2HPCA

Crystal structure of fragment d from human fibrinogen complexed with gly-pro-arg-pro-amide.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 17
structure length 74
sequence length 74
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2006-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hpcA00
2A45G 2OYHC 1N73B 2HODB 2H43A 1JY3N 1W2EA 1M1JB 2HPCA 2OYHB 1JY2O 2HODA 2FFDB 1FZCC 3HUSB 1LTJB 2Z4EA 1LWUA 1JY3O 2FFDC 1FZCB 1LTJC 1FZAA 1FZEA 1RF0C 3HUSC 1N73C 2Q9IA 1LWUC 2FFDA 1JY2N 2HPCB 1FZBA 1JY2P 1LWUB 1FZCA 2A45I 2XNXA 2OYIB 3H32A 1RE3C 1RE4C 2A45H 1M1JA 2OYIC 1LT9B 1FZGA 1T3UA 3GHGC 3H32B 1N73A 1FZFA 1LT9C 1LT9A 2HLOA 3E1IA 1RF1A 2OYHA 1RF1C 1RF0A 3HUSA 1M1JC 3GHGB 1N86A 3BVHA 1RE3A 1RE4A 1JY3P 2OYIA 1RF1B 1LTJA 3GHGA
chains in the Genus database with same CATH superfamily
1GW3A 3AEDC 3F89A 3L70J 3PH0A 1Q7YQ 3S4RA 1VQ7P 2Z4EA 2Y0EA 1SQVK 1T3JA 3MTUE 1G2CB 1CZQA 1X22A 2E42A 1IC2A 2BCCJ 2FYUJ 3L73G 4IFMA 1HGZA 5AW3B 3AE3C 4L76A 3V2RA 4DCKA 1EXIA 4AUWA 1NTZG 4I7ZB 1RQVA 1KZUB 1GU5A 5AW2B 1U7MA 1IZNB 2ITAA 2E76C 3JC22 2HYNA 3L70E 1BCCG 1Q90D 1YBKA 1MFZA 2FXMA 2PGDA 2YMKA 2YXRB 2V4HA 3H32B 1GDTA 1RF1C 4IFFA 3JCUE 2I1JA 4GOEA 1OVRA 4YTPC 1HJBA 1SQBG 3MD0A 2UWJE 1OX3A 5TISE 3WU2H 4N6JA 1LTBC 3QH9A 3P8CE 5AW6B 2AEFA 3SSUA 1SQQG 1Y47A 5KLVJ 2H8PD 4D6TJ 3EQ2A 3U59A 2FYUK 1NU1J 1YQ4C 3MZWB 2NZ2A 5APUA 2FFDC 3G3ZA 3H1KG 2CK3H 1LTJC 4H0LD 4WBAA 1S3JA 1JM0A 3KZIH 3RBZA 4H0LB 5CCGA 1YYCA 2WMMA 2Z5IA 3N7NA 2Y0CA 2BCCD 1J1DB 2R5BA 1NTMG 1ZN5A 1S9KD 1KV4A 5BU5A 4MN4C 4H13D 1ZP0C 2IBZE 1Q2NA 2ZT9D 3PP5A 3II6A 3TDKA 3V2NA 3L73E 1IFPA 5AVTB 3L72G 5CCHA 1RH5B 3R2PA 2WSCJ 4HB1A 1FZFA 1K04A 1HBWA 2KOGA 3GMAA 3LW5J 2PFXA 3TGUE 4LGDE 2FKWB 4IFDK 2A06E 2WT7B 1NJIQ 2WSEH 4TLFA 2Y9ZA 5B5EE 1MKMA 5AVQB 1NU1G 1OW8A 3AE1C 4I1LA 3FWLA 1T2KD 1L4AC 5AVVB 3C9IA 3O6QB 1H0TA 1L4AD 2ZYAA 3V4WA 3AE9C 1SFCC 2IYOA 5CCHD 3L37A 1PGJA 1ZLLA 1E5WA 1VQ5P 3HE5B 1BE3G 5KKZC 3FWNA 1S5LE 1TU3F 2LR2A 3AE8C 1ZR2A 1YITP 2Q5UA 1J1EC 1JMMA 1GTWA 1BSNA 1Q86Q 1KB9H 3GHGC 1L0NJ 1KQLA 1LP1A 2G3AA 2K9YA 2OYOA 2N1TA 3CCMP 3H1JG 1SQXG 1NU1K 1L0NE 4KHXA 2K9JA 3ZDMA 1RQUA 3PHLA 5KLVK 1G2CA 1UIXA 2YO3A 2N1TB 3IF4A 1SP4A 4JQ0D 5TISH 1H8AA 2ZYGA 4N78E 2W8ZA 3A0HE 4ZMDA 1K73Q 2CPBA 2IBZD 3QWOC 3H1LG 4U3FJ 3VTPC 4NPEA 2IYPA 3V6IA 1NU1D 1U7JA 1VF5D 1EDLA 1W2BO 2R32A 3Q5RA 1YQ3C 2WPSA 1VQOP 5KLIC 3W68A 2B87B 3A2AA 3L71G 5AW4B 2Y0DA 1J1DC 2LKMA 4L74A 5KAIE 1JY2P 2O01N 1AVOA 2B89A 2O3JA 1VL2A 1IK9A 1GL2A 3CI9A 3RL0g 1DIPA 2LXCB 1N73A 1VQMP 2M5AB 2OYHA 2BEZF 3L70G 1M1KQ 3AEEC 2GUSA 4U7JA 1N7LA 3B8EB 3L75D 2OARA 2P7JA 4OGQC 2NPSB 1N73C 1GW4A 1SQQK 3BCCE 3G4SP 1SQBE 2E5YA 3L70D 2W83C 1MV8A 3HE4A 1QLED 1WT6A 1N7SA 3HUSB 3B5ND 2VRSA 3CCQP 1JOCA 1ZR4A 3RBXA 2WPQA 3CL3D 3A5TA 1ZRTD 2Q7CA 3RK2B 2J59M 4UB8H 4W80A 3RGUA 3VMXA 3L71D 3RK3C 1D7MA 2K37A 2P58A 1RHZB 3MIWA 4GODA 1HH0A 3VMAA 2W90A 4N3YB 4BXLA 2KIKA 3L75J 4Y99C 3H32A 5CMZA 2A45H 3WUTA 5KKZB 4ZNCA 2E43A 3H1LD 3C8VA 1T2KC 1BCCD 4HH2A 3FX0A 3Q1MA 2C9LY 1LTSC 3CLQA 3F5HA 1DD3A 1M56D 1K05A 1HJ0A 1NYHA 2HG5D 1KFNA 1FBMA 1N86A 2FYNB 2XNDH 3B5NB 4LLHA 1DX7A 1FDOA 1L0LG 2D2CB 2J58A 2OYHC 1ZMEC 3TK1A 1FOSF 2NPSD 2M3BA 3AE7C 1SQXD 5AVYB 1USEA 4I6MC 3CCUP 2J5UA 1VF5C 1YJWP 3BCCG 2QJYC 1SQVJ 2WZ7A 2M0BA 2BCCE 1FZEA 1GMJA 3OW2O 1YHQP 1BE3D 2ZVNB 4U3FD 1X9VA 2OTJP 1LTIC 1LWUC 4WY4C 4H13C 5KAFE 2JKVA 5AW8B 1WMKA 2ZXXA 4RKUJ 4EYYQ 3L72J 1MZ9A 1FZCA 1P84H 5BVZA 2FYZA 1LTTC 1OXZA 1RE4C 2H7HA 1MUUA 3O6QA 1L0LE 4RO0A 5GTHE 4YPCA 2OYIC 3OJAB 4XE5B 3P32A 1VQLP 4W7YA 2N1TC 1BGYD 2E76B 3HD7A 1BGYJ 2YNYA 3M9HA 3Q2YA 1SQVE 2YIUC 1AVYA 3L74J 1BGYE 3HRNA 1RF1B 1BDCA 4OGQB 3CX5E 3AE2C 1N73B 4EOTA 1W2EA 2WSFJ 2H88C 1JY2O 1USDA 4QMAA 5AVWB 5KJ7D 1DH3A 2XV5A 1GK6A 3AE4C 4EIJA 3CD6P 1JB0J 2P1JA 3HD7B 3HE5A 1JTHB 3H1HG 3L72D 1PZQA 2DW3A 4PD4D 1KYOE 1S72P 4YXDC 1RF0C 3LIEA 1MFTA 1VQ4P 1PL5A 4IL6H 5GTIE 2QJPC 1KQSO 2ZT9C 4WY4D 1VQ9P 2BCCG 1S5LX 2E76D 5AW5B 1IFIA 4N78D 1GL2D 1QVFO 1NVOA 2QRXA 3H1JJ 1SQXJ 4WWIA 1KB9E 4M3LA 2Q6QA 1KFMA 3H1KD 2G8YA 2KNCB 2OTKE 2AXCA 2B88A 1P84D 1T8ZA 1PV3A 1QX8A 2R3CA 5DJUB 3S9OA 3KYQA 4EDFA 1RE4A 2OYIA 4PD4I 2QE7H 2ZJSE 1KD1Q 3KHUA 3R4YA 3A0BE 1KILE 1HWTC 1QL1A 4IL6X 2HODA 1OMIA 2FY8A 3CWBJ 3I5CA 4L75A 3D71A 1X8YA 2OTLP 2QJKB 1LWUA 1PP9D 2WITA 2JO1A 3NFQA 2W27A 2K1AA 4WY4A 3H1HD 4Y28J 1OZHA 2KB7P 2KP8A 2QJYB 2V7QH 3H1HJ 2IX7C 3L71E 4UB6E 3VYIA 1IK7A 3H1KJ 1IFDA 1S1CX 3RK3D 1ZRTE 3RL0B 2FFDA 4WB4A 1EZVI 1N7SB 3P8MC 1KORA 1P84I 2AXTH 2C0XA 4H13B 1Y8AA 4PD4H 3V2PA 3CC7P 1NTMJ 2QEXP 4LC1A 4UB6H 3G71P 1KILD 1NWQA 3IFMA 1T3UA 1SQPJ 3CC2P 2WVRA 3T97B 2OGUA 1YTZI 2D2CC 3AEBC 3KQGA 1L4AA 3VN0A 2RH0A 1SQPE 1OVVA 2AXTE 2O1KA 5AVZB 1PGPA 2ZVOB 5EFWB 1M90Q 3H1KE 2KSJA 1CSBA 3I55P 5AW9B 1PFIA 4U3FG 1QL2A 2BEQD 2QIWA 3CXHD 3CWBD 3SWKA 1H0TB 1L4AB 1JY3O 3TYYA 4C7RA 1YIJP 1FZCB 1NTKJ 3HD7C 4NPFX 1NTKD 1JTHA 4ASVA 2R3SA 5B66H 3EFGA 5KLVE 1KQFB 1FOSE 1LJ2A 3PJSK 1GZLA 1FZBA 2WSEJ 1NU1E 3A3YB 1M57D 3MGNA 2RKLA 1VPCA 3GG2A 1PGOA 1S5LH 3V2QA 2OQQA 2P67A 3FXDA 4IL6E 4BRYB 2M8RA 5GTIH 1GD2E 2KUBA 3AE5C 3MUDA 4O9BA 5E79E 4IOIH 1LTGC 4K35A 2K9JB 2WWWA 3I56P 1AQ5A 1FU1A 4PV1D 2IZ1A 1LT1A 1L0LJ 2KZJA 5CCGC 3B4SA 2ZAEB 3CCJP 2YKPA 1SQVD 2JEEA 1L0ND 3BVHA 2JWAA 1RE3A 1UIIA 4JBZA 1FS0E 2AEMA 3H1JE 1JNMA 1E79H 1URQC 2KK7A 1GL2C 2XZRA 3AEGC 2NPSC 4GIFA 3AEAC 4KT0J 1U57A 1URQD 1NKNA 2N9BA 3VMZA 5CBNA 1FC2C 1EDIA 1Q81Q 2QJKC 4C7NB 4AYCA 2H89C 2ZT9B 3UIAA 3HUSC 1M8OB 3VP9A 1A02F 3D6YA 1PP9J 1NKZB 2RN0A 2SPZA 3CXHH 3GF3A 3H1LJ 5CJ0A 1OVUA 5KLVD 1N8RQ 2ZYDA 3M0AA 1WRGA 4AQRD 1IFMA 1X0TA 1SQBK 3KPEA 1H88A 1G1IA 1OIPA 2L91A 3L75G 3RK2C 5AVXB 1N7SC 3IR9A 3MHVA 3PRJA 2A45I 3B5NA 3L71J 5CHXA 5AVRB 1NTZK 5C39A 3RK3B 1EZVG 3V4QA 2KYVA 4K3AA 1HUCA 3TGUJ 1YJ9P 1OFCX 4PV1B 1IJDB 4Y99B 2Q3EA 5B5EH 3B71A 5CJ4A 3BRTB 3PTZA 1M1JC 1SQPD 2FBWC 4CPGA 1VQ6P 3AECC 3CX5I 1BCCE 2M3EA 1AFOA 1JO5A 2A45G 1JUNA 2IPPA 3H1LE 5APTA 2H43A 3TNUB 2V7QJ 3B5NC 4NPDA 1KMIZ 4ASWA 1EC5A 2GUVA 2AEJA 1PPJD 1NTZE 2FXOA 5DJTB 1KYOH 3D70A 1KQGB 1FZAA 1LTAC 4RESB 1S9KE 4KJMA 1NTZJ 2GA1A 2KZIA 2N9YB 1SLQA 2P10A 3K5BA 2YMYA 3M9BA 1ZOYC 1SFCA 1FAVA 3A7OA 1NH4A 1BDDA 1NAFA 3HE4B 3L72E 3IN6A 4XFJA 3V5BA 4Z1MH 3CMEP 1IO4A 1LWUB 4WY4B 1CW5A 1KILA 1KILC 3HTKB 5APSA 1GU4A 2HFED 3CX5D 2JJLA 3H1JD 3CPWO 1DEEG 3BCCD 3H1IG 4PJ0E 1J2JB 1KTMA 3H1ID 5BU8B 4JPZB 1ZW0A 1LT9A 1SQXK 3A0HH 5E79H 5GTHH 3G6EP 2FYNC 1EZVE 3BATA 2HR3A 4D6TG 2W6BA 4DZOA 2WQYC 1L0LD 3EFFK 1S2EA 2KLUA 1JCDA 1FDIA 2XU6A 4TT3H 2HODB 1N7SD 1JY3N 2WTYA 3L74D 4R4LA 1M7LA 3N4XA 3S1KA 2IBZI 3AEFC 4ZKUA 1L0LK 1URQB 1JY3P 3VP8A 2JP3A 4JYBA 3IAOA 4JYCA 4H44C 2WSSH 4U3FE 1Y9BA 5CBOA 1EXJA 2PP6A 4DOJA 1NTKE 2WSCH 3BCCJ 3M0DA 1ZV8A 2IDBA 4W7ZA 3LW5H 2FYUE 5H2FE 1KYOD 3BRVB 5L8RJ 3RL0D 1R5SA 3PLNA 3CXHE 4C46A 1SQXE 2JR8A 3VMYA 4B86A 1SQPG 2POHA 2OYIB 2E75B 2ZXEB 1IFNA 1SVFA 1DD4A 3VOPA 1LT9B 3SFEC 1G1JA 2P2UA 1FDMA 1EQ7A 2IZ0A 3M9QA 3SWFA 1EZVD 3EWKA 3H1IJ 1Q82Q 1W5CE 1NGMB 1LGHB 1RF1A 4PV1C 3G9RA 3HUSA 5AW0B 2LXBA 3CX5H 5CCGD 3Q5PA 3CC4P 1H89A 2R44A 4OWFA 1SQBJ 1JCCA 1GL2B 1YTZT 3NMDA 5CCHC 2Q1KA 1URQA 3WUVA 5KLVG 1DEBA 4H0LC 4R4MA 2QSIA 1HVVA 1SQPK 2E74C 4EI2A 1RY3A 2BASA 3ITKA 3LIDA 3TF5A 1X79B 3HD7D 3Q5SA 2QJPB 2Q9IA 3CXHI 1PP9E 3OAKA 2WSFH 1PPJE 2QG4A 1KC8Q 1AJYA 3RL0C 1L0NG 3USSA 1SQBD 3H6PA 2XNXA 3NTNA 4L73A 4DT0A 2YO2A 3BASA 4RJTA 1KILB 3HTKA 2KS1A 3O8ZA 1K9MQ 3L4FA 2IBZG 2CPSA 4H44D 1J1EB 2I1KA 1VDFA 3CCSP 2RMZA 1EDJA 1PIXA 4WVZA 4OGQD 3M91A 2O01J 3L35A 5H2FH 1CI6B 4ZKPA 5KJ7A 4D6TD 1AQTA 1NHLA 3E1RA 5B66E 2HPCA 1HTLC 3L73D 2O01H 2YIUB 5APVA 1NTKG 1NTKK 1OW7A 1L0NK 2KI7B 3JSVC 1OWAA 1SFCB 3KDPB 3KZIE 5M1BA 2B9BA 1NTME 2W6AA 4A7PA 1NAYA 1SFCD 2E74D 3CWBG 1R8EA 3U1CA 2WPRA 3M06A 4PD4E 1N2DC 2E75D 3WUUA 1AV1A 3AE6C 2HPCB 4OH8B 1A02J 4BWNA 2Q3IA 3TGUG 4HJGH 4OVNF 4I7ZC 2QM7A 4GDOA 1BE3J 5APQA 5APYA 1NO4A 2MJZA 2NRGA 1BSHA 1FJKA 4GKGA 2C9NY 1PPJG 1LT9C 2L5GB 1NTMK 3M0DC 4I2LC 2D2CD 3L36A 1P84E 5KAFH 2R5DA 3GLMA 1GK4A 1Z56A 4JF7A 2W6JH 3E7KA 3W67A 1HGVA 3C1LA 3TSIA 3WU2E 4H44B 1FZCC 4DJGA 2NPSA 2Y9YA 3Q3DA 1PGQA 1QEXA 2FYUD 2MKVA 5KLIB 2KSEA 1PP9G 3P7KA 1ZXGA 1BE3E 2K3RA 2B87A 2IFNA 3ABVC 5AVUB 4BRYA 3L74G 4C7NA 1EDKA 1FJPA 2IFMA 3FGAD 1JY2N 3MP7B 1NTMD 2E75C 3CWBE 2YXQB 2JWDA 4GT1A 3NXSA 1JMBA 4UB8E 3L74E 3JCUH 1R5LA 3D6ZA 3CCEP 1VQPP 2A06D 2JDIH 3MUDC 4PJ0H 3GW6A 1M1JA 2PAJA 2M5AA 2XDJA 4D6TE 1FZGA 1KN7A 2HLOA 1IFJA 1XTCC 2I8DA 1HF9A 2A06G 5APWA 1RF0A 3GF7A 3H1IE 1XTGB 1SQQD 3KXDA 5AW7B 2O1JA 1SS1A 2QVAA 5APXA 3CCVP 1YJNP 1LTJA 3GHGA 3SWYA 3U1AA 3WMM0 2KNCA 1YI2P 3SFDC 1CI6A 1SQVG 1M1JB 1AA0A 1JEKA 2E74B 2OYHB 1VQ8P 1QGKB 4YXWH 2YKQA 3CCRP 1L2PA 1K8AQ 1KYOI 1LTJB 2FFDB 1OW6A 5TJHA 2WPVB 2XKMA 1QVGO 3RK3E 1VF5B 2FYUG 3L73J 1KB9I 3H25A 2GM4A 2KS1B 3TNUA 3A0BH 1NOHA 1LP1B 3H1HE 1VQNP 2QM8A 3CMAP 1NTZD 4XA4A 2QA4P 1VQKP 3T97A 5AVSB 5K5GB 5KAIH 1S4XA 5KTBA 5KJ7C 1BCCJ 1FE6A 1BGYG 1RE3C 2PRRA 3FXEA 3P8CD 2C0WA 3L75E 4HKZH 3CCLP 4HYTB 2Z5HA 2K88A 3E1IA 1SQQE 2KLVA 2KXPB 1T6AA 2E5TA 2YKOA 2N1TD 2ZFCA 3GHGB 3OA7A 4GOFA 5AW1B 3TGUD 1SQQJ 2WT7A 2FXPA 1LNQA 1KB9D 3RK2D
chains in the Genus database with same CATH topology
1GW3A 2Z4EA 1SQVK 1T3JA 3MTUE 1G2CB 1CZQA 2E42A 1IC2A 4IFMA 1HGZA 5AW3B 4AUWA 3V2RA 1KZUB 1GU5A 5AW2B 2HYNA 2FXMA 1MFZA 3H32B 1GDTA 1RF1C 4IFFA 1HJBA 2I1JA 3MD0A 5AW6B 1LTBC 3P8CE 2H8PD 3EQ2A 3U59A 2FYUK 5APUA 2FFDC 3G3ZA 1LTJC 4WBAA 5CCGA 1YYCA 2Z5IA 3N7NA 1J1DB 2R5BA 1ZN5A 1S9KD 5BU5A 3V2NA 3PP5A 3II6A 5AVTB 5CCHA 3R2PA 1HBWA 1FZFA 2KOGA 4LGDE 2FKWB 4IFDK 2WT7B 2WSEH 5AVQB 4I1LA 1T2KD 1L4AC 5AVVB 3C9IA 1L4AD 3V4WA 1SFCC 5CCHD 3L37A 1ZLLA 1E5WA 3HE5B 1GTWA 1ZR2A 2Q5UA 1J1EC 1JMMA 3GHGC 1KQLA 2N1TA 1NU1K 4KHXA 5KLVK 1G2CA 2YO3A 2N1TB 1SP4A 1H8AA 4N78E 2CPBA 3VTPC 2R32A 2WPSA 3A2AA 5AW4B 1J1DC 2LKMA 1JY2P 3CI9A 1IK9A 1GL2A 1N73A 2OYHA 2GUSA 1N7LA 3B8EB 1N73C 2OARA 2P7JA 2NPSB 1GW4A 1SQQK 3HE4A 1MV8A 1WT6A 1N7SA 3HUSB 3B5ND 2VRSA 1JOCA 1ZR4A 2WPQA 3CL3D 3A5TA 2Q7CA 3RK2B 2J59M 4W80A 3VMXA 3RK3C 3MIWA 1HH0A 4N3YB 4Y99C 3H32A 5CMZA 2A45H 2E43A 1T2KC 4HH2A 2C9LY 1LTSC 3CLQA 3M9BA 4N6JA 2WT7A 4LLHA 3B5NB 2HG5D 1KFNA 1FBMA 1N86A 1DX7A 2J58A 2OYHC 3TK1A 1FOSF 2NPSD 2M3BA 5AVYB 4I6MC 2WZ7A 1FZEA 1X9VA 1LTIC 1LWUC 4WY4C 5AW8B 1MZ9A 1FZCA 5BVZA 2FYZA 1LTTC 1OXZA 1RE4C 2H7HA 1MUUA 2OYIC 3OJAB 4XE5B 3P32A 2N1TC 3HD7A 2YNYA 3M9HA 3HRNA 1RF1B 1N73B 4EOTA 1W2EA 1JY2O 1DH3A 5AVWB 5KJ7D 2XV5A 1GK6A 4EIJA 2P1JA 3HD7B 1JTHB 1RF0C 3LIEA 4WY4D 5AW5B 1IFIA 4N78D 1GL2D 4M3LA 1KFMA 1T8ZA 2R3CA 2OYIA 3KYQA 1RE4A 1HWTC 1QL1A 2HODA 3I5CA 1X8YA 1LWUA 2WITA 4WY4A 3NFQA 2W27A 3U1AA 2KP8A 2KB7P 2IX7C 3VYIA 1IFDA 3RK3D 3RL0B 2FFDA 4WB4A 1N7SB 3P8MC 2C0XA 3V2PA 4LC1A 1KILD 1NWQA 3IFMA 1T3UA 1YTZI 3KQGA 1L4AA 3VN0A 2O1KA 5AVZB 2KSJA 1CSBA 5AW9B 1PFIA 1QL2A 1L4AB 1JY3O 3TYYA 4C7RA 1FZCB 3HD7C 1JTHA 3EFGA 1FOSE 1GZLA 1FZBA 3A3YB 3MGNA 3V2QA 1VPCA 2P67A 1GD2E 2M8RA 3MUDA 4O9BA 1LTGC 2WWWA 1AQ5A 1FU1A 5CCGC 2YKPA 2JEEA 3BVHA 1RE3A 1JNMA 1URQC 1GL2C 2XZRA 4XA4A 2NPSC 4GIFA 1URQD 1NKNA 2N9BA 3VMZA 4C7NB 4AYCA 3UIAA 3VP9A 3HUSC 1NKZB 5CJ0A 3M0AA 1WRGA 4AQRD 1IFMA 1SQBK 3KPEA 1H88A 1G1IA 3RK2C 5AVXB 1N7SC 3IR9A 5CHXA 5AVRB 2A45I 3B5NA 1A02F 1NTZK 3RK3B 3V4QA 2KYVA 1HUCA 1IJDB 4Y99B 5CJ4A 3BRTB 1M1JC 1AFOA 1JO5A 2A45G 1JUNA 2IPPA 2H43A 5APTA 3TNUB 3B5NC 2GUVA 4RESB 1FZAA 1LTAC 1S9KE 1SLQA 2YMYA 1SFCA 1FAVA 3A7OA 1NH4A 3HE4B 1NAFA 3V5BA 4DOJA 1IO4A 1LWUB 4WY4B 1CW5A 1KILA 1KILC 3HTKB 5APSA 1GU4A 2HFED 2JJLA 1J2JB 5BU8B 1LT9A 1SQXK 3BATA 2W6BA 4DZOA 1JCDA 2XU6A 2HODB 1N7SD 1JY3N 2WTYA 1M7LA 3N4XA 4ZKUA 1L0LK 1URQB 1JY3P 3VP8A 4JYBA 4JYCA 2PP6A 2WSCH 3M0DA 1ZV8A 4W7ZA 3LW5H 3RL0D 3BRVB 4C46A 3VMYA 4B86A 2POHA 2OYIB 2ZXEB 1IFNA 1SVFA 3VOPA 1LT9B 1G1JA 2P2UA 1FDMA 1EQ7A 3M9QA 3SWFA 1RF1A 1LGHB 5CCGD 5AW0B 3HUSA 1H89A 1JCCA 1GL2B 1YTZT 3NMDA 5CCHC 1URQA 1DEBA 1HVVA 1SQPK 1RY3A 2BASA 3LIDA 1X79B 3HD7D 2Q9IA 3OAKA 2WSFH 3RL0C 3H6PA 2XNXA 3NTNA 2YO2A 3BASA 1KILB 3HTKA 3O8ZA 3L4FA 2CPSA 1J1EB 2I1KA 1VDFA 3M91A 3L35A 1CI6B 4ZKPA 5KJ7A 1NHLA 2HPCA 1HTLC 2O01H 5APVA 1NTKK 3KDPB 1L0NK 1OWAA 1SFCB 2W6AA 1SFCD 3U1CA 2WPRA 3M06A 1N2DC 2HPCB 4OH8B 1A02J 2Q3IA 2QM7A 5APQA 5APYA 1NO4A 2MJZA 1FJKA 4GKGA 2C9NY 1LT9C 2L5GB 1NTMK 3M0DC 4I2LC 3L36A 2R5DA 1GK4A 1Z56A 4JF7A 1HGVA 3TSIA 1FZCC 2NPSA 3P7KA 5AVUB 2IFNA 4C7NA 1FJPA 2IFMA 1JY2N 4GT1A 3NXSA 1M1JA 2PAJA 2XDJA 1FZGA 2HLOA 1IFJA 1XTCC 5APWA 1RF0A 1XTGB 5AW7B 2O1JA 5APXA 1LTJA 3GHGA 3SWYA 3WMM0 1CI6A 1M1JB 2OYHB 2FFDB 2YKQA 1LTJB 2XKMA 2GM4A 3TNUA 1NOHA 2QM8A 3T97A 5AVSB 5KTBA 5KJ7C 1RE3C 3P8CD 2C0WA 4HYTB 2Z5HA 3E1IA 2KLVA 2ZFCA 3OA7A 2YKOA 2N1TD 3GHGB 5AW1B 3HE5A 4W7YA 3RK2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A45 G;  2OYH C;  1N73 B;  2HOD B;  2H43 A;  1JY3 N;  1W2E A;  1M1J B;  2HPC A;  2OYH B;  1JY2 O;  2HOD A;  2FFD B;  1FZC C;  3HUS B;  1LTJ B;  2Z4E A;  1LWU A;  1JY3 O;  2FFD C;  1FZC B;  1LTJ C;  1FZA A;  1FZE A;  1RF0 C;  3HUS C;  1N73 C;  2Q9I A;  1LWU C;  2FFD A;  1JY2 N;  2HPC B;  1FZB A;  1JY2 P;  1LWU B;  1FZC A;  2A45 I;  2XNX A;  2OYI B;  3H32 A;  1RE3 C;  1RE4 C;  2A45 H;  1M1J A;  2OYI C;  1LT9 B;  1FZG A;  1T3U A;  3GHG C;  3H32 B;  1N73 A;  1FZF A;  1LT9 C;  1LT9 A;  2HLO A;  3E1I A;  1RF1 A;  2OYH A;  1RF1 C;  1RF0 A;  3HUS A;  1M1J C;  3GHG B;  1N86 A;  3BVH A;  1RE3 A;  1RE4 A;  1JY3 P;  2OYI A;  1RF1 B;  1LTJ A;  3GHG A; 
#chains in the Genus database with same CATH topology
 1GW3 A;  3AED C;  3F89 A;  3L70 J;  3PH0 A;  1Q7Y Q;  3S4R A;  1VQ7 P;  2Z4E A;  2Y0E A;  1SQV K;  1T3J A;  3MTU E;  1G2C B;  1CZQ A;  1X22 A;  2E42 A;  1IC2 A;  2BCC J;  2FYU J;  3L73 G;  4IFM A;  1HGZ A;  5AW3 B;  3AE3 C;  4L76 A;  3V2R A;  4DCK A;  1EXI A;  4AUW A;  1NTZ G;  4I7Z B;  1RQV A;  1KZU B;  1GU5 A;  5AW2 B;  1U7M A;  1IZN B;  2ITA A;  2E76 C;  3JC2 2;  2HYN A;  3L70 E;  1BCC G;  1Q90 D;  1YBK A;  1MFZ A;  2FXM A;  2PGD A;  2YMK A;  2YXR B;  2V4H A;  3H32 B;  1GDT A;  1RF1 C;  4IFF A;  3JCU E;  2I1J A;  4GOE A;  1OVR A;  4YTP C;  1HJB A;  1SQB G;  3MD0 A;  2UWJ E;  1OX3 A;  5TIS E;  3WU2 H;  4N6J A;  1LTB C;  3QH9 A;  3P8C E;  5AW6 B;  2AEF A;  3SSU A;  1SQQ G;  1Y47 A;  5KLV J;  2H8P D;  4D6T J;  3EQ2 A;  3U59 A;  2FYU K;  1NU1 J;  1YQ4 C;  3MZW B;  2NZ2 A;  5APU A;  2FFD C;  3G3Z A;  3H1K G;  2CK3 H;  1LTJ C;  4H0L D;  4WBA A;  1S3J A;  1JM0 A;  3KZI H;  3RBZ A;  4H0L B;  5CCG A;  1YYC A;  2WMM A;  2Z5I A;  3N7N A;  2Y0C A;  2BCC D;  1J1D B;  2R5B A;  1NTM G;  1ZN5 A;  1S9K D;  1KV4 A;  5BU5 A;  4MN4 C;  4H13 D;  1ZP0 C;  2IBZ E;  1Q2N A;  2ZT9 D;  3PP5 A;  3II6 A;  3TDK A;  3V2N A;  3L73 E;  1IFP A;  5AVT B;  3L72 G;  5CCH A;  1RH5 B;  3R2P A;  2WSC J;  4HB1 A;  1FZF A;  1K04 A;  1HBW A;  2KOG A;  3GMA A;  3LW5 J;  2PFX A;  3TGU E;  4LGD E;  2FKW B;  4IFD K;  2A06 E;  2WT7 B;  1NJI Q;  2WSE H;  4TLF A;  2Y9Z A;  5B5E E;  1MKM A;  5AVQ B;  1NU1 G;  1OW8 A;  3AE1 C;  4I1L A;  3FWL A;  1T2K D;  1L4A C;  5AVV B;  3C9I A;  3O6Q B;  1H0T A;  1L4A D;  2ZYA A;  3V4W A;  3AE9 C;  1SFC C;  2IYO A;  5CCH D;  3L37 A;  1PGJ A;  1ZLL A;  1E5W A;  1VQ5 P;  3HE5 B;  1BE3 G;  5KKZ C;  3FWN A;  1S5L E;  1TU3 F;  2LR2 A;  3AE8 C;  1ZR2 A;  1YIT P;  2Q5U A;  1J1E C;  1JMM A;  1GTW A;  1BSN A;  1Q86 Q;  1KB9 H;  3GHG C;  1L0N J;  1KQL A;  1LP1 A;  2G3A A;  2K9Y A;  2OYO A;  2N1T A;  3CCM P;  3H1J G;  1SQX G;  1NU1 K;  1L0N E;  4KHX A;  2K9J A;  3ZDM A;  1RQU A;  3PHL A;  5KLV K;  1G2C A;  1UIX A;  2YO3 A;  2N1T B;  3IF4 A;  1SP4 A;  4JQ0 D;  5TIS H;  1H8A A;  2ZYG A;  4N78 E;  2W8Z A;  3A0H E;  4ZMD A;  1K73 Q;  2CPB A;  2IBZ D;  3QWO C;  3H1L G;  4U3F J;  3VTP C;  4NPE A;  2IYP A;  3V6I A;  1NU1 D;  1U7J A;  1VF5 D;  1EDL A;  1W2B O;  2R32 A;  3Q5R A;  1YQ3 C;  2WPS A;  1VQO P;  5KLI C;  3W68 A;  2B87 B;  3A2A A;  3L71 G;  5AW4 B;  2Y0D A;  1J1D C;  2LKM A;  4L74 A;  5KAI E;  1JY2 P;  2O01 N;  1AVO A;  2B89 A;  2O3J A;  1VL2 A;  1IK9 A;  1GL2 A;  3CI9 A;  3RL0 g;  1DIP A;  2LXC B;  1N73 A;  1VQM P;  2M5A B;  2OYH A;  2BEZ F;  3L70 G;  1M1K Q;  3AEE C;  2GUS A;  4U7J A;  1N7L A;  3B8E B;  3L75 D;  2OAR A;  2P7J A;  4OGQ C;  2NPS B;  1N73 C;  1GW4 A;  1SQQ K;  3BCC E;  3G4S P;  1SQB E;  2E5Y A;  3L70 D;  2W83 C;  1MV8 A;  3HE4 A;  1QLE D;  1WT6 A;  1N7S A;  3HUS B;  3B5N D;  2VRS A;  3CCQ P;  1JOC A;  1ZR4 A;  3RBX A;  2WPQ A;  3CL3 D;  3A5T A;  1ZRT D;  2Q7C A;  3RK2 B;  2J59 M;  4UB8 H;  4W80 A;  3RGU A;  3VMX A;  3L71 D;  3RK3 C;  1D7M A;  2K37 A;  2P58 A;  1RHZ B;  3MIW A;  4GOD A;  1HH0 A;  3VMA A;  2W90 A;  4N3Y B;  4BXL A;  2KIK A;  3L75 J;  4Y99 C;  3H32 A;  5CMZ A;  2A45 H;  3WUT A;  5KKZ B;  4ZNC A;  2E43 A;  3H1L D;  3C8V A;  1T2K C;  1BCC D;  4HH2 A;  3FX0 A;  3Q1M A;  2C9L Y;  1LTS C;  3CLQ A;  3F5H A;  1DD3 A;  1M56 D;  1K05 A;  1HJ0 A;  1NYH A;  2HG5 D;  1KFN A;  1FBM A;  1N86 A;  2FYN B;  2XND H;  3B5N B;  4LLH A;  1DX7 A;  1FDO A;  1L0L G;  2D2C B;  2J58 A;  2OYH C;  1ZME C;  3TK1 A;  1FOS F;  2NPS D;  2M3B A;  3AE7 C;  1SQX D;  5AVY B;  1USE A;  4I6M C;  3CCU P;  2J5U A;  1VF5 C;  1YJW P;  3BCC G;  2QJY C;  1SQV J;  2WZ7 A;  2M0B A;  2BCC E;  1FZE A;  1GMJ A;  3OW2 O;  1YHQ P;  1BE3 D;  2ZVN B;  4U3F D;  1X9V A;  2OTJ P;  1LTI C;  1LWU C;  4WY4 C;  4H13 C;  5KAF E;  2JKV A;  5AW8 B;  1WMK A;  2ZXX A;  4RKU J;  4EYY Q;  3L72 J;  1MZ9 A;  1FZC A;  1P84 H;  5BVZ A;  2FYZ A;  1LTT C;  1OXZ A;  1RE4 C;  2H7H A;  1MUU A;  3O6Q A;  1L0L E;  4RO0 A;  5GTH E;  4YPC A;  2OYI C;  3OJA B;  4XE5 B;  3P32 A;  1VQL P;  4W7Y A;  2N1T C;  1BGY D;  2E76 B;  3HD7 A;  1BGY J;  2YNY A;  3M9H A;  3Q2Y A;  1SQV E;  2YIU C;  1AVY A;  3L74 J;  1BGY E;  3HRN A;  1RF1 B;  1BDC A;  4OGQ B;  3CX5 E;  3AE2 C;  1N73 B;  4EOT A;  1W2E A;  2WSF J;  2H88 C;  1JY2 O;  1USD A;  4QMA A;  5AVW B;  5KJ7 D;  1DH3 A;  2XV5 A;  1GK6 A;  3AE4 C;  4EIJ A;  3CD6 P;  1JB0 J;  2P1J A;  3HD7 B;  3HE5 A;  1JTH B;  3H1H G;  3L72 D;  1PZQ A;  2DW3 A;  4PD4 D;  1KYO E;  1S72 P;  4YXD C;  1RF0 C;  3LIE A;  1MFT A;  1VQ4 P;  1PL5 A;  4IL6 H;  5GTI E;  2QJP C;  1KQS O;  2ZT9 C;  4WY4 D;  1VQ9 P;  2BCC G;  1S5L X;  2E76 D;  5AW5 B;  1IFI A;  4N78 D;  1GL2 D;  1QVF O;  1NVO A;  2QRX A;  3H1J J;  1SQX J;  4WWI A;  1KB9 E;  4M3L A;  2Q6Q A;  1KFM A;  3H1K D;  2G8Y A;  2KNC B;  2OTK E;  2AXC A;  2B88 A;  1P84 D;  1T8Z A;  1PV3 A;  1QX8 A;  2R3C A;  5DJU B;  3S9O A;  3KYQ A;  4EDF A;  1RE4 A;  2OYI A;  4PD4 I;  2QE7 H;  2ZJS E;  1KD1 Q;  3KHU A;  3R4Y A;  3A0B E;  1KIL E;  1HWT C;  1QL1 A;  4IL6 X;  2HOD A;  1OMI A;  2FY8 A;  3CWB J;  3I5C A;  4L75 A;  3D71 A;  1X8Y A;  2OTL P;  2QJK B;  1LWU A;  1PP9 D;  2WIT A;  2JO1 A;  3NFQ A;  2W27 A;  2K1A A;  4WY4 A;  3H1H D;  4Y28 J;  1OZH A;  2KB7 P;  2KP8 A;  2QJY B;  2V7Q H;  3H1H J;  2IX7 C;  3L71 E;  4UB6 E;  3VYI A;  1IK7 A;  3H1K J;  1IFD A;  1S1C X;  3RK3 D;  1ZRT E;  3RL0 B;  2FFD A;  4WB4 A;  1EZV I;  1N7S B;  3P8M C;  1KOR A;  1P84 I;  2AXT H;  2C0X A;  4H13 B;  1Y8A A;  4PD4 H;  3V2P A;  3CC7 P;  1NTM J;  2QEX P;  4LC1 A;  4UB6 H;  3G71 P;  1KIL D;  1NWQ A;  3IFM A;  1T3U A;  1SQP J;  3CC2 P;  2WVR A;  3T97 B;  2OGU A;  1YTZ I;  2D2C C;  3AEB C;  3KQG A;  1L4A A;  3VN0 A;  2RH0 A;  1SQP E;  1OVV A;  2AXT E;  2O1K A;  5AVZ B;  1PGP A;  2ZVO B;  5EFW B;  1M90 Q;  3H1K E;  2KSJ A;  1CSB A;  3I55 P;  5AW9 B;  1PFI A;  4U3F G;  1QL2 A;  2BEQ D;  2QIW A;  3CXH D;  3CWB D;  3SWK A;  1H0T B;  1L4A B;  1JY3 O;  3TYY A;  4C7R A;  1YIJ P;  1FZC B;  1NTK J;  3HD7 C;  4NPF X;  1NTK D;  1JTH A;  4ASV A;  2R3S A;  5B66 H;  3EFG A;  5KLV E;  1KQF B;  1FOS E;  1LJ2 A;  3PJS K;  1GZL A;  1FZB A;  2WSE J;  1NU1 E;  3A3Y B;  1M57 D;  3MGN A;  2RKL A;  1VPC A;  3GG2 A;  1PGO A;  1S5L H;  3V2Q A;  2OQQ A;  2P67 A;  3FXD A;  4IL6 E;  4BRY B;  2M8R A;  5GTI H;  1GD2 E;  2KUB A;  3AE5 C;  3MUD A;  4O9B A;  5E79 E;  4IOI H;  1LTG C;  4K35 A;  2K9J B;  2WWW A;  3I56 P;  1AQ5 A;  1FU1 A;  4PV1 D;  2IZ1 A;  1LT1 A;  1L0L J;  2KZJ A;  5CCG C;  3B4S A;  2ZAE B;  3CCJ P;  2YKP A;  1SQV D;  2JEE A;  1L0N D;  3BVH A;  2JWA A;  1RE3 A;  1UII A;  4JBZ A;  1FS0 E;  2AEM A;  3H1J E;  1JNM A;  1E79 H;  1URQ C;  2KK7 A;  1GL2 C;  2XZR A;  3AEG C;  2NPS C;  4GIF A;  3AEA C;  4KT0 J;  1U57 A;  1URQ D;  1NKN A;  2N9B A;  3VMZ A;  5CBN A;  1FC2 C;  1EDI A;  1Q81 Q;  2QJK C;  4C7N B;  4AYC A;  2H89 C;  2ZT9 B;  3UIA A;  3HUS C;  1M8O B;  3VP9 A;  1A02 F;  3D6Y A;  1PP9 J;  1NKZ B;  2RN0 A;  2SPZ A;  3CXH H;  3GF3 A;  3H1L J;  5CJ0 A;  1OVU A;  5KLV D;  1N8R Q;  2ZYD A;  3M0A A;  1WRG A;  4AQR D;  1IFM A;  1X0T A;  1SQB K;  3KPE A;  1H88 A;  1G1I A;  1OIP A;  2L91 A;  3L75 G;  3RK2 C;  5AVX B;  1N7S C;  3IR9 A;  3MHV A;  3PRJ A;  2A45 I;  3B5N A;  3L71 J;  5CHX A;  5AVR B;  1NTZ K;  5C39 A;  3RK3 B;  1EZV G;  3V4Q A;  2KYV A;  4K3A A;  1HUC A;  3TGU J;  1YJ9 P;  1OFC X;  4PV1 B;  1IJD B;  4Y99 B;  2Q3E A;  5B5E H;  3B71 A;  5CJ4 A;  3BRT B;  3PTZ A;  1M1J C;  1SQP D;  2FBW C;  4CPG A;  1VQ6 P;  3AEC C;  3CX5 I;  1BCC E;  2M3E A;  1AFO A;  1JO5 A;  2A45 G;  1JUN A;  2IPP A;  3H1L E;  5APT A;  2H43 A;  3TNU B;  2V7Q J;  3B5N C;  4NPD A;  1KMI Z;  4ASW A;  1EC5 A;  2GUV A;  2AEJ A;  1PPJ D;  1NTZ E;  2FXO A;  5DJT B;  1KYO H;  3D70 A;  1KQG B;  1FZA A;  1LTA C;  4RES B;  1S9K E;  4KJM A;  1NTZ J;  2GA1 A;  2KZI A;  2N9Y B;  1SLQ A;  2P10 A;  3K5B A;  2YMY A;  3M9B A;  1ZOY C;  1SFC A;  1FAV A;  3A7O A;  1NH4 A;  1BDD A;  1NAF A;  3HE4 B;  3L72 E;  3IN6 A;  4XFJ A;  3V5B A;  4Z1M H;  3CME P;  1IO4 A;  1LWU B;  4WY4 B;  1CW5 A;  1KIL A;  1KIL C;  3HTK B;  5APS A;  1GU4 A;  2HFE D;  3CX5 D;  2JJL A;  3H1J D;  3CPW O;  1DEE G;  3BCC D;  3H1I G;  4PJ0 E;  1J2J B;  1KTM A;  3H1I D;  5BU8 B;  4JPZ B;  1ZW0 A;  1LT9 A;  1SQX K;  3A0H H;  5E79 H;  5GTH H;  3G6E P;  2FYN C;  1EZV E;  3BAT A;  2HR3 A;  4D6T G;  2W6B A;  4DZO A;  2WQY C;  1L0L D;  3EFF K;  1S2E A;  2KLU A;  1JCD A;  1FDI A;  2XU6 A;  4TT3 H;  2HOD B;  1N7S D;  1JY3 N;  2WTY A;  3L74 D;  4R4L A;  1M7L A;  3N4X A;  3S1K A;  2IBZ I;  3AEF C;  4ZKU A;  1L0L K;  1URQ B;  1JY3 P;  3VP8 A;  2JP3 A;  4JYB A;  3IAO A;  4JYC A;  4H44 C;  2WSS H;  4U3F E;  1Y9B A;  5CBO A;  1EXJ A;  2PP6 A;  4DOJ A;  1NTK E;  2WSC H;  3BCC J;  3M0D A;  1ZV8 A;  2IDB A;  4W7Z A;  3LW5 H;  2FYU E;  5H2F E;  1KYO D;  3BRV B;  5L8R J;  3RL0 D;  1R5S A;  3PLN A;  3CXH E;  4C46 A;  1SQX E;  2JR8 A;  3VMY A;  4B86 A;  1SQP G;  2POH A;  2OYI B;  2E75 B;  2ZXE B;  1IFN A;  1SVF A;  1DD4 A;  3VOP A;  1LT9 B;  3SFE C;  1G1J A;  2P2U A;  1FDM A;  1EQ7 A;  2IZ0 A;  3M9Q A;  3SWF A;  1EZV D;  3EWK A;  3H1I J;  1Q82 Q;  1W5C E;  1NGM B;  1LGH B;  1RF1 A;  4PV1 C;  3G9R A;  3HUS A;  5AW0 B;  2LXB A;  3CX5 H;  5CCG D;  3Q5P A;  3CC4 P;  1H89 A;  2R44 A;  4OWF A;  1SQB J;  1JCC A;  1GL2 B;  1YTZ T;  3NMD A;  5CCH C;  2Q1K A;  1URQ A;  3WUV A;  5KLV G;  1DEB A;  4H0L C;  4R4M A;  2QSI A;  1HVV A;  1SQP K;  2E74 C;  4EI2 A;  1RY3 A;  2BAS A;  3ITK A;  3LID A;  3TF5 A;  1X79 B;  3HD7 D;  3Q5S A;  2QJP B;  2Q9I A;  3CXH I;  1PP9 E;  3OAK A;  2WSF H;  1PPJ E;  2QG4 A;  1KC8 Q;  1AJY A;  3RL0 C;  1L0N G;  3USS A;  1SQB D;  3H6P A;  2XNX A;  3NTN A;  4L73 A;  4DT0 A;  2YO2 A;  3BAS A;  4RJT A;  1KIL B;  3HTK A;  2KS1 A;  3O8Z A;  1K9M Q;  3L4F A;  2IBZ G;  2CPS A;  4H44 D;  1J1E B;  2I1K A;  1VDF A;  3CCS P;  2RMZ A;  1EDJ A;  1PIX A;  4WVZ A;  4OGQ D;  3M91 A;  2O01 J;  3L35 A;  5H2F H;  1CI6 B;  4ZKP A;  5KJ7 A;  4D6T D;  1AQT A;  1NHL A;  3E1R A;  5B66 E;  2HPC A;  1HTL C;  3L73 D;  2O01 H;  2YIU B;  5APV A;  1NTK G;  1NTK K;  1OW7 A;  1L0N K;  2KI7 B;  3JSV C;  1OWA A;  1SFC B;  3KDP B;  3KZI E;  5M1B A;  2B9B A;  1NTM E;  2W6A A;  4A7P A;  1NAY A;  1SFC D;  2E74 D;  3CWB G;  1R8E A;  3U1C A;  2WPR A;  3M06 A;  4PD4 E;  1N2D C;  2E75 D;  3WUU A;  1AV1 A;  3AE6 C;  2HPC B;  4OH8 B;  1A02 J;  4BWN A;  2Q3I A;  3TGU G;  4HJG H;  4OVN F;  4I7Z C;  2QM7 A;  4GDO A;  1BE3 J;  5APQ A;  5APY A;  1NO4 A;  2MJZ A;  2NRG A;  1BSH A;  1FJK A;  4GKG A;  2C9N Y;  1PPJ G;  1LT9 C;  2L5G B;  1NTM K;  3M0D C;  4I2L C;  2D2C D;  3L36 A;  1P84 E;  5KAF H;  2R5D A;  3GLM A;  1GK4 A;  1Z56 A;  4JF7 A;  2W6J H;  3E7K A;  3W67 A;  1HGV A;  3C1L A;  3TSI A;  3WU2 E;  4H44 B;  1FZC C;  4DJG A;  2NPS A;  2Y9Y A;  3Q3D A;  1PGQ A;  1QEX A;  2FYU D;  2MKV A;  5KLI B;  2KSE A;  1PP9 G;  3P7K A;  1ZXG A;  1BE3 E;  2K3R A;  2B87 A;  2IFN A;  3ABV C;  5AVU B;  4BRY A;  3L74 G;  4C7N A;  1EDK A;  1FJP A;  2IFM A;  3FGA D;  1JY2 N;  3MP7 B;  1NTM D;  2E75 C;  3CWB E;  2YXQ B;  2JWD A;  4GT1 A;  3NXS A;  1JMB A;  4UB8 E;  3L74 E;  3JCU H;  1R5L A;  3D6Z A;  3CCE P;  1VQP P;  2A06 D;  2JDI H;  3MUD C;  4PJ0 H;  3GW6 A;  1M1J A;  2PAJ A;  2M5A A;  2XDJ A;  4D6T E;  1FZG A;  1KN7 A;  2HLO A;  1IFJ A;  1XTC C;  2I8D A;  1HF9 A;  2A06 G;  5APW A;  1RF0 A;  3GF7 A;  3H1I E;  1XTG B;  1SQQ D;  3KXD A;  5AW7 B;  2O1J A;  1SS1 A;  2QVA A;  5APX A;  3CCV P;  1YJN P;  1LTJ A;  3GHG A;  3SWY A;  3U1A A;  3WMM 0;  2KNC A;  1YI2 P;  3SFD C;  1CI6 A;  1SQV G;  1M1J B;  1AA0 A;  1JEK A;  2E74 B;  2OYH B;  1VQ8 P;  1QGK B;  4YXW H;  2YKQ A;  3CCR P;  1L2P A;  1K8A Q;  1KYO I;  1LTJ B;  2FFD B;  1OW6 A;  5TJH A;  2WPV B;  2XKM A;  1QVG O;  3RK3 E;  1VF5 B;  2FYU G;  3L73 J;  1KB9 I;  3H25 A;  2GM4 A;  2KS1 B;  3TNU A;  3A0B H;  1NOH A;  1LP1 B;  3H1H E;  1VQN P;  2QM8 A;  3CMA P;  1NTZ D;  4XA4 A;  2QA4 P;  1VQK P;  3T97 A;  5AVS B;  5K5G B;  5KAI H;  1S4X A;  5KTB A;  5KJ7 C;  1BCC J;  1FE6 A;  1BGY G;  1RE3 C;  2PRR A;  3FXE A;  3P8C D;  2C0W A;  3L75 E;  4HKZ H;  3CCL P;  4HYT B;  2Z5H A;  2K88 A;  3E1I A;  1SQQ E;  2KLV A;  2KXP B;  1T6A A;  2E5T A;  2YKO A;  2N1T D;  2ZFC A;  3GHG B;  3OA7 A;  4GOF A;  5AW1 B;  3TGU D;  1SQQ J;  2WT7 A;  2FXP A;  1LNQ A;  1KB9 D;  3RK2 D; 
#chains in the Genus database with same CATH homology
 1GW3 A;  2Z4E A;  1SQV K;  1T3J A;  3MTU E;  1G2C B;  1CZQ A;  2E42 A;  1IC2 A;  4IFM A;  1HGZ A;  5AW3 B;  4AUW A;  3V2R A;  1KZU B;  1GU5 A;  5AW2 B;  2HYN A;  2FXM A;  1MFZ A;  3H32 B;  1GDT A;  1RF1 C;  4IFF A;  1HJB A;  2I1J A;  3MD0 A;  5AW6 B;  1LTB C;  3P8C E;  2H8P D;  3EQ2 A;  3U59 A;  2FYU K;  5APU A;  2FFD C;  3G3Z A;  1LTJ C;  4WBA A;  5CCG A;  1YYC A;  2Z5I A;  3N7N A;  1J1D B;  2R5B A;  1ZN5 A;  1S9K D;  5BU5 A;  3V2N A;  3PP5 A;  3II6 A;  5AVT B;  5CCH A;  3R2P A;  1HBW A;  1FZF A;  2KOG A;  4LGD E;  2FKW B;  4IFD K;  2WT7 B;  2WSE H;  5AVQ B;  4I1L A;  1T2K D;  1L4A C;  5AVV B;  3C9I A;  1L4A D;  3V4W A;  1SFC C;  5CCH D;  3L37 A;  1ZLL A;  1E5W A;  3HE5 B;  1GTW A;  1ZR2 A;  2Q5U A;  1J1E C;  1JMM A;  3GHG C;  1KQL A;  2N1T A;  1NU1 K;  4KHX A;  5KLV K;  1G2C A;  2YO3 A;  2N1T B;  1SP4 A;  1H8A A;  4N78 E;  2CPB A;  3VTP C;  2R32 A;  2WPS A;  3A2A A;  5AW4 B;  1J1D C;  2LKM A;  1JY2 P;  3CI9 A;  1IK9 A;  1GL2 A;  1N73 A;  2OYH A;  2GUS A;  1N7L A;  3B8E B;  1N73 C;  2OAR A;  2P7J A;  2NPS B;  1GW4 A;  1SQQ K;  3HE4 A;  1MV8 A;  1WT6 A;  1N7S A;  3HUS B;  3B5N D;  2VRS A;  1JOC A;  1ZR4 A;  2WPQ A;  3CL3 D;  3A5T A;  2Q7C A;  3RK2 B;  2J59 M;  4W80 A;  3VMX A;  3RK3 C;  3MIW A;  1HH0 A;  4N3Y B;  4Y99 C;  3H32 A;  5CMZ A;  2A45 H;  2E43 A;  1T2K C;  4HH2 A;  2C9L Y;  1LTS C;  3CLQ A;  3M9B A;  4N6J A;  2WT7 A;  4LLH A;  3B5N B;  2HG5 D;  1KFN A;  1FBM A;  1N86 A;  1DX7 A;  2J58 A;  2OYH C;  3TK1 A;  1FOS F;  2NPS D;  2M3B A;  5AVY B;  4I6M C;  2WZ7 A;  1FZE A;  1X9V A;  1LTI C;  1LWU C;  4WY4 C;  5AW8 B;  1MZ9 A;  1FZC A;  5BVZ A;  2FYZ A;  1LTT C;  1OXZ A;  1RE4 C;  2H7H A;  1MUU A;  2OYI C;  3OJA B;  4XE5 B;  3P32 A;  2N1T C;  3HD7 A;  2YNY A;  3M9H A;  3HRN A;  1RF1 B;  1N73 B;  4EOT A;  1W2E A;  1JY2 O;  1DH3 A;  5AVW B;  5KJ7 D;  2XV5 A;  1GK6 A;  4EIJ A;  2P1J A;  3HD7 B;  1JTH B;  1RF0 C;  3LIE A;  4WY4 D;  5AW5 B;  1IFI A;  4N78 D;  1GL2 D;  4M3L A;  1KFM A;  1T8Z A;  2R3C A;  2OYI A;  3KYQ A;  1RE4 A;  1HWT C;  1QL1 A;  2HOD A;  3I5C A;  1X8Y A;  1LWU A;  2WIT A;  4WY4 A;  3NFQ A;  2W27 A;  3U1A A;  2KP8 A;  2KB7 P;  2IX7 C;  3VYI A;  1IFD A;  3RK3 D;  3RL0 B;  2FFD A;  4WB4 A;  1N7S B;  3P8M C;  2C0X A;  3V2P A;  4LC1 A;  1KIL D;  1NWQ A;  3IFM A;  1T3U A;  1YTZ I;  3KQG A;  1L4A A;  3VN0 A;  2O1K A;  5AVZ B;  2KSJ A;  1CSB A;  5AW9 B;  1PFI A;  1QL2 A;  1L4A B;  1JY3 O;  3TYY A;  4C7R A;  1FZC B;  3HD7 C;  1JTH A;  3EFG A;  1FOS E;  1GZL A;  1FZB A;  3A3Y B;  3MGN A;  3V2Q A;  1VPC A;  2P67 A;  1GD2 E;  2M8R A;  3MUD A;  4O9B A;  1LTG C;  2WWW A;  1AQ5 A;  1FU1 A;  5CCG C;  2YKP A;  2JEE A;  3BVH A;  1RE3 A;  1JNM A;  1URQ C;  1GL2 C;  2XZR A;  4XA4 A;  2NPS C;  4GIF A;  1URQ D;  1NKN A;  2N9B A;  3VMZ A;  4C7N B;  4AYC A;  3UIA A;  3VP9 A;  3HUS C;  1NKZ B;  5CJ0 A;  3M0A A;  1WRG A;  4AQR D;  1IFM A;  1SQB K;  3KPE A;  1H88 A;  1G1I A;  3RK2 C;  5AVX B;  1N7S C;  3IR9 A;  5CHX A;  5AVR B;  2A45 I;  3B5N A;  1A02 F;  1NTZ K;  3RK3 B;  3V4Q A;  2KYV A;  1HUC A;  1IJD B;  4Y99 B;  5CJ4 A;  3BRT B;  1M1J C;  1AFO A;  1JO5 A;  2A45 G;  1JUN A;  2IPP A;  2H43 A;  5APT A;  3TNU B;  3B5N C;  2GUV A;  4RES B;  1FZA A;  1LTA C;  1S9K E;  1SLQ A;  2YMY A;  1SFC A;  1FAV A;  3A7O A;  1NH4 A;  3HE4 B;  1NAF A;  3V5B A;  4DOJ A;  1IO4 A;  1LWU B;  4WY4 B;  1CW5 A;  1KIL A;  1KIL C;  3HTK B;  5APS A;  1GU4 A;  2HFE D;  2JJL A;  1J2J B;  5BU8 B;  1LT9 A;  1SQX K;  3BAT A;  2W6B A;  4DZO A;  1JCD A;  2XU6 A;  2HOD B;  1N7S D;  1JY3 N;  2WTY A;  1M7L A;  3N4X A;  4ZKU A;  1L0L K;  1URQ B;  1JY3 P;  3VP8 A;  4JYB A;  4JYC A;  2PP6 A;  2WSC H;  3M0D A;  1ZV8 A;  4W7Z A;  3LW5 H;  3RL0 D;  3BRV B;  4C46 A;  3VMY A;  4B86 A;  2POH A;  2OYI B;  2ZXE B;  1IFN A;  1SVF A;  3VOP A;  1LT9 B;  1G1J A;  2P2U A;  1FDM A;  1EQ7 A;  3M9Q A;  3SWF A;  1RF1 A;  1LGH B;  5CCG D;  5AW0 B;  3HUS A;  1H89 A;  1JCC A;  1GL2 B;  1YTZ T;  3NMD A;  5CCH C;  1URQ A;  1DEB A;  1HVV A;  1SQP K;  1RY3 A;  2BAS A;  3LID A;  1X79 B;  3HD7 D;  2Q9I A;  3OAK A;  2WSF H;  3RL0 C;  3H6P A;  2XNX A;  3NTN A;  2YO2 A;  3BAS A;  1KIL B;  3HTK A;  3O8Z A;  3L4F A;  2CPS A;  1J1E B;  2I1K A;  1VDF A;  3M91 A;  3L35 A;  1CI6 B;  4ZKP A;  5KJ7 A;  1NHL A;  2HPC A;  1HTL C;  2O01 H;  5APV A;  1NTK K;  3KDP B;  1L0N K;  1OWA A;  1SFC B;  2W6A A;  1SFC D;  3U1C A;  2WPR A;  3M06 A;  1N2D C;  2HPC B;  4OH8 B;  1A02 J;  2Q3I A;  2QM7 A;  5APQ A;  5APY A;  1NO4 A;  2MJZ A;  1FJK A;  4GKG A;  2C9N Y;  1LT9 C;  2L5G B;  1NTM K;  3M0D C;  4I2L C;  3L36 A;  2R5D A;  1GK4 A;  1Z56 A;  4JF7 A;  1HGV A;  3TSI A;  1FZC C;  2NPS A;  3P7K A;  5AVU B;  2IFN A;  4C7N A;  1FJP A;  2IFM A;  1JY2 N;  4GT1 A;  3NXS A;  1M1J A;  2PAJ A;  2XDJ A;  1FZG A;  2HLO A;  1IFJ A;  1XTC C;  5APW A;  1RF0 A;  1XTG B;  5AW7 B;  2O1J A;  5APX A;  1LTJ A;  3GHG A;  3SWY A;  3WMM 0;  1CI6 A;  1M1J B;  2OYH B;  2FFD B;  2YKQ A;  1LTJ B;  2XKM A;  2GM4 A;  3TNU A;  1NOH A;  2QM8 A;  3T97 A;  5AVS B;  5KTB A;  5KJ7 C;  1RE3 C;  3P8C D;  2C0W A;  4HYT B;  2Z5H A;  3E1I A;  2KLV A;  2ZFC A;  3OA7 A;  2YKO A;  2N1T D;  3GHG B;  5AW1 B;  3HE5 A;  4W7Y A;  3RK2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...