2GIZA 1X1BA 5GPCA 4BE1A 2EA4A 3OYFA 2ACJA 3GWZA 5F04A 2MG4A 3VB2A 3IL2A 2IS2A 4LB5A 4XMYA 1N75A 3SEZA 1JT6A 2VQLA 2CW8A 4HEA2 3OOPA 3BPXA 4L9TA 2OV7A 3F8NA 2PX9A 4HNUA 3NEUA 5E3MA 1SFEA 5F1JA 3WU0A 5CYVA 4BY1J 2KP6A 1OQYA 4A3DJ 3BJOA 1UJ8A 5LRRA 2RREA 2YU3A 3JRBA 3BTCA 2DBBA 1WFXA 1D3YA 3BC8A 2L9SA 3HKZN 2DOFA 4KJZA 4LOCA 3P5JA 3BDDA 4AM3A 1OR7A 1WI3A 1FZPB 4LJZF 2HYGD 4WF2A 1V4RA 5CKTA 2CW0F 2OJED 3CQZJ 1YW8A 3DV8A 3OR1C 1VQOI 3DPUA 2QBYB 4D5CA 5FFXA 3E5UA 1X3UA 5HLIA 3KEOA 1FTTA 1PUFB 1YG2A 2XAQA 2ADUA 2JA2A 1ON1A 5BPIA 4A5MA 2Y0SN 2VUMJ 3V7SA 2BY1A 1SMYF 5F0HA 1XSDA 3TEDA 4L18B 2CQKA 2W7NA 1DP3A 2M45A 1GVDA 4AD9A 3G73A 1MBEA 1P7IA 1WRJA 2XF7A 3ZQGA 2STWA 1P4XA 3FK7A 1DDNA 1W36C 3T5XA 1TWAJ 3CJRB 3ZQ7A 3ZMSA 2JZYA 4H4KC 4M6XA 4RGXA 2DPDA 1ETXA 1K4SA 2B0LA 1YW9A 2MH2A 1K79A 1JGGA 5C4XJ 4Q5SF 1Y0UA 2QKMB 4NQWB 4FE4A 9ANTA 2QLZA 2ESNA 3R0JA 3P7NA 2VJ5A 2AQEA 3BLYA 5DD4A 2AXTC 2VASA 3PFYA 3PO3J 3G3ZA 4U7BA 1VNDA 2NVYJ 4XK4A 2KZGA 2JVGA 3I4MJ 2HPMA 1TQMA 2PEXA 4DQ2A 2DJIA 1V5FA 4HZFA 2UV1A 5DV5A 3QP6A 2K3FA 3CMYA 2RAEA 4HNTA 2HQAA 5E3NA 2M87A 2CUJA 4ENJA 4OIPF 2A6TA 3M8JA 2EV5A 2Z5UA 2YU9J 3FMRA 5E3OA 5GTIC 1XDSA 5FRNA 4ABZA 1U5TB 1WH5A 2GA2A 1YRNA 5JR3A 1LVKA 1VQLI 4OIRF 4G7OF 4C2UA 2BGCA 3E6CC 1MJBA 4XKCA 4YEJA 3KLNA 2W84A 2HQ5A 3I5UA 2GLOA 4XL9A 3COAC 1R22A 1EJ9A 2KL4A 3V42A 4KYWA 4E7HA 2E7WA 2L2OA 1FYMA 1ZG1A 3KZZA 4HAMA 3TQNA 2HDWA 3KE2A 3VDXA 2ZJPF 2FSWA 1QZEA 3DU5A 2CUZA 5FO5A 3BTLA 2X6YA 3MD2A 2PQ8A 5FFZA 1KGSA 3E6BA 1XG1A 2BW3A 1ZARA 3TO6A 4IHSA 2JN6A 2KJBA 2PMHA 1IRXA 1R6RA 2H6BA 2UUZA 2M34A 5HLGA 3AG1H 3I3LA 3PUFA 2E2IJ 2VJJA 1IXCA 3L1PA 2ETHA 3LFUA 1RNLA 4BHBA 2Q0OA 3OIPA 2E1CA 5ILVA 5DCMB 3WE2A 5FJ8J 4A93J 2ME0A 1VTNC 1FOXA 1VQ7I 2HNHA 3K10A 2WA0A 4CCMA 1BC7C 3I55I 2XSJC 1SMTA 4IHWA 3JW4A 3TKYA 3MKWB 5K5QA 4YELA 2XAUA 4IQ4A 1ETOA 3GLXA 2JRMA 2NXNB 2LC2A 1K78A 3JAMK 3WU2C 3L9FA 5EG0A 3S3NA 2FMYA 2LF7A 1JKRC 3RZOJ 1IUFA 3C1DA 3WHBA 3HTUA 2VBYA 1K83J 1B72A 3DPTA 3MVPA 1I5ZA 4BGDA 2ISYA 4B3AA 2VQHA 5BPDA 3BG9A 3E97A 2CO5A 2Y31A 5HS7A 4BJ6C 5L3FA 3AL0C 1MNMC 4DYCA 1VQ6I 2JMWA 5EEGA 3SHFA 3ESWB 1ULYA 2BY2A 2YX7A 3KP2A 4EATA 1A31A 3O6BB 2QBYA 2QZ8A 1GT0C 2XF5A 3S32A 2Z16A 1P2FA 3ZMUA 5J1YA 1CF7B 2WAQN 4M3GA 2ZCWA 1MH3A 1QGPA 2EZHA 4O5VA 4E4HA 3LL7A 2NNYA 4A12A 1SD5A 4XLAA 3G2BA 1OYIA 4XSZF 2ZSHB 1J9IA 1XC5A 4IPAA 2RGVA 1XCVA 4M9XA 4CCKA 2AXLA 2E36A 1RKWA 1IN8A 2G9WA 1U3EM 2LBFA 2VJ4A 4W97A 3MN2A 2MFZA 1EH8A 3BQYA 3HXLA 3M1CA 1LEAA 2ZMEC 1ENHA 1XCBA 3EYYA 3KIOA 1FIPA 5E17F 3HHHA 4RLFA 1S7AA 4BU2A 2A6HF 5LHHA 4BEHA 1R23A 3LAPA 1R5HA 2DO7A 3CDIA 2L54A 2MLGA 1MBKA 4EEFG 2VODA 2WB1N 1HC8A 3GTGJ 2IGNA 1AOYA 1VQNI 2HEOA 1S8NA 1QHGA 1OCRH 3W2VA 1HW2A 3KP6A 4X0GA 2EV0A 2L9VA 4JK1X 4AIKA 3G6EI 2ID3A 2LKSA 2PMZN 3LSGA 4CA0A 4CGZA 1Y8QB 4NDLA 1DPRA 1HQCA 4IHXA 4UUSB 1J09A 2VL8A 4E7SA 4KMFA 2OQGA 2IGKA 2BBYA 3NWTA 3EDPA 2A3SA 3CUOA 2JSCA 5TGTA 3GFMA 3T1BA 3OS1A 3WTSC 1U8BA 4EJOA 3R61A 2V1XA 1DGWY 2P8TA 4IHTA 5FKKA 1BI2A 2XKPA 4GYGA 2PFBA 2ISZA 3VFZA 1MD0A 2LK2A 4V2FA 5DUIA 2DMUA 5D4SA 2FRHA 3QWLA 2CFXA 3WTTC 5J4VA 4UNOA 4HDUA 1UB9A 4AVZA 3CO7C 3FBNB 4DOZA 3TBIA 2COMA 3ZMVA 2K86A 3KYCB 3O2PE 2TRTA 2E5ZA 1MMNA 4G94A 2LF8A 4IRHA 4F92B 1E3HA 4D9JA 3HRMA 2LSOA 1X1DA 1MBFA 3TW6A 4CYCB 2H6CA 3BZKA 2FD5A 3RKYA 2HQRA 3RQ4A 3S1RJ 2JVHA 2NRAC 4EM1A 1DU0A 4EGZA 4F52A 2H1KA 4RAYA 1MMDA 1UFMA 2FA5A 2LH9A 1WZ2A 2ZFUA 2QF7A 4A3IJ 3GTKJ 5D8LB 4C3JJ 4BDYA 2O61A 2R7QA 3QOPA 5HODA 4HF2A 4M74A 2K9LA 1YJNI 2C6YA 3CZ6A 4ZTFA 5E3LA 2Z2SB 4LMYA 2ZJ2A 1B9NA 4XLFA 1XN7A 1RI7A 3CCLI 4KT6A 1SFUA 1MMGA 2LMDA 3WTXC 2XGXA 2R4GA 1LVAA 3LSTA 3OYKA 1JHFA 1S7EA 2R93J 5HNHA 4CZCA 1ERDA 4IF4A 2D2WA 5EZGA 2VPLA 1VQ9I 5CJ9A 5E8IA 2GZWA 3W2WA 4B44A 4O6JA 4W1UA 2BY3A 1ZHFA 2KRFA 2BHYA 2EIJH 2OZUA 3V4GA 1GV5A 1YE9A 3SZGA 4YRVA 3RKWA 2VXDA 1AWCA 1S6LA 4PJMA 4G6DA 5C44J 2PJRA 2KLOA 2NNNA 5TISC 4DNCA 2M4KA 3CMMA 4XKBA 4XONA 2VXZA 1BI3A 5DCFA 1TT5B 2Y2ZA 3RPUA 3DWLE 4LGWA 1X3WB 5H6RA 3K70C 1FOKA 1GVJA 1TTYA 1Z6RA 2ECBA 2FMLA 1R00A 3OYBA 1B1BA 1RETA 5CPRB 2O5RA 3KYDB 2M8GX 1SD4A 2GIVA 5KAIC 4PUSA 3GFIA 1FJLA 2Y75A 3VWBA 4HDVA 5E1WA 4A3CJ 2BY0A 3OMYA 5CVJA 1JXSA 2V9PA 1WJEA 2R7XA 3GBGA 1KONA 3KETA 4CCNA 2FQ4A 3GYHX 2LKXA 1I6HJ 2DFEA 3FKJA 3M9AA 2ZSIB 3V8LA 3RSNA 2W82A 1UHSA 2BE5F 1FBQA 3DKWA 5EZHA 4Y7NJ 1IV8A 4XN0A 3FWEA 4B3XA 4LFUA 3I71A 3FK6A 3H9GA 5ICFA 5FD5A 1RIOH 3OSGA 4BXUA 3D0SA 3K4NA 1MW7A 2WTEA 2P6SA 4ZYHA 3O8HA 4HX4A 1D0XA 1W7PD 4CCLA 1UZCA 4XRSA 2O6GE 2M2EA 5HOOA 2V79A 3MKYB 1GDTA 3CUQB 3JRIA 3QP5A 2QQ9A 4KUMA 2G0EA 3AAFA 4M9SA 2A68F 2FOWA 3SXYA 2FXAA 5M5YJ 4NC6A 3P9KA 3REOA 4R8HA 1QQIA 1JUMA 1FOYA 3BQZA 3QODA 1IV6A 3G1LA 2FJ1A 2EK5A 4U0YA 3OYCA 1YS7A 3GZ6A 1FLIA 3FXKA 4LITA 2XPWA 3JTHA 1ETYA 2Q8KA 2ZC2A 1EH7A 3L09A 3VYRB 4C9YA 5D4RA 1CQTA 3Q9SA 3ZCOA 1YO5C 5AIPA 5F1RA 3OYLA 2LY9A 4MLOA 1Q1HA 3I54A 5B5EC 3WE3A 1TBXA 1X58A 2OBPA 2L0KA 3HOZJ 4Y52J 1DU6A 2DOEA 3X2QH 4IL6C 5D5WB 1U9NA 4B48A 5LFAA 3CESA 2RNJA 4RGUA 3FZVA 2DQRA 1W5CC 2HTJA 1HCRA 2P0WA 4NHJA 3B6AA 4KFCA 2XB5A 3K4LA 4PGGA 5JVTA 2IVMA 2JK3A 4ZJZA 1FBUA 3F21A 4HV6A 1H89C 5FLMJ 1SVMA 3BJAA 3LNQA 1LPQA 1KQ9A 4BYYA 2BZTA 1WCMJ 4LG0B 3DBHB 2MSYA 5H2FC 2BXZA 2Y48A 1BBYA 4PSXA 4PK4A 4BE0A 4IQJA 4XLPF 3CJQB 3PUBA 1YQAA 4FX4A 4ZH4F 3BG5A 3ABMH 4OOIA 1EF4A 2P5VA 1BM9A 3KFWX 3KX2A 4RM2A 3A0HC 4K2EA 4AC0A 2R7UA 1Z05A 2V4JC 3Q0WA 2PMUA 3VOEA 2IW5A 1LFPA 3GF2A 1IDYA 3K4MA 4HA8A 2ECCA 3OL3A 3KCCA 2CV2A 5LGNA 5DUKA 2F4MB 2F5CA 3PFIA 5DM7F 3ABUA 3M8EA 2GOXB 1CGPA 1XGOA 2X1CA 3GLLA 4A6EA 5E1XA 2XGDA 3ZN1A 4EGYA 3ZMDA 4BQNA 1F43A 3ULQB 4B43A 1K7AA 2DMTA 2W4SA 5D5UB 4XOPA 2E35A 2DOAA 2IJLA 3ZQIA 1EH6A 3ZGKA 4HBLA 5J8CA 4PJNA 4DZPA 2Q2EA 1I3AA 3DEEA 3PSIA 3OYNA 2DCEA 2E2JJ 1B59A 3DTEA 2EB7A 4XIDA 1ZG3A 4UUTA 4AYBN 3P9CA 3TOAA 1TC3C 1OISA 4PFPA 2HKXA 3ABLH 4C2MJ 3KP4A 4KN7X 2EIKH 1H8AC 1QPIA 4DYRA 2NS7A 2LY2A 1PP8F 4CXFA 3PSFA 2CW7A 1WI9A 3I59B 1IAWA 5JLWA 1D1AA 2ZXWH 1OMIA 3BZ6A 1DPUA 1FOWA 4BQAA 2VBZA 4PCQA 1MSEC 4MFDA 3ZQLA 5A2QZ 3ASOH 3GZNB 4KT5C 2KIQA 1ODDA 2KHMA 3AG4H 2DFHA 2HDDA 1WVRA 2DA5A 3WG7H 2QEXI 1OR7C 4Y17A 4II3A 3RPQA 3ABKH 2MH9A 4MTDA 1TP4A 3RIRA 2XVCA 4PGHA 2QUFA 1MMSA 3VPRA 3C2HA 3U9GA 1A04A 3IAM2 3ZOBA 5IP7J 1R5GA 2X1DA 4BS9A 5FD6A 2HI3A 1RC9A 1G3TA 3FHZA 3GTQJ 3GX4X 3RTRA 1WGXA 1JKPC 2ZFWA 2EQRA 3H1CA 3A2KA 1JUPA 1YS6A 3OIQA 5JHFA 4I7HA 3LOCA 4I99C 3HRTA 4AIHA 4D1QA 1N25A 1A36A 1HDPA 4I0BA 3IH4A 4XM3A 4QPQA 2DFFA 4OU0A 4RMNA 1IXRC 1HKQA 1FYKA 4M6VA 4IOAF 4ZZDA 2DAOA 3ONQA 5FRMA 1LNWA 4CZZA 5LBQA 5K5RA 4YIFA 3LSPA 1JE8A 2VC1A 3FXOA 1IF1A 4ON0A 2OD5A 3HUGB 2R7OA 1MBHA 3J7YJ 2GM4A 2RQQA 1C0WA 3Q0VA 5KAFC 1OYWA 3AL0B 2W1OA 1ETQA 3CCJI 4ESBA 2XROA 1V3FA 4HX7A 4WXDA 4F93B 2K02A 5F6FA 3ZR8X 5D6FA 2DT6A 2O8XA 2R7WA 5GP9A 4GXOA 1P6RA 4XLHA 1TL8A 3MCZA 3CMEI 2E1MC 3JCUC 3BOQA 2NVTJ 2EA2A 2QWWA 1B8IA 2HPIA 1H88C 2Z9OA 2HVSA 2CQNA 1HOMA 2KDZA 4F55A 3IRQA 1FP2A 2V1DA 1ZRCA 3PQKA 2XSDC 1LE8A 2KFDA 4UV8A 5D6EA 2COBA 3BP8A 4EMSA 2BXYA 4B47A 2KZVA 4KISA 5K5OA 5IT3A 3H5AA 1JJ6C 4E7IA 1W7PB 4G7ZF 1XX5A 1BI0A 3MFKA 1X2NA 1WJAA 5DS9A 2HTSA 3G71I 3WODF 1BJAA 3K2AA 1T6SA 1XD7A 1G3YA 2O8KA 3LSMA 3A02A 4G12A 2XGCA 4QSHA 3DPLC 2JA7J 2I10A 3I4PA 1ZGAA 4J01A 4BJ5C 2E19A 1B9MA 4EJWA 2DMNA 1O3RA 3KPHA 5DEQA 5B66C 2DJNA 2E60A 3OOUA 4MGRA 3ZRGA 1G8XA 1SFXA 4HSRA 5FKNA 3TW7A 1SD7A 2ELJA 2NOJB 6PAXA 1AKHB 2HVQA 2VBWA 5EGOB 3F22A 2E71A 4KITB 1W5SA 2OC6A 1MH4A 3OYIA 4JBAA 5B1AH 3C7JA 3FXQA 3OYHA 2MYSA 5J1RA 2L7FP 5LGTA 2R5ZA 3IP4B 4LIUA 4XICA 4CHUA 2RC4A 2QSHX 1JUSA 5J6XA 1GXPA 2M7BA 2KRCA 1FWZA 4BKXA 2CH0A 2GWRA 2LP0A 4EV0A 1VQMI 1ZGWA 1RUNA 2XPUA 3BR1A 2R3SA 4RAZA 3U1DA 1Y1VJ 4GCVA 1TNSA 2M30A 1VQ5I 1JHHA 3KZYA 4OMZA 2BVLA 5IYDJ 4JQFA 4L9VA 2M0MA 3OYMA 1O57A 4S05A 4CSWA 3SQNA 2LREA 2K5CA 3G1OA 1YW7A 4IJAA 1W4MA 2DW4A 2E2HJ 3W6JB 3OYJA 3CCUI 2DDBA 2E1OA 2X48A 3QPLA 1ZKGA 2RDPA 1LFBA 4FX0A 1JKQC 2VBXA 1USTA 4IRIA 4KMUX 2W85A 4PJ0C 2L4MA 4YIIA 5E8GA 1U9OA 3QYFA 3IKTA 2ELKA 2JT1A 1MSFC 4D7MA 3QYBA 2CUFA 2H94A 1Z3XA 3CC2I 1ZH5A 1R4NB 1J75A 1GV2A 4A0XA 1YJWI 1FMWA 4P9FA 5KVRA 3BR3A 1Q1VA 1Z6TA 3S3MA 2D1HA 1PUFA 3E1SA 2F2EA 4A3GJ 1TT0A 3I53A 1JJ8C 1XGMA 4UB6C 4BL0B 3IUOA 1O3QA 5DYMA 4XQFA 5M3MJ 5CVRA 3OIOA 1XMAA 2NVQJ 2M9HA 4P96A 1T0FA 4JYKA 2IRFG 5H6QA 4HF1A 3R6SA 3WU1B 4L5JA 5GADJ 3FXMA 2YR2A 2IT0A 4ZYGA 1T98A 3NWSA 3QU6A 3EQLF 1O3SA 2FBKA 1RR7A 1POGA 4UVCA 5FKMA 3KYLA 4HV5A 4KNYA 1QBJA 3FIWA 1HKSA 4JOMA 5ILUA 2DK5A 1KZHA 4XR6A 3L2RA 2LRDA 3K4KA 4G6QA 5LLQA 4NQWA 2DTRA 2QQAA 5IP6A 1WJDA 3HOTA 2RNGA 2RN7A 2ZNZA 4LLGF 1BR1A 4M3DA 1DP7P 1ZGJA 1U8RA 1G4DA 1HW5A 2L3DA 5HS9A 2PBIA 2E5NA 4BJTA 1RZ4A 2WC2A 1QPMA 3BR2A 3O8GA 3GTJJ 1X19A 3GFJA 2CU7A 4E7LA 3LA7A 3OR2C 1MBJA 4WCGA 1YTYA 3MAJA 2L01A 4F3QA 3ECOA 4A3BJ 1FBSA 3GCMA 4I76A 4YFNF 2CUEA 1HKTA 2P7CB 5AONA 3BG6A 1JI8A 1U6GA 3CMAI 4B1RA 5DDGA 3LSRA 3IAS2 3ERMA 2XPVA 3ZMZA 4BBSJ 2VONA 3NAUA 1U5TA 2M8EA 3SDGA 1W36D 2KPMA 1KU3A 1IRFA 2IS6A 2V1NA 1XMKA 2TCTA 4XLNF 2IA2A 4E7KA 4FHTA 3A01B 4ZDOA 5LEKA 2KIUA 4ANJA 4JX5A 1ZRFA 1NG6A 3J80K 3VYTB 1R1TA 1X2MA 2XF6A 4BQOA 4B4CA 2EV6A 2KISA 3CO6C 4IHVA 4EJUA 3LQRA 3QU3A 4RDUA 3JR9A 2HWVA 3N05A 3J7AO 2HXOA 4FTHA 3FISA 2W57A 2DA4A 4UVAA 3GZ5A 2XHKA 4GRIA 3MZHA 2KMUA 4PJLA 4FT8A 3V8KA 1W1WE 2VQCA 2CFOA 2MABA 1KA8A 1VQ4I 3FDYA 5ICGA 3EETA 3K0LA 2KIFA 3FXLA 1XPXA 2DT5A 4DW6A 5IOYA 1MZBA 5KCMA 2DMQA 2P7VB 1WSUA 1TLHB 1Z0XA 4L0YB 3GTPJ 4M3EA 2STTA 3U1KA 2MC4A 3F8FA 2CRGA 2XASA 3F6OA 4XN3A 3CCSI 3FXRA 1FTZA 1BIAA 5DCMA 1OYYA 4N4NB 3H9QA 4I02A 4E7ZA 2CJJA 3GTLJ 1REPC 3C2BA 5FKLA 5J8FA 2ESHA 4EJVA 2E7XA 2EBIA 3S2DJ 1D0ZA 1E0EA 3HSFA 4BE2A 1T39A 3HOUJ 1QVTA 5BOXA 2NS0A 2V9VA 3HIFA 4V2GA 1RRJA 1OPCA 4NB5A 4C2TA 2MBFA 4PDKA 1T33A 1FC3A 1U2WA 4I6ZA 1V5EA 4ZYAA 2XDVA 2LNBA 2LYCA 2M5WA 5LD2C 1E3PA 4UVBA 2A61A 1IZ1A 4R1HA 2DQLA 3CLQA 1OLTA 2K85A 3F23A 1ZYRF 2IA0A 2VLAA 3CCQI 5KK1A 4LLLA 2LTPA 4WWCA 3IC7A 5A2QK 3OYEA 3F8MA 4NC7A 1LDKB 1MMAA 2P81A 4L5IA 2HZTA 1OCOH 1CF7A 1BW5A 3Q3SA 1F36A 1AU7A 2ZBKA 3G1MA 3KEYA 3DP7A 1HW1A 1ZAOA 2D1VA 2V6CA 1NH3A 1L3LA 2CYYA 2HZDA 3GTOJ 4ESFA 5IYBJ 3SJMA 5L3EA
chains in the Genus database with same CATH topology
1D5YA 4AC0A 1OCTC 1VNDA 1RESA 2NVYJ 4XK4A 3Q0WA 3I4MJ 5F27A 2IBDA 2O7OA 1IDYA 2ECCA 1HDDC 2YS9A 2AO9A 3CMYA 4X1EA 3HGGA 2RAEA 5M5XJ 3S14J 4M3FA 5E3NA 1GUUA 2EZIA 2YU9J 5E3OA 2DA1A 4ABZA 2XGDA 1WH5A 1YRNA 1F43A 2DMTA 1O4XA 4DZJA 3ZQIA 1A5JA 2MW8A 5BNGA 2HQ5A 4A3JJ 3PO2J 3HEFA 2GLOA 1TWFJ 2Y30A 1Z77A 4DZPA 2E2JJ 5IP9J 4XIDA 4UUTA 4AYBN 1TC3C 1ZTRA 2OF7A 4C2MJ 3S16J 3BTLA 1H8AC 3S1QJ 5C3EJ 1QPIA 1XG1A 4DYRA 2NS7A 3HB9A 3MKLA 4XRSG 2X6OA 4UUSA 3D1NI 1AKHA 2B63J 4BY7J 5EGOA 1OCPA 3BR5A 3H0GJ 5DTDA 2JN6A 5JLWA 5IOZA 2NVXJ 4DYQA 3HDDA 2M34A 1MSEC 3BTIA 4MFDA 3ZQLA 1W0UA 1ZR2A 2WV1A 2W48A 2E2IJ 2HDDA 3L1PA 3IH2A 2DA5A 2R0QC 2HOSA 1WH7A 4A3LJ 3HOYJ 1IRZA 1TWHJ 3K7AJ 1ETWA 1OJLA 1IC8A 5FJ8J 4A93J 1MBGA 2ME0A 2JWTA 2ID6A 3VPRA 3W6VA 3ZOBA 5IP7J 1E3OC 1JTXA 4MFEA 2HI3A 4IHWA 2N8GA 1TWGJ 3GTQJ 3I4NJ 1WGXA 1JKPC 1NK3P 2EQRA 1R9TJ 1JUPA 1ETOA 2EH3A 3LOCA 3ZQHA 3S17J 5EG0A 1HDPA 5K7HA 3IH4A 2GBYA 1JKRC 5IYCJ 1IUFA 3RZOJ 3BR0A 4CYCA 3WHBA 4FISA 3JREA 1K83J 1JT0A 1B72A 4D5FA 3MVPA 4M6VA 4B3AA 2R5YA 1RPWA 3BG9A 2XGEA 3HOVJ 2Y31A 3IH3A 2D5VA 3LSPA 4DYCA 3TP0A 1MNMC 2Y9YA 2JMWA 1MBHA 4D7NA 1OFCX 2EZKA 2GM4A 1JTYA 3Q0VA 1GT0C 1FEXA 5J1YA 5IPAA 1ETQA 2WAQN 3BTJA 3DEWA 4M3GA 1MH3A 2EZHA 1TWCJ 2Y9ZA 2CQXA 2R7ZJ 2L7ZA 4A3FJ 1LFUP 1XC5A 3QPSA 5GP9A 3HM5A 4C3HJ 1ETKA 5K7FA 5GPAA 1RKWA 1ZR4A 1VF9A 1I3QJ 2NVTJ 4W97A 3MN2A 4RBOA 4IHYA 3TP3A 1B8IA 1H88C 3S1NJ 5J3LA 3BQYA 2KDZA 1T56A 1QRYA 2XSDC 3BR6A 1LE8A 1ENHA 4GFBA 4XRMA 1FIPA 3M4OJ 2COBA 3B6CA 2XB0X 2OPTA 1JJ6C 1YRNB 1MBKA 4EEFG 1NTCA 2WB1N 3GTGJ 2HOTA 1X2NA 1K61A 5DS9A 3K2AA 2O8KA 3A02A 4G12A 3UKGA 2XGCA 3F0CA 4QSHA 2JA7J 2I10A 5K7ZA 1G2HA 2E19A 2ID3A 2DMNA 2PMZN 4QTRA 3LSGA 2DJNA 3OOUA 4NDLA 4IHXA 5FKNA 3HOXJ 3TW7A 2VI6A 4UUSB 2KT0A 3FKIJ 1AKHB 5EGOB 4JP0A 2ME6A 2JJ7A 3S15J 1MH4A 1WPKA 2VKEA 3CDLA 2DMPA 1U8BA 3A01A 5J1RA 2L7FP 2R5ZA 4XICA 3HGYA 5FKKA 2LD5A 3LSJA 2R92J 2LVSA 2DTZA 1JUSA 1ZK8A 3ZQFA 3RKQA 4FE7A 4BKXA 2LP0A 1ZGWA 1Y1WJ 4MIMA 2K9NA 2LK2A 2XPUA 3BR1A 3M3YJ 4V2FA 3RZDJ 2DMUA 2XRLA 1Y1VJ 2MGQA 3JRGA 2DA3A 3Q0UA 1A6IA 4A69C 3ZQCA 3HOWJ 4HNVA 4S0HB 2TRTA 5FLVA 1FIAA 5EG0B 5IYDJ 1I50J 1MBFA 1ITYA 3TW6A 4CYCB 3G1OA 2HXIA 2FD5A 1B72B 4X6AJ 4C3IJ 3S1RJ 2E2HJ 1DU0A 2E1OA 2X48A 2H1KA 3QPLA 1IG7A 1ZKGA 2X9DA 1LFBA 1JKQC 2QF7A 4A3IJ 3GTKJ 1ETVA 1U9OA 1NK2P 4C3JJ 2ELKA 5F0FA 3JRFA 5C4JJ 4D7MA 1W0TA 1XS9A 1MSFC 5HODA 2CUFA 5F0CA 3QQAA 1BJZA 1SFOJ 5E3LA 4BXXJ 1GV2A 3S2HJ 1UG2A 1APLC 3BR3A 1Q1VA 1PUFA 4A3GJ 3A03A 1JJ8C 2M0CA 4IEJA 1ZQ3P 5M3MJ 1S7EA 4JX4A 2R93J 3OIOA 2CQQA 2M9HA 5EZGA 2NVQJ 4JYKA 2QCOA 4BBRJ 1IDZA 4W1UA 5EF6A 1B8IB 3PM1A 2O9LA 1ORKA 3JRHA 1GV5A 1RR7A 1POGA 2ZB9A 5FKMA 1LE8B 2DA2A 3SFIA 2IEKA 3FIWA 2LR8A 5EEAA 2K40A 2VKVA 5C44J 4QIWN 4JX6A 5IP6A 2JA5J 4M3DA 1VFCA 1BW6A 1SANA 1UMQA 5EDNA 2DA7A 2Y2ZA 5F08A 2NS8A 2HYJA 3DCFA 4MO7A 2ECBA 2L9RA 3BR2A 3O8GA 2K9SA 2LFBA 3IV5A 3GTJJ 1RETA 2CU7A 1MBJA 2M8GX 2AHQA 1FJLA 4A3BJ 4I76A 5M5WJ 2CUEA 2DA6A 4A3CJ 4B1RA 2NOGA 4A3KJ 3BT9A 3JRCA 3S1MJ 3LSRA 2FX0A 2XPVA 4BBSJ 2VPRA 3NAUA 3GBGA 3RQIA 2FQ4A 3SDGA 2TCTA 2LKXA 1IJWC 1I6HJ 2L7MP 4A3MJ 3A01B 1U78A 2R5ZB 3JRAA 4JX5A 1UHSA 5EZHA 1P7JA 1X2MA 4Y7NJ 1VI0A 1BA5A 1AHDP 4L5EA 4B4CA 3FK6A 3WHCA 4IHVA 3H3VK 3JR9A 4RDUA 5EYRA 3OSGA 1BL0A 2HXOA 2HOAA 4FTHA 3FISA 2DA4A 3E7LA 3O8HA 5GPCA 5M3FJ 5F04A 2MG4A 4XRSA 2M2EA 1GDTA 4DW6A 3JRIA 3OSFA 4J19A 5IOYA 1JT6A 2G0EA 2DMQA 1Z0XA 2H8RA 5M5YJ 3GTPJ 2YUSA 4M3EA 1JUMA 3GTMJ 5E3MA 2CRGA 5F1JA 3BQZA 4BY1J 1IV6A 3G1LA 2FJ1A 4A3DJ 1FTZA 3CCYA 1HOMA 2R5YB 3JRBA 3BTCA 2CJJA 3GTLJ 2XPWA 3NARA 3C2BA 3HKZN 1ETYA 5FKLA 4LOCA 2JA8J 1CQTA 1QVUA 1WI3A 2EBIA 3S2DJ 5J1UA 1IGNA 3JRDA 3CQZJ 2LY9A 4FCYA 4MLOA 3HOUJ 4A3EJ 1QVTA 4D5CA 1X58A 1HLVA 2L0KA 3HOZJ 4Y52J 1JKOC 1DU6A 4V2GA 1FTTA 1PUFB 1U9NA 5JLXA 3HBLA 2Y0SN 2VUMJ 1T33A 1RKTA 2K9QA 2LLKA 4I6ZA 4M3BA 2EZLA 5F0HA 3TEDA 1HCRA 3BG3A 1HF0A 3B6AA 4AUXA 2XB5A 1GVDA 1MBEA 1P7IA 2JK3A 3ZQGA 1H89C 3FK7A 5FLMJ 1TWAJ 3LNQA 2IAIA 2LTPA 1ETXA 1WCMJ 2JA6J 2DN0A 2MSYA 5FKOA 1JGGA 5C4XJ 2P81A 1BW5A 4FE4A 9ANTA 3Q3SA 1F36A 1AU7A 3G1MA 3BG5A 1EF4A 3GTOJ 5IYBJ 3SJMA 3PO3J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D5Y A;  4AC0 A;  1OCT C;  1VND A;  1RES A;  2NVY J;  4XK4 A;  3Q0W A;  3I4M J;  5F27 A;  2IBD A;  2O7O A;  1IDY A;  2ECC A;  1HDD C;  2YS9 A;  2AO9 A;  3CMY A;  4X1E A;  3HGG A;  2RAE A;  5M5X J;  3S14 J;  4M3F A;  5E3N A;  1GUU A;  2EZI A;  2YU9 J;  5E3O A;  2DA1 A;  4ABZ A;  2XGD A;  1WH5 A;  1YRN A;  1F43 A;  2DMT A;  1O4X A;  4DZJ A;  3ZQI A;  1A5J A;  2MW8 A;  5BNG A;  2HQ5 A;  4A3J J;  3PO2 J;  3HEF A;  2GLO A;  1TWF J;  2Y30 A;  1Z77 A;  4DZP A;  2E2J J;  5IP9 J;  4XID A;  4UUT A;  4AYB N;  1TC3 C;  1ZTR A;  2OF7 A;  4C2M J;  3S16 J;  3BTL A;  1H8A C;  3S1Q J;  5C3E J;  1QPI A;  1XG1 A;  4DYR A;  2NS7 A;  3HB9 A;  3MKL A;  4XRS G;  2X6O A;  4UUS A;  3D1N I;  1AKH A;  2B63 J;  4BY7 J;  5EGO A;  1OCP A;  3BR5 A;  3H0G J;  5DTD A;  2JN6 A;  5JLW A;  5IOZ A;  2NVX J;  4DYQ A;  3HDD A;  2M34 A;  1MSE C;  3BTI A;  4MFD A;  3ZQL A;  1W0U A;  1ZR2 A;  2WV1 A;  2W48 A;  2E2I J;  2HDD A;  3L1P A;  3IH2 A;  2DA5 A;  2R0Q C;  2HOS A;  1WH7 A;  4A3L J;  3HOY J;  1IRZ A;  1TWH J;  3K7A J;  1ETW A;  1OJL A;  1IC8 A;  5FJ8 J;  4A93 J;  1MBG A;  2ME0 A;  2JWT A;  2ID6 A;  3VPR A;  3W6V A;  3ZOB A;  5IP7 J;  1E3O C;  1JTX A;  4MFE A;  2HI3 A;  4IHW A;  2N8G A;  1TWG J;  3GTQ J;  3I4N J;  1WGX A;  1JKP C;  1NK3 P;  2EQR A;  1R9T J;  1JUP A;  1ETO A;  2EH3 A;  3LOC A;  3ZQH A;  3S17 J;  5EG0 A;  1HDP A;  5K7H A;  3IH4 A;  2GBY A;  1JKR C;  5IYC J;  1IUF A;  3RZO J;  3BR0 A;  4CYC A;  3WHB A;  4FIS A;  3JRE A;  1K83 J;  1JT0 A;  1B72 A;  4D5F A;  3MVP A;  4M6V A;  4B3A A;  2R5Y A;  1RPW A;  3BG9 A;  2XGE A;  3HOV J;  2Y31 A;  3IH3 A;  2D5V A;  3LSP A;  4DYC A;  3TP0 A;  1MNM C;  2Y9Y A;  2JMW A;  1MBH A;  4D7N A;  1OFC X;  2EZK A;  2GM4 A;  1JTY A;  3Q0V A;  1GT0 C;  1FEX A;  5J1Y A;  5IPA A;  1ETQ A;  2WAQ N;  3BTJ A;  3DEW A;  4M3G A;  1MH3 A;  2EZH A;  1TWC J;  2Y9Z A;  2CQX A;  2R7Z J;  2L7Z A;  4A3F J;  1LFU P;  1XC5 A;  3QPS A;  5GP9 A;  3HM5 A;  4C3H J;  1ETK A;  5K7F A;  5GPA A;  1RKW A;  1ZR4 A;  1VF9 A;  1I3Q J;  2NVT J;  4W97 A;  3MN2 A;  4RBO A;  4IHY A;  3TP3 A;  1B8I A;  1H88 C;  3S1N J;  5J3L A;  3BQY A;  2KDZ A;  1T56 A;  1QRY A;  2XSD C;  3BR6 A;  1LE8 A;  1ENH A;  4GFB A;  4XRM A;  1FIP A;  3M4O J;  2COB A;  3B6C A;  2XB0 X;  2OPT A;  1JJ6 C;  1YRN B;  1MBK A;  4EEF G;  1NTC A;  2WB1 N;  3GTG J;  2HOT A;  1X2N A;  1K61 A;  5DS9 A;  3K2A A;  2O8K A;  3A02 A;  4G12 A;  3UKG A;  2XGC A;  3F0C A;  4QSH A;  2JA7 J;  2I10 A;  5K7Z A;  1G2H A;  2E19 A;  2ID3 A;  2DMN A;  2PMZ N;  4QTR A;  3LSG A;  2DJN A;  3OOU A;  4NDL A;  4IHX A;  5FKN A;  3HOX J;  3TW7 A;  2VI6 A;  4UUS B;  2KT0 A;  3FKI J;  1AKH B;  5EGO B;  4JP0 A;  2ME6 A;  2JJ7 A;  3S15 J;  1MH4 A;  1WPK A;  2VKE A;  3CDL A;  2DMP A;  1U8B A;  3A01 A;  5J1R A;  2L7F P;  2R5Z A;  4XIC A;  3HGY A;  5FKK A;  2LD5 A;  3LSJ A;  2R92 J;  2LVS A;  2DTZ A;  1JUS A;  1ZK8 A;  3ZQF A;  3RKQ A;  4FE7 A;  4BKX A;  2LP0 A;  1ZGW A;  1Y1W J;  4MIM A;  2K9N A;  2LK2 A;  2XPU A;  3BR1 A;  3M3Y J;  4V2F A;  3RZD J;  2DMU A;  2XRL A;  1Y1V J;  2MGQ A;  3JRG A;  2DA3 A;  3Q0U A;  1A6I A;  4A69 C;  3ZQC A;  3HOW J;  4HNV A;  4S0H B;  2TRT A;  5FLV A;  1FIA A;  5EG0 B;  5IYD J;  1I50 J;  1MBF A;  1ITY A;  3TW6 A;  4CYC B;  3G1O A;  2HXI A;  2FD5 A;  1B72 B;  4X6A J;  4C3I J;  3S1R J;  2E2H J;  1DU0 A;  2E1O A;  2X48 A;  2H1K A;  3QPL A;  1IG7 A;  1ZKG A;  2X9D A;  1LFB A;  1JKQ C;  2QF7 A;  4A3I J;  3GTK J;  1ETV A;  1U9O A;  1NK2 P;  4C3J J;  2ELK A;  5F0F A;  3JRF A;  5C4J J;  4D7M A;  1W0T A;  1XS9 A;  1MSF C;  5HOD A;  2CUF A;  5F0C A;  3QQA A;  1BJZ A;  1SFO J;  5E3L A;  4BXX J;  1GV2 A;  3S2H J;  1UG2 A;  1APL C;  3BR3 A;  1Q1V A;  1PUF A;  4A3G J;  3A03 A;  1JJ8 C;  2M0C A;  4IEJ A;  1ZQ3 P;  5M3M J;  1S7E A;  4JX4 A;  2R93 J;  3OIO A;  2CQQ A;  2M9H A;  5EZG A;  2NVQ J;  4JYK A;  2QCO A;  4BBR J;  1IDZ A;  4W1U A;  5EF6 A;  1B8I B;  3PM1 A;  2O9L A;  1ORK A;  3JRH A;  1GV5 A;  1RR7 A;  1POG A;  2ZB9 A;  5FKM A;  1LE8 B;  2DA2 A;  3SFI A;  2IEK A;  3FIW A;  2LR8 A;  5EEA A;  2K40 A;  2VKV A;  5C44 J;  4QIW N;  4JX6 A;  5IP6 A;  2JA5 J;  4M3D A;  1VFC A;  1BW6 A;  1SAN A;  1UMQ A;  5EDN A;  2DA7 A;  2Y2Z A;  5F08 A;  2NS8 A;  2HYJ A;  3DCF A;  4MO7 A;  2ECB A;  2L9R A;  3BR2 A;  3O8G A;  2K9S A;  2LFB A;  3IV5 A;  3GTJ J;  1RET A;  2CU7 A;  1MBJ A;  2M8G X;  2AHQ A;  1FJL A;  4A3B J;  4I76 A;  5M5W J;  2CUE A;  2DA6 A;  4A3C J;  4B1R A;  2NOG A;  4A3K J;  3BT9 A;  3JRC A;  3S1M J;  3LSR A;  2FX0 A;  2XPV A;  4BBS J;  2VPR A;  3NAU A;  3GBG A;  3RQI A;  2FQ4 A;  3SDG A;  2TCT A;  2LKX A;  1IJW C;  1I6H J;  2L7M P;  4A3M J;  3A01 B;  1U78 A;  2R5Z B;  3JRA A;  4JX5 A;  1UHS A;  5EZH A;  1P7J A;  1X2M A;  4Y7N J;  1VI0 A;  1BA5 A;  1AHD P;  4L5E A;  4B4C A;  3FK6 A;  3WHC A;  4IHV A;  3H3V K;  3JR9 A;  4RDU A;  5EYR A;  3OSG A;  1BL0 A;  2HXO A;  2HOA A;  4FTH A;  3FIS A;  2DA4 A;  3E7L A;  3O8H A;  5GPC A;  5M3F J;  5F04 A;  2MG4 A;  4XRS A;  2M2E A;  1GDT A;  4DW6 A;  3JRI A;  3OSF A;  4J19 A;  5IOY A;  1JT6 A;  2G0E A;  2DMQ A;  1Z0X A;  2H8R A;  5M5Y J;  3GTP J;  2YUS A;  4M3E A;  1JUM A;  3GTM J;  5E3M A;  2CRG A;  5F1J A;  3BQZ A;  4BY1 J;  1IV6 A;  3G1L A;  2FJ1 A;  4A3D J;  1FTZ A;  3CCY A;  1HOM A;  2R5Y B;  3JRB A;  3BTC A;  2CJJ A;  3GTL J;  2XPW A;  3NAR A;  3C2B A;  3HKZ N;  1ETY A;  5FKL A;  4LOC A;  2JA8 J;  1CQT A;  1QVU A;  1WI3 A;  2EBI A;  3S2D J;  5J1U A;  1IGN A;  3JRD A;  3CQZ J;  2LY9 A;  4FCY A;  4MLO A;  3HOU J;  4A3E J;  1QVT A;  4D5C A;  1X58 A;  1HLV A;  2L0K A;  3HOZ J;  4Y52 J;  1JKO C;  1DU6 A;  4V2G A;  1FTT A;  1PUF B;  1U9N A;  5JLX A;  3HBL A;  2Y0S N;  2VUM J;  1T33 A;  1RKT A;  2K9Q A;  2LLK A;  4I6Z A;  4M3B A;  2EZL A;  5F0H A;  3TED A;  1HCR A;  3BG3 A;  1HF0 A;  3B6A A;  4AUX A;  2XB5 A;  1GVD A;  1MBE A;  1P7I A;  2JK3 A;  3ZQG A;  1H89 C;  3FK7 A;  5FLM J;  1TWA J;  3LNQ A;  2IAI A;  2LTP A;  1ETX A;  1WCM J;  2JA6 J;  2DN0 A;  2MSY A;  5FKO A;  1JGG A;  5C4X J;  2P81 A;  1BW5 A;  4FE4 A;  9ANT A;  3Q3S A;  1F36 A;  1AU7 A;  3G1M A;  3BG5 A;  1EF4 A;  3GTO J;  5IYB J;  3SJM A;  3PO3 J; 
#chains in the Genus database with same CATH topology
 1T38 A;  2Z99 A;  1RES A;  1X1A A;  4FAS D;  3OWT A;  1Y0N A;  4PSW A;  3BY6 A;  4A0Y A;  2PJP A;  5F27 A;  2Z3Y A;  1UG0 A;  2IBD A;  4LB6 B;  1TZL A;  4N0B A;  3OS0 A;  2AO9 A;  3AKZ A;  2VOP A;  2FUG 2;  3HGG A;  1S7O A;  2WAD A;  2FOK A;  3H3Z A;  3MQ0 A;  4X1E A;  1VZ0 A;  2OCC H;  3IWZ A;  4M3F A;  2GOM A;  1VQ8 I;  5FB2 A;  3KLO A;  3HL2 A;  1GUU A;  3FF5 A;  2V1U A;  3ERE D;  3DU6 A;  2JUC A;  3VOD A;  2DA1 A;  4M6Y A;  4HLY A;  1FP1 D;  2I8D A;  4CIC A;  1X3Z B;  1MDM B;  1WQ2 A;  4DZJ A;  3OYA A;  1A5J A;  3HPG A;  2F4O B;  1J2X A;  5BNG A;  3PO2 J;  3M8F A;  2R7R A;  2XAJ A;  3K4B A;  2XRN A;  1TWF J;  2Y30 A;  4IKF A;  1Z67 A;  1WJB A;  1X1C A;  2Z1D A;  5IP9 J;  1S72 I;  2LOO A;  2XAH A;  1M1E B;  4BHC A;  4ZDP A;  2HU9 A;  1HSJ A;  5L3G A;  1EA3 A;  5FLX Z;  1IW7 F;  3R0A A;  3S16 J;  3S1Q J;  4MQV A;  2H09 A;  3HB9 A;  4UUS A;  2TDX A;  2X6O A;  3D1N I;  1EV7 A;  3DKX A;  1OCP A;  3BR5 A;  3H0G J;  3H3U A;  3LA2 A;  4Y3O A;  5IOZ A;  3E0J B;  3DQV C;  2V9K A;  2VIX A;  3HDD A;  4LIV A;  2O03 A;  2P6T A;  1W0U A;  1ZR2 A;  1SAX A;  3IH2 A;  4A3L J;  1WH7 A;  1KU7 A;  1V5G A;  1LDJ A;  1TWH J;  3PNY A;  5H20 A;  3K7A J;  1ETW A;  4FQG A;  3K4J A;  1IC8 A;  2DLL A;  3FBI B;  1UAA A;  1MBG A;  2DYR H;  2JWT A;  2AS5 F;  1U0J A;  1GLN A;  1XB4 A;  5E1Z B;  3W6V A;  2ICW G;  2RVC A;  3SEQ A;  1B6A A;  1I1G A;  4Q4Z F;  2DFI A;  4HX8 A;  2JUG A;  5B3S H;  2N8G A;  2JPC A;  2GQQ A;  3F8B A;  1Y56 A;  3JSO A;  2UWM A;  2EWN A;  3FXJ A;  4N9H A;  4CO8 A;  2GBY A;  3CCR I;  3C2G A;  2MD0 A;  3HSE A;  3GME A;  3BR0 A;  4NC8 A;  2L7K A;  3EUH A;  5IYC J;  4CYC A;  5BS6 A;  4FIS A;  4HPQ A;  3JRE A;  1JT0 A;  4GGG A;  4D5F A;  3K1P A;  4KIF A;  2Q1Z B;  3LFK A;  4OWR B;  4XKV A;  3N4M A;  1RPW A;  3BPV A;  2XGE A;  3K4C A;  2ZXJ A;  3Q9V A;  2IGO A;  3F8C A;  2Y9Y A;  3G4S I;  3P9I A;  3A1Y A;  3M1E A;  1WJ5 A;  2X1E A;  1OFC X;  2EZK A;  3H5R A;  2HQN A;  1F4K A;  3HJE A;  2BOL A;  3TOB A;  1FEX A;  4RS8 A;  1YLF A;  3BTJ A;  1UHM A;  3F72 A;  3SZP A;  5K1Y A;  4PJJ A;  2X51 A;  1D0Y A;  1TWC J;  2A69 F;  2Y9Z A;  4HG2 A;  2V26 A;  1F5T A;  2JPB A;  3RYR A;  2L7Z A;  2M1B A;  4MEY F;  4A3F J;  1RUO A;  3ELK A;  2VN2 A;  3I58 A;  5IY5 H;  4C3H J;  1SEU A;  2ZXI A;  1ON2 A;  3FM5 A;  1ZR4 A;  1VF9 A;  2IGM A;  4QLC U;  3E5X A;  4RBO A;  4IHY A;  3TP3 A;  3K2Z A;  3S1N J;  5J3L A;  1IO2 A;  4KN4 X;  3BR6 A;  2PI0 A;  5KNL A;  4HYE A;  2OQR A;  2QM3 A;  1UEL B;  3QOE A;  2E1M B;  1FX7 A;  1XTA A;  2QQ8 A;  2BHZ A;  3AG2 H;  4RB0 A;  1T95 A;  4HW0 A;  2KJC A;  4HQE A;  1UHW A;  1NHA A;  1I27 A;  1YRN B;  2VC0 A;  1Z1D A;  3E6M A;  2UXX A;  2HOT A;  3H92 A;  4A0Z A;  5L3C A;  5CVV A;  2CS3 A;  5AIQ A;  3H5N A;  2MD5 A;  1H9G A;  1DGR M;  3HZJ A;  3AG3 H;  4ZZL A;  1RR8 C;  1G2H A;  1N78 A;  4IOC F;  1PUE E;  1P4W A;  3B02 A;  4LK1 F;  3TO7 A;  5ILS A;  5J4Y A;  4RB2 C;  4RB3 C;  1VQK I;  5DM6 F;  4U0V A;  1XSX A;  2L9N A;  1K4T A;  1ZRE A;  3VYS B;  4ZDL A;  1TW2 A;  3GFL A;  4HST A;  2VI6 A;  1D1C A;  2RKH A;  2KT0 A;  2HS5 A;  2BW3 B;  4QWQ A;  4U7D A;  1KU9 A;  4JP0 A;  2ME6 A;  1MDM A;  4J00 A;  1WPK A;  2W00 A;  1YI2 I;  1LUJ B;  3RPU D;  4BQQ A;  4ZYD A;  4S04 A;  5L3D A;  4MEX F;  1D8J A;  5LEJ A;  3ZMT A;  2DMP A;  3CCM I;  4CCO A;  3HGY A;  2LD5 A;  3LSJ A;  2LVS A;  2IA1 A;  3CJN A;  4UV9 A;  1R36 A;  3RKQ A;  4FE7 A;  2YPR A;  1Y1W J;  2EJR A;  4AIJ A;  5GAH J;  2EFP A;  2QQB A;  4HF0 A;  2K9N A;  2LG4 A;  4MIM A;  4MTE A;  4RB1 A;  3M3Y J;  3K70 D;  1TQP A;  1ZG5 A;  3LAJ A;  2WBM A;  3OS2 A;  3RDI A;  4AU7 A;  3IRR A;  3MKZ A;  3CCV I;  1SVO A;  3JRG A;  2X6X A;  1ZRD A;  3V8J A;  3Q0U A;  1YHQ I;  2EPF A;  1A6I A;  1WKM A;  3ASN H;  3ZQC A;  3SDB A;  4HNV A;  5FGM A;  4S0H B;  4EM0 B;  2Y0S A;  3V7R A;  5EJC A;  2VOO A;  5J47 A;  1K78 B;  1XGS A;  1FIA A;  3CUQ A;  5EG0 B;  3D5L A;  1I50 J;  4P9U A;  3QYE A;  1W5T A;  4Z2Y A;  2IXS A;  3VEP A;  2DK8 A;  3QPT A;  1FPQ A;  3UR3 C;  1R49 A;  1B72 B;  2ZO4 A;  2OTJ I;  4C3I J;  1S29 A;  1X4O A;  4HRI A;  4N9I A;  1OKR A;  2EFN A;  4AVP A;  1WJC A;  4YFX F;  2LY1 A;  3HOS A;  1AA7 A;  3C3W A;  3HRS A;  1ETV A;  1EKE A;  1PDN C;  1NK2 P;  2W24 A;  5F0F A;  3JRF A;  2NYX A;  5C4J J;  4BDZ A;  5F0C A;  3QQA A;  2KIM A;  3DXJ F;  3SYT A;  2GA1 A;  1S5L C;  1SFO J;  4KIG A;  2BYV E;  2CG4 A;  5ED4 A;  2AQF A;  3CTA A;  1UG2 A;  3FMS A;  1L0O C;  2FBI A;  2VKH A;  3EUA A;  1YIJ I;  3CC7 I;  3A03 A;  2ZJQ F;  2GXA A;  4WX9 A;  3K69 A;  1YIT I;  4IEJ A;  4I0A A;  1ZQ3 P;  1VQP I;  4JX4 A;  2K4J A;  2CQQ A;  2LBF B;  1TW3 A;  4G8X A;  1SVL A;  2IS1 A;  1J5Y A;  4BBR J;  5EF6 A;  3PM1 A;  4PFO A;  1ORK A;  3JRH A;  2ZB9 A;  1HBX G;  3NRV A;  4GYI A;  2DA2 A;  3SFI A;  5BMZ A;  3W3C A;  4M72 A;  4LG0 A;  4IX7 A;  4UY8 I;  2QEN A;  3GW2 A;  2H8W A;  1SAU A;  4LD5 A;  5EEA A;  1QNT A;  4BEH B;  4UXN A;  2K40 A;  2M4G A;  5CQE A;  2F5D A;  4QIW N;  3K1M A;  4JX6 A;  1ZLK A;  3LQQ A;  2L4A A;  3C18 A;  3SFZ A;  1XDU A;  2HOE A;  1BW6 A;  1UMQ A;  5EDN A;  2DA7 A;  2ZME B;  2XAG A;  2HYJ A;  4I2O A;  3FHN A;  1G3W A;  4MO7 A;  3K9T A;  2LFB A;  3D5R C;  3IV5 A;  4G6T B;  1KYW A;  4ESJ A;  3MZ8 A;  2AHQ A;  5M5W J;  5HDN A;  1R5I D;  2DA6 A;  3DBR B;  4IRG A;  1X4P A;  5TJJ A;  1R7J A;  2X0L A;  2NOG A;  3WTZ A;  3S1M J;  4OIQ F;  2BVM A;  2FX0 A;  5JVG F;  4IO9 F;  2PG4 A;  3CF2 A;  4DBR A;  2IP2 A;  4NUB A;  4Z6Y A;  1N77 A;  2FQ3 A;  3RI4 A;  4F91 B;  5FRO A;  2X4H A;  4G7H F;  5HLH A;  3BCA A;  2R7F A;  2L7M P;  4P1W A;  3BWG A;  3PIP F;  2Y69 H;  2M7A A;  4E70 A;  3ROU A;  1G3S A;  2F48 A;  4A2U A;  3FM3 A;  1I6X A;  1BR2 A;  1VI0 A;  1Z91 A;  4GO1 A;  2ZXH A;  3LSI A;  3MMY B;  2Y0M A;  3BCB A;  2L02 A;  3T8T A;  4CH7 A;  3WHC A;  3HSR A;  5F64 A;  3H3V K;  1PP7 U;  5EYR A;  1MGT A;  4ENM A;  4LLN A;  2HOA A;  2RV8 A;  4HQM A;  2DU9 A;  3ECH A;  1J0R A;  2G7H A;  3WGH A;  1YFH A;  3E7L A;  3J81 Z;  3H0D A;  1KQ8 A;  3T8R A;  5M3F J;  2EFQ A;  2LDU A;  2HR3 A;  3M07 A;  1XMX A;  2QGU A;  3I59 A;  5D5X B;  3GO5 A;  2P5K A;  3L2V A;  5B1B H;  3CLO A;  3EUK L;  3OSF A;  4J19 A;  4G9Y A;  3F6V A;  4XSX F;  1Y8R B;  1YOV B;  1H9T A;  4F7Z A;  2H27 A;  2H8R A;  4NNJ A;  2CV1 A;  2YUS A;  3D5S C;  4B09 A;  5GTH C;  2R7V A;  2ZJR F;  3GTM J;  3CF5 F;  4BH9 A;  3ISP A;  4L0Z B;  3DF8 A;  3CCY A;  1A35 A;  2QKL B;  3VSL A;  3F9K A;  4ASN A;  4CYD A;  2A5Y B;  3GXO A;  2OCE A;  4UHT A;  3L2U A;  2R5Y B;  3GVA A;  3V7C A;  1DQU A;  3LSK A;  1IN5 A;  4FET A;  3WTU C;  3NAR A;  1R58 A;  2DT7 B;  2WAQ A;  2JA8 J;  5LRS A;  2Z33 A;  1QVU A;  1BN5 A;  5J1U A;  1TQI A;  2BEO A;  1IGN A;  3JRD A;  2VKD A;  4FCY A;  3GEZ A;  4Q47 A;  3VYU B;  3R60 A;  4A3E J;  4IZZ A;  2GXB A;  3I56 I;  1HLV A;  1JKO C;  5KHD A;  1T0F C;  1FYL A;  2DPU A;  4BAC A;  5JLX A;  3NQO A;  3HBL A;  5FLX K;  1BIB A;  5JFR A;  4OIO F;  1FSH A;  1RKT A;  2K9Q A;  2LLK A;  5CVU A;  4M3B A;  3MEX A;  5J40 A;  2EZL A;  5LHI A;  1V55 H;  4KA4 A;  5IT9 Z;  3RCO A;  4MHG A;  2P5L C;  3BG3 A;  3CDH A;  1HF0 A;  3K1N A;  4AUX A;  3QRF F;  1TNT A;  3U21 A;  1LKX A;  3L2W A;  4ZTJ A;  1E17 A;  3DTK A;  3HUG A;  2IAI A;  2QSG X;  3KP7 A;  5HDG A;  1S3J A;  1P4A A;  2JA6 J;  2DN0 A;  5FKO A;  3QAH A;  3WGI A;  2WB1 A;  3B73 A;  3QPH A;  2PJR B;  2W25 A;  3ZPL A;  4OIN F;  2K4B A;  1Z21 A;  2B9S A;  2IS4 A;  1R1U A;  3HHG A;  2X85 A;  4RA2 A;  2FE3 A;  2I5U A;  2FBH A;  2XKO A;  1D5Y A;  5HVQ C;  1OCT C;  4XRF A;  1IN6 A;  4LK0 F;  3A0B C;  2PMZ A;  1T8I A;  2OUM A;  1IUY A;  3TGN A;  4EJT A;  2O7O A;  4P55 A;  1SFK A;  2FNA A;  1HDD C;  2YS9 A;  4WK8 F;  1U5T C;  2UZK A;  2CSO A;  2XUB A;  2GAU A;  4ETS A;  5M5X J;  4H0E A;  3S14 J;  1OCZ H;  2EZI A;  3N97 A;  1Z3Y A;  2DOD A;  3ZQQ A;  2OA4 A;  2R7T A;  2QYO A;  4L9J A;  3JTG A;  5JI6 A;  3HG9 A;  1XSV A;  1W7P A;  4C30 A;  1STZ A;  2CWE A;  2ZME A;  1O4X A;  3FMQ A;  3OV8 A;  3DKY A;  1KQ0 A;  3H35 A;  2MW8 A;  4RGR A;  4A3J J;  3HEF A;  4P5O A;  1Z77 A;  4BNC A;  4B8X A;  4PZJ A;  4YG2 F;  5ERI A;  4WXC A;  3LWF A;  1WHU A;  2ZNY A;  2EFO A;  4I09 A;  3PJR A;  5HS8 A;  1UCR A;  3OL4 A;  4TV7 A;  1ZTR A;  1Z9C A;  3LSH A;  2OF7 A;  3E6D A;  2F4I A;  1P92 A;  2VB6 A;  5C3E J;  2GXG A;  2QVO A;  3MKL A;  4XRS G;  4BXF A;  4YIR X;  4HOB A;  5CQG A;  1AKH A;  2B63 J;  4BY7 J;  1OCC H;  5EGO A;  5DTD A;  4DBQ A;  2NVX J;  2J5O A;  4DYQ A;  5LHG A;  4U87 A;  1ZLJ A;  3BTI A;  3S2W A;  5ICC A;  2P4W A;  5E20 A;  4GDF A;  4DGW B;  3K6G A;  2WV1 A;  2W48 A;  3AFH A;  1PJR A;  2R0Q C;  2WAE A;  2HOS A;  2K3P A;  3WTV C;  1IRZ A;  3HOY J;  1F1Z A;  4CDG A;  2PLY A;  1OJL A;  2LKP A;  4KDP A;  2HFH A;  4RGS A;  1ZN2 A;  4U0W A;  4EVI A;  1Z7U A;  2ID6 A;  3WTY C;  1Z7L A;  2HVR A;  1SD6 A;  5BQT A;  3H36 A;  1O7L A;  1E3O C;  3TDZ C;  1JTX A;  3A4C A;  3DEU A;  4MFE A;  4YFK F;  3W6K B;  1LQ1 A;  3WG9 A;  3HPH A;  1TWG J;  2YSR A;  2YX4 A;  2EIL H;  2KRH A;  3I4N J;  1NK3 P;  2FF4 A;  3R4K A;  1R9T J;  2EH3 A;  2WWY A;  3ZQH A;  2CMP A;  3TMO A;  4BAY A;  1XGN A;  3S17 J;  1BOB A;  3EYI A;  2O3F A;  5K7H A;  3PIO F;  1D5V A;  4QPO A;  5CLS A;  4MQ9 F;  1HA8 A;  1ZEL A;  3IHU A;  1I39 A;  3OY9 A;  1E2X A;  1J7K A;  2R5Y A;  3OYG A;  3MWM A;  3HOV J;  2KQR A;  2D5V A;  2A5W A;  2HYF A;  2L5Q A;  3IH3 A;  1LB2 A;  2OTL I;  4M9Z A;  3TP0 A;  2K9M A;  4V19 K;  1FY7 A;  2RQP A;  1ONV A;  3RKX A;  3RJP A;  3KP3 A;  3JSP A;  1F9N A;  4D7N A;  2MA3 A;  4CCJ A;  3M7G A;  3H9J A;  1JTY A;  1HST A;  2NAZ A;  5GAE J;  5LGU A;  3Q5F A;  5IPA A;  3DEW A;  4KIB A;  1MND A;  2UXN A;  2VT3 A;  1MNE A;  1QO0 D;  1P9Q C;  2K27 A;  3ZP5 A;  1KYZ A;  2CQX A;  3DLA A;  4XNF A;  3I64 A;  3HTS B;  2R7Z J;  1LFU P;  2A6E F;  3CP2 A;  3QPS A;  1SC7 A;  3L00 A;  3HM5 A;  3IKV A;  3L2Q A;  1ETK A;  5K7F A;  5GPA A;  4RAF A;  4EM2 A;  2CQ7 A;  5HNF A;  1I3Q J;  1IXS B;  3HYI A;  2PN6 A;  4ITV A;  2G7U A;  2NVU B;  4DJA A;  2VE9 A;  2VJI A;  1T56 A;  4I98 B;  1QRY A;  3BZC A;  4IVN A;  4II2 A;  4GFB A;  4XRM A;  3ABT A;  2V7F A;  3M4O J;  1V54 H;  3LMM A;  3B6C A;  1IN4 A;  1QA6 A;  1R4M B;  2V6E A;  2EIM H;  2XB0 X;  2OPT A;  2EIN H;  1FNN A;  4OAY A;  1NTC A;  2QA4 I;  2QSF X;  3TO9 A;  2JRT A;  2FEZ A;  1K61 A;  3KP5 A;  1HXD A;  1PVE A;  3FXU A;  1T08 B;  5HDK A;  4EQQ A;  2Q2E B;  4XLE A;  3UKG A;  2VT2 A;  3HC7 A;  3F0C A;  4N4O B;  3U2R A;  2H1L A;  1GXQ A;  4ZC3 A;  3JAM Z;  5K7Z A;  3RYP A;  3S3O A;  3CD6 I;  2DXI A;  4OAZ A;  1LEB A;  2EFW A;  4XLC A;  4QTR A;  3DFG A;  2F5V A;  2X6W A;  3BG7 A;  3PQJ A;  4M73 A;  3CCE I;  2OU2 A;  4XBF A;  2D45 A;  1BI1 A;  4CUG A;  1WWX A;  4RAG A;  2XAF A;  3HOX J;  4UUV A;  1YYV A;  1A6Q A;  3FKI J;  4ZYE A;  1T2K A;  3ZN0 A;  3TDU C;  5DD8 A;  1K6Y A;  2JJ7 A;  3S15 J;  1I1S A;  2VKE A;  3CJT B;  5GAG J;  3PNT A;  2FNP A;  3CDL A;  3A01 A;  1YIO A;  5E18 F;  3L7W A;  3GUD A;  3S93 A;  1IRG A;  2VQG A;  2R92 J;  2DTZ A;  1ZK8 A;  3ZQF A;  2O0Y A;  1PYV A;  4M71 A;  1B4A A;  1D1B A;  3PNV A;  5EEH A;  1YX3 A;  4U88 A;  3E5Q A;  3RZD J;  1R1V A;  2XRL A;  4LG3 A;  3DLL F;  2VE8 A;  1D8K A;  3KEQ A;  5TRD A;  3EUH C;  2MGQ A;  4XOT A;  5CVI A;  3DBL B;  2E1N A;  2DA3 A;  1NG7 A;  4A69 C;  3HOW J;  3S8P A;  1FT9 A;  5HLT A;  5FLV A;  1JGS A;  4RM3 A;  3FX3 A;  3WTW C;  1MJ9 A;  1ITY A;  1BR4 A;  2BV6 A;  2HXI A;  1G6N A;  1FMV A;  2JSP A;  2WV0 A;  1J59 A;  4Y4R A;  1USS A;  1O7F A;  4X6A J;  4A5N A;  1BC8 C;  4BUP A;  1IG7 A;  1DUX C;  2X9D A;  1MJA A;  4DIQ A;  5D8K B;  1MIJ A;  3I9V 2;  3T0Y A;  4UB8 C;  4Y15 A;  1W0T A;  4NBQ A;  3HRU A;  1XS9 A;  2MC3 A;  4WXH A;  4R79 A;  4E7J A;  3E3V A;  3BRO A;  3MZY A;  2ZKZ A;  3OYD A;  1QZY A;  1BJZ A;  2XIG A;  1Y39 A;  1X1P A;  2FU4 A;  2A05 A;  4BXX J;  3S2H J;  2B7E A;  2M3A A;  2KKO A;  1LJ9 A;  1APL C;  4Q48 A;  2ELH A;  5L3B A;  2XV4 S;  2WY8 Q;  4AWX B;  4A6D A;  2M0C A;  2E34 A;  3DTI A;  2K7L A;  4Y13 A;  2DI3 A;  3J81 K;  5JHU A;  2JQ7 A;  2OZ6 A;  4ENN A;  1G59 A;  2QCO A;  4D0P A;  1LDD A;  1K6O A;  5E79 C;  4I01 A;  1B8I B;  5D5V B;  3J80 Z;  2O9L A;  1IDZ A;  4ENK A;  2F5F A;  1H0M A;  1LE8 B;  2IEK A;  2LR8 A;  1O3T A;  1MKM A;  3LA3 A;  3TL4 X;  2VKV A;  4HLX A;  4IXA A;  3BJ6 A;  2JA5 J;  4AID A;  3L2C A;  3SZT A;  1VFC A;  2HDC A;  3IWF A;  3O3K A;  1SAN A;  4MNU A;  2R7D A;  5F08 A;  2NS8 A;  2HKO A;  2MLK A;  3DCF A;  4AYB A;  2XC7 A;  4XOR A;  3PL8 A;  3I0T A;  2F6C A;  2L9R A;  1YJ9 I;  2CGP A;  2K9S A;  5ICE A;  2J5P A;  4OMY A;  2WY7 Q;  3WGG A;  3VSK A;  3J7A Y;  2DDA A;  1GHC A;  4Y33 A;  1QU3 A;  3ZXS A;  1YX5 A;  1WJF A;  3J7Z I;  1FSE A;  3CC4 I;  2WAF A;  4A3K J;  3BT9 A;  3JRC A;  4BHP A;  2F5E A;  2VPR A;  4L9N A;  5IT9 K;  2KDO A;  2DYS H;  1R71 A;  1S9H A;  2OAZ A;  3RQI A;  3ML6 A;  4RLQ A;  2R7S A;  3UNG C;  1ACI A;  4XKW A;  2IPQ X;  1IJW C;  3EPZ A;  1BOA A;  1QHH D;  4A3M J;  1U78 A;  3W2A A;  2R5Z B;  3JRA A;  2HGC A;  1QZZ A;  1P7J A;  1IN7 A;  1KU2 A;  4KIC A;  1AHD P;  1BA5 A;  4L5E A;  2JTV A;  2CV0 A;  4E6K G;  3KZI C;  3F3X A;  3HKZ A;  1Y6I A;  3CP8 A;  3CUQ C;  4O3M A;  1BL0 A;  2A07 F;  2GIZ A;  1X1B A;  5GPC A;  4BE1 A;  2EA4 A;  3OYF A;  2ACJ A;  3GWZ A;  5F04 A;  2MG4 A;  3VB2 A;  3IL2 A;  2IS2 A;  4LB5 A;  4XMY A;  1N75 A;  3SEZ A;  1JT6 A;  2VQL A;  2CW8 A;  4HEA 2;  3OOP A;  3BPX A;  4L9T A;  2OV7 A;  3F8N A;  2PX9 A;  4HNU A;  3NEU A;  5E3M A;  1SFE A;  5F1J A;  3WU0 A;  5CYV A;  4BY1 J;  2KP6 A;  1OQY A;  4A3D J;  3BJO A;  1UJ8 A;  5LRR A;  2RRE A;  2YU3 A;  3JRB A;  3BTC A;  2DBB A;  1WFX A;  1D3Y A;  3BC8 A;  2L9S A;  3HKZ N;  2DOF A;  4KJZ A;  4LOC A;  3P5J A;  3BDD A;  4AM3 A;  1OR7 A;  1WI3 A;  1FZP B;  4LJZ F;  2HYG D;  4WF2 A;  1V4R A;  5CKT A;  2CW0 F;  2OJE D;  3CQZ J;  1YW8 A;  3DV8 A;  3OR1 C;  1VQO I;  3DPU A;  2QBY B;  4D5C A;  5FFX A;  3E5U A;  1X3U A;  5HLI A;  3KEO A;  1FTT A;  1PUF B;  1YG2 A;  2XAQ A;  2ADU A;  2JA2 A;  1ON1 A;  5BPI A;  4A5M A;  2Y0S N;  2VUM J;  3V7S A;  2BY1 A;  1SMY F;  5F0H A;  1XSD A;  3TED A;  4L18 B;  2CQK A;  2W7N A;  1DP3 A;  2M45 A;  1GVD A;  4AD9 A;  3G73 A;  1MBE A;  1P7I A;  1WRJ A;  2XF7 A;  3ZQG A;  2STW A;  1P4X A;  3FK7 A;  1DDN A;  1W36 C;  3T5X A;  1TWA J;  3CJR B;  3ZQ7 A;  3ZMS A;  2JZY A;  4H4K C;  4M6X A;  4RGX A;  2DPD A;  1ETX A;  1K4S A;  2B0L A;  1YW9 A;  2MH2 A;  1K79 A;  1JGG A;  5C4X J;  4Q5S F;  1Y0U A;  2QKM B;  4NQW B;  4FE4 A;  9ANT A;  2QLZ A;  2ESN A;  3R0J A;  3P7N A;  2VJ5 A;  2AQE A;  3BLY A;  5DD4 A;  2AXT C;  2VAS A;  3PFY A;  3PO3 J;  3G3Z A;  4U7B A;  1VND A;  2NVY J;  4XK4 A;  2KZG A;  2JVG A;  3I4M J;  2HPM A;  1TQM A;  2PEX A;  4DQ2 A;  2DJI A;  1V5F A;  4HZF A;  2UV1 A;  5DV5 A;  3QP6 A;  2K3F A;  3CMY A;  2RAE A;  4HNT A;  2HQA A;  5E3N A;  2M87 A;  2CUJ A;  4ENJ A;  4OIP F;  2A6T A;  3M8J A;  2EV5 A;  2Z5U A;  2YU9 J;  3FMR A;  5E3O A;  5GTI C;  1XDS A;  5FRN A;  4ABZ A;  1U5T B;  1WH5 A;  2GA2 A;  1YRN A;  5JR3 A;  1LVK A;  1VQL I;  4OIR F;  4G7O F;  4C2U A;  2BGC A;  3E6C C;  1MJB A;  4XKC A;  4YEJ A;  3KLN A;  2W84 A;  2HQ5 A;  3I5U A;  2GLO A;  4XL9 A;  3COA C;  1R22 A;  1EJ9 A;  2KL4 A;  3V42 A;  4KYW A;  4E7H A;  2E7W A;  2L2O A;  1FYM A;  1ZG1 A;  3KZZ A;  4HAM A;  3TQN A;  2HDW A;  3KE2 A;  3VDX A;  2ZJP F;  2FSW A;  1QZE A;  3DU5 A;  2CUZ A;  5FO5 A;  3BTL A;  2X6Y A;  3MD2 A;  2PQ8 A;  5FFZ A;  1KGS A;  3E6B A;  1XG1 A;  2BW3 A;  1ZAR A;  3TO6 A;  4IHS A;  2JN6 A;  2KJB A;  2PMH A;  1IRX A;  1R6R A;  2H6B A;  2UUZ A;  2M34 A;  5HLG A;  3AG1 H;  3I3L A;  3PUF A;  2E2I J;  2VJJ A;  1IXC A;  3L1P A;  2ETH A;  3LFU A;  1RNL A;  4BHB A;  2Q0O A;  3OIP A;  2E1C A;  5ILV A;  5DCM B;  3WE2 A;  5FJ8 J;  4A93 J;  2ME0 A;  1VTN C;  1FOX A;  1VQ7 I;  2HNH A;  3K10 A;  2WA0 A;  4CCM A;  1BC7 C;  3I55 I;  2XSJ C;  1SMT A;  4IHW A;  3JW4 A;  3TKY A;  3MKW B;  5K5Q A;  4YEL A;  2XAU A;  4IQ4 A;  1ETO A;  3GLX A;  2JRM A;  2NXN B;  2LC2 A;  1K78 A;  3JAM K;  3WU2 C;  3L9F A;  5EG0 A;  3S3N A;  2FMY A;  2LF7 A;  1JKR C;  3RZO J;  1IUF A;  3C1D A;  3WHB A;  3HTU A;  2VBY A;  1K83 J;  1B72 A;  3DPT A;  3MVP A;  1I5Z A;  4BGD A;  2ISY A;  4B3A A;  2VQH A;  5BPD A;  3BG9 A;  3E97 A;  2CO5 A;  2Y31 A;  5HS7 A;  4BJ6 C;  5L3F A;  3AL0 C;  1MNM C;  4DYC A;  1VQ6 I;  2JMW A;  5EEG A;  3SHF A;  3ESW B;  1ULY A;  2BY2 A;  2YX7 A;  3KP2 A;  4EAT A;  1A31 A;  3O6B B;  2QBY A;  2QZ8 A;  1GT0 C;  2XF5 A;  3S32 A;  2Z16 A;  1P2F A;  3ZMU A;  5J1Y A;  1CF7 B;  2WAQ N;  4M3G A;  2ZCW A;  1MH3 A;  1QGP A;  2EZH A;  4O5V A;  4E4H A;  3LL7 A;  2NNY A;  4A12 A;  1SD5 A;  4XLA A;  3G2B A;  1OYI A;  4XSZ F;  2ZSH B;  1J9I A;  1XC5 A;  4IPA A;  2RGV A;  1XCV A;  4M9X A;  4CCK A;  2AXL A;  2E36 A;  1RKW A;  1IN8 A;  2G9W A;  1U3E M;  2LBF A;  2VJ4 A;  4W97 A;  3MN2 A;  2MFZ A;  1EH8 A;  3BQY A;  3HXL A;  3M1C A;  1LEA A;  2ZME C;  1ENH A;  1XCB A;  3EYY A;  3KIO A;  1FIP A;  5E17 F;  3HHH A;  4RLF A;  1S7A A;  4BU2 A;  2A6H F;  5LHH A;  4BEH A;  1R23 A;  3LAP A;  1R5H A;  2DO7 A;  3CDI A;  2L54 A;  2MLG A;  1MBK A;  4EEF G;  2VOD A;  2WB1 N;  1HC8 A;  3GTG J;  2IGN A;  1AOY A;  1VQN I;  2HEO A;  1S8N A;  1QHG A;  1OCR H;  3W2V A;  1HW2 A;  3KP6 A;  4X0G A;  2EV0 A;  2L9V A;  4JK1 X;  4AIK A;  3G6E I;  2ID3 A;  2LKS A;  2PMZ N;  3LSG A;  4CA0 A;  4CGZ A;  1Y8Q B;  4NDL A;  1DPR A;  1HQC A;  4IHX A;  4UUS B;  1J09 A;  2VL8 A;  4E7S A;  4KMF A;  2OQG A;  2IGK A;  2BBY A;  3NWT A;  3EDP A;  2A3S A;  3CUO A;  2JSC A;  5TGT A;  3GFM A;  3T1B A;  3OS1 A;  3WTS C;  1U8B A;  4EJO A;  3R61 A;  2V1X A;  1DGW Y;  2P8T A;  4IHT A;  5FKK A;  1BI2 A;  2XKP A;  4GYG A;  2PFB A;  2ISZ A;  3VFZ A;  1MD0 A;  2LK2 A;  4V2F A;  5DUI A;  2DMU A;  5D4S A;  2FRH A;  3QWL A;  2CFX A;  3WTT C;  5J4V A;  4UNO A;  4HDU A;  1UB9 A;  4AVZ A;  3CO7 C;  3FBN B;  4DOZ A;  3TBI A;  2COM A;  3ZMV A;  2K86 A;  3KYC B;  3O2P E;  2TRT A;  2E5Z A;  1MMN A;  4G94 A;  2LF8 A;  4IRH A;  4F92 B;  1E3H A;  4D9J A;  3HRM A;  2LSO A;  1X1D A;  1MBF A;  3TW6 A;  4CYC B;  2H6C A;  3BZK A;  2FD5 A;  3RKY A;  2HQR A;  3RQ4 A;  3S1R J;  2JVH A;  2NRA C;  4EM1 A;  1DU0 A;  4EGZ A;  4F52 A;  2H1K A;  4RAY A;  1MMD A;  1UFM A;  2FA5 A;  2LH9 A;  1WZ2 A;  2ZFU A;  2QF7 A;  4A3I J;  3GTK J;  5D8L B;  4C3J J;  4BDY A;  2O61 A;  2R7Q A;  3QOP A;  5HOD A;  4HF2 A;  4M74 A;  2K9L A;  1YJN I;  2C6Y A;  3CZ6 A;  4ZTF A;  5E3L A;  2Z2S B;  4LMY A;  2ZJ2 A;  1B9N A;  4XLF A;  1XN7 A;  1RI7 A;  3CCL I;  4KT6 A;  1SFU A;  1MMG A;  2LMD A;  3WTX C;  2XGX A;  2R4G A;  1LVA A;  3LST A;  3OYK A;  1JHF A;  1S7E A;  2R93 J;  5HNH A;  4CZC A;  1ERD A;  4IF4 A;  2D2W A;  5EZG A;  2VPL A;  1VQ9 I;  5CJ9 A;  5E8I A;  2GZW A;  3W2W A;  4B44 A;  4O6J A;  4W1U A;  2BY3 A;  1ZHF A;  2KRF A;  2BHY A;  2EIJ H;  2OZU A;  3V4G A;  1GV5 A;  1YE9 A;  3SZG A;  4YRV A;  3RKW A;  2VXD A;  1AWC A;  1S6L A;  4PJM A;  4G6D A;  5C44 J;  2PJR A;  2KLO A;  2NNN A;  5TIS C;  4DNC A;  2M4K A;  3CMM A;  4XKB A;  4XON A;  2VXZ A;  1BI3 A;  5DCF A;  1TT5 B;  2Y2Z A;  3RPU A;  3DWL E;  4LGW A;  1X3W B;  5H6R A;  3K70 C;  1FOK A;  1GVJ A;  1TTY A;  1Z6R A;  2ECB A;  2FML A;  1R00 A;  3OYB A;  1B1B A;  1RET A;  5CPR B;  2O5R A;  3KYD B;  2M8G X;  1SD4 A;  2GIV A;  5KAI C;  4PUS A;  3GFI A;  1FJL A;  2Y75 A;  3VWB A;  4HDV A;  5E1W A;  4A3C J;  2BY0 A;  3OMY A;  5CVJ A;  1JXS A;  2V9P A;  1WJE A;  2R7X A;  3GBG A;  1KON A;  3KET A;  4CCN A;  2FQ4 A;  3GYH X;  2LKX A;  1I6H J;  2DFE A;  3FKJ A;  3M9A A;  2ZSI B;  3V8L A;  3RSN A;  2W82 A;  1UHS A;  2BE5 F;  1FBQ A;  3DKW A;  5EZH A;  4Y7N J;  1IV8 A;  4XN0 A;  3FWE A;  4B3X A;  4LFU A;  3I71 A;  3FK6 A;  3H9G A;  5ICF A;  5FD5 A;  1RIO H;  3OSG A;  4BXU A;  3D0S A;  3K4N A;  1MW7 A;  2WTE A;  2P6S A;  4ZYH A;  3O8H A;  4HX4 A;  1D0X A;  1W7P D;  4CCL A;  1UZC A;  4XRS A;  2O6G E;  2M2E A;  5HOO A;  2V79 A;  3MKY B;  1GDT A;  3CUQ B;  3JRI A;  3QP5 A;  2QQ9 A;  4KUM A;  2G0E A;  3AAF A;  4M9S A;  2A68 F;  2FOW A;  3SXY A;  2FXA A;  5M5Y J;  4NC6 A;  3P9K A;  3REO A;  4R8H A;  1QQI A;  1JUM A;  1FOY A;  3BQZ A;  3QOD A;  1IV6 A;  3G1L A;  2FJ1 A;  2EK5 A;  4U0Y A;  3OYC A;  1YS7 A;  3GZ6 A;  1FLI A;  3FXK A;  4LIT A;  2XPW A;  3JTH A;  1ETY A;  2Q8K A;  2ZC2 A;  1EH7 A;  3L09 A;  3VYR B;  4C9Y A;  5D4R A;  1CQT A;  3Q9S A;  3ZCO A;  1YO5 C;  5AIP A;  5F1R A;  3OYL A;  2LY9 A;  4MLO A;  1Q1H A;  3I54 A;  5B5E C;  3WE3 A;  1TBX A;  1X58 A;  2OBP A;  2L0K A;  3HOZ J;  4Y52 J;  1DU6 A;  2DOE A;  3X2Q H;  4IL6 C;  5D5W B;  1U9N A;  4B48 A;  5LFA A;  3CES A;  2RNJ A;  4RGU A;  3FZV A;  2DQR A;  1W5C C;  2HTJ A;  1HCR A;  2P0W A;  4NHJ A;  3B6A A;  4KFC A;  2XB5 A;  3K4L A;  4PGG A;  5JVT A;  2IVM A;  2JK3 A;  4ZJZ A;  1FBU A;  3F21 A;  4HV6 A;  1H89 C;  5FLM J;  1SVM A;  3BJA A;  3LNQ A;  1LPQ A;  1KQ9 A;  4BYY A;  2BZT A;  1WCM J;  4LG0 B;  3DBH B;  2MSY A;  5H2F C;  2BXZ A;  2Y48 A;  1BBY A;  4PSX A;  4PK4 A;  4BE0 A;  4IQJ A;  4XLP F;  3CJQ B;  3PUB A;  1YQA A;  4FX4 A;  4ZH4 F;  3BG5 A;  3ABM H;  4OOI A;  1EF4 A;  2P5V A;  1BM9 A;  3KFW X;  3KX2 A;  4RM2 A;  3A0H C;  4K2E A;  4AC0 A;  2R7U A;  1Z05 A;  2V4J C;  3Q0W A;  2PMU A;  3VOE A;  2IW5 A;  1LFP A;  3GF2 A;  1IDY A;  3K4M A;  4HA8 A;  2ECC A;  3OL3 A;  3KCC A;  2CV2 A;  5LGN A;  5DUK A;  2F4M B;  2F5C A;  3PFI A;  5DM7 F;  3ABU A;  3M8E A;  2GOX B;  1CGP A;  1XGO A;  2X1C A;  3GLL A;  4A6E A;  5E1X A;  2XGD A;  3ZN1 A;  4EGY A;  3ZMD A;  4BQN A;  1F43 A;  3ULQ B;  4B43 A;  1K7A A;  2DMT A;  2W4S A;  5D5U B;  4XOP A;  2E35 A;  2DOA A;  2IJL A;  3ZQI A;  1EH6 A;  3ZGK A;  4HBL A;  5J8C A;  4PJN A;  4DZP A;  2Q2E A;  1I3A A;  3DEE A;  3PSI A;  3OYN A;  2DCE A;  2E2J J;  1B59 A;  3DTE A;  2EB7 A;  4XID A;  1ZG3 A;  4UUT A;  4AYB N;  3P9C A;  3TOA A;  1TC3 C;  1OIS A;  4PFP A;  2HKX A;  3ABL H;  4C2M J;  3KP4 A;  4KN7 X;  2EIK H;  1H8A C;  1QPI A;  4DYR A;  2NS7 A;  2LY2 A;  1PP8 F;  4CXF A;  3PSF A;  2CW7 A;  1WI9 A;  3I59 B;  1IAW A;  5JLW A;  1D1A A;  2ZXW H;  1OMI A;  3BZ6 A;  1DPU A;  1FOW A;  4BQA A;  2VBZ A;  4PCQ A;  1MSE C;  4MFD A;  3ZQL A;  5A2Q Z;  3ASO H;  3GZN B;  4KT5 C;  2KIQ A;  1ODD A;  2KHM A;  3AG4 H;  2DFH A;  2HDD A;  1WVR A;  2DA5 A;  3WG7 H;  2QEX I;  1OR7 C;  4Y17 A;  4II3 A;  3RPQ A;  3ABK H;  2MH9 A;  4MTD A;  1TP4 A;  3RIR A;  2XVC A;  4PGH A;  2QUF A;  1MMS A;  3VPR A;  3C2H A;  3U9G A;  1A04 A;  3IAM 2;  3ZOB A;  5IP7 J;  1R5G A;  2X1D A;  4BS9 A;  5FD6 A;  2HI3 A;  1RC9 A;  1G3T A;  3FHZ A;  3GTQ J;  3GX4 X;  3RTR A;  1WGX A;  1JKP C;  2ZFW A;  2EQR A;  3H1C A;  3A2K A;  1JUP A;  1YS6 A;  3OIQ A;  5JHF A;  4I7H A;  3LOC A;  4I99 C;  3HRT A;  4AIH A;  4D1Q A;  1N25 A;  1A36 A;  1HDP A;  4I0B A;  3IH4 A;  4XM3 A;  4QPQ A;  2DFF A;  4OU0 A;  4RMN A;  1IXR C;  1HKQ A;  1FYK A;  4M6V A;  4IOA F;  4ZZD A;  2DAO A;  3ONQ A;  5FRM A;  1LNW A;  4CZZ A;  5LBQ A;  5K5R A;  4YIF A;  3LSP A;  1JE8 A;  2VC1 A;  3FXO A;  1IF1 A;  4ON0 A;  2OD5 A;  3HUG B;  2R7O A;  1MBH A;  3J7Y J;  2GM4 A;  2RQQ A;  1C0W A;  3Q0V A;  5KAF C;  1OYW A;  3AL0 B;  2W1O A;  1ETQ A;  3CCJ I;  4ESB A;  2XRO A;  1V3F A;  4HX7 A;  4WXD A;  4F93 B;  2K02 A;  5F6F A;  3ZR8 X;  5D6F A;  2DT6 A;  2O8X A;  2R7W A;  5GP9 A;  4GXO A;  1P6R A;  4XLH A;  1TL8 A;  3MCZ A;  3CME I;  2E1M C;  3JCU C;  3BOQ A;  2NVT J;  2EA2 A;  2QWW A;  1B8I A;  2HPI A;  1H88 C;  2Z9O A;  2HVS A;  2CQN A;  1HOM A;  2KDZ A;  4F55 A;  3IRQ A;  1FP2 A;  2V1D A;  1ZRC A;  3PQK A;  2XSD C;  1LE8 A;  2KFD A;  4UV8 A;  5D6E A;  2COB A;  3BP8 A;  4EMS A;  2BXY A;  4B47 A;  2KZV A;  4KIS A;  5K5O A;  5IT3 A;  3H5A A;  1JJ6 C;  4E7I A;  1W7P B;  4G7Z F;  1XX5 A;  1BI0 A;  3MFK A;  1X2N A;  1WJA A;  5DS9 A;  2HTS A;  3G71 I;  3WOD F;  1BJA A;  3K2A A;  1T6S A;  1XD7 A;  1G3Y A;  2O8K A;  3LSM A;  3A02 A;  4G12 A;  2XGC A;  4QSH A;  3DPL C;  2JA7 J;  2I10 A;  3I4P A;  1ZGA A;  4J01 A;  4BJ5 C;  2E19 A;  1B9M A;  4EJW A;  2DMN A;  1O3R A;  3KPH A;  5DEQ A;  5B66 C;  2DJN A;  2E60 A;  3OOU A;  4MGR A;  3ZRG A;  1G8X A;  1SFX A;  4HSR A;  5FKN A;  3TW7 A;  1SD7 A;  2ELJ A;  2NOJ B;  6PAX A;  1AKH B;  2HVQ A;  2VBW A;  5EGO B;  3F22 A;  2E71 A;  4KIT B;  1W5S A;  2OC6 A;  1MH4 A;  3OYI A;  4JBA A;  5B1A H;  3C7J A;  3FXQ A;  3OYH A;  2MYS A;  5J1R A;  2L7F P;  5LGT A;  2R5Z A;  3IP4 B;  4LIU A;  4XIC A;  4CHU A;  2RC4 A;  2QSH X;  1JUS A;  5J6X A;  1GXP A;  2M7B A;  2KRC A;  1FWZ A;  4BKX A;  2CH0 A;  2GWR A;  2LP0 A;  4EV0 A;  1VQM I;  1ZGW A;  1RUN A;  2XPU A;  3BR1 A;  2R3S A;  4RAZ A;  3U1D A;  1Y1V J;  4GCV A;  1TNS A;  2M30 A;  1VQ5 I;  1JHH A;  3KZY A;  4OMZ A;  2BVL A;  5IYD J;  4JQF A;  4L9V A;  2M0M A;  3OYM A;  1O57 A;  4S05 A;  4CSW A;  3SQN A;  2LRE A;  2K5C A;  3G1O A;  1YW7 A;  4IJA A;  1W4M A;  2DW4 A;  2E2H J;  3W6J B;  3OYJ A;  3CCU I;  2DDB A;  2E1O A;  2X48 A;  3QPL A;  1ZKG A;  2RDP A;  1LFB A;  4FX0 A;  1JKQ C;  2VBX A;  1UST A;  4IRI A;  4KMU X;  2W85 A;  4PJ0 C;  2L4M A;  4YII A;  5E8G A;  1U9O A;  3QYF A;  3IKT A;  2ELK A;  2JT1 A;  1MSF C;  4D7M A;  3QYB A;  2CUF A;  2H94 A;  1Z3X A;  3CC2 I;  1ZH5 A;  1R4N B;  1J75 A;  1GV2 A;  4A0X A;  1YJW I;  1FMW A;  4P9F A;  5KVR A;  3BR3 A;  1Q1V A;  1Z6T A;  3S3M A;  2D1H A;  1PUF A;  3E1S A;  2F2E A;  4A3G J;  1TT0 A;  3I53 A;  1JJ8 C;  1XGM A;  4UB6 C;  4BL0 B;  3IUO A;  1O3Q A;  5DYM A;  4XQF A;  5M3M J;  5CVR A;  3OIO A;  1XMA A;  2NVQ J;  2M9H A;  4P96 A;  1T0F A;  4JYK A;  2IRF G;  5H6Q A;  4HF1 A;  3R6S A;  3WU1 B;  4L5J A;  5GAD J;  3FXM A;  2YR2 A;  2IT0 A;  4ZYG A;  1T98 A;  3NWS A;  3QU6 A;  3EQL F;  1O3S A;  2FBK A;  1RR7 A;  1POG A;  4UVC A;  5FKM A;  3KYL A;  4HV5 A;  4KNY A;  1QBJ A;  3FIW A;  1HKS A;  4JOM A;  5ILU A;  2DK5 A;  1KZH A;  4XR6 A;  3L2R A;  2LRD A;  3K4K A;  4G6Q A;  5LLQ A;  4NQW A;  2DTR A;  2QQA A;  5IP6 A;  1WJD A;  3HOT A;  2RNG A;  2RN7 A;  2ZNZ A;  4LLG F;  1BR1 A;  4M3D A;  1DP7 P;  1ZGJ A;  1U8R A;  1G4D A;  1HW5 A;  2L3D A;  5HS9 A;  2PBI A;  2E5N A;  4BJT A;  1RZ4 A;  2WC2 A;  1QPM A;  3BR2 A;  3O8G A;  3GTJ J;  1X19 A;  3GFJ A;  2CU7 A;  4E7L A;  3LA7 A;  3OR2 C;  1MBJ A;  4WCG A;  1YTY A;  3MAJ A;  2L01 A;  4F3Q A;  3ECO A;  4A3B J;  1FBS A;  3GCM A;  4I76 A;  4YFN F;  2CUE A;  1HKT A;  2P7C B;  5AON A;  3BG6 A;  1JI8 A;  1U6G A;  3CMA I;  4B1R A;  5DDG A;  3LSR A;  3IAS 2;  3ERM A;  2XPV A;  3ZMZ A;  4BBS J;  2VON A;  3NAU A;  1U5T A;  2M8E A;  3SDG A;  1W36 D;  2KPM A;  1KU3 A;  1IRF A;  2IS6 A;  2V1N A;  1XMK A;  2TCT A;  4XLN F;  2IA2 A;  4E7K A;  4FHT A;  3A01 B;  4ZDO A;  5LEK A;  2KIU A;  4ANJ A;  4JX5 A;  1ZRF A;  1NG6 A;  3J80 K;  3VYT B;  1R1T A;  1X2M A;  2XF6 A;  4BQO A;  4B4C A;  2EV6 A;  2KIS A;  3CO6 C;  4IHV A;  4EJU A;  3LQR A;  3QU3 A;  4RDU A;  3JR9 A;  2HWV A;  3N05 A;  3J7A O;  2HXO A;  4FTH A;  3FIS A;  2W57 A;  2DA4 A;  4UVA A;  3GZ5 A;  2XHK A;  4GRI A;  3MZH A;  2KMU A;  4PJL A;  4FT8 A;  3V8K A;  1W1W E;  2VQC A;  2CFO A;  2MAB A;  1KA8 A;  1VQ4 I;  3FDY A;  5ICG A;  3EET A;  3K0L A;  2KIF A;  3FXL A;  1XPX A;  2DT5 A;  4DW6 A;  5IOY A;  1MZB A;  5KCM A;  2DMQ A;  2P7V B;  1WSU A;  1TLH B;  1Z0X A;  4L0Y B;  3GTP J;  4M3E A;  2STT A;  3U1K A;  2MC4 A;  3F8F A;  2CRG A;  2XAS A;  3F6O A;  4XN3 A;  3CCS I;  3FXR A;  1FTZ A;  1BIA A;  5DCM A;  1OYY A;  4N4N B;  3H9Q A;  4I02 A;  4E7Z A;  2CJJ A;  3GTL J;  1REP C;  3C2B A;  5FKL A;  5J8F A;  2ESH A;  4EJV A;  2E7X A;  2EBI A;  3S2D J;  1D0Z A;  1E0E A;  3HSF A;  4BE2 A;  1T39 A;  3HOU J;  1QVT A;  5BOX A;  2NS0 A;  2V9V A;  3HIF A;  4V2G A;  1RRJ A;  1OPC A;  4NB5 A;  4C2T A;  2MBF A;  4PDK A;  1T33 A;  1FC3 A;  1U2W A;  4I6Z A;  1V5E A;  4ZYA A;  2XDV A;  2LNB A;  2LYC A;  2M5W A;  5LD2 C;  1E3P A;  4UVB A;  2A61 A;  1IZ1 A;  4R1H A;  2DQL A;  3CLQ A;  1OLT A;  2K85 A;  3F23 A;  1ZYR F;  2IA0 A;  2VLA A;  3CCQ I;  5KK1 A;  4LLL A;  2LTP A;  4WWC A;  3IC7 A;  5A2Q K;  3OYE A;  3F8M A;  4NC7 A;  1LDK B;  1MMA A;  2P81 A;  4L5I A;  2HZT A;  1OCO H;  1CF7 A;  1BW5 A;  3Q3S A;  1F36 A;  1AU7 A;  2ZBK A;  3G1M A;  3KEY A;  3DP7 A;  1HW1 A;  1ZAO A;  2D1V A;  2V6C A;  1NH3 A;  1L3L A;  2CYY A;  2HZD A;  3GTO J;  4ESF A;  5IYB J;  3SJM A;  5L3E A; 
#chains in the Genus database with same CATH homology
 1D5Y A;  4AC0 A;  1OCT C;  1VND A;  1RES A;  2NVY J;  4XK4 A;  3Q0W A;  3I4M J;  5F27 A;  2IBD A;  2O7O A;  1IDY A;  2ECC A;  1HDD C;  2YS9 A;  2AO9 A;  3CMY A;  4X1E A;  3HGG A;  2RAE A;  5M5X J;  3S14 J;  4M3F A;  5E3N A;  1GUU A;  2EZI A;  2YU9 J;  5E3O A;  2DA1 A;  4ABZ A;  2XGD A;  1WH5 A;  1YRN A;  1F43 A;  2DMT A;  1O4X A;  4DZJ A;  3ZQI A;  1A5J A;  2MW8 A;  5BNG A;  2HQ5 A;  4A3J J;  3PO2 J;  3HEF A;  2GLO A;  1TWF J;  2Y30 A;  1Z77 A;  4DZP A;  2E2J J;  5IP9 J;  4XID A;  4UUT A;  4AYB N;  1TC3 C;  1ZTR A;  2OF7 A;  4C2M J;  3S16 J;  3BTL A;  1H8A C;  3S1Q J;  5C3E J;  1QPI A;  1XG1 A;  4DYR A;  2NS7 A;  3HB9 A;  3MKL A;  4XRS G;  2X6O A;  4UUS A;  3D1N I;  1AKH A;  2B63 J;  4BY7 J;  5EGO A;  1OCP A;  3BR5 A;  3H0G J;  5DTD A;  2JN6 A;  5JLW A;  5IOZ A;  2NVX J;  4DYQ A;  3HDD A;  2M34 A;  1MSE C;  3BTI A;  4MFD A;  3ZQL A;  1W0U A;  1ZR2 A;  2WV1 A;  2W48 A;  2E2I J;  2HDD A;  3L1P A;  3IH2 A;  2DA5 A;  2R0Q C;  2HOS A;  1WH7 A;  4A3L J;  3HOY J;  1IRZ A;  1TWH J;  3K7A J;  1ETW A;  1OJL A;  1IC8 A;  5FJ8 J;  4A93 J;  1MBG A;  2ME0 A;  2JWT A;  2ID6 A;  3VPR A;  3W6V A;  3ZOB A;  5IP7 J;  1E3O C;  1JTX A;  4MFE A;  2HI3 A;  4IHW A;  2N8G A;  1TWG J;  3GTQ J;  3I4N J;  1WGX A;  1JKP C;  1NK3 P;  2EQR A;  1R9T J;  1JUP A;  1ETO A;  2EH3 A;  3LOC A;  3ZQH A;  3S17 J;  5EG0 A;  1HDP A;  5K7H A;  3IH4 A;  2GBY A;  1JKR C;  5IYC J;  1IUF A;  3RZO J;  3BR0 A;  4CYC A;  3WHB A;  4FIS A;  3JRE A;  1K83 J;  1JT0 A;  1B72 A;  4D5F A;  3MVP A;  4M6V A;  4B3A A;  2R5Y A;  1RPW A;  3BG9 A;  2XGE A;  3HOV J;  2Y31 A;  3IH3 A;  2D5V A;  3LSP A;  4DYC A;  3TP0 A;  1MNM C;  2Y9Y A;  2JMW A;  1MBH A;  4D7N A;  1OFC X;  2EZK A;  2GM4 A;  1JTY A;  3Q0V A;  1GT0 C;  1FEX A;  5J1Y A;  5IPA A;  1ETQ A;  2WAQ N;  3BTJ A;  3DEW A;  4M3G A;  1MH3 A;  2EZH A;  1TWC J;  2Y9Z A;  2CQX A;  2R7Z J;  2L7Z A;  4A3F J;  1LFU P;  1XC5 A;  3QPS A;  5GP9 A;  3HM5 A;  4C3H J;  1ETK A;  5K7F A;  5GPA A;  1RKW A;  1ZR4 A;  1VF9 A;  1I3Q J;  2NVT J;  4W97 A;  3MN2 A;  4RBO A;  4IHY A;  3TP3 A;  1B8I A;  1H88 C;  3S1N J;  5J3L A;  3BQY A;  2KDZ A;  1T56 A;  1QRY A;  2XSD C;  3BR6 A;  1LE8 A;  1ENH A;  4GFB A;  4XRM A;  1FIP A;  3M4O J;  2COB A;  3B6C A;  2XB0 X;  2OPT A;  1JJ6 C;  1YRN B;  1MBK A;  4EEF G;  1NTC A;  2WB1 N;  3GTG J;  2HOT A;  1X2N A;  1K61 A;  5DS9 A;  3K2A A;  2O8K A;  3A02 A;  4G12 A;  3UKG A;  2XGC A;  3F0C A;  4QSH A;  2JA7 J;  2I10 A;  5K7Z A;  1G2H A;  2E19 A;  2ID3 A;  2DMN A;  2PMZ N;  4QTR A;  3LSG A;  2DJN A;  3OOU A;  4NDL A;  4IHX A;  5FKN A;  3HOX J;  3TW7 A;  2VI6 A;  4UUS B;  2KT0 A;  3FKI J;  1AKH B;  5EGO B;  4JP0 A;  2ME6 A;  2JJ7 A;  3S15 J;  1MH4 A;  1WPK A;  2VKE A;  3CDL A;  2DMP A;  1U8B A;  3A01 A;  5J1R A;  2L7F P;  2R5Z A;  4XIC A;  3HGY A;  5FKK A;  2LD5 A;  3LSJ A;  2R92 J;  2LVS A;  2DTZ A;  1JUS A;  1ZK8 A;  3ZQF A;  3RKQ A;  4FE7 A;  4BKX A;  2LP0 A;  1ZGW A;  1Y1W J;  4MIM A;  2K9N A;  2LK2 A;  2XPU A;  3BR1 A;  3M3Y J;  4V2F A;  3RZD J;  2DMU A;  2XRL A;  1Y1V J;  2MGQ A;  3JRG A;  2DA3 A;  3Q0U A;  1A6I A;  4A69 C;  3ZQC A;  3HOW J;  4HNV A;  4S0H B;  2TRT A;  5FLV A;  1FIA A;  5EG0 B;  5IYD J;  1I50 J;  1MBF A;  1ITY A;  3TW6 A;  4CYC B;  3G1O A;  2HXI A;  2FD5 A;  1B72 B;  4X6A J;  4C3I J;  3S1R J;  2E2H J;  1DU0 A;  2E1O A;  2X48 A;  2H1K A;  3QPL A;  1IG7 A;  1ZKG A;  2X9D A;  1LFB A;  1JKQ C;  2QF7 A;  4A3I J;  3GTK J;  1ETV A;  1U9O A;  1NK2 P;  4C3J J;  2ELK A;  5F0F A;  3JRF A;  5C4J J;  4D7M A;  1W0T A;  1XS9 A;  1MSF C;  5HOD A;  2CUF A;  5F0C A;  3QQA A;  1BJZ A;  1SFO J;  5E3L A;  4BXX J;  1GV2 A;  3S2H J;  1UG2 A;  1APL C;  3BR3 A;  1Q1V A;  1PUF A;  4A3G J;  3A03 A;  1JJ8 C;  2M0C A;  4IEJ A;  1ZQ3 P;  5M3M J;  1S7E A;  4JX4 A;  2R93 J;  3OIO A;  2CQQ A;  2M9H A;  5EZG A;  2NVQ J;  4JYK A;  2QCO A;  4BBR J;  1IDZ A;  4W1U A;  5EF6 A;  1B8I B;  3PM1 A;  2O9L A;  1ORK A;  3JRH A;  1GV5 A;  1RR7 A;  1POG A;  2ZB9 A;  5FKM A;  1LE8 B;  2DA2 A;  3SFI A;  2IEK A;  3FIW A;  2LR8 A;  5EEA A;  2K40 A;  2VKV A;  5C44 J;  4QIW N;  4JX6 A;  5IP6 A;  2JA5 J;  4M3D A;  1VFC A;  1BW6 A;  1SAN A;  1UMQ A;  5EDN A;  2DA7 A;  2Y2Z A;  5F08 A;  2NS8 A;  2HYJ A;  3DCF A;  4MO7 A;  2ECB A;  2L9R A;  3BR2 A;  3O8G A;  2K9S A;  2LFB A;  3IV5 A;  3GTJ J;  1RET A;  2CU7 A;  1MBJ A;  2M8G X;  2AHQ A;  1FJL A;  4A3B J;  4I76 A;  5M5W J;  2CUE A;  2DA6 A;  4A3C J;  4B1R A;  2NOG A;  4A3K J;  3BT9 A;  3JRC A;  3S1M J;  3LSR A;  2FX0 A;  2XPV A;  4BBS J;  2VPR A;  3NAU A;  3GBG A;  3RQI A;  2FQ4 A;  3SDG A;  2TCT A;  2LKX A;  1IJW C;  1I6H J;  2L7M P;  4A3M J;  3A01 B;  1U78 A;  2R5Z B;  3JRA A;  4JX5 A;  1UHS A;  5EZH A;  1P7J A;  1X2M A;  4Y7N J;  1VI0 A;  1BA5 A;  1AHD P;  4L5E A;  4B4C A;  3FK6 A;  3WHC A;  4IHV A;  3H3V K;  3JR9 A;  4RDU A;  5EYR A;  3OSG A;  1BL0 A;  2HXO A;  2HOA A;  4FTH A;  3FIS A;  2DA4 A;  3E7L A;  3O8H A;  5GPC A;  5M3F J;  5F04 A;  2MG4 A;  4XRS A;  2M2E A;  1GDT A;  4DW6 A;  3JRI A;  3OSF A;  4J19 A;  5IOY A;  1JT6 A;  2G0E A;  2DMQ A;  1Z0X A;  2H8R A;  5M5Y J;  3GTP J;  2YUS A;  4M3E A;  1JUM A;  3GTM J;  5E3M A;  2CRG A;  5F1J A;  3BQZ A;  4BY1 J;  1IV6 A;  3G1L A;  2FJ1 A;  4A3D J;  1FTZ A;  3CCY A;  1HOM A;  2R5Y B;  3JRB A;  3BTC A;  2CJJ A;  3GTL J;  2XPW A;  3NAR A;  3C2B A;  3HKZ N;  1ETY A;  5FKL A;  4LOC A;  2JA8 J;  1CQT A;  1QVU A;  1WI3 A;  2EBI A;  3S2D J;  5J1U A;  1IGN A;  3JRD A;  3CQZ J;  2LY9 A;  4FCY A;  4MLO A;  3HOU J;  4A3E J;  1QVT A;  4D5C A;  1X58 A;  1HLV A;  2L0K A;  3HOZ J;  4Y52 J;  1JKO C;  1DU6 A;  4V2G A;  1FTT A;  1PUF B;  1U9N A;  5JLX A;  3HBL A;  2Y0S N;  2VUM J;  1T33 A;  1RKT A;  2K9Q A;  2LLK A;  4I6Z A;  4M3B A;  2EZL A;  5F0H A;  3TED A;  1HCR A;  3BG3 A;  1HF0 A;  3B6A A;  4AUX A;  2XB5 A;  1GVD A;  1MBE A;  1P7I A;  2JK3 A;  3ZQG A;  1H89 C;  3FK7 A;  5FLM J;  1TWA J;  3LNQ A;  2IAI A;  2LTP A;  1ETX A;  1WCM J;  2JA6 J;  2DN0 A;  2MSY A;  5FKO A;  1JGG A;  5C4X J;  2P81 A;  1BW5 A;  4FE4 A;  9ANT A;  3Q3S A;  1F36 A;  1AU7 A;  3G1M A;  3BG5 A;  1EF4 A;  3GTO J;  5IYB J;  3SJM A;  3PO3 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...