2HPCA

Crystal structure of fragment d from human fibrinogen complexed with gly-pro-arg-pro-amide.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha chain
molecule tags Blood clotting
total genus 17
structure length 74
sequence length 74
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2006-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hpcA00
1LWUC 1FZBA 1RE4A 1FZFA 2OYHA 2FFDC 3GHGB 3GHGC 2HLOA 1FZEA 1M1JC 1M1JB 3H32B 2HPCA 1T3UA 2XNXA 1FZAA 1JY2O 2A45H 2OYIA 1RF0C 2OYIC 2FFDA 1LWUA 1JY3O 3E1IA 1RE3C 2H43A 1RF1C 1RF1B 2HODB 1FZCB 3GHGA 1JY2N 1FZCC 3HUSB 3H32A 3HUSC 1LT9B 1JY2P 1LT9C 1M1JA 1N73C 3BVHA 1W2EA 2A45G 1N73B 1JY3N 1LTJC 1JY3P 1N86A 1LTJB 1RF0A 1RE3A 1RF1A 1FZGA 1RE4C 2HODA 2OYHC 2OYHB 1FZCA 3HUSA 2A45I 1LT9A 1N73A 2HPCB 2Q9IA 2OYIB 1LTJA 2Z4EA 2FFDB 1LWUB
chains in the Genus database with same CATH superfamily
3H1LE 1BE3G 1RH5B 2BCCG 3M9BA 1SQBG 1UIXA 3TNUB 4PV1D 1MFZA 2HG5D 2HYNA 5CHXA 4XFJA 1VQLP 3AEGC 2OGUA 1X0TA 5CMZA 1A02J 2KZJA 1RE4A 2NPSC 5AW3B 3KHUA 2B87A 3O6QA 3P32A 5KJ7C 2KS1B 1HGZA 3HTKB 5E79E 4XA4A 5TISH 4L75A 2CPSA 3F89A 1P84H 4GOFA 1HJBA 4C7RA 1G2CB 1LP1A 3BRVB 3V2QA 2M3EA 2P1JA 1IJDB 1NWQA 3L74J 4BWNA 1LTJB 4QMAA 4H44C 1CI6A 1JMBA 2FFDC 4RESB 3H1HJ 1AQTA 5C39A 1A02F 1H89A 3M9QA 3OW2O 3BCCD 3KQGA 1BSHA 3SFEC 3L74G 2FYUD 2IFMA 2YNYA 1HWTC 3H32A 4WWIA 1CW5A 3KXDA 3VOPA 3L70J 1S1CX 1J1EC 2YKPA 2NRGA 3H1HG 2J58A 2QRXA 1U7MA 4TT3H 3B5ND 3U1AA 1IFJA 4IFMA 5BVZA 2IFNA 2OARA 1U57A 2AEMA 4DJGA 3L70G 2K9YA 3K5BA 2WSEJ 3VMXA 1NGMB 2AXTE 2WTYA 1NO4A 1HVVA 2YO3A 3H1ID 5H2FE 2I1KA 2N1TD 3TSIA 1LJ2A 2KUBA 1FDIA 2ZT9D 5AVQB 2N1TA 1SQVD 1HH0A 4BRYA 2BEZF 2WSSH 5BU5A 1SQPE 1FDOA 4K35A 3CCSP 2ZVNB 4HH2A 4N78E 1KC8Q 1T3JA 4XE5B 3RL0D 4GT1A 1SFCD 3V2PA 2H89C 2WSEH 4WY4D 1SFCA 3RK3E 3NTNA 1KQLA 4WY4A 4B86A 3AE6C 3RK3B 5DJUB 1NVOA 3H1LD 1QGKB 4KJMA 3S1KA 1W2BO 4L73A 3TNUA 1L4AD 1L4AA 1SQPK 2IDBA 3LW5J 2M8RA 1GDTA 1BCCJ 3R4YA 3M06A 2ZYAA 1ZW0A 1G1JA 1K04A 1GL2C 3PHLA 3BRTB 2KS1A 1R8EA 3CX5I 1AA0A 1DEEG 3L35A 3HTKA 1JEKA 3KPEA 1FOSF 3SSUA 1KTMA 1FBMA 3CX5E 1FC2C 3E7KA 3H1KE 1HTLC 2IYPA 1S2EA 1BCCG 5CBNA 3GF3A 1G2CA 3WMM0 4D6TE 2Q1KA 1YYCA 2R44A 2W27A 5KLIC 2WSCJ 3TDKA 2GA1A 4EI2A 4I7ZC 1DX7A 3V5BA 2YIUB 2BEQD 4U7JA 3U59A 3GF7A 4WVZA 1LTJA 1YI2P 1K73Q 4HB1A 1GW4A 1T3UA 1BDCA 1BGYE 4OVNF 2R5DA 1VQ7P 3VTPC 2A45I 5APWA 1U7JA 2WSCH 3L73E 2CPBA 3L4FA 1OVRA 3EQ2A 1IO4A 1PP9J 4RJTA 1N2DC 3JSVC 2ZXEB 5B66H 4O9BA 3CXHI 3Q2YA 1OVVA 1KB9H 4W7ZA 1S5LE 5APYA 1IFNA 1PP9G 3WU2H 5KAIH 2V4HA 5APSA 1RQUA 1N73B 2LR2A 2V7QJ 1IFIA 3U1CA 2KZIA 2P10A 1SS1A 1URQC 2E43A 1VQ9P 2BASA 5EFWB 4LC1A 2WT7B 3L37A 3GHGA 1EDJA 1SQPD 4ZMDA 4N78D 3CCUP 3M0DC 1KILD 1JO5A 2OYIC 1L0LJ 3FXDA 3SFDC 5APTA 2OTKE 1M1JC 4OGQB 2V7QH 1OW7A 1RF0C 1PPJE 2KNCB 3OAKA 1RY3A 2O01H 1FZCC 2FBWC 1BSNA 2R32A 1PV3A 2FY8A 1J2JB 1VDFA 5AW0B 2QEXP 1FJPA 1T2KC 1L0LG 1NU1E 1PGJA 2O3JA 2M3BA 2E5YA 1GD2E 1Q2NA 4GODA 1IFDA 1BE3E 2PGDA 3CLQA 3IFMA 1IFPA 2ZFCA 3PH0A 2HPCB 3MHVA 1MZ9A 2GUSA 5AVRB 1JM0A 1CZQA 4YXDC 5B5EE 2XV5A 3CX5D 5CCHD 3H1KD 1P84I 5CCHA 1JY3N 1N8RQ 2I8DA 1NU1K 2E74B 4D6TD 2OYHB 4A7PA 4DT0A 1GU4A 4IFDK 3W67A 1WRGA 1K8AQ 1OIPA 1AFOA 3KZIH 1Z56A 2IBZG 1OVUA 1OW6A 1L0NJ 1OW8A 4U3FE 3CC2P 1BGYD 1XTCC 3CCVP 2PRRA 3FWNA 5AVVB 3D70A 2QVAA 1ZOYC 1K9MQ 2NPSB 3CXHH 1L0NG 2PFXA 1QVFO 4Y99C 4EIJA 4PD4H 4TLFA 2WPSA 2YMKA 3L74E 3VYIA 3CL3D 1Y47A 3H25A 2KSJA 1NTZJ 4PV1C 2WPRA 1JTHB 1HJ0A 2R3SA 3L71E 2Q6QA 1FU1A 4OWFA 1SQQE 2RKLA 5AW6B 1K05A 1NAFA 1N73A 2IYOA 3M91A 1EDLA 3P8CD 2MJZA 2Z4EA 2FFDB 1ZN5A 3RK2B 1NTZG 3B8EB 1KD1Q 1JY2O 2K9JB 1QL2A 5AW1B 5CCGD 2WT7A 1KZUB 1J1EB 2SPZA 1YHQP 5APQA 1DEBA 4OGQD 3V6IA 4W7YA 4RKUJ 2MKVA 1NAYA 2QM8A 1RF1C 1SQQK 5KKZC 2JWDA 1PPJD 1M8OB 2KNCA 2QG4A 3CCRP 2P7JA 2R3CA 2KIKA 3A3YB 4HYTB 3AE4C 3L75J 1IZNB 2IX7C 1WT6A 1E79H 1SQXD 3BCCJ 1PIXA 1KN7A 3RBXA 2FYUJ 4K3AA 2C0XA 3B5NC 3PLNA 1SVFA 4IL6H 1LNQA 1OWAA 2HPCA 3L75G 1LT1A 3BCCG 1X9VA 1M1KQ 1QLED 1D7MA 4Z1MH 2FYUG 2E74D 1JCCA 1YJWP 1G1IA 1NTKE 2D2CB 1LWUC 3L75D 3H1JE 1EC5A 2W90A 2OYHA 3TK1A 3V4WA 3SWKA 1VQ6P 1EXJA 3RGUA 3CD6P 1H0TB 1WMKA 4U3FD 2YXRB 2ZAEB 3H1IJ 2Q3IA 4HKZH 1ZXGA 2ZJSE 1N7LA 1HBWA 2H8PD 2NPSD 3G9RA 1XTGB 1NTME 2KXPB 1KFMA 2WWWA 1PFIA 1SQVJ 2NPSA 1DIPA 1H88A 3RL0C 1NTKK 1GL2B 4IL6X 1KMIZ 4H0LC 3H1IG 1QEXA 1VQPP 3CCEP 1ZRTE 3LIDA 1YTZT 1VF5C 1KORA 1SQVG 1AVOA 2JKVA 1GTWA 2FKWB 5GTHH 3AEFC 1KB9I 3VMYA 3ZDMA 2Y0CA 5KLIB 2QJPC 1JY2P 1L4AC 2QA4P 4I7ZB 1KB9E 4UB8H 3H1LJ 1JTHA 3T97B 3L71D 4KT0J 4GDOA 1NTMK 1JOCA 1SQQD 3WU2E 5KAIE 3RK2D 3B71A 1S3JA 4AQRD 1OXZA 5AVXB 2FFDA 3TGUE 5GTIH 1ZLLA 5CJ0A 3II6A 4I1LA 3PP5A 3HUSC 3H1LG 2K9JA 3A0HH 2NZ2A 1PZQA 1YJNP 1KYOD 3MD0A 2KLUA 2C9NY 3CCMP 4GIFA 1VQMP 3M0AA 2UWJE 3VMAA 2HFED 2B88A 1LTTC 3CC7P 2Q3EA 2QM7A 1LTJC 1AJYA 1X8YA 3VP9A 2W6JH 2XDJA 3IN6A 3C9IA 1JB0J 1VQ4P 2N9YB 1T8ZA 1DD3A 3HD7C 5AW4B 2Z5HA 1EZVI 2KK7A 2C9LY 1URQB 1EZVE 3ABVC 5KLVE 1M57D 1IK9A 3GW6A 3CCLP 5BU8B 1SP4A 3V2RA 3ITKA 3C1LA 3LW5H 1VQOP 1KQFB 2D2CD 2OYIB 3HE4B 1M1JB 1NTKD 4DCKA 3H1JD 4EYYQ 1VQKP 3MTUE 2FXOA 1FZCB 3AE8C 1LGHB 2L91A 3KZIE 5KLVK 2QJKC 3VN0A 3IF4A 1FZBA 3CPWO 3GHGC 3B4SA 2XKMA 2P58A 4YXWH 2JJLA 2O1JA 2IBZI 2YKQA 1EXIA 3IR9A 1NTMD 3VMZA 1ZP0C 2W6BA 3O8ZA 3L72E 1GL2D 4IOIH 1KILC 1Q81Q 3CXHE 1SQPJ 3CI9A 1GL2A 4I2LC 3OJAB 1FZFA 2HLOA 1EQ7A 4PD4I 1ZRTD 1ZR4A 2AEFA 1KQSO 2OQQA 2QE7H 1LT9C 1GMJA 2GUVA 2WPVB 1SQPG 2O01N 2H88C 4ZNCA 3CWBE 3T97A 1RHZB 2XNXA 1ZR2A 3PTZA 3D6YA 1MUUA 2O1KA 1FS0E 2KB7P 2ZXXA 3TGUD 3AE3C 1IFMA 4JF7A 3A0BE 3EWKA 4M3LA 3KYQA 1HGVA 3D71A 1TU3F 4NPDA 2A06E 3RK3D 1N7SC 2ZVOB 4Y99B 2QJYC 4R4LA 5APVA 1NH4A 3H1KJ 4YPCA 5TJHA 4YTPC 5KAFH 4D6TJ 3GMAA 1USEA 3RBZA 3LIEA 1OZHA 3H1KG 2BCCE 1GW3A 1SQBE 1BGYJ 3BATA 2RMZA 4D6TG 1URQD 4JYCA 1J1DC 2Y9YA 1EZVD 1URQA 2ZYGA 3AE1C 5KLVD 5TISE 3BASA 1P84E 2B9BA 2DW3A 1BGYG 1L2PA 4IL6E 1LTGC 3M0DA 4JQ0D 2OYIA 3HE4A 1RE3C 1RF1B 5KKZB 1CI6B 1SQBK 4GOEA 1FZCA 2E76C 3EFFK 1VQ8P 2IZ1A 3FX0A 2FYUE 4EDFA 1FZAA 1USDA 1YQ3C 5CCGC 4H13C 3L73D 1W2EA 2E75C 1VPCA 3L72D 3OA7A 2J5UA 3B5NB 3CXHD 1S5LH 2Q7CA 1X22A 5AVTB 3H1HE 2ITAA 2L5GB 3I5CA 3A2AA 4L76A 3GLMA 2YKOA 1RE4C 4H44B 2FYUK 4I6MC 1LWUB 5GTHE 3L70E 3AE5C 2HODB 2XU6A 3P7KA 3AEDC 1SQVE 4WBAA 3USSA 1PPJG 1OFCX 1YITP 1SQXJ 4NPEA 1AV1A 4PJ0H 5GTIE 3RL0g 5AW2B 1OX3A 3AEEC 3A0HE 3RL0B 2A06D 2AEJA 2YXQB 3WUUA 4H0LB 1SQXG 2K1AA 1UIIA 3N7NA 3PRJA 3H6PA 2FXMA 2QIWA 1DH3A 5APUA 1VF5B 3MIWA 2XZRA 2KI7B 1NU1D 2H7HA 1SQVK 2PP6A 3V4QA 2QJPB 1YJ9P 1L4AB 2Y9ZA 1MKMA 1BE3D 2HR3A 1Q82Q 2BCCD 3TF5A 1SQBD 5KTBA 1FOSE 4U3FJ 4N6JA 3A7OA 3MP7B 3M9HA 1YTZI 5B5EH 3HUSB 3KDPB 1M90Q 1NKNA 3HRNA 3V2NA 4AUWA 1BDDA 1KFNA 3MUDA 1YQ4C 4UB6H 1LTBC 1P84D 2IZ0A 3G6EP 4U3FG 2FYNC 3L36A 5AVSB 3D6ZA 2N9BA 4DOJA 3AECC 3AEAC 3E1IA 2OTJP 1ZMEC 4AYCA 2N1TC 1RF1A 1BCCE 1FZGA 1NHLA 2ZT9C 1VQNP 1M56D 3RK2C 2M5AB 1YIJP 2KSEA 3WUTA 3L71J 1OMIA 1LTIC 1SQQJ 2G8YA 3AEBC 1MV8A 5KJ7D 2I1JA 1AVYA 1SFCC 3HD7B 4WY4C 5KJ7A 2C0WA 3EFGA 4LGDE 4EOTA 3NMDA 2JWAA 3R2PA 3L71G 3L74D 1SQQG 5B66E 3B5NA 5K5GB 2W83C 1Q90D 3H1HD 1AQ5A 1JUNA 1S9KE 4WB4A 4H44D 2JDIH 1QX8A 2KLVA 1FDMA 2RN0A 5AW5B 3Q5PA 3CC4P 1LWUA 3L70D 3G71P 4LLHA 4ZKUA 2KOGA 2HODA 1PP9E 1M7LA 4JYBA 1VQ5P 1KYOH 1ZV8A 2QJKB 4ZKPA 3MGNA 1X79B 2W6AA 3JCUH 3GHGB 1YBKA 3GG2A 2LXBA 2K88A 1KILE 2Q5UA 5M1BA 4H0LD 1KILB 2JO1A 2K37A 2D2CC 2K3RA 4NPFX 1VF5D 1PL5A 3QH9A 3Q5SA 1JY3O 1S72P 3HE5B 1JY2N 2W8ZA 1LT9B 1NTKJ 2Y0EA 2YO2A 3H1JJ 1JNMA 3F5HA 5KAFE 5E79H 1R5SA 1Q7YQ 3FWLA 3CMEP 1NOHA 1GK6A 1L0LE 1HF9A 1T6AA 2H43A 1NTKG 2PAJA 5L8RJ 3IAOA 2JEEA 3H1JG 4R4MA 3HUSA 2YMYA 1NTMJ 1KQGB 3N4XA 1Y8AA 3C8VA 2P67A 2KP8A 1FE6A 1N7SB 2QJYB 4ASWA 5AVYB 1NTMG 1H0TA 1PGOA 4HJGH 3P8MC 1H8AA 1R5LA 1BCCD 1L0LK 2AXCA 5APXA 2Z5IA 4C7NB 2M5AA 1QVGO 1IK7A 5AW8B 4RO0A 2IBZE 3HD7D 3FGAD 1MFTA 3HD7A 3TGUJ 1EDKA 3AE7C 2ZYDA 1J1DB 3RK3C 2POHA 4PD4E 1LTAC 1W5CE 2WSFJ 1NJIQ 2WZ7A 2WQYC 2AXTH 2XNDH 1L0NE 5H2FH 3TGUG 3AE9C 1KB9D 1S9KD 2KYVA 2E42A 2RH0A 3I56P 2FXPA 2LKMA 1JCDA 2LXCB 3CCJP 4ASVA 3G4SP 1JMMA 3W68A 3P8CE 1GZLA 2WPQA 2O01J 2E76B 1QL1A 2VRSA 1PP9D 2WSFH 1Q86Q 2R5BA 5CCHC 1PGPA 1Y9BA 3CMAP 4MN4C 4H13B 3SWYA 5CBOA 1L0NK 1JY3P 1N86A 1CSBA 1NTZE 1GU5A 2E75B 2YIUC 1DD4A 2G3AA 5KLVJ 4PJ0E 3NXSA 1E5WA 1IC2A 1KILA 1S4XA 2JR8A 4PV1B 1LTSC 1EZVG 5KLVG 2M0BA 4L74A 2CK3H 3VP8A 2FYZA 3HE5A 1LT9A 3Q5RA 5AVWB 3PJSK 2B87B 2B89A 3O6QB 4BXLA 1NKZB 1FZEA 1KV4A 3CX5H 1SQXE 4DZOA 1NTZK 3SWFA 1VL2A 2WITA 2E5TA 1L0LD 1LP1B 3L73J 3NFQA 2J59M 2GM4A 3L72J 2OYOA 1N7SD 4CPGA 1FJKA 1M1JA 1N73C 4UB6E 3BVHA 2A45G 1N7SA 4OH8B 1RF0A 3L73G 2WVRA 3L75E 4IFFA 3A5TA 1T2KD 3AE2C 1SQXK 3BCCE 3S9OA 3L72G 3H32B 2A45H 1NYHA 4Y28J 2OTLP 2QSIA 4C7NA 3I55P 3CWBJ 3WUVA 2IBZD 5AVZB 3FXEA 1EDIA 4OGQC 2JP3A 2Y0DA 3S4RA 3E1RA 3CWBG 4JPZB 4PD4D 3TYYA 2FYNB 4W80A 1L0ND 4JBZA 4N3YB 2P2UA 3JC22 3Q1MA 5CJ4A 3H1IE 3CWBD 3Q3DA 3UIAA 4UB8E 3G3ZA 2N1TB 1NU1J 1RE3A 1GK4A 1SLQA 5AVUB 4BRYB 2A06G 2E76D 2ZT9B 2Q9IA 1HUCA 5AW7B 1RQVA 3A0BH 4KHXA 2WMMA 1BE3J 3CCQP 4GKGA 2BCCJ 1KYOI 3MUDC 4H13D 1SQBJ 4C46A 2IPPA 3MZWB 1NU1G 1KYOE 1SFCB 5CCGA 2E75D 2E74C 1S5LX 5AW9B 3JCUE 4WY4B 2OYHC 1PGQA 1NTZD 1FAVA 5DJTB 3QWOC
chains in the Genus database with same CATH topology
1FZBA 1FDMA 3GHGC 5AW5B 1CZQA 2XKMA 3M9BA 2XV5A 5CCHD 3TNUB 1LWUA 2JJLA 2O1JA 1MFZA 2HG5D 2YKQA 2HYNA 3IR9A 5CHXA 3VMZA 5CCHA 2W6BA 1JY3N 3O8ZA 4LLHA 1GL2D 1NU1K 4ZKUA 2KOGA 2OYHB 2HODA 1M7LA 4JYBA 1KILC 1ZV8A 1GU4A 4IFDK 4ZKPA 1WRGA 3MGNA 1X79B 3CI9A 1GL2A 5CMZA 1A02J 4I2LC 2W6AA 3OJAB 1AFOA 1RE4A 1FZFA 3GHGB 2NPSC 1Z56A 2HLOA 1EQ7A 5AW3B 1ZR4A 3P32A 5KJ7C 1HGZA 1LT9C 1XTCC 3HTKB 5AVVB 4XA4A 2GUVA 2Q5UA 1KILB 2CPSA 1HJBA 4C7RA 1G2CB 3BRVB 2NPSB 3V2QA 3T97A 2XNXA 2P1JA 1JY3O 4Y99C 1IJDB 1ZR2A 1NWQA 3HE5B 1MUUA 2O1KA 1JY2N 1LT9B 4EIJA 2KB7P 1LTJB 2YO2A 1JNMA 1IFMA 2WPSA 1CI6A 4JF7A 3VYIA 2FFDC 4M3LA 4RESB 3CL3D 3KYQA 1HGVA 1A02F 1H89A 3M9QA 3KQGA 2KSJA 3RK3D 1NOHA 1GK6A 1N7SC 4Y99B 2WPRA 2H43A 2PAJA 1JTHB 2IFMA 2YNYA 1HWTC 3H32A 1CW5A 2JEEA 5APVA 1NH4A 1FU1A 5AW6B 3VOPA 1NAFA 3HUSA 2YMYA 1J1EC 1N73A 2YKPA 3M91A 3P8CD 2J58A 2MJZA 2Z4EA 2FFDB 3N4XA 1ZN5A 3RK2B 2P67A 2KP8A 3B5ND 3B8EB 1JY2O 1N7SB 3U1AA 1QL2A 5AW1B 1IFJA 3LIEA 4IFMA 5BVZA 5CCGD 2IFNA 2OARA 5AVYB 2WT7A 1KZUB 1GW3A 1J1EB 3P8MC 1H8AA 3BATA 1L0LK 1URQD 5APQA 1DEBA 4JYCA 1J1DC 4W7YA 5APXA 2Z5IA 3VMXA 4C7NB 1URQA 2QM8A 1RF1C 1SQQK 2WTYA 1NO4A 1HVVA 2YO3A 5AW8B 3BASA 2I1KA 2N1TD 3TSIA 3HD7D 2P7JA 5AVQB 2N1TA 2R3CA 1LTGC 3HD7A 1HH0A 3A3YB 3M0DA 4HYTB 1J1DB 3RK3C 5BU5A 2OYIA 2POHA 3HE4A 1RE3C 2IX7C 4HH2A 1RF1B 1WT6A 1CI6B 1LTAC 1SQBK 4N78E 1T3JA 4XE5B 2WZ7A 3RL0D 4GT1A 1SFCD 3V2PA 1FZCA 2WSEH 4WY4D 2C0XA 1SFCA 1S9KD 3NTNA 2KYVA 2E42A 1KQLA 3B5NC 4WY4A 4B86A 1SVFA 1OWAA 2HPCA 3RK3B 2LKMA 1FZAA 5CCGC 1JCDA 1X9VA 1W2EA 1JMMA 3TNUA 1L4AD 3P8CE 1GZLA 2WPQA 1VPCA 1QL1A 1JCCA 1G1IA 2VRSA 1L4AA 1SQPK 1LWUC 2WSFH 3OA7A 3B5NB 2OYHA 3TK1A 3V4WA 2R5BA 2Q7CA 2M8RA 5CCHC 1GDTA 5AVTB 3SWYA 1L0NK 2L5GB 3M06A 3I5CA 3A2AA 1JY3P 1G1JA 1N86A 1CSBA 1GL2C 3BRTB 1GU5A 2YKOA 1RE4C 3L35A 2FYUK 3HTKA 3KPEA 1FOSF 4I6MC 2Q3IA 1FBMA 3NXSA 1LWUB 1N7LA 1HBWA 1E5WA 1IC2A 1KILA 2H8PD 2NPSD 1HTLC 1XTGB 1G2CA 1KFMA 2WWWA 3WMM0 1PFIA 2NPSA 2HODB 2XU6A 3P7KA 1H88A 1YYCA 2W27A 3RL0C 1LTSC 1NTKK 1DX7A 1GL2B 3V5BA 4WBAA 3VP8A 2FYZA 3HE5A 3U59A 1LT9A 5AVWB 1LTJA 3LIDA 1YTZT 1GW4A 1NKZB 1FZEA 1T3UA 4DZOA 5AW2B 1NTZK 3SWFA 1GTWA 2FKWB 3VMYA 3RL0B 1JY2P 2WITA 1L4AC 2R5DA 3VTPC 1JTHA 2A45I 3N7NA 3H6PA 2FXMA 1NTMK 5APWA 1DH3A 1JOCA 3NFQA 5APUA 2J59M 3RK2D 2WSCH 2GM4A 2CPBA 3L4FA 3MIWA 2XZRA 4AQRD 1OXZA 5AVXB 3EQ2A 2FFDA 1N7SD 2H7HA 1IO4A 1SQVK 2PP6A 1N2DC 1ZLLA 1FJKA 3II6A 5CJ0A 4I1LA 2ZXEB 3PP5A 3V4QA 3HUSC 1M1JA 1N73C 1L4AB 3BVHA 2A45G 4O9BA 1N7SA 4OH8B 1RF0A 4IFFA 3A5TA 4W7ZA 1T2KD 1SQXK 3MD0A 2C9NY 5KTBA 5APYA 1FOSE 4GIFA 3M0AA 4N6JA 3A7OA 1IFNA 3H32B 3M9HA 2A45H 2HFED 1YTZI 1LTTC 5APSA 3HUSB 3KDPB 1N73B 1NKNA 2QM7A 3HRNA 1LTJC 3V2NA 4C7NA 1IFIA 4AUWA 3U1CA 1KFNA 3MUDA 1LTBC 5AVZB 1X8YA 3L36A 3VP9A 1URQC 5AVSB 2E43A 2XDJA 3C9IA 2N9BA 4DOJA 2BASA 3E1IA 4LC1A 2WT7B 3L37A 3GHGA 1T8ZA 4AYCA 2N1TC 3TYYA 3HD7C 1RF1A 5AW4B 1FZGA 4N78D 2Z5HA 1NHLA 3M0DC 1KILD 1JO5A 2C9LY 2OYIC 4W80A 3RK2C 1URQB 5APTA 4N3YB 1M1JC 2P2UA 1IK9A 5CJ4A 1RF0C 1LTIC 3OAKA 1RY3A 2O01H 3UIAA 1FZCC 1MV8A 5KJ7D 2I1JA 3G3ZA 2N1TB 2R32A 5BU8B 1SP4A 1SFCC 1J2JB 1VDFA 1RE3A 3V2RA 3HD7B 5AW0B 1GK4A 1SLQA 5AVUB 4WY4C 1FJPA 3LW5H 5KJ7A 1T2KC 2C0WA 3EFGA 4LGDE 4EOTA 2Q9IA 1HUCA 5AW7B 2OYIB 3HE4B 3NMDA 3R2PA 1M1JB 2M3BA 4KHXA 1GD2E 4GKGA 3B5NA 3MTUE 1FZCB 1IFDA 4C46A 2IPPA 3CLQA 1SFCB 3IFMA 5CCGA 1AQ5A 1JUNA 1LGHB 1S9KE 5AW9B 2OYHC 4WY4B 2ZFCA 4WB4A 5KLVK 2HPCB 3VN0A 1MZ9A 1FAVA 2GUSA 5AVRB 2KLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWU C;  1FZB A;  1RE4 A;  1FZF A;  2OYH A;  2FFD C;  3GHG B;  3GHG C;  2HLO A;  1FZE A;  1M1J C;  1M1J B;  3H32 B;  2HPC A;  1T3U A;  2XNX A;  1FZA A;  1JY2 O;  2A45 H;  2OYI A;  1RF0 C;  2OYI C;  2FFD A;  1LWU A;  1JY3 O;  3E1I A;  1RE3 C;  2H43 A;  1RF1 C;  1RF1 B;  2HOD B;  1FZC B;  3GHG A;  1JY2 N;  1FZC C;  3HUS B;  3H32 A;  3HUS C;  1LT9 B;  1JY2 P;  1LT9 C;  1M1J A;  1N73 C;  3BVH A;  1W2E A;  2A45 G;  1N73 B;  1JY3 N;  1LTJ C;  1JY3 P;  1N86 A;  1LTJ B;  1RF0 A;  1RE3 A;  1RF1 A;  1FZG A;  1RE4 C;  2HOD A;  2OYH C;  2OYH B;  1FZC A;  3HUS A;  2A45 I;  1LT9 A;  1N73 A;  2HPC B;  2Q9I A;  2OYI B;  1LTJ A;  2Z4E A;  2FFD B;  1LWU B; 
#chains in the Genus database with same CATH topology
 3H1L E;  1BE3 G;  1RH5 B;  2BCC G;  3M9B A;  1SQB G;  1UIX A;  3TNU B;  4PV1 D;  1MFZ A;  2HG5 D;  2HYN A;  5CHX A;  4XFJ A;  1VQL P;  3AEG C;  2OGU A;  1X0T A;  5CMZ A;  1A02 J;  2KZJ A;  1RE4 A;  2NPS C;  5AW3 B;  3KHU A;  2B87 A;  3O6Q A;  3P32 A;  5KJ7 C;  2KS1 B;  1HGZ A;  3HTK B;  5E79 E;  4XA4 A;  5TIS H;  4L75 A;  2CPS A;  3F89 A;  1P84 H;  4GOF A;  1HJB A;  4C7R A;  1G2C B;  1LP1 A;  3BRV B;  3V2Q A;  2M3E A;  2P1J A;  1IJD B;  1NWQ A;  3L74 J;  4BWN A;  1LTJ B;  4QMA A;  4H44 C;  1CI6 A;  1JMB A;  2FFD C;  4RES B;  3H1H J;  1AQT A;  5C39 A;  1A02 F;  1H89 A;  3M9Q A;  3OW2 O;  3BCC D;  3KQG A;  1BSH A;  3SFE C;  3L74 G;  2FYU D;  2IFM A;  2YNY A;  1HWT C;  3H32 A;  4WWI A;  1CW5 A;  3KXD A;  3VOP A;  3L70 J;  1S1C X;  1J1E C;  2YKP A;  2NRG A;  3H1H G;  2J58 A;  2QRX A;  1U7M A;  4TT3 H;  3B5N D;  3U1A A;  1IFJ A;  4IFM A;  5BVZ A;  2IFN A;  2OAR A;  1U57 A;  2AEM A;  4DJG A;  3L70 G;  2K9Y A;  3K5B A;  2WSE J;  3VMX A;  1NGM B;  2AXT E;  2WTY A;  1NO4 A;  1HVV A;  2YO3 A;  3H1I D;  5H2F E;  2I1K A;  2N1T D;  3TSI A;  1LJ2 A;  2KUB A;  1FDI A;  2ZT9 D;  5AVQ B;  2N1T A;  1SQV D;  1HH0 A;  4BRY A;  2BEZ F;  2WSS H;  5BU5 A;  1SQP E;  1FDO A;  4K35 A;  3CCS P;  2ZVN B;  4HH2 A;  4N78 E;  1KC8 Q;  1T3J A;  4XE5 B;  3RL0 D;  4GT1 A;  1SFC D;  3V2P A;  2H89 C;  2WSE H;  4WY4 D;  1SFC A;  3RK3 E;  3NTN A;  1KQL A;  4WY4 A;  4B86 A;  3AE6 C;  3RK3 B;  5DJU B;  1NVO A;  3H1L D;  1QGK B;  4KJM A;  3S1K A;  1W2B O;  4L73 A;  3TNU A;  1L4A D;  1L4A A;  1SQP K;  2IDB A;  3LW5 J;  2M8R A;  1GDT A;  1BCC J;  3R4Y A;  3M06 A;  2ZYA A;  1ZW0 A;  1G1J A;  1K04 A;  1GL2 C;  3PHL A;  3BRT B;  2KS1 A;  1R8E A;  3CX5 I;  1AA0 A;  1DEE G;  3L35 A;  3HTK A;  1JEK A;  3KPE A;  1FOS F;  3SSU A;  1KTM A;  1FBM A;  3CX5 E;  1FC2 C;  3E7K A;  3H1K E;  1HTL C;  2IYP A;  1S2E A;  1BCC G;  5CBN A;  3GF3 A;  1G2C A;  3WMM 0;  4D6T E;  2Q1K A;  1YYC A;  2R44 A;  2W27 A;  5KLI C;  2WSC J;  3TDK A;  2GA1 A;  4EI2 A;  4I7Z C;  1DX7 A;  3V5B A;  2YIU B;  2BEQ D;  4U7J A;  3U59 A;  3GF7 A;  4WVZ A;  1LTJ A;  1YI2 P;  1K73 Q;  4HB1 A;  1GW4 A;  1T3U A;  1BDC A;  1BGY E;  4OVN F;  2R5D A;  1VQ7 P;  3VTP C;  2A45 I;  5APW A;  1U7J A;  2WSC H;  3L73 E;  2CPB A;  3L4F A;  1OVR A;  3EQ2 A;  1IO4 A;  1PP9 J;  4RJT A;  1N2D C;  3JSV C;  2ZXE B;  5B66 H;  4O9B A;  3CXH I;  3Q2Y A;  1OVV A;  1KB9 H;  4W7Z A;  1S5L E;  5APY A;  1IFN A;  1PP9 G;  3WU2 H;  5KAI H;  2V4H A;  5APS A;  1RQU A;  1N73 B;  2LR2 A;  2V7Q J;  1IFI A;  3U1C A;  2KZI A;  2P10 A;  1SS1 A;  1URQ C;  2E43 A;  1VQ9 P;  2BAS A;  5EFW B;  4LC1 A;  2WT7 B;  3L37 A;  3GHG A;  1EDJ A;  1SQP D;  4ZMD A;  4N78 D;  3CCU P;  3M0D C;  1KIL D;  1JO5 A;  2OYI C;  1L0L J;  3FXD A;  3SFD C;  5APT A;  2OTK E;  1M1J C;  4OGQ B;  2V7Q H;  1OW7 A;  1RF0 C;  1PPJ E;  2KNC B;  3OAK A;  1RY3 A;  2O01 H;  1FZC C;  2FBW C;  1BSN A;  2R32 A;  1PV3 A;  2FY8 A;  1J2J B;  1VDF A;  5AW0 B;  2QEX P;  1FJP A;  1T2K C;  1L0L G;  1NU1 E;  1PGJ A;  2O3J A;  2M3B A;  2E5Y A;  1GD2 E;  1Q2N A;  4GOD A;  1IFD A;  1BE3 E;  2PGD A;  3CLQ A;  3IFM A;  1IFP A;  2ZFC A;  3PH0 A;  2HPC B;  3MHV A;  1MZ9 A;  2GUS A;  5AVR B;  1JM0 A;  1CZQ A;  4YXD C;  5B5E E;  2XV5 A;  3CX5 D;  5CCH D;  3H1K D;  1P84 I;  5CCH A;  1JY3 N;  1N8R Q;  2I8D A;  1NU1 K;  2E74 B;  4D6T D;  2OYH B;  4A7P A;  4DT0 A;  1GU4 A;  4IFD K;  3W67 A;  1WRG A;  1K8A Q;  1OIP A;  1AFO A;  3KZI H;  1Z56 A;  2IBZ G;  1OVU A;  1OW6 A;  1L0N J;  1OW8 A;  4U3F E;  3CC2 P;  1BGY D;  1XTC C;  3CCV P;  2PRR A;  3FWN A;  5AVV B;  3D70 A;  2QVA A;  1ZOY C;  1K9M Q;  2NPS B;  3CXH H;  1L0N G;  2PFX A;  1QVF O;  4Y99 C;  4EIJ A;  4PD4 H;  4TLF A;  2WPS A;  2YMK A;  3L74 E;  3VYI A;  3CL3 D;  1Y47 A;  3H25 A;  2KSJ A;  1NTZ J;  4PV1 C;  2WPR A;  1JTH B;  1HJ0 A;  2R3S A;  3L71 E;  2Q6Q A;  1FU1 A;  4OWF A;  1SQQ E;  2RKL A;  5AW6 B;  1K05 A;  1NAF A;  1N73 A;  2IYO A;  3M91 A;  1EDL A;  3P8C D;  2MJZ A;  2Z4E A;  2FFD B;  1ZN5 A;  3RK2 B;  1NTZ G;  3B8E B;  1KD1 Q;  1JY2 O;  2K9J B;  1QL2 A;  5AW1 B;  5CCG D;  2WT7 A;  1KZU B;  1J1E B;  2SPZ A;  1YHQ P;  5APQ A;  1DEB A;  4OGQ D;  3V6I A;  4W7Y A;  4RKU J;  2MKV A;  1NAY A;  2QM8 A;  1RF1 C;  1SQQ K;  5KKZ C;  2JWD A;  1PPJ D;  1M8O B;  2KNC A;  2QG4 A;  3CCR P;  2P7J A;  2R3C A;  2KIK A;  3A3Y B;  4HYT B;  3AE4 C;  3L75 J;  1IZN B;  2IX7 C;  1WT6 A;  1E79 H;  1SQX D;  3BCC J;  1PIX A;  1KN7 A;  3RBX A;  2FYU J;  4K3A A;  2C0X A;  3B5N C;  3PLN A;  1SVF A;  4IL6 H;  1LNQ A;  1OWA A;  2HPC A;  3L75 G;  1LT1 A;  3BCC G;  1X9V A;  1M1K Q;  1QLE D;  1D7M A;  4Z1M H;  2FYU G;  2E74 D;  1JCC A;  1YJW P;  1G1I A;  1NTK E;  2D2C B;  1LWU C;  3L75 D;  3H1J E;  1EC5 A;  2W90 A;  2OYH A;  3TK1 A;  3V4W A;  3SWK A;  1VQ6 P;  1EXJ A;  3RGU A;  3CD6 P;  1H0T B;  1WMK A;  4U3F D;  2YXR B;  2ZAE B;  3H1I J;  2Q3I A;  4HKZ H;  1ZXG A;  2ZJS E;  1N7L A;  1HBW A;  2H8P D;  2NPS D;  3G9R A;  1XTG B;  1NTM E;  2KXP B;  1KFM A;  2WWW A;  1PFI A;  1SQV J;  2NPS A;  1DIP A;  1H88 A;  3RL0 C;  1NTK K;  1GL2 B;  4IL6 X;  1KMI Z;  4H0L C;  3H1I G;  1QEX A;  1VQP P;  3CCE P;  1ZRT E;  3LID A;  1YTZ T;  1VF5 C;  1KOR A;  1SQV G;  1AVO A;  2JKV A;  1GTW A;  2FKW B;  5GTH H;  3AEF C;  1KB9 I;  3VMY A;  3ZDM A;  2Y0C A;  5KLI B;  2QJP C;  1JY2 P;  1L4A C;  2QA4 P;  4I7Z B;  1KB9 E;  4UB8 H;  3H1L J;  1JTH A;  3T97 B;  3L71 D;  4KT0 J;  4GDO A;  1NTM K;  1JOC A;  1SQQ D;  3WU2 E;  5KAI E;  3RK2 D;  3B71 A;  1S3J A;  4AQR D;  1OXZ A;  5AVX B;  2FFD A;  3TGU E;  5GTI H;  1ZLL A;  5CJ0 A;  3II6 A;  4I1L A;  3PP5 A;  3HUS C;  3H1L G;  2K9J A;  3A0H H;  2NZ2 A;  1PZQ A;  1YJN P;  1KYO D;  3MD0 A;  2KLU A;  2C9N Y;  3CCM P;  4GIF A;  1VQM P;  3M0A A;  2UWJ E;  3VMA A;  2HFE D;  2B88 A;  1LTT C;  3CC7 P;  2Q3E A;  2QM7 A;  1LTJ C;  1AJY A;  1X8Y A;  3VP9 A;  2W6J H;  2XDJ A;  3IN6 A;  3C9I A;  1JB0 J;  1VQ4 P;  2N9Y B;  1T8Z A;  1DD3 A;  3HD7 C;  5AW4 B;  2Z5H A;  1EZV I;  2KK7 A;  2C9L Y;  1URQ B;  1EZV E;  3ABV C;  5KLV E;  1M57 D;  1IK9 A;  3GW6 A;  3CCL P;  5BU8 B;  1SP4 A;  3V2R A;  3ITK A;  3C1L A;  3LW5 H;  1VQO P;  1KQF B;  2D2C D;  2OYI B;  3HE4 B;  1M1J B;  1NTK D;  4DCK A;  3H1J D;  4EYY Q;  1VQK P;  3MTU E;  2FXO A;  1FZC B;  3AE8 C;  1LGH B;  2L91 A;  3KZI E;  5KLV K;  2QJK C;  3VN0 A;  3IF4 A;  1FZB A;  3CPW O;  3GHG C;  3B4S A;  2XKM A;  2P58 A;  4YXW H;  2JJL A;  2O1J A;  2IBZ I;  2YKQ A;  1EXI A;  3IR9 A;  1NTM D;  3VMZ A;  1ZP0 C;  2W6B A;  3O8Z A;  3L72 E;  1GL2 D;  4IOI H;  1KIL C;  1Q81 Q;  3CXH E;  1SQP J;  3CI9 A;  1GL2 A;  4I2L C;  3OJA B;  1FZF A;  2HLO A;  1EQ7 A;  4PD4 I;  1ZRT D;  1ZR4 A;  2AEF A;  1KQS O;  2OQQ A;  2QE7 H;  1LT9 C;  1GMJ A;  2GUV A;  2WPV B;  1SQP G;  2O01 N;  2H88 C;  4ZNC A;  3CWB E;  3T97 A;  1RHZ B;  2XNX A;  1ZR2 A;  3PTZ A;  3D6Y A;  1MUU A;  2O1K A;  1FS0 E;  2KB7 P;  2ZXX A;  3TGU D;  3AE3 C;  1IFM A;  4JF7 A;  3A0B E;  3EWK A;  4M3L A;  3KYQ A;  1HGV A;  3D71 A;  1TU3 F;  4NPD A;  2A06 E;  3RK3 D;  1N7S C;  2ZVO B;  4Y99 B;  2QJY C;  4R4L A;  5APV A;  1NH4 A;  3H1K J;  4YPC A;  5TJH A;  4YTP C;  5KAF H;  4D6T J;  3GMA A;  1USE A;  3RBZ A;  3LIE A;  1OZH A;  3H1K G;  2BCC E;  1GW3 A;  1SQB E;  1BGY J;  3BAT A;  2RMZ A;  4D6T G;  1URQ D;  4JYC A;  1J1D C;  2Y9Y A;  1EZV D;  1URQ A;  2ZYG A;  3AE1 C;  5KLV D;  5TIS E;  3BAS A;  1P84 E;  2B9B A;  2DW3 A;  1BGY G;  1L2P A;  4IL6 E;  1LTG C;  3M0D A;  4JQ0 D;  2OYI A;  3HE4 A;  1RE3 C;  1RF1 B;  5KKZ B;  1CI6 B;  1SQB K;  4GOE A;  1FZC A;  2E76 C;  3EFF K;  1VQ8 P;  2IZ1 A;  3FX0 A;  2FYU E;  4EDF A;  1FZA A;  1USD A;  1YQ3 C;  5CCG C;  4H13 C;  3L73 D;  1W2E A;  2E75 C;  1VPC A;  3L72 D;  3OA7 A;  2J5U A;  3B5N B;  3CXH D;  1S5L H;  2Q7C A;  1X22 A;  5AVT B;  3H1H E;  2ITA A;  2L5G B;  3I5C A;  3A2A A;  4L76 A;  3GLM A;  2YKO A;  1RE4 C;  4H44 B;  2FYU K;  4I6M C;  1LWU B;  5GTH E;  3L70 E;  3AE5 C;  2HOD B;  2XU6 A;  3P7K A;  3AED C;  1SQV E;  4WBA A;  3USS A;  1PPJ G;  1OFC X;  1YIT P;  1SQX J;  4NPE A;  1AV1 A;  4PJ0 H;  5GTI E;  3RL0 g;  5AW2 B;  1OX3 A;  3AEE C;  3A0H E;  3RL0 B;  2A06 D;  2AEJ A;  2YXQ B;  3WUU A;  4H0L B;  1SQX G;  2K1A A;  1UII A;  3N7N A;  3PRJ A;  3H6P A;  2FXM A;  2QIW A;  1DH3 A;  5APU A;  1VF5 B;  3MIW A;  2XZR A;  2KI7 B;  1NU1 D;  2H7H A;  1SQV K;  2PP6 A;  3V4Q A;  2QJP B;  1YJ9 P;  1L4A B;  2Y9Z A;  1MKM A;  1BE3 D;  2HR3 A;  1Q82 Q;  2BCC D;  3TF5 A;  1SQB D;  5KTB A;  1FOS E;  4U3F J;  4N6J A;  3A7O A;  3MP7 B;  3M9H A;  1YTZ I;  5B5E H;  3HUS B;  3KDP B;  1M90 Q;  1NKN A;  3HRN A;  3V2N A;  4AUW A;  1BDD A;  1KFN A;  3MUD A;  1YQ4 C;  4UB6 H;  1LTB C;  1P84 D;  2IZ0 A;  3G6E P;  4U3F G;  2FYN C;  3L36 A;  5AVS B;  3D6Z A;  2N9B A;  4DOJ A;  3AEC C;  3AEA C;  3E1I A;  2OTJ P;  1ZME C;  4AYC A;  2N1T C;  1RF1 A;  1BCC E;  1FZG A;  1NHL A;  2ZT9 C;  1VQN P;  1M56 D;  3RK2 C;  2M5A B;  1YIJ P;  2KSE A;  3WUT A;  3L71 J;  1OMI A;  1LTI C;  1SQQ J;  2G8Y A;  3AEB C;  1MV8 A;  5KJ7 D;  2I1J A;  1AVY A;  1SFC C;  3HD7 B;  4WY4 C;  5KJ7 A;  2C0W A;  3EFG A;  4LGD E;  4EOT A;  3NMD A;  2JWA A;  3R2P A;  3L71 G;  3L74 D;  1SQQ G;  5B66 E;  3B5N A;  5K5G B;  2W83 C;  1Q90 D;  3H1H D;  1AQ5 A;  1JUN A;  1S9K E;  4WB4 A;  4H44 D;  2JDI H;  1QX8 A;  2KLV A;  1FDM A;  2RN0 A;  5AW5 B;  3Q5P A;  3CC4 P;  1LWU A;  3L70 D;  3G71 P;  4LLH A;  4ZKU A;  2KOG A;  2HOD A;  1PP9 E;  1M7L A;  4JYB A;  1VQ5 P;  1KYO H;  1ZV8 A;  2QJK B;  4ZKP A;  3MGN A;  1X79 B;  2W6A A;  3JCU H;  3GHG B;  1YBK A;  3GG2 A;  2LXB A;  2K88 A;  1KIL E;  2Q5U A;  5M1B A;  4H0L D;  1KIL B;  2JO1 A;  2K37 A;  2D2C C;  2K3R A;  4NPF X;  1VF5 D;  1PL5 A;  3QH9 A;  3Q5S A;  1JY3 O;  1S72 P;  3HE5 B;  1JY2 N;  2W8Z A;  1LT9 B;  1NTK J;  2Y0E A;  2YO2 A;  3H1J J;  1JNM A;  3F5H A;  5KAF E;  5E79 H;  1R5S A;  1Q7Y Q;  3FWL A;  3CME P;  1NOH A;  1GK6 A;  1L0L E;  1HF9 A;  1T6A A;  2H43 A;  1NTK G;  2PAJ A;  5L8R J;  3IAO A;  2JEE A;  3H1J G;  4R4M A;  3HUS A;  2YMY A;  1NTM J;  1KQG B;  3N4X A;  1Y8A A;  3C8V A;  2P67 A;  2KP8 A;  1FE6 A;  1N7S B;  2QJY B;  4ASW A;  5AVY B;  1NTM G;  1H0T A;  1PGO A;  4HJG H;  3P8M C;  1H8A A;  1R5L A;  1BCC D;  1L0L K;  2AXC A;  5APX A;  2Z5I A;  4C7N B;  2M5A A;  1QVG O;  1IK7 A;  5AW8 B;  4RO0 A;  2IBZ E;  3HD7 D;  3FGA D;  1MFT A;  3HD7 A;  3TGU J;  1EDK A;  3AE7 C;  2ZYD A;  1J1D B;  3RK3 C;  2POH A;  4PD4 E;  1LTA C;  1W5C E;  2WSF J;  1NJI Q;  2WZ7 A;  2WQY C;  2AXT H;  2XND H;  1L0N E;  5H2F H;  3TGU G;  3AE9 C;  1KB9 D;  1S9K D;  2KYV A;  2E42 A;  2RH0 A;  3I56 P;  2FXP A;  2LKM A;  1JCD A;  2LXC B;  3CCJ P;  4ASV A;  3G4S P;  1JMM A;  3W68 A;  3P8C E;  1GZL A;  2WPQ A;  2O01 J;  2E76 B;  1QL1 A;  2VRS A;  1PP9 D;  2WSF H;  1Q86 Q;  2R5B A;  5CCH C;  1PGP A;  1Y9B A;  3CMA P;  4MN4 C;  4H13 B;  3SWY A;  5CBO A;  1L0N K;  1JY3 P;  1N86 A;  1CSB A;  1NTZ E;  1GU5 A;  2E75 B;  2YIU C;  1DD4 A;  2G3A A;  5KLV J;  4PJ0 E;  3NXS A;  1E5W A;  1IC2 A;  1KIL A;  1S4X A;  2JR8 A;  4PV1 B;  1LTS C;  1EZV G;  5KLV G;  2M0B A;  4L74 A;  2CK3 H;  3VP8 A;  2FYZ A;  3HE5 A;  1LT9 A;  3Q5R A;  5AVW B;  3PJS K;  2B87 B;  2B89 A;  3O6Q B;  4BXL A;  1NKZ B;  1FZE A;  1KV4 A;  3CX5 H;  1SQX E;  4DZO A;  1NTZ K;  3SWF A;  1VL2 A;  2WIT A;  2E5T A;  1L0L D;  1LP1 B;  3L73 J;  3NFQ A;  2J59 M;  2GM4 A;  3L72 J;  2OYO A;  1N7S D;  4CPG A;  1FJK A;  1M1J A;  1N73 C;  4UB6 E;  3BVH A;  2A45 G;  1N7S A;  4OH8 B;  1RF0 A;  3L73 G;  2WVR A;  3L75 E;  4IFF A;  3A5T A;  1T2K D;  3AE2 C;  1SQX K;  3BCC E;  3S9O A;  3L72 G;  3H32 B;  2A45 H;  1NYH A;  4Y28 J;  2OTL P;  2QSI A;  4C7N A;  3I55 P;  3CWB J;  3WUV A;  2IBZ D;  5AVZ B;  3FXE A;  1EDI A;  4OGQ C;  2JP3 A;  2Y0D A;  3S4R A;  3E1R A;  3CWB G;  4JPZ B;  4PD4 D;  3TYY A;  2FYN B;  4W80 A;  1L0N D;  4JBZ A;  4N3Y B;  2P2U A;  3JC2 2;  3Q1M A;  5CJ4 A;  3H1I E;  3CWB D;  3Q3D A;  3UIA A;  4UB8 E;  3G3Z A;  2N1T B;  1NU1 J;  1RE3 A;  1GK4 A;  1SLQ A;  5AVU B;  4BRY B;  2A06 G;  2E76 D;  2ZT9 B;  2Q9I A;  1HUC A;  5AW7 B;  1RQV A;  3A0B H;  4KHX A;  2WMM A;  1BE3 J;  3CCQ P;  4GKG A;  2BCC J;  1KYO I;  3MUD C;  4H13 D;  1SQB J;  4C46 A;  2IPP A;  3MZW B;  1NU1 G;  1KYO E;  1SFC B;  5CCG A;  2E75 D;  2E74 C;  1S5L X;  5AW9 B;  3JCU E;  4WY4 B;  2OYH C;  1PGQ A;  1NTZ D;  1FAV A;  5DJT B;  3QWO C; 
#chains in the Genus database with same CATH homology
 1FZB A;  1FDM A;  3GHG C;  5AW5 B;  1CZQ A;  2XKM A;  3M9B A;  2XV5 A;  5CCH D;  3TNU B;  1LWU A;  2JJL A;  2O1J A;  1MFZ A;  2HG5 D;  2YKQ A;  2HYN A;  3IR9 A;  5CHX A;  3VMZ A;  5CCH A;  2W6B A;  1JY3 N;  3O8Z A;  4LLH A;  1GL2 D;  1NU1 K;  4ZKU A;  2KOG A;  2OYH B;  2HOD A;  1M7L A;  4JYB A;  1KIL C;  1ZV8 A;  1GU4 A;  4IFD K;  4ZKP A;  1WRG A;  3MGN A;  1X79 B;  3CI9 A;  1GL2 A;  5CMZ A;  1A02 J;  4I2L C;  2W6A A;  3OJA B;  1AFO A;  1RE4 A;  1FZF A;  3GHG B;  2NPS C;  1Z56 A;  2HLO A;  1EQ7 A;  5AW3 B;  1ZR4 A;  3P32 A;  5KJ7 C;  1HGZ A;  1LT9 C;  1XTC C;  3HTK B;  5AVV B;  4XA4 A;  2GUV A;  2Q5U A;  1KIL B;  2CPS A;  1HJB A;  4C7R A;  1G2C B;  3BRV B;  2NPS B;  3V2Q A;  3T97 A;  2XNX A;  2P1J A;  1JY3 O;  4Y99 C;  1IJD B;  1ZR2 A;  1NWQ A;  3HE5 B;  1MUU A;  2O1K A;  1JY2 N;  1LT9 B;  4EIJ A;  2KB7 P;  1LTJ B;  2YO2 A;  1JNM A;  1IFM A;  2WPS A;  1CI6 A;  4JF7 A;  3VYI A;  2FFD C;  4M3L A;  4RES B;  3CL3 D;  3KYQ A;  1HGV A;  1A02 F;  1H89 A;  3M9Q A;  3KQG A;  2KSJ A;  3RK3 D;  1NOH A;  1GK6 A;  1N7S C;  4Y99 B;  2WPR A;  2H43 A;  2PAJ A;  1JTH B;  2IFM A;  2YNY A;  1HWT C;  3H32 A;  1CW5 A;  2JEE A;  5APV A;  1NH4 A;  1FU1 A;  5AW6 B;  3VOP A;  1NAF A;  3HUS A;  2YMY A;  1J1E C;  1N73 A;  2YKP A;  3M91 A;  3P8C D;  2J58 A;  2MJZ A;  2Z4E A;  2FFD B;  3N4X A;  1ZN5 A;  3RK2 B;  2P67 A;  2KP8 A;  3B5N D;  3B8E B;  1JY2 O;  1N7S B;  3U1A A;  1QL2 A;  5AW1 B;  1IFJ A;  3LIE A;  4IFM A;  5BVZ A;  5CCG D;  2IFN A;  2OAR A;  5AVY B;  2WT7 A;  1KZU B;  1GW3 A;  1J1E B;  3P8M C;  1H8A A;  3BAT A;  1L0L K;  1URQ D;  5APQ A;  1DEB A;  4JYC A;  1J1D C;  4W7Y A;  5APX A;  2Z5I A;  3VMX A;  4C7N B;  1URQ A;  2QM8 A;  1RF1 C;  1SQQ K;  2WTY A;  1NO4 A;  1HVV A;  2YO3 A;  5AW8 B;  3BAS A;  2I1K A;  2N1T D;  3TSI A;  3HD7 D;  2P7J A;  5AVQ B;  2N1T A;  2R3C A;  1LTG C;  3HD7 A;  1HH0 A;  3A3Y B;  3M0D A;  4HYT B;  1J1D B;  3RK3 C;  5BU5 A;  2OYI A;  2POH A;  3HE4 A;  1RE3 C;  2IX7 C;  4HH2 A;  1RF1 B;  1WT6 A;  1CI6 B;  1LTA C;  1SQB K;  4N78 E;  1T3J A;  4XE5 B;  2WZ7 A;  3RL0 D;  4GT1 A;  1SFC D;  3V2P A;  1FZC A;  2WSE H;  4WY4 D;  2C0X A;  1SFC A;  1S9K D;  3NTN A;  2KYV A;  2E42 A;  1KQL A;  3B5N C;  4WY4 A;  4B86 A;  1SVF A;  1OWA A;  2HPC A;  3RK3 B;  2LKM A;  1FZA A;  5CCG C;  1JCD A;  1X9V A;  1W2E A;  1JMM A;  3TNU A;  1L4A D;  3P8C E;  1GZL A;  2WPQ A;  1VPC A;  1QL1 A;  1JCC A;  1G1I A;  2VRS A;  1L4A A;  1SQP K;  1LWU C;  2WSF H;  3OA7 A;  3B5N B;  2OYH A;  3TK1 A;  3V4W A;  2R5B A;  2Q7C A;  2M8R A;  5CCH C;  1GDT A;  5AVT B;  3SWY A;  1L0N K;  2L5G B;  3M06 A;  3I5C A;  3A2A A;  1JY3 P;  1G1J A;  1N86 A;  1CSB A;  1GL2 C;  3BRT B;  1GU5 A;  2YKO A;  1RE4 C;  3L35 A;  2FYU K;  3HTK A;  3KPE A;  1FOS F;  4I6M C;  2Q3I A;  1FBM A;  3NXS A;  1LWU B;  1N7L A;  1HBW A;  1E5W A;  1IC2 A;  1KIL A;  2H8P D;  2NPS D;  1HTL C;  1XTG B;  1G2C A;  1KFM A;  2WWW A;  3WMM 0;  1PFI A;  2NPS A;  2HOD B;  2XU6 A;  3P7K A;  1H88 A;  1YYC A;  2W27 A;  3RL0 C;  1LTS C;  1NTK K;  1DX7 A;  1GL2 B;  3V5B A;  4WBA A;  3VP8 A;  2FYZ A;  3HE5 A;  3U59 A;  1LT9 A;  5AVW B;  1LTJ A;  3LID A;  1YTZ T;  1GW4 A;  1NKZ B;  1FZE A;  1T3U A;  4DZO A;  5AW2 B;  1NTZ K;  3SWF A;  1GTW A;  2FKW B;  3VMY A;  3RL0 B;  1JY2 P;  2WIT A;  1L4A C;  2R5D A;  3VTP C;  1JTH A;  2A45 I;  3N7N A;  3H6P A;  2FXM A;  1NTM K;  5APW A;  1DH3 A;  1JOC A;  3NFQ A;  5APU A;  2J59 M;  3RK2 D;  2WSC H;  2GM4 A;  2CPB A;  3L4F A;  3MIW A;  2XZR A;  4AQR D;  1OXZ A;  5AVX B;  3EQ2 A;  2FFD A;  1N7S D;  2H7H A;  1IO4 A;  1SQV K;  2PP6 A;  1N2D C;  1ZLL A;  1FJK A;  3II6 A;  5CJ0 A;  4I1L A;  2ZXE B;  3PP5 A;  3V4Q A;  3HUS C;  1M1J A;  1N73 C;  1L4A B;  3BVH A;  2A45 G;  4O9B A;  1N7S A;  4OH8 B;  1RF0 A;  4IFF A;  3A5T A;  4W7Z A;  1T2K D;  1SQX K;  3MD0 A;  2C9N Y;  5KTB A;  5APY A;  1FOS E;  4GIF A;  3M0A A;  4N6J A;  3A7O A;  1IFN A;  3H32 B;  3M9H A;  2A45 H;  2HFE D;  1YTZ I;  1LTT C;  5APS A;  3HUS B;  3KDP B;  1N73 B;  1NKN A;  2QM7 A;  3HRN A;  1LTJ C;  3V2N A;  4C7N A;  1IFI A;  4AUW A;  3U1C A;  1KFN A;  3MUD A;  1LTB C;  5AVZ B;  1X8Y A;  3L36 A;  3VP9 A;  1URQ C;  5AVS B;  2E43 A;  2XDJ A;  3C9I A;  2N9B A;  4DOJ A;  2BAS A;  3E1I A;  4LC1 A;  2WT7 B;  3L37 A;  3GHG A;  1T8Z A;  4AYC A;  2N1T C;  3TYY A;  3HD7 C;  1RF1 A;  5AW4 B;  1FZG A;  4N78 D;  2Z5H A;  1NHL A;  3M0D C;  1KIL D;  1JO5 A;  2C9L Y;  2OYI C;  4W80 A;  3RK2 C;  1URQ B;  5APT A;  4N3Y B;  1M1J C;  2P2U A;  1IK9 A;  5CJ4 A;  1RF0 C;  1LTI C;  3OAK A;  1RY3 A;  2O01 H;  3UIA A;  1FZC C;  1MV8 A;  5KJ7 D;  2I1J A;  3G3Z A;  2N1T B;  2R32 A;  5BU8 B;  1SP4 A;  1SFC C;  1J2J B;  1VDF A;  1RE3 A;  3V2R A;  3HD7 B;  5AW0 B;  1GK4 A;  1SLQ A;  5AVU B;  4WY4 C;  1FJP A;  3LW5 H;  5KJ7 A;  1T2K C;  2C0W A;  3EFG A;  4LGD E;  4EOT A;  2Q9I A;  1HUC A;  5AW7 B;  2OYI B;  3HE4 B;  3NMD A;  3R2P A;  1M1J B;  2M3B A;  4KHX A;  1GD2 E;  4GKG A;  3B5N A;  3MTU E;  1FZC B;  1IFD A;  4C46 A;  2IPP A;  3CLQ A;  1SFC B;  3IFM A;  5CCG A;  1AQ5 A;  1JUN A;  1LGH B;  1S9K E;  5AW9 B;  2OYH C;  4WY4 B;  2ZFC A;  4WB4 A;  5KLV K;  2HPC B;  3VN0 A;  1MZ9 A;  1FAV A;  2GUS A;  5AVR B;  2KLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...