2HPCA

Crystal structure of fragment d from human fibrinogen complexed with gly-pro-arg-pro-amide.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
b'IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha chain
molecule tags Blood clotting
total genus 17
structure length 74
sequence length 74
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2006-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hpcA00
2OYIC 1W2EA 2H43A 2HODA 2OYHC 1LT9C 2A45H 3HUSC 1N73A 2FFDC 1T3UA 1LTJA 1RF1C 1M1JA 2OYIA 1JY3N 1FZEA 1RF1A 2HODB 2OYHA 1LTJB 1N73B 1M1JB 1JY2N 3E1IA 3HUSA 1RF1B 2OYIB 1LT9A 2FFDA 2OYHB 1LT9B 3HUSB 2FFDB 3H32A 1JY3P 3GHGC 3H32B 2A45I 1JY2P 2HLOA 1LWUC 1RF0C 2Z4EA 2HPCA 1RE4C 2Q9IA 2HPCB 1FZFA 3GHGA 1LWUA 1RF0A 1RE4A 3BVHA 1N86A 3GHGB 1FZGA 1FZCC 1FZAA 2A45G 1LWUB 1JY3O 1FZBA 1RE3C 1FZCA 2XNXA 1JY2O 1FZCB 1N73C 1RE3A 1LTJC 1M1JC
chains in the Genus database with same CATH superfamily
1MZ9A 1FJPA 1SQXE 2WVRA 1IFDA 1EZVE 3CXHD 2IBZE 2PFXA 1G2CB 1GL2D 5CHXA 2YXQB 2HPCB 2MKVA 2W27A 4NPFX 3QH9A 1M56D 2YMKA 1T6AA 3GMAA 2A06E 1RE3A 2M5AB 1HJBA 3GG2A 1RF1A 1N2DC 2BCCG 3L72E 2JDIH 1JCDA 1PGJA 2E74C 1GL2B 2WSCH 2PGDA 2RKLA 2NRGA 2AXTH 3BRVB 3H1JJ 3CC4P 1GW4A 5AVZB 4DZOA 4PV1D 3E1RA 4GIFA 1VQKP 5KAFE 4DT0A 1EDLA 1YI2P 5E79E 3H1HD 4N78E 1SFCC 2IZ0A 2B88A 2LKMA 5AW2B 4IOIH 3PH0A 3H1LD 4PV1B 1S1CX 2PAJA 5AVRB 4L76A 3L75J 1JO5A 2JKVA 1U57A 1K04A 5KJ7D 3VN0A 1H8AA 3P7KA 1SFCA 5AVXB 2O3JA 3GLMA 1N73B 5GTHH 3RK2D 2BCCJ 3VMAA 1J1DB 3MUDC 1VQPP 4IL6X 4C46A 1JTHB 2WITA 2Z5IA 4UB6H 1NJIQ 3BCCG 3I5CA 2A45I 5KLIB 3RK2B 3VMXA 3AECC 2NPSD 1EDKA 2QG4A 1VDFA 2LXCB 2K9YA 2G8YA 1KQGB 2M8RA 3KZIE 3N7NA 3O8ZA 4HJGH 4HYTB 1SQQK 1JEKA 2XNDH 3L70E 1HGVA 2K88A 3PTZA 2M0BA 2KZJA 2LR2A 1IFJA 1LTIC 3FXEA 2B89A 2R5BA 3HE4B 3CX5D 1LTTC 3L74D 1IZNB 2FKWB 2WMMA 2WSEJ 4D6TD 2ZVNB 3D70A 3B4SA 2KNCB 3TGUG 1L4AC 2J58A 3WU2E 1JY2O 1FC2C 1KORA 4HKZH 3FWLA 5AVTB 1VF5C 2W6JH 2J5UA 3KYQA 2D2CD 1FAVA 1K8AQ 1MV8A 1S4XA 1W5CE 4R4LA 2JEEA 1KB9D 1R8EA 2OTLP 4WY4C 4KHXA 1BGYJ 1VL2A 3GHGA 3BCCJ 2WPSA 1AV1A 1L4AA 1IFIA 3D71A 3TK1A 4L74A 4XFJA 1M7LA 3CCRP 2D2CB 3H32A 4YXDC 1YJNP 1VQ8P 1RE4C 1URQD 4WY4A 2GM4A 1S9KD 4N6JA 3RK3E 3SFDC 2W8ZA 3USSA 4I1LA 3L36A 4K3AA 1SQBE 2I1KA 3VOPA 3IR9A 1BCCD 1RE4A 1URQB 1NU1D 2Q3EA 4GODA 2Q6QA 3P8MC 2QJKB 1W2EA 3KHUA 3MHVA 1VQ9P 1GL2C 1G2CA 1NTMG 1NHLA 1TU3F 2M3EA 1N8RQ 3G71P 1KFNA 5B66E 1KYOH 2M3BA 1HVVA 5L8RJ 3A0BE 1MFTA 3AE5C 5B5EH 1YYCA 1AVYA 3F5HA 1JNMA 1FJKA 1P84D 2L5GB 4U3FE 1GL2A 1ZW0A 3V2RA 2WSCJ 2JWDA 1YHQP 4PV1C 3C1LA 3H1LJ 3H1JE 3CCMP 4GKGA 1J1EB 3IFMA 2IZ1A 2OARA 5CBNA 2QM7A 1FU1A 1L0NK 2OQQA 2H7HA 3L74G 1BSNA 3BASA 2OYIC 3CMEP 5APWA 3V2PA 5KJ7C 4GOEA 1KILD 3TF5A 3TNUA 4IFDK 1IK9A 1NTMJ 2W6AA 3L75E 1FDMA 2QRXA 5GTIH 1IK7A 1L0LE 2OYIA 1JY3N 1S3JA 3RK2C 2AEJA 2K9JA 5KJ7A 1KILB 4H44C 1LP1B 4GDOA 5AVVB 1LTBC 1VQOP 3C8VA 2FXPA 1XTCC 1LT9B 3L71G 1GK6A 2FXOA 1JY2P 2N1TD 2ZJSE 2ZYGA 3HD7D 1PP9G 1VQ4P 4MN4C 2IPPA 1L0NE 2WPVB 2I1JA 2KXPB 5EFWB 3L74J 1BCCG 2P7JA 4D6TJ 1GTWA 3ITKA 3CXHI 3BVHA 3TDKA 3HD7B 1IO4A 1K05A 1D7MA 1OX3A 3AEFC 3H1KG 3CWBE 2DW3A 2FFDB 1EQ7A 2QE7H 2KYVA 3NFQA 3L73G 3M9HA 4ZMDA 4DOJA 4PD4D 3W68A 1KQFB 2C0XA 4C7NB 4K35A 3II6A 2D2CC 5CCGC 3MIWA 3WUTA 1Q86Q 1NKNA 3MP7B 2QVAA 5APXA 2C9NY 3L4FA 1USEA 3L71J 3BCCD 4HH2A 5TISH 3FGAD 1BGYE 2H43A 4I2LC 1UIIA 5CCGA 1MFZA 4Y28J 4GT1A 1VQ7P 1A02F 3SFEC 1BCCJ 3A0HE 1WRGA 3HTKB 2Y0DA 1NU1J 1GD2E 1OVVA 4WBAA 1QLED 1LTJC 2H8PD 2WQYC 5AW0B 4TT3H 1NAFA 2LXBA 1KQSO 2QIWA 1JM0A 1H88A 1NTKG 3H1KJ 1IJDB 3CXHE 1FZCC 1FDOA 4OGQD 1VQMP 2L91A 3AE3C 1KD1Q 1PPJG 2GUVA 1LTAC 2IBZD 2V7QJ 1GW3A 3TGUD 1M1JC 1OIPA 1SQPD 5DJUB 1LTJA 1OW8A 1M90Q 1RY3A 1NTZD 1NTMK 3SSUA 2ZYAA 3S1KA 1FZGA 1FS0E 3CCSP 3U1AA 5KAFH 3V5BA 1FZCA 1SS1A 4OGQB 1HJ0A 1J1EC 3I56P 5E79H 2E76D 1NKZB 1M1JA 2K37A 5AVWB 1SQVG 5TJHA 4IFFA 2P10A 1SVFA 1PGOA 1G1IA 5AW5B 1Y47A 2B87B 4ASVA 3NXSA 1S72P 4ZKPA 1LGHB 3H1HE 3AEBC 1Y9BA 2E76B 2IX7C 4JBZA 5K5GB 5AW4B 1MKMA 3H1LE 1PGPA 1KTMA 3CX5I 2WSSH 2OGUA 1QGKB 1XTGB 3PP5A 1NTKJ 1BDCA 5APTA 5BU8B 4OH8B 1JMMA 4U7JA 2P58A 3E1IA 5DJTB 1KILC 1GZLA 4BXLA 1EC5A 4W7YA 3VMZA 4IL6E 3VP9A 1NTMD 1KB9I 5CCHC 1AA0A 1LT9C 4EI2A 2HFED 4L73A 5KLVD 3Q5SA 3KZIH 1YTZI 1GDTA 1EDIA 3B71A 1JY3O 2E75D 2H89C 2YO2A 3MUDA 2OYOA 1QX8A 3V4WA 5CCHA 4UB8E 3CMAP 1U7MA 3PHLA 3HD7C 2JJLA 2NPSB 1OMIA 3OAKA 1H0TB 2FFDC 2HR3A 1FE6A 3LW5H 1LTSC 4W80A 2QJPB 3B5NC 2WSFJ 1SQXG 3AEAC 3WU2H 2ZXEB 1EZVG 3CX5E 2IBZG 1NU1K 3L37A 3L74E 1ZR4A 4JPZB 1SQPG 4PJ0E 4D6TE 3VYIA 2RMZA 2KK7A 3RL0D 3PJSK 4CPGA 4RO0A 1NTZG 2CPBA 2A06G 2FFDA 2GA1A 3MZWB 1WT6A 2R3CA 2Y9ZA 3QWOC 4DJGA 1AFOA 3B5NA 5CBOA 3L72G 2Z4EA 1P84I 1Q7YQ 2YKQA 1ZXGA 2E42A 1KB9E 4C7NA 3S9OA 1DEEG 5AW3B 3TYYA 3D6YA 2A45H 3RL0B 5AW8B 5APUA 4BRYB 4HB1A 5H2FE 5C39A 3H1ID 1RF0C 2Q9IA 1NOHA 1HGZA 2AXCA 2KB7P 1NAYA 3L71D 1OWAA 3T97A 1SQQE 1S9KE 1PP9D 1FOSE 2O01H 3RK3D 1T2KD 1Q81Q 2WT7A 1CI6A 1RF0A 2YO3A 2XZRA 3CI9A 2KS1B 3TGUJ 1BCCE 1SQPJ 4Y99B 1NU1E 2KUBA 1N7SD 3CCVP 2FYZA 1YTZT 1CW5A 5B66H 1HTLC 3A0BH 1NTZJ 2HPCA 3H1KD 4I6MC 2H88C 2O01N 3K5BA 3L72J 2M5AA 5KLVG 4YPCA 1W2BO 3L73D 1RF1B 5APSA 1N7SB 3RL0g 2IFNA 3HUSB 3MD0A 2E74D 1P84E 1HH0A 2Q5UA 4Z1MH 3CCEP 1DD4A 2E43A 4GOFA 1KYOD 4XE5B 2FYNB 3VP8A 2Q3IA 1LNQA 1ZV8A 3FX0A 1KC8Q 3Q1MA 5AW9B 1QEXA 2JWAA 2VRSA 2E74B 1AQTA 1Y8AA 1SFCD 3MGNA 3SWYA 1T3JA 1N73C 3AE2C 2XDJA 1QVGO 1LT1A 4RESB 4ZNCA 3M0AA 1OW6A 3BATA 1IC2A 2Y0EA 1J1DC 3A7OA 1KQLA 1LWUB 1KILE 1SFCB 1NTKD 3IN6A 1N73A 1AVOA 1NWQA 3CL3D 3Q5RA 1PPJD 5KLIC 5KLVJ 4PD4I 1VPCA 2AEFA 1YBKA 3FWNA 2V4HA 3U59A 1E79H 4LLHA 1U7JA 2R5DA 1KMIZ 3TSIA 4LGDE 3AE6C 2BCCE 2SPZA 1JTHA 3PRJA 2WPRA 1T3UA 1Q90D 3BRTB 3H1IG 2FBWC 4YXWH 2FYUD 1BE3D 2NPSC 2CK3H 3CLQA 4IFMA 1KZUB 5APVA 1UIXA 1SQVD 3WUVA 2A45G 3W67A 1KV4A 1NVOA 1GMJA 2WZ7A 5KAIE 3CC7P 2KI7B 3V4QA 3FXDA 1JMBA 1EDJA 1SQBG 2NPSA 2N1TB 1H0TA 2G3AA 1K73Q 3EQ2A 1ZRTD 2RH0A 3E7KA 3HE4A 3HE5B 3LW5J 1A02J 1JY2N 3I55P 2WSEH 5AVSB 2J59M 2KNCA 2E5TA 2KZIA 4R4MA 3NTNA 1ZP0C 3JSVC 2RN0A 1PGQA 1L4AD 1SQPK 2QM8A 2MJZA 4NPDA 1VF5D 3A5TA 3LIEA 3AEGC 4PD4E 2XU6A 1NTZK 3P8CE 3G3ZA 3H1IJ 3JCUE 2QJYB 2KOGA 1S5LE 4JYBA 3PLNA 4U3FG 2W6BA 3GF7A 1N86A 3GHGB 4KT0J 1DH3A 3M91A 1RH5B 1L4AB 3H25A 4WWIA 3RBXA 3BCCE 1PP9J 4BRYA 1X9VA 3A0HH 4C7RA 3H32B 1URQC 3G6EP 3NMDA 5AW1B 2QJKC 1SQBJ 2PRRA 4EYYQ 1RQUA 2QSIA 3CXHH 5APYA 1S2EA 1T2KC 1DIPA 5AW7B 2XV5A 1MUUA 2YMYA 3M9BA 1JCCA 2C0WA 1URQA 3OA7A 2W90A 1SQXD 2XKMA 4DCKA 1RE3C 2JR8A 1EZVD 1AJYA 3A2AA 1RF1C 1N7SC 1IFPA 3L73J 3HUSC 3M06A 2HODB 3GF3A 1PZQA 3TGUE 1LJ2A 1L0LG 1SQPE 5AVUB 2A06D 2FYNC 1FZBA 3L72D 4U3FJ 1NTZE 1OFCX 3AE8C 4EDFA 1FOSF 2FYUG 2W83C 1BE3G 5KLVK 1N7SA 3SWKA 3HUSA 3GW6A 3AE1C 5CJ0A 4H0LD 2YIUB 4H13D 1ZR2A 2Z5HA 1E5WA 1R5LA 2AXTE 3VTPC 4N78D 1Z56A 1L0NG 1ZN5A 2JO1A 3AE7C 3IF4A 2ZT9D 1LWUC 4H0LB 1KN7A 4H13B 3O6QB 1R5SA 2XNXA 1Q2NA 1NH4A 3V2NA 4IL6H 4QMAA 2I8DA 4JF7A 2OYHB 3CCUP 1H89A 2UWJE 3R2PA 2ZT9B 2KLUA 3CWBG 4N3YB 3TNUB 3B8EB 2NZ2A 1LWUA 1IFNA 1L0LJ 4M3LA 5M1BA 3S4RA 2ZAEB 1NTME 1YITP 1YJ9P 3G9RA 1BDDA 2OYIB 3EFGA 1VQNP 4I7ZB 2FYUJ 1BE3J 5AW6B 2K9JB 1KILA 2Q7CA 1AQ5A 2BASA 2AEMA 2Y9YA 1LTGC 5GTHE 5KLVE 4H44D 1SQVJ 4KJMA 1M1KQ 4UB8H 1X22A 3EFFK 1LP1A 2IDBA 1SP4A 1BGYG 1LT9A 4AYCA 2N1TC 1L2PA 3CCQP 2HYNA 1L0NJ 1G1JA 4UB6E 3RBZA 1HF9A 2BEQD 4H44B 2P2UA 3G4SP 2E75B 3L70D 3CX5H 3V6IA 1DEBA 1M8OB 4PJ0H 3MTUE 1OXZA 2N1TA 2FXMA 2YKOA 2JP3A 4RKUJ 5KKZB 1SQBK 3HD7A 3CWBJ 3HE5A 1RQVA 5CMZA 4B86A 2QJYC 3A3YB 3GHGC 1KB9H 2HLOA 5CJ4A 3P32A 2R3SA 3ZDMA 2Q1KA 3CCLP 5H2FH 3Q5PA 4YTPC 2PP6A 1FBMA 1KYOI 1Q82Q 1NYHA 5CCGD 4TLFA 3N4XA 1EXIA 2YKPA 3KXDA 4A7PA 3H1IE 3L71E 1VQ5P 2HG5D 4JQ0D 3H1HG 2R32A 1YQ3C 2QEXP 3ABVC 4L75A 1VQ6P 1PP9E 3LIDA 1SQQD 3HTKA 3H1LG 3AE9C 1SQXJ 1T8ZA 1YJWP 3UIAA 1SQBD 2WPQA 1DD3A 3VMYA 3C9IA 2B9BA 3SWFA 2BEZF 4LC1A 1M57D 3V2QA 1PV3A 3M0DC 3D6ZA 1X0TA 3RK3B 5KTBA 4OGQC 1GK4A 3CCJP 1NTKK 2KIKA 1HUCA 3H6PA 5APQA 2V7QH 3U1CA 1WMKA 3H1KE 3OJAB 2HODA 1HWTC 1FZEA 1P84H 2C9LY 1LTJB 2YIUC 1IFMA 3OW2O 2O1KA 2FY8A 1OW7A 3L73E 3M0DA 2OTJP 2KSJA 3CC2P 1L0LK 2P67A 1X79B 2N9BA 2GUSA 1FZCB 1OVRA 4U3FD 2E76C 1KYOE 1M1JB 2K1AA 2FYUK 4H0LC 4H13C 5B5EE 1K9MQ 2B87A 3H1HJ 2CPSA 1BSHA 1SQVK 3Q3DA 1PFIA 3H1JD 4OVNF 1N7LA 1JB0J 1DX7A 1FZAA 3L70G 2KSEA 3IAOA 3WUUA 2OYHC 2R44A 2ZT9C 2K3RA 1JY3P 1VQLP 1NGMB 3JC22 3O6QA 5AVQB 4RJTA 2O1JA 1KFMA 1PL5A 3AEEC 3KDPB 4ASWA 1X8YA 4D6TG 1YQ4C 1QL2A 4I7ZC 5AVYB 1GU4A 2OYHA 1NTKE 3L75D 2OTKE 1QL1A 1PPJE 1FZFA 2ZFCA 1FDIA 1L0LD 3CD6P 2N9YB 4OWFA 4ZKUA 5CCHD 2ZVOB 1ZMEC 3RGUA 5BVZA 4W7ZA 1NO4A 5GTIE 3WMM0 1RHZB 5BU5A 2KP8A 4AUWA 2BCCD 2WWWA 3L35A 3EWKA 2E75C 5KAIH 2FYUE 1BE3E 2E5YA 1QVFO 4EOTA 1SQVE 2QJPC 3L70J 4EIJA 2KLVA 1SQQG 3F89A 4WVZA 3R4YA 5KKZC 2IFMA 1L0ND 3KQGA 3KPEA 4JYCA 1EZVI 2IBZI 1ZRTE 2WSFH 1NU1G 3B5ND 1JOCA 2POHA 1SQXK 1GU5A 3RL0C 4PD4H 3CWBD 3JCUH 2YNYA 1S5LH 3CPWO 2ZYDA 1OZHA 3B5NB 1ZLLA 3HRNA 4O9BA 2ZXXA 4WY4D 2IYPA 2WTYA 4BWNA 1J2JB 2Y0CA 3P8CD 1YIJP 3AE4C 4NPEA 3AEDC 1OVUA 4AQRD 1VF5B 3H1JG 1SQQJ 1BGYD 2QA4P 3Q2YA 4WY4B 4Y99C 1CSBA 1S5LX 3T97B 1SLQA 5TISE 2O01J 3RK3C 1HBWA 1JUNA 2YXRB 3M9QA 1ZOYC 2WT7B 1PIXA 1CI6B 2P1JA 2IYOA 1USDA 4WB4A 2ITAA 1EXJA 2KS1A 1CZQA 4XA4A 3L75G
chains in the Genus database with same CATH topology
4Y99B 1MZ9A 1FJPA 1SP4A 5AVVB 1LTBC 1N7SD 1IFDA 2FYZA 1LT9A 1YTZT 1XTCC 1LT9B 1CW5A 1G2CB 1GL2D 4AYCA 2N1TC 1HTLC 5CHXA 1GK6A 1JY2P 2HYNA 2N1TD 2HPCA 2HPCB 1G1JA 4I6MC 2W27A 3HD7D 2P2UA 2IPPA 1RE3A 1HJBA 2I1JA 1RF1A 1N2DC 1RF1B 1DEBA 5APSA 1N7SB 2IFNA 3HUSB 2P7JA 1JCDA 3MD0A 1GTWA 1GL2B 2WSCH 3MTUE 1OXZA 2N1TA 2FXMA 2YKOA 1HH0A 3BRVB 2Q5UA 3BVHA 1GW4A 1SQBK 3HD7A 5AVZB 2E43A 3HD7B 1IO4A 3HE5A 4XE5B 4DZOA 3VP8A 2Q3IA 1ZV8A 4GIFA 5CMZA 4B86A 5AW9B 3A3YB 2FFDB 1EQ7A 3GHGC 2HLOA 5CJ4A 2KYVA 4N78E 2VRSA 1SFCC 3P32A 3NFQA 3M9HA 1SFCD 4DOJA 3MGNA 3SWYA 2LKMA 5AW2B 1T3JA 1N73C 2XDJA 2C0XA 2PP6A 4C7NB 1FBMA 3II6A 5CCGC 3MIWA 1NKNA 2PAJA 4RESB 5AVRB 5CCGD 3M0AA 5APXA 1JO5A 3N4XA 2C9NY 3BATA 1IC2A 3L4FA 5KJ7D 3VN0A 1J1DC 1H8AA 2YKPA 3A7OA 1KQLA 4HH2A 3P7KA 1LWUB 1SFCA 1SFCB 5AVXB 2H43A 1N73A 1NWQA 3CL3D 4I2LC 1N73B 2HG5D 5CCGA 1MFZA 2R32A 1VPCA 3RK2D 4GT1A 3LIDA 3U59A 1A02F 3HTKA 4LLHA 1WRGA 2R5DA 3HTKB 1GD2E 3TSIA 1T8ZA 1J1DB 4LGDE 4WBAA 3UIAA 2WPQA 3VMYA 1JTHA 1LTJC 2H8PD 2WPRA 3C9IA 4C46A 1JTHB 3SWFA 2WITA 1T3UA 5AW0B 3BRTB 4LC1A 2Z5IA 3V2QA 3M0DC 1NAFA 3I5CA 2NPSC 2A45I 3RK2B 3VMXA 1H88A 3CLQA 2NPSD 3RK3B 4IFMA 5KTBA 1IJDB 1KZUB 5APVA 1GK4A 1FZCC 2A45G 1NTKK 1VDFA 2GUVA 1HUCA 1LTAC 3H6PA 5APQA 3U1CA 2M8RA 1GW3A 3N7NA 1M1JC 3O8ZA 3OJAB 2HODA 1HWTC 2WZ7A 1LTJA 1FZEA 2C9LY 1LTJB 1IFMA 2O1KA 3V4QA 4HYTB 1RY3A 3M0DA 1SQQK 2KSJA 1NTMK 1HGVA 1L0LK 2NPSA 2N1TB 1FZGA 2P67A 3U1AA 1X79B 1IFJA 1LTIC 2N9BA 2GUSA 3EQ2A 3V5BA 1FZCA 2R5BA 1FZCB 1J1EC 3HE4A 3HE5B 3HE4B 1NKZB 1M1JA 1LTTC 1A02J 1M1JB 1JY2N 2FYUK 5AVWB 2WSEH 5AVSB 2FKWB 2J59M 4IFFA 1SVFA 2CPSA 1G1IA 3NTNA 5AW5B 1SQVK 1PFIA 3NXSA 1N7LA 1DX7A 1FZAA 1L4AC 2J58A 1L4AD 1JY2O 1SQPK 2QM8A 4ZKPA 2MJZA 1LGHB 5AVTB 2OYHC 3A5TA 3LIEA 3KYQA 2IX7C 1FAVA 1MV8A 5AW4B 2XU6A 1NTZK 3P8CE 3G3ZA 1JY3P 2JEEA 2KOGA 4JYBA 4KHXA 4WY4C 5AVQB 2W6BA 3GHGA 2O1JA 1N86A 1KFMA 3GHGB 1DH3A 1XTGB 2WPSA 3PP5A 3M91A 3KDPB 1L4AA 1IFIA 5APTA 1L4AB 5BU8B 4OH8B 3TK1A 1X8YA 1QL2A 1JMMA 5AVYB 1M7LA 1X9VA 1GU4A 2OYHA 3E1IA 1KILC 1GZLA 3H32A 4C7RA 3H32B 1URQC 4W7YA 1QL1A 3VMZA 1RE4C 1FZFA 1URQD 2ZFCA 3NMDA 3VP9A 4WY4A 2GM4A 1S9KD 5AW1B 4N6JA 5CCHC 4ZKUA 1LT9C 5CCHD 4I1LA 3L36A 2HFED 2I1KA 5BVZA 5APYA 1T2KC 4W7ZA 1NO4A 5AW7B 2XV5A 3VOPA 3WMM0 1MUUA 5BU5A 2YMYA 3M9BA 2KP8A 1GDTA 1YTZI 4AUWA 1JCCA 2C0WA 2WWWA 3IR9A 3L35A 1URQA 1RE4A 3OA7A 1URQB 2XKMA 1JY3O 1RE3C 4EOTA 2YO2A 3P8MC 3A2AA 3MUDA 1RF1C 1W2EA 1N7SC 3HUSC 3M06A 3V4WA 5CCHA 4EIJA 2HODB 1GL2C 2KLVA 1G2CA 1NHLA 5AVUB 3HD7C 2IFMA 2JJLA 2NPSB 1KFNA 1FZBA 2M3BA 3OAKA 1HVVA 3KQGA 3KPEA 1YYCA 1FOSF 2FFDC 5KLVK 1JNMA 1N7SA 1FJKA 3LW5H 4JYCA 1LTSC 2L5GB 3HUSA 4W80A 3B5NC 2WSFH 1GL2A 5CJ0A 3V2RA 3B5ND 2ZXEB 1JOCA 1ZR2A 2POHA 2Z5HA 1SQXK 1E5WA 1NU1K 3L37A 1ZR4A 1GU5A 3VYIA 3RL0C 3RL0D 2YNYA 4GKGA 3VTPC 1J1EB 2CPBA 4N78D 2FFDA 3IFMA 1Z56A 2OARA 1ZN5A 1WT6A 2R3CA 1AFOA 2QM7A 3B5NA 1FU1A 1LWUC 1L0NK 3B5NB 2Z4EA 1ZLLA 3HRNA 4O9BA 4WY4D 2H7HA 2YKQA 2WTYA 2E42A 2XNXA 1J2JB 4C7NA 3P8CD 5AW3B 3TYYA 3BASA 1NH4A 2OYIC 2A45H 3RL0B 3V2NA 5APWA 5AW8B 5APUA 3V2PA 4AQRD 4JF7A 2OYHB 5KJ7C 1KILD 1H89A 1RF0C 3TNUA 2Q9IA 1NOHA 3R2PA 4N3YB 4IFDK 3TNUB 3B8EB 1HGZA 1LWUA 1IK9A 2KB7P 2W6AA 1IFNA 4M3LA 1OWAA 1FDMA 4WY4B 3T97A 4Y99C 1CSBA 1SLQA 1S9KE 1FOSE 2OYIA 1JY3N 2OYIB 3EFGA 3RK2C 2O01H 3RK3C 1HBWA 1JUNA 5AW6B 1KILA 3RK3D 2Q7CA 1T2KD 5KJ7A 1KILB 1AQ5A 2BASA 2WT7A 3M9QA 1LTGC 1CI6A 1RF0A 2WT7B 2YO3A 1CI6B 2XZRA 3CI9A 2P1JA 4WB4A 1CZQA 4XA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYI C;  1W2E A;  2H43 A;  2HOD A;  2OYH C;  1LT9 C;  2A45 H;  3HUS C;  1N73 A;  2FFD C;  1T3U A;  1LTJ A;  1RF1 C;  1M1J A;  2OYI A;  1JY3 N;  1FZE A;  1RF1 A;  2HOD B;  2OYH A;  1LTJ B;  1N73 B;  1M1J B;  1JY2 N;  3E1I A;  3HUS A;  1RF1 B;  2OYI B;  1LT9 A;  2FFD A;  2OYH B;  1LT9 B;  3HUS B;  2FFD B;  3H32 A;  1JY3 P;  3GHG C;  3H32 B;  2A45 I;  1JY2 P;  2HLO A;  1LWU C;  1RF0 C;  2Z4E A;  2HPC A;  1RE4 C;  2Q9I A;  2HPC B;  1FZF A;  3GHG A;  1LWU A;  1RF0 A;  1RE4 A;  3BVH A;  1N86 A;  3GHG B;  1FZG A;  1FZC C;  1FZA A;  2A45 G;  1LWU B;  1JY3 O;  1FZB A;  1RE3 C;  1FZC A;  2XNX A;  1JY2 O;  1FZC B;  1N73 C;  1RE3 A;  1LTJ C;  1M1J C; 
#chains in the Genus database with same CATH topology
 1MZ9 A;  1FJP A;  1SQX E;  2WVR A;  1IFD A;  1EZV E;  3CXH D;  2IBZ E;  2PFX A;  1G2C B;  1GL2 D;  5CHX A;  2YXQ B;  2HPC B;  2MKV A;  2W27 A;  4NPF X;  3QH9 A;  1M56 D;  2YMK A;  1T6A A;  3GMA A;  2A06 E;  1RE3 A;  2M5A B;  1HJB A;  3GG2 A;  1RF1 A;  1N2D C;  2BCC G;  3L72 E;  2JDI H;  1JCD A;  1PGJ A;  2E74 C;  1GL2 B;  2WSC H;  2PGD A;  2RKL A;  2NRG A;  2AXT H;  3BRV B;  3H1J J;  3CC4 P;  1GW4 A;  5AVZ B;  4DZO A;  4PV1 D;  3E1R A;  4GIF A;  1VQK P;  5KAF E;  4DT0 A;  1EDL A;  1YI2 P;  5E79 E;  3H1H D;  4N78 E;  1SFC C;  2IZ0 A;  2B88 A;  2LKM A;  5AW2 B;  4IOI H;  3PH0 A;  3H1L D;  4PV1 B;  1S1C X;  2PAJ A;  5AVR B;  4L76 A;  3L75 J;  1JO5 A;  2JKV A;  1U57 A;  1K04 A;  5KJ7 D;  3VN0 A;  1H8A A;  3P7K A;  1SFC A;  5AVX B;  2O3J A;  3GLM A;  1N73 B;  5GTH H;  3RK2 D;  2BCC J;  3VMA A;  1J1D B;  3MUD C;  1VQP P;  4IL6 X;  4C46 A;  1JTH B;  2WIT A;  2Z5I A;  4UB6 H;  1NJI Q;  3BCC G;  3I5C A;  2A45 I;  5KLI B;  3RK2 B;  3VMX A;  3AEC C;  2NPS D;  1EDK A;  2QG4 A;  1VDF A;  2LXC B;  2K9Y A;  2G8Y A;  1KQG B;  2M8R A;  3KZI E;  3N7N A;  3O8Z A;  4HJG H;  4HYT B;  1SQQ K;  1JEK A;  2XND H;  3L70 E;  1HGV A;  2K88 A;  3PTZ A;  2M0B A;  2KZJ A;  2LR2 A;  1IFJ A;  1LTI C;  3FXE A;  2B89 A;  2R5B A;  3HE4 B;  3CX5 D;  1LTT C;  3L74 D;  1IZN B;  2FKW B;  2WMM A;  2WSE J;  4D6T D;  2ZVN B;  3D70 A;  3B4S A;  2KNC B;  3TGU G;  1L4A C;  2J58 A;  3WU2 E;  1JY2 O;  1FC2 C;  1KOR A;  4HKZ H;  3FWL A;  5AVT B;  1VF5 C;  2W6J H;  2J5U A;  3KYQ A;  2D2C D;  1FAV A;  1K8A Q;  1MV8 A;  1S4X A;  1W5C E;  4R4L A;  2JEE A;  1KB9 D;  1R8E A;  2OTL P;  4WY4 C;  4KHX A;  1BGY J;  1VL2 A;  3GHG A;  3BCC J;  2WPS A;  1AV1 A;  1L4A A;  1IFI A;  3D71 A;  3TK1 A;  4L74 A;  4XFJ A;  1M7L A;  3CCR P;  2D2C B;  3H32 A;  4YXD C;  1YJN P;  1VQ8 P;  1RE4 C;  1URQ D;  4WY4 A;  2GM4 A;  1S9K D;  4N6J A;  3RK3 E;  3SFD C;  2W8Z A;  3USS A;  4I1L A;  3L36 A;  4K3A A;  1SQB E;  2I1K A;  3VOP A;  3IR9 A;  1BCC D;  1RE4 A;  1URQ B;  1NU1 D;  2Q3E A;  4GOD A;  2Q6Q A;  3P8M C;  2QJK B;  1W2E A;  3KHU A;  3MHV A;  1VQ9 P;  1GL2 C;  1G2C A;  1NTM G;  1NHL A;  1TU3 F;  2M3E A;  1N8R Q;  3G71 P;  1KFN A;  5B66 E;  1KYO H;  2M3B A;  1HVV A;  5L8R J;  3A0B E;  1MFT A;  3AE5 C;  5B5E H;  1YYC A;  1AVY A;  3F5H A;  1JNM A;  1FJK A;  1P84 D;  2L5G B;  4U3F E;  1GL2 A;  1ZW0 A;  3V2R A;  2WSC J;  2JWD A;  1YHQ P;  4PV1 C;  3C1L A;  3H1L J;  3H1J E;  3CCM P;  4GKG A;  1J1E B;  3IFM A;  2IZ1 A;  2OAR A;  5CBN A;  2QM7 A;  1FU1 A;  1L0N K;  2OQQ A;  2H7H A;  3L74 G;  1BSN A;  3BAS A;  2OYI C;  3CME P;  5APW A;  3V2P A;  5KJ7 C;  4GOE A;  1KIL D;  3TF5 A;  3TNU A;  4IFD K;  1IK9 A;  1NTM J;  2W6A A;  3L75 E;  1FDM A;  2QRX A;  5GTI H;  1IK7 A;  1L0L E;  2OYI A;  1JY3 N;  1S3J A;  3RK2 C;  2AEJ A;  2K9J A;  5KJ7 A;  1KIL B;  4H44 C;  1LP1 B;  4GDO A;  5AVV B;  1LTB C;  1VQO P;  3C8V A;  2FXP A;  1XTC C;  1LT9 B;  3L71 G;  1GK6 A;  2FXO A;  1JY2 P;  2N1T D;  2ZJS E;  2ZYG A;  3HD7 D;  1PP9 G;  1VQ4 P;  4MN4 C;  2IPP A;  1L0N E;  2WPV B;  2I1J A;  2KXP B;  5EFW B;  3L74 J;  1BCC G;  2P7J A;  4D6T J;  1GTW A;  3ITK A;  3CXH I;  3BVH A;  3TDK A;  3HD7 B;  1IO4 A;  1K05 A;  1D7M A;  1OX3 A;  3AEF C;  3H1K G;  3CWB E;  2DW3 A;  2FFD B;  1EQ7 A;  2QE7 H;  2KYV A;  3NFQ A;  3L73 G;  3M9H A;  4ZMD A;  4DOJ A;  4PD4 D;  3W68 A;  1KQF B;  2C0X A;  4C7N B;  4K35 A;  3II6 A;  2D2C C;  5CCG C;  3MIW A;  3WUT A;  1Q86 Q;  1NKN A;  3MP7 B;  2QVA A;  5APX A;  2C9N Y;  3L4F A;  1USE A;  3L71 J;  3BCC D;  4HH2 A;  5TIS H;  3FGA D;  1BGY E;  2H43 A;  4I2L C;  1UII A;  5CCG A;  1MFZ A;  4Y28 J;  4GT1 A;  1VQ7 P;  1A02 F;  3SFE C;  1BCC J;  3A0H E;  1WRG A;  3HTK B;  2Y0D A;  1NU1 J;  1GD2 E;  1OVV A;  4WBA A;  1QLE D;  1LTJ C;  2H8P D;  2WQY C;  5AW0 B;  4TT3 H;  1NAF A;  2LXB A;  1KQS O;  2QIW A;  1JM0 A;  1H88 A;  1NTK G;  3H1K J;  1IJD B;  3CXH E;  1FZC C;  1FDO A;  4OGQ D;  1VQM P;  2L91 A;  3AE3 C;  1KD1 Q;  1PPJ G;  2GUV A;  1LTA C;  2IBZ D;  2V7Q J;  1GW3 A;  3TGU D;  1M1J C;  1OIP A;  1SQP D;  5DJU B;  1LTJ A;  1OW8 A;  1M90 Q;  1RY3 A;  1NTZ D;  1NTM K;  3SSU A;  2ZYA A;  3S1K A;  1FZG A;  1FS0 E;  3CCS P;  3U1A A;  5KAF H;  3V5B A;  1FZC A;  1SS1 A;  4OGQ B;  1HJ0 A;  1J1E C;  3I56 P;  5E79 H;  2E76 D;  1NKZ B;  1M1J A;  2K37 A;  5AVW B;  1SQV G;  5TJH A;  4IFF A;  2P10 A;  1SVF A;  1PGO A;  1G1I A;  5AW5 B;  1Y47 A;  2B87 B;  4ASV A;  3NXS A;  1S72 P;  4ZKP A;  1LGH B;  3H1H E;  3AEB C;  1Y9B A;  2E76 B;  2IX7 C;  4JBZ A;  5K5G B;  5AW4 B;  1MKM A;  3H1L E;  1PGP A;  1KTM A;  3CX5 I;  2WSS H;  2OGU A;  1QGK B;  1XTG B;  3PP5 A;  1NTK J;  1BDC A;  5APT A;  5BU8 B;  4OH8 B;  1JMM A;  4U7J A;  2P58 A;  3E1I A;  5DJT B;  1KIL C;  1GZL A;  4BXL A;  1EC5 A;  4W7Y A;  3VMZ A;  4IL6 E;  3VP9 A;  1NTM D;  1KB9 I;  5CCH C;  1AA0 A;  1LT9 C;  4EI2 A;  2HFE D;  4L73 A;  5KLV D;  3Q5S A;  3KZI H;  1YTZ I;  1GDT A;  1EDI A;  3B71 A;  1JY3 O;  2E75 D;  2H89 C;  2YO2 A;  3MUD A;  2OYO A;  1QX8 A;  3V4W A;  5CCH A;  4UB8 E;  3CMA P;  1U7M A;  3PHL A;  3HD7 C;  2JJL A;  2NPS B;  1OMI A;  3OAK A;  1H0T B;  2FFD C;  2HR3 A;  1FE6 A;  3LW5 H;  1LTS C;  4W80 A;  2QJP B;  3B5N C;  2WSF J;  1SQX G;  3AEA C;  3WU2 H;  2ZXE B;  1EZV G;  3CX5 E;  2IBZ G;  1NU1 K;  3L37 A;  3L74 E;  1ZR4 A;  4JPZ B;  1SQP G;  4PJ0 E;  4D6T E;  3VYI A;  2RMZ A;  2KK7 A;  3RL0 D;  3PJS K;  4CPG A;  4RO0 A;  1NTZ G;  2CPB A;  2A06 G;  2FFD A;  2GA1 A;  3MZW B;  1WT6 A;  2R3C A;  2Y9Z A;  3QWO C;  4DJG A;  1AFO A;  3B5N A;  5CBO A;  3L72 G;  2Z4E A;  1P84 I;  1Q7Y Q;  2YKQ A;  1ZXG A;  2E42 A;  1KB9 E;  4C7N A;  3S9O A;  1DEE G;  5AW3 B;  3TYY A;  3D6Y A;  2A45 H;  3RL0 B;  5AW8 B;  5APU A;  4BRY B;  4HB1 A;  5H2F E;  5C39 A;  3H1I D;  1RF0 C;  2Q9I A;  1NOH A;  1HGZ A;  2AXC A;  2KB7 P;  1NAY A;  3L71 D;  1OWA A;  3T97 A;  1SQQ E;  1S9K E;  1PP9 D;  1FOS E;  2O01 H;  3RK3 D;  1T2K D;  1Q81 Q;  2WT7 A;  1CI6 A;  1RF0 A;  2YO3 A;  2XZR A;  3CI9 A;  2KS1 B;  3TGU J;  1BCC E;  1SQP J;  4Y99 B;  1NU1 E;  2KUB A;  1N7S D;  3CCV P;  2FYZ A;  1YTZ T;  1CW5 A;  5B66 H;  1HTL C;  3A0B H;  1NTZ J;  2HPC A;  3H1K D;  4I6M C;  2H88 C;  2O01 N;  3K5B A;  3L72 J;  2M5A A;  5KLV G;  4YPC A;  1W2B O;  3L73 D;  1RF1 B;  5APS A;  1N7S B;  3RL0 g;  2IFN A;  3HUS B;  3MD0 A;  2E74 D;  1P84 E;  1HH0 A;  2Q5U A;  4Z1M H;  3CCE P;  1DD4 A;  2E43 A;  4GOF A;  1KYO D;  4XE5 B;  2FYN B;  3VP8 A;  2Q3I A;  1LNQ A;  1ZV8 A;  3FX0 A;  1KC8 Q;  3Q1M A;  5AW9 B;  1QEX A;  2JWA A;  2VRS A;  2E74 B;  1AQT A;  1Y8A A;  1SFC D;  3MGN A;  3SWY A;  1T3J A;  1N73 C;  3AE2 C;  2XDJ A;  1QVG O;  1LT1 A;  4RES B;  4ZNC A;  3M0A A;  1OW6 A;  3BAT A;  1IC2 A;  2Y0E A;  1J1D C;  3A7O A;  1KQL A;  1LWU B;  1KIL E;  1SFC B;  1NTK D;  3IN6 A;  1N73 A;  1AVO A;  1NWQ A;  3CL3 D;  3Q5R A;  1PPJ D;  5KLI C;  5KLV J;  4PD4 I;  1VPC A;  2AEF A;  1YBK A;  3FWN A;  2V4H A;  3U59 A;  1E79 H;  4LLH A;  1U7J A;  2R5D A;  1KMI Z;  3TSI A;  4LGD E;  3AE6 C;  2BCC E;  2SPZ A;  1JTH A;  3PRJ A;  2WPR A;  1T3U A;  1Q90 D;  3BRT B;  3H1I G;  2FBW C;  4YXW H;  2FYU D;  1BE3 D;  2NPS C;  2CK3 H;  3CLQ A;  4IFM A;  1KZU B;  5APV A;  1UIX A;  1SQV D;  3WUV A;  2A45 G;  3W67 A;  1KV4 A;  1NVO A;  1GMJ A;  2WZ7 A;  5KAI E;  3CC7 P;  2KI7 B;  3V4Q A;  3FXD A;  1JMB A;  1EDJ A;  1SQB G;  2NPS A;  2N1T B;  1H0T A;  2G3A A;  1K73 Q;  3EQ2 A;  1ZRT D;  2RH0 A;  3E7K A;  3HE4 A;  3HE5 B;  3LW5 J;  1A02 J;  1JY2 N;  3I55 P;  2WSE H;  5AVS B;  2J59 M;  2KNC A;  2E5T A;  2KZI A;  4R4M A;  3NTN A;  1ZP0 C;  3JSV C;  2RN0 A;  1PGQ A;  1L4A D;  1SQP K;  2QM8 A;  2MJZ A;  4NPD A;  1VF5 D;  3A5T A;  3LIE A;  3AEG C;  4PD4 E;  2XU6 A;  1NTZ K;  3P8C E;  3G3Z A;  3H1I J;  3JCU E;  2QJY B;  2KOG A;  1S5L E;  4JYB A;  3PLN A;  4U3F G;  2W6B A;  3GF7 A;  1N86 A;  3GHG B;  4KT0 J;  1DH3 A;  3M91 A;  1RH5 B;  1L4A B;  3H25 A;  4WWI A;  3RBX A;  3BCC E;  1PP9 J;  4BRY A;  1X9V A;  3A0H H;  4C7R A;  3H32 B;  1URQ C;  3G6E P;  3NMD A;  5AW1 B;  2QJK C;  1SQB J;  2PRR A;  4EYY Q;  1RQU A;  2QSI A;  3CXH H;  5APY A;  1S2E A;  1T2K C;  1DIP A;  5AW7 B;  2XV5 A;  1MUU A;  2YMY A;  3M9B A;  1JCC A;  2C0W A;  1URQ A;  3OA7 A;  2W90 A;  1SQX D;  2XKM A;  4DCK A;  1RE3 C;  2JR8 A;  1EZV D;  1AJY A;  3A2A A;  1RF1 C;  1N7S C;  1IFP A;  3L73 J;  3HUS C;  3M06 A;  2HOD B;  3GF3 A;  1PZQ A;  3TGU E;  1LJ2 A;  1L0L G;  1SQP E;  5AVU B;  2A06 D;  2FYN C;  1FZB A;  3L72 D;  4U3F J;  1NTZ E;  1OFC X;  3AE8 C;  4EDF A;  1FOS F;  2FYU G;  2W83 C;  1BE3 G;  5KLV K;  1N7S A;  3SWK A;  3HUS A;  3GW6 A;  3AE1 C;  5CJ0 A;  4H0L D;  2YIU B;  4H13 D;  1ZR2 A;  2Z5H A;  1E5W A;  1R5L A;  2AXT E;  3VTP C;  4N78 D;  1Z56 A;  1L0N G;  1ZN5 A;  2JO1 A;  3AE7 C;  3IF4 A;  2ZT9 D;  1LWU C;  4H0L B;  1KN7 A;  4H13 B;  3O6Q B;  1R5S A;  2XNX A;  1Q2N A;  1NH4 A;  3V2N A;  4IL6 H;  4QMA A;  2I8D A;  4JF7 A;  2OYH B;  3CCU P;  1H89 A;  2UWJ E;  3R2P A;  2ZT9 B;  2KLU A;  3CWB G;  4N3Y B;  3TNU B;  3B8E B;  2NZ2 A;  1LWU A;  1IFN A;  1L0L J;  4M3L A;  5M1B A;  3S4R A;  2ZAE B;  1NTM E;  1YIT P;  1YJ9 P;  3G9R A;  1BDD A;  2OYI B;  3EFG A;  1VQN P;  4I7Z B;  2FYU J;  1BE3 J;  5AW6 B;  2K9J B;  1KIL A;  2Q7C A;  1AQ5 A;  2BAS A;  2AEM A;  2Y9Y A;  1LTG C;  5GTH E;  5KLV E;  4H44 D;  1SQV J;  4KJM A;  1M1K Q;  4UB8 H;  1X22 A;  3EFF K;  1LP1 A;  2IDB A;  1SP4 A;  1BGY G;  1LT9 A;  4AYC A;  2N1T C;  1L2P A;  3CCQ P;  2HYN A;  1L0N J;  1G1J A;  4UB6 E;  3RBZ A;  1HF9 A;  2BEQ D;  4H44 B;  2P2U A;  3G4S P;  2E75 B;  3L70 D;  3CX5 H;  3V6I A;  1DEB A;  1M8O B;  4PJ0 H;  3MTU E;  1OXZ A;  2N1T A;  2FXM A;  2YKO A;  2JP3 A;  4RKU J;  5KKZ B;  1SQB K;  3HD7 A;  3CWB J;  3HE5 A;  1RQV A;  5CMZ A;  4B86 A;  2QJY C;  3A3Y B;  3GHG C;  1KB9 H;  2HLO A;  5CJ4 A;  3P32 A;  2R3S A;  3ZDM A;  2Q1K A;  3CCL P;  5H2F H;  3Q5P A;  4YTP C;  2PP6 A;  1FBM A;  1KYO I;  1Q82 Q;  1NYH A;  5CCG D;  4TLF A;  3N4X A;  1EXI A;  2YKP A;  3KXD A;  4A7P A;  3H1I E;  3L71 E;  1VQ5 P;  2HG5 D;  4JQ0 D;  3H1H G;  2R32 A;  1YQ3 C;  2QEX P;  3ABV C;  4L75 A;  1VQ6 P;  1PP9 E;  3LID A;  1SQQ D;  3HTK A;  3H1L G;  3AE9 C;  1SQX J;  1T8Z A;  1YJW P;  3UIA A;  1SQB D;  2WPQ A;  1DD3 A;  3VMY A;  3C9I A;  2B9B A;  3SWF A;  2BEZ F;  4LC1 A;  1M57 D;  3V2Q A;  1PV3 A;  3M0D C;  3D6Z A;  1X0T A;  3RK3 B;  5KTB A;  4OGQ C;  1GK4 A;  3CCJ P;  1NTK K;  2KIK A;  1HUC A;  3H6P A;  5APQ A;  2V7Q H;  3U1C A;  1WMK A;  3H1K E;  3OJA B;  2HOD A;  1HWT C;  1FZE A;  1P84 H;  2C9L Y;  1LTJ B;  2YIU C;  1IFM A;  3OW2 O;  2O1K A;  2FY8 A;  1OW7 A;  3L73 E;  3M0D A;  2OTJ P;  2KSJ A;  3CC2 P;  1L0L K;  2P67 A;  1X79 B;  2N9B A;  2GUS A;  1FZC B;  1OVR A;  4U3F D;  2E76 C;  1KYO E;  1M1J B;  2K1A A;  2FYU K;  4H0L C;  4H13 C;  5B5E E;  1K9M Q;  2B87 A;  3H1H J;  2CPS A;  1BSH A;  1SQV K;  3Q3D A;  1PFI A;  3H1J D;  4OVN F;  1N7L A;  1JB0 J;  1DX7 A;  1FZA A;  3L70 G;  2KSE A;  3IAO A;  3WUU A;  2OYH C;  2R44 A;  2ZT9 C;  2K3R A;  1JY3 P;  1VQL P;  1NGM B;  3JC2 2;  3O6Q A;  5AVQ B;  4RJT A;  2O1J A;  1KFM A;  1PL5 A;  3AEE C;  3KDP B;  4ASW A;  1X8Y A;  4D6T G;  1YQ4 C;  1QL2 A;  4I7Z C;  5AVY B;  1GU4 A;  2OYH A;  1NTK E;  3L75 D;  2OTK E;  1QL1 A;  1PPJ E;  1FZF A;  2ZFC A;  1FDI A;  1L0L D;  3CD6 P;  2N9Y B;  4OWF A;  4ZKU A;  5CCH D;  2ZVO B;  1ZME C;  3RGU A;  5BVZ A;  4W7Z A;  1NO4 A;  5GTI E;  3WMM 0;  1RHZ B;  5BU5 A;  2KP8 A;  4AUW A;  2BCC D;  2WWW A;  3L35 A;  3EWK A;  2E75 C;  5KAI H;  2FYU E;  1BE3 E;  2E5Y A;  1QVF O;  4EOT A;  1SQV E;  2QJP C;  3L70 J;  4EIJ A;  2KLV A;  1SQQ G;  3F89 A;  4WVZ A;  3R4Y A;  5KKZ C;  2IFM A;  1L0N D;  3KQG A;  3KPE A;  4JYC A;  1EZV I;  2IBZ I;  1ZRT E;  2WSF H;  1NU1 G;  3B5N D;  1JOC A;  2POH A;  1SQX K;  1GU5 A;  3RL0 C;  4PD4 H;  3CWB D;  3JCU H;  2YNY A;  1S5L H;  3CPW O;  2ZYD A;  1OZH A;  3B5N B;  1ZLL A;  3HRN A;  4O9B A;  2ZXX A;  4WY4 D;  2IYP A;  2WTY A;  4BWN A;  1J2J B;  2Y0C A;  3P8C D;  1YIJ P;  3AE4 C;  4NPE A;  3AED C;  1OVU A;  4AQR D;  1VF5 B;  3H1J G;  1SQQ J;  1BGY D;  2QA4 P;  3Q2Y A;  4WY4 B;  4Y99 C;  1CSB A;  1S5L X;  3T97 B;  1SLQ A;  5TIS E;  2O01 J;  3RK3 C;  1HBW A;  1JUN A;  2YXR B;  3M9Q A;  1ZOY C;  2WT7 B;  1PIX A;  1CI6 B;  2P1J A;  2IYO A;  1USD A;  4WB4 A;  2ITA A;  1EXJ A;  2KS1 A;  1CZQ A;  4XA4 A;  3L75 G; 
#chains in the Genus database with same CATH homology
 4Y99 B;  1MZ9 A;  1FJP A;  1SP4 A;  5AVV B;  1LTB C;  1N7S D;  1IFD A;  2FYZ A;  1LT9 A;  1YTZ T;  1XTC C;  1LT9 B;  1CW5 A;  1G2C B;  1GL2 D;  4AYC A;  2N1T C;  1HTL C;  5CHX A;  1GK6 A;  1JY2 P;  2HYN A;  2N1T D;  2HPC A;  2HPC B;  1G1J A;  4I6M C;  2W27 A;  3HD7 D;  2P2U A;  2IPP A;  1RE3 A;  1HJB A;  2I1J A;  1RF1 A;  1N2D C;  1RF1 B;  1DEB A;  5APS A;  1N7S B;  2IFN A;  3HUS B;  2P7J A;  1JCD A;  3MD0 A;  1GTW A;  1GL2 B;  2WSC H;  3MTU E;  1OXZ A;  2N1T A;  2FXM A;  2YKO A;  1HH0 A;  3BRV B;  2Q5U A;  3BVH A;  1GW4 A;  1SQB K;  3HD7 A;  5AVZ B;  2E43 A;  3HD7 B;  1IO4 A;  3HE5 A;  4XE5 B;  4DZO A;  3VP8 A;  2Q3I A;  1ZV8 A;  4GIF A;  5CMZ A;  4B86 A;  5AW9 B;  3A3Y B;  2FFD B;  1EQ7 A;  3GHG C;  2HLO A;  5CJ4 A;  2KYV A;  4N78 E;  2VRS A;  1SFC C;  3P32 A;  3NFQ A;  3M9H A;  1SFC D;  4DOJ A;  3MGN A;  3SWY A;  2LKM A;  5AW2 B;  1T3J A;  1N73 C;  2XDJ A;  2C0X A;  2PP6 A;  4C7N B;  1FBM A;  3II6 A;  5CCG C;  3MIW A;  1NKN A;  2PAJ A;  4RES B;  5AVR B;  5CCG D;  3M0A A;  5APX A;  1JO5 A;  3N4X A;  2C9N Y;  3BAT A;  1IC2 A;  3L4F A;  5KJ7 D;  3VN0 A;  1J1D C;  1H8A A;  2YKP A;  3A7O A;  1KQL A;  4HH2 A;  3P7K A;  1LWU B;  1SFC A;  1SFC B;  5AVX B;  2H43 A;  1N73 A;  1NWQ A;  3CL3 D;  4I2L C;  1N73 B;  2HG5 D;  5CCG A;  1MFZ A;  2R32 A;  1VPC A;  3RK2 D;  4GT1 A;  3LID A;  3U59 A;  1A02 F;  3HTK A;  4LLH A;  1WRG A;  2R5D A;  3HTK B;  1GD2 E;  3TSI A;  1T8Z A;  1J1D B;  4LGD E;  4WBA A;  3UIA A;  2WPQ A;  3VMY A;  1JTH A;  1LTJ C;  2H8P D;  2WPR A;  3C9I A;  4C46 A;  1JTH B;  3SWF A;  2WIT A;  1T3U A;  5AW0 B;  3BRT B;  4LC1 A;  2Z5I A;  3V2Q A;  3M0D C;  1NAF A;  3I5C A;  2NPS C;  2A45 I;  3RK2 B;  3VMX A;  1H88 A;  3CLQ A;  2NPS D;  3RK3 B;  4IFM A;  5KTB A;  1IJD B;  1KZU B;  5APV A;  1GK4 A;  1FZC C;  2A45 G;  1NTK K;  1VDF A;  2GUV A;  1HUC A;  1LTA C;  3H6P A;  5APQ A;  3U1C A;  2M8R A;  1GW3 A;  3N7N A;  1M1J C;  3O8Z A;  3OJA B;  2HOD A;  1HWT C;  2WZ7 A;  1LTJ A;  1FZE A;  2C9L Y;  1LTJ B;  1IFM A;  2O1K A;  3V4Q A;  4HYT B;  1RY3 A;  3M0D A;  1SQQ K;  2KSJ A;  1NTM K;  1HGV A;  1L0L K;  2NPS A;  2N1T B;  1FZG A;  2P67 A;  3U1A A;  1X79 B;  1IFJ A;  1LTI C;  2N9B A;  2GUS A;  3EQ2 A;  3V5B A;  1FZC A;  2R5B A;  1FZC B;  1J1E C;  3HE4 A;  3HE5 B;  3HE4 B;  1NKZ B;  1M1J A;  1LTT C;  1A02 J;  1M1J B;  1JY2 N;  2FYU K;  5AVW B;  2WSE H;  5AVS B;  2FKW B;  2J59 M;  4IFF A;  1SVF A;  2CPS A;  1G1I A;  3NTN A;  5AW5 B;  1SQV K;  1PFI A;  3NXS A;  1N7L A;  1DX7 A;  1FZA A;  1L4A C;  2J58 A;  1L4A D;  1JY2 O;  1SQP K;  2QM8 A;  4ZKP A;  2MJZ A;  1LGH B;  5AVT B;  2OYH C;  3A5T A;  3LIE A;  3KYQ A;  2IX7 C;  1FAV A;  1MV8 A;  5AW4 B;  2XU6 A;  1NTZ K;  3P8C E;  3G3Z A;  1JY3 P;  2JEE A;  2KOG A;  4JYB A;  4KHX A;  4WY4 C;  5AVQ B;  2W6B A;  3GHG A;  2O1J A;  1N86 A;  1KFM A;  3GHG B;  1DH3 A;  1XTG B;  2WPS A;  3PP5 A;  3M91 A;  3KDP B;  1L4A A;  1IFI A;  5APT A;  1L4A B;  5BU8 B;  4OH8 B;  3TK1 A;  1X8Y A;  1QL2 A;  1JMM A;  5AVY B;  1M7L A;  1X9V A;  1GU4 A;  2OYH A;  3E1I A;  1KIL C;  1GZL A;  3H32 A;  4C7R A;  3H32 B;  1URQ C;  4W7Y A;  1QL1 A;  3VMZ A;  1RE4 C;  1FZF A;  1URQ D;  2ZFC A;  3NMD A;  3VP9 A;  4WY4 A;  2GM4 A;  1S9K D;  5AW1 B;  4N6J A;  5CCH C;  4ZKU A;  1LT9 C;  5CCH D;  4I1L A;  3L36 A;  2HFE D;  2I1K A;  5BVZ A;  5APY A;  1T2K C;  4W7Z A;  1NO4 A;  5AW7 B;  2XV5 A;  3VOP A;  3WMM 0;  1MUU A;  5BU5 A;  2YMY A;  3M9B A;  2KP8 A;  1GDT A;  1YTZ I;  4AUW A;  1JCC A;  2C0W A;  2WWW A;  3IR9 A;  3L35 A;  1URQ A;  1RE4 A;  3OA7 A;  1URQ B;  2XKM A;  1JY3 O;  1RE3 C;  4EOT A;  2YO2 A;  3P8M C;  3A2A A;  3MUD A;  1RF1 C;  1W2E A;  1N7S C;  3HUS C;  3M06 A;  3V4W A;  5CCH A;  4EIJ A;  2HOD B;  1GL2 C;  2KLV A;  1G2C A;  1NHL A;  5AVU B;  3HD7 C;  2IFM A;  2JJL A;  2NPS B;  1KFN A;  1FZB A;  2M3B A;  3OAK A;  1HVV A;  3KQG A;  3KPE A;  1YYC A;  1FOS F;  2FFD C;  5KLV K;  1JNM A;  1N7S A;  1FJK A;  3LW5 H;  4JYC A;  1LTS C;  2L5G B;  3HUS A;  4W80 A;  3B5N C;  2WSF H;  1GL2 A;  5CJ0 A;  3V2R A;  3B5N D;  2ZXE B;  1JOC A;  1ZR2 A;  2POH A;  2Z5H A;  1SQX K;  1E5W A;  1NU1 K;  3L37 A;  1ZR4 A;  1GU5 A;  3VYI A;  3RL0 C;  3RL0 D;  2YNY A;  4GKG A;  3VTP C;  1J1E B;  2CPB A;  4N78 D;  2FFD A;  3IFM A;  1Z56 A;  2OAR A;  1ZN5 A;  1WT6 A;  2R3C A;  1AFO A;  2QM7 A;  3B5N A;  1FU1 A;  1LWU C;  1L0N K;  3B5N B;  2Z4E A;  1ZLL A;  3HRN A;  4O9B A;  4WY4 D;  2H7H A;  2YKQ A;  2WTY A;  2E42 A;  2XNX A;  1J2J B;  4C7N A;  3P8C D;  5AW3 B;  3TYY A;  3BAS A;  1NH4 A;  2OYI C;  2A45 H;  3RL0 B;  3V2N A;  5APW A;  5AW8 B;  5APU A;  3V2P A;  4AQR D;  4JF7 A;  2OYH B;  5KJ7 C;  1KIL D;  1H89 A;  1RF0 C;  3TNU A;  2Q9I A;  1NOH A;  3R2P A;  4N3Y B;  4IFD K;  3TNU B;  3B8E B;  1HGZ A;  1LWU A;  1IK9 A;  2KB7 P;  2W6A A;  1IFN A;  4M3L A;  1OWA A;  1FDM A;  4WY4 B;  3T97 A;  4Y99 C;  1CSB A;  1SLQ A;  1S9K E;  1FOS E;  2OYI A;  1JY3 N;  2OYI B;  3EFG A;  3RK2 C;  2O01 H;  3RK3 C;  1HBW A;  1JUN A;  5AW6 B;  1KIL A;  3RK3 D;  2Q7C A;  1T2K D;  5KJ7 A;  1KIL B;  1AQ5 A;  2BAS A;  2WT7 A;  3M9Q A;  1LTG C;  1CI6 A;  1RF0 A;  2WT7 B;  2YO3 A;  1CI6 B;  2XZR A;  3CI9 A;  2P1J A;  4WB4 A;  1CZQ A;  4XA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...