2HQ0A

Structure of rafe from streptococcus pneumoniae
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
388
structure length
387
Chain Sequence
GPSSTVTIEYFNQKKEMTKTLEEITRDFEKENPIKVKVVNVPNAGEVLKTRVLAGDVPDVVNIYPQSIELQEWAKAGVFEDLSNKDYLKRVKNGYAEKYAVNEKVYNVPFTANAYGIYYNKDKFEELGLKVPETWDEFEQLVKDIVAKGQTPFGIAGADAWTLNGYNQLAFATATGGGKEANQYLRYSQPNAIKLSDPIMKDDIKVMDILRINGSKQKNWEGAGYTDVIGAFARGDVLMTPNGSWAITAINEQKPNFKIGTFMIPGKEKGQSLTVGAGDLAWSISATTKHPKEANAFVEYMTRPEVMQKYYDVDGSPTAIEGVKQAGEDSPLAGMTEYAFTDRHLVWLQQYWTSEADFHTLTMNYVLTGDKQGMVNDLNAFFNPMKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structures of RafE from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Sugar binding protein
molecule keywords Sugar ABC transporter, sugar-binding protein
total genus 136
structure length 387
sequence length 388
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hq0A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hq0A02
3B6TA 3GZGA 3O9PA 2ONSA 2GHAA 3PPNA 1XT8A 1P99A 2ONRA 3K1MA 3MP8A 3PV0E 4YB5A 3S9NC 2B3FA 1B6HA 1MQHA 3MZ9A 2I3VA 4PETA 3RLFE 3FUZA 1P1NA 3K02A 2F8DA 4HW8A 2VHAA 3OMBA 1MQIA 3IK6B 4M1VA 4DE8A 4BDOA 5ICTA 4PFTA 4YB6A 5DEXB 4KCCA 1LAFE 4JBZA 3LSXA 3H6VA 3D4CA 3G3GA 4R9GA 3OENA 3C9HA 2Z8DA 3Q26A 5DT6A 3T9HB 4BDMA 4F22A 4F39A 5ISUA 1CB6A 1FTJA 2LAOA 3W15C 1B3EA 2IEEA 2F6GA 1FQCA 5EHSA 1NNPA 2HZLA 4HS7A 4H65A 2XD3A 1MPBA 1B7ZA 4XKPA 4YAHX 1II5A 3T93B 4OXVA 3VFJA 1QW0A 1R1NA 3MVYA 3N6TA 3S2VA 4NWDA 1IZ1A 1MM7A 4EDPA 3CSGA 4LP2B 2XXHA 3KN3A 2AYSA 2H5YA 3B6WA 1POY1 2PYYA 4DCYA 1P1OA 2H98A 2Q89A 2VP1A 1ZIUA 4FEDA 1MXWA 3E9XA 2QJEA 2D3IA 3M3FA 1PB9A 3LSFB 5CMBA 3PD9A 4RJZA 2I49A 2D21A 3TPAA 2V84A 1MY2A 3BKIB 5I58B 2O51A 5I2NA 5ICQA 4ZEKA 2F7CA 5TPAA 1UIVA 1IXGA 3DLNA 5DVIA 3LUYA 3FGSA 2FA7A 1B0HA 3RTWB 3K0VA 4ZEDA 4BDNA 2Y7WA 1BLFA 3N6UA 4GQOA 1B51A 1B5JA 3MZBA 4MFIA 3TMGA 5BUUA 4R74A 4ZEBA 1QULA 2GFEA 2VD2A 4Q8RA 4HTGA 1Z7ME 5L9OA 4OFOA 1HSJA 1ATGA 1S9TA 1PDAA 5AA3A 3TAJA 2HAVA 3SDFA 2O7IA 5H8HB 5CRYA 4X1BA 1KWHA 3R7XA 1AIVA 1GTKA 1H44A 4H1XA 5HPQA 4H67A 4JXIA 4NF4A 2ALUA 3SEUA 3ZS6A 3DELB 1FCKA 4F29A 3QUJA 4BDQA 4R6HA 1YPNA 1ZTYA 3PUXE 4O3BA 3BBRA 3G3IA 5LOMA 1J1NA 3U93A 2ABHA 4KHZE 3QXMA 2UVGA 3RGYA 4JB7A 3SEVA 1FQFA 2P1SA 3MZ1A 1BP5A 1B46A 1XHYA 1Y1MA 4IO3A 2RF1A 4ELOA 1NMUA 1SVXB 3ODBA 4NTLA 1WODA 2H99A 3OOAA 1A40A 1JEVA 1P1QA 1OVTA 4O3CA 4QFPA 4YKPA 4G77A 1MH3A 1PBPA 2AL5A 5H8NB 1B4HA 4AQ4A 1XVYA 3C33A 3TKDA 1FQAA 3TODA 3PU5A 3H7MA 3H6WA 1R9LA 3JYRA 3VV5A 1ZLQA 4HCWA 4N6PA 1Y3QA 4NEDA 1A8EA 1LSTA 1FTMA 1MQDA 3MWBA 1QKBA 4LONB 1LAXA 1R6ZA 1MY1A 2H9BA 5I2KB 1DOTA 5K2XA 1VFEA 3OO9A 1IIWA 1USYH 2B3BA 4X9TA 4H8JA 3TYHA 3U1OA 3USDA 5BWJA 2DP8A 2HEUA 1QVSA 3S9LC 4M4GA 1MM6A 1B58A 2AIXA 4IO6A 4DDDA 3QIMA 3MJNA 3DP8A 2Y7PA 4G68C 5FHNA 1L5TA 4KFQA 2PBWA 2XXQA 4ZE9A 1SD3A 1POTA 2F6PA 1MQGA 5JTYA 1Y9UA 1BTJA 4RPOA 3TQWA 2X26A 4LZ5A 5M2VA 4NF4B 4U1ZA 2RINA 4FEBA 4GL0A 1USYE 3C4MA 5I56B 5I57B 3UGWA 3L6GA 3KSJA 3CG1A 5HM4B 2O68A 2WKYA 3MP1A 4KR5A 4F3GA 5JK4A 2V3TA 3BFTA 4YICA 5I57A 3RTFB 2XXRA 4PFWA 5B7DA 1JVYA 4ND9A 4OZ9A 1OLCA 3KG2A 3EF7A 4DXCA 3FXQA 4EQ7A 4GL8A 4P0GA 3FVKA 2DWAA 4OWDA 4QSDA 3MVXA 1TT1A 3OEMA 4DXBA 1Y3PA 2V3QA 1O7TA 1NL5A 4L17A 3RT6B 1SBPA 1EZPA 4O3AA 2QPQA 4YZZA 3I3VA 3R26A 4KCDA 5H8QB 4QHQA 1VR5A 4IY5A 3EQ1A 4GFRA 4H5FA 1IUDA 1HSEA 4C1TA 4R72A 5A5XA 3E4RA 3UP9A 2XXUA 3C32A 2O69A 3N26A 5KDTA 3LSLA 1N04A 4GXSB 4TQUQ 1SYIA 1PEBA 3O6HA 4IY6A 4FATA 1A55A 1A8FA 1NH8A 1URDA 4Z7EA 3THIA 3HPIA 4K3FA 5I2KA 3U8QA 2XXXA 4XIGQ 2DE3A 4R6YA 2UVJA 3HSTA 3O2AA 3PGFA 3K00A 3KOTA 1NNKA 5FHMA 5DVJA 4BLAA 5AA2D 2AL4A 1D9VA 2I48A 3SKPA 4YKJA 1LB8A 1MDP1 4EUOA 3Q25A 1N84A 1M5CA 3VDFA 1OQHA 3FJ7A 4PFUA 2I4BA 3UN6A 1GGGA 2Q9TA 1YCJA 1WDNA 5CMCA 2ZYMA 4BDLA 3FVNA 4WKMA 5L9MA 4FIMA 3H6TA 3TCHA 3UA8A 1LBCA 3Q27A 4RPNA 5AA2A 1EZ9A 3K6XA 1T0KA 5J1DA 3S4UA 5I56A 1B2HA 3HHFA 3WAFA 3BFUA 5TU0A 1Y20A 3S9EA 4GD5A 3CRBA 2ONKE 3ECRA 2ESNA 3O97A 4MLQA 3T96B 2R9JA 2QRYA 2HZKA 1NNTA 1MY4A 4G8HA 4X1DA 3KSXA 3A3UA 1P1WA 3KOSA 1SW1A 2HQ0A 2XXYA 4YMAA 1ZKBA 3FV2A 3IO4A 1H45A 1MPCA 1NFTA 2UYFA 4Q5TA 1B0LA 3B6QA 3PUZE 2NOOA 5H8SA 4ZEFA 4PP0A 4OEVA 3MAMA 1H43A 4ISUA 4YKKA 2FYIA 1US5A 2FNCA 3H03A 4XKRA 3TTKA 4NF6A 3TFLA 1OMPA 4F3BA 1LLSA 3IAZA 1UTBB 4GWOA 4DIGA 3ONMA 2XXWA 4QSCA 2F7AA 1I6QA 1YAEA 3C36A 3E3KA 3F11A 4OHNA 5TP9B 1MG1A 3EHTA 1XVXA 3O29A 4G68B 1MPDA 4F3PA 1DTGA 3IOUA 3IORA 4G68A 4U22A 5TPAB 2OZZA 3DM0A 3OEKA 4NWCA 3T66A 2V93A 4F18A 2DVZA 2D5WA 4Q0CA 1MDQA 3FIRA 1BIYA 4QFLA 1VFDA 1EZOA 1B3HA 4I62A 4LZ8A 2HXWA 4LA9A 5EHMA 3T9VA 4NF6B 5K2YA 2OK2A 3CI8A 4JWXA 4BDRA 1PB7A 1XOCA 4ELQA 2NXOA 2DVCA 1AH5A 3Q28A 1B52A 4LVQA 3S9MC 1MY0A 2ZXTA 4DCXA 1UIUA 4RK9A 1B3FA 2O84X 3KJ7A 2DOJA 3TUSA 1IXCA 3PMWA 3QYTA 4IO4A 1MY3A 4GIZA 2M8CA 3M3LA 4OESA 4F3SA 4UA8A 5ITPA 2QSXA 3L6HA 4JWYA 3O28A 3HCQA 3OSQA 3HN0A 2ZYOA 3T22A 1DPPA 5H8HA 4ESXA 2BJJX 2E0SA 3CIJA 4LQ2A 4N07A 1OVBA 3MUQA 4H6DA 4OEUA 4EF2A 4R9FA 4PFYA 3FJGA 4F1YA 2Y84A 5ELVA 1VE4A 3CFZA 4QFKA 3TTLA 3LR1A 4X48A 2Q2CA 3EHSA 2XX9A 4R6KA 3IOVA 2Y7RA 3RT8A 4ONYA 1AOVA 1FQDA 1Y4CA 2V3UA 3HHGA 1AMFA 4KI0E 4PQJA 3ILUB 2XXIA 1JW4A 4FE8A 1FTKA 4OYVA 3PUYE 1ZJLA 1LAGE 2W7YA 2XX8A 1LFHA 2OJTA 2Q88A 3MQ9A 5AA1A 5AE4A 3K6UA 4R2BA 5KZTA 2DYXA 3PUVE 2DXYA 2QS1A 4ELPA 1FQEA 5KDTB 2I0BA 2P0SA 4OQOA 3FVOA 4EQBA 3TTMA 3VLUA 5CC2A 1MQJA 2X7PA 2O1LA 4OTEA 2Q8JA 3SEWA 4JDFA 3TELA 3M3KA 1SYHA 2XXTA 3EHUA 1B05A 4QFNA 4RNSA 4TLMB 5H8FB 1B1XA 2DS9A 4R75A 3RY3A 2HCAA 1FTLA 1RYXA 3KGCA 4OFJA 1SQYA 1TXFA 2DSFA 1XS5A 2DE4A 3KZGA 4OFLA 5TP9A 3FVGA 3KFMA 4GXAA 4ZECA 1SI1A 2A5SA 1UTBA 2G29A 4TLLB 3EN3A 3LC8A 3ZKKA 4ESWA 4KYEA 1DTZA 3C35A 3PD8A 3C31A 4P0IA 4ZS9A 4WEPA 3TCFA 3MW0A 4F19A 3IJOB 1GVCA 5L8DA 4ZZEA 1ZBMA 1DMBA 1EU8A 3IL1B 1MXXA 1B40A 1N76A 3I6VA 3K2DA 5CMMA 4IGTA 5JTYB 2PT1A 1TWYA 3H4ZA 3QAXA 4P11A 1D9YA 1I6BA 4FJPA 1DSNA 2CMOA 2I3WA 1M5DA 3ILTB 1MXVA 3JZJA 3TCGA 1UTHA 3CSBA 3V5AA 3FXRA 3D4GA 5CI5A 1I69A 1MH4A 3EPEA 1RYOA 3MP6A 1JQFA 4TOZA 2RC9A 3HO7A 3K01A 4H0WA 3JV9A 3O6IA 5B70A 3SETA 4NF8A 3FJMA 4NE4A 5AA4A 2RC8A 5EYFA 3RN8A 1LFGA 2VD3A 3R6UA 3IR1A 1MXZA 3TEPA 1ZU0A 2DE2A 4U2RA 1M5BA 1NKXA 2Z22A 2GH9A 1ANFA 3O66A 1SDXA 2F78A 2QL3A 3A3CA 4KYDA 5ITOA 3VVFA 3LSWA 2PMSA 4ZDMA 3QK6A 5L9SA 3RNNA 2A5TA 4RYAA 2YLNA 4NF5B 3W9VA 5AA4B 1IITA 3G3JA 5HBCA 3V89B 3IB1A 3KN7A 4XTCQ 3PMXA 4DLDA 4C0RA 5I84A 2HFBA 2XXPA 1JW5A 4XXUA 4YB7A 1MRPA 1S7YA 1LCFA 3A09A 5KCJB 4JSOA 1HSLA 3GXAA 3WAEA 2R6GE 1IXIA 4F31B 3FASA 1A99A 4N13A 2GHBA 3B7DA 1O64A 1AL3A 4THIA 3VLVA 3T9UA 1Y4TA 3G3HA 3IJXB 3OO7A 3TTRA 2THIA 1B5HA 1SI0A 2Z8EA 2XX7A 1QJMA 4GOTA 2PT2A 4JSDA 3G7WA 4G8NA 1B3GA 4RY1A 4DZ1A 2XHDA 3IO6A 3RQTA 2O1MA 5KCJA 4E0WA 1I6AA 4I1DA 3QUFA 2UYEA 2P2AA 3PMVA 4U1OA 2NUVA 5F7VA 4Z0IA 4IO2A 3PUWE 3OO6A 5F1QA 4HCYA 3T9XB 4NF5A 1IEJA 1B9JA 2OWSA 4OVJA 5FHOA 3W9WA 2O7UA 3KJTA 4IO7A 4LZ7A 3M8UA 2H25A 3N5LA 1VSOA 3IB2A 3RUMA 4RK2A 2F35A 3KEIA 2Q2AA 3FD3A 5DTBA 1B4ZA 2QS3A 4R73A 3ZKLA 3E13X 3VXCA 5H8FA 1US4A 1SW5A 2Z8FA 3PPPA 4OENA 3OELA 3IX1A 1JETA 1MXYA 3G3FA 2F5XA 3LBSA 3H6UA 3SEYA 5FTIA 2V25A 1F9BA 2B65A 2UVHA 4U4SA 1PC3A 2VGQA 3K1PA 3KN8A 1DPEA 1N7WA 1Q35A 2QS4A 2RCAA 4WXJA 3ZSFA 1LGBC 1NNFA 3O6GA 4H8IA 1LBBA 1M5FA 3VE1B 4F1VA 2ZYNA 3DP4A 4LQ5A 2Y7KA 1B3LA 5H8QA 2NVUB 1UTHB 3UIFA 4EF1A 1H76A 4EQ9A 4EXLA 3TZAA 2GRVA 2IA4A 4KD5A 1GV8A 4U23A 1GR2A 1FTOA 2REGA 1IQ7A 5H8NA 1R9QA 2NWJA 1ELJA 1B7UA 2RKMA 4G4PA 4OMBA 3IB0A 4IGRA 1H3DA 1ZMGA 1QKAA 3Q29A 4F2QA 2Z23A 5DEXA 1SW2A 2DWHA 3CR9A 3MPKA 4R2FA 3K6VA 1PBQA 2X7QA 4GF8A 3GBAA 2ZNSA 4PE5B 2OCUA 3OSRA 4MLVA 3MBPA 4QFOA 3MVWA 1O63A 3AXFA 4NMYA 1A54A 3PPOA 2OBGA 4KQPA 4LATA 4QSEA 3HV1A 1Y3NA 3VXBA 3SEXA 2OLBA 4FAJA 2REJA 3U94A 1JVXA 1OIBA 5JEIA 3V83A 3OXNA 1Q1KA 2F36A 4G2ZA 3RPWA 4POWA 5FTHA 3IOWA 2DQVA 1D3KA 2F97A 4U21A 4G8MA 3TTNA 3IOTA 4ECFA 4OERA 1A7LA 2O6AA 3MC2A 4GRKA 1M5EA 3K6WA 4F1UA 1QUIA 3H06B 3SERA 1LCTA 1OLAA 1N7XA 1B5IA 2A5TB 4FORA 2G93A 4YU0A 2DXRA 1B7HA 3K4UA 2ZMBA 3DP6A 3GLBA 2XD2A 1N0TA 3KBRA 4QRZA 4QF9A 5I59A 1NH7A 3PPQA 2I58A 3U72A 2I6EA 4MF3A 4RXLA 1P1UA 2F7BA 4LUBA 5I58A 4Q30B 4UACA 5CBRA 2I4CA 3VLWA 1MXUA 2ZNUA 4GLIA 1QUKA 2UVIA 3N94A 4KPTA 2YPNA 1BKAA 1JW1A 2PX1A 2I0CA 3U92A 1LAHE 3H3GA 3VVEA 2RC7A 1URGA 4H5GA 2H4IA 1UQWA 4WEDA 3SESA 4EXKA 3FV1A 1JNFA 4POXA 4ZEIA 1JEUA 2RCBA 4I9DA 4IO5A 4XKNA 3V8XB 1OQGA 4F2OA 3FZVA 2DWJA 2PVUA 4MH5A 3CG3A 4E0XA 3TQLA 4OETA 2QMXA 1MS7A 2ZYKA 2Y7IA 3CFLA 3K1NA 3VVDA 1EH3A 2QMWA 5DVFA 1LB9A 1D4NA 1S50A 5AA2B 5CM6A 2ANJA 3G3KA 3PPRA 3GBBA 4IB2A 4ZE8A 1CE2A 4U4XA 2CZLA 1Z7NE 2YJPA 4RA1A 2KLFA 5IAIA 1B32A 3QSLA 1Y1ZA 3UK4A 2XXVA 3FATA 3MPLA 1XC1A 1URSA 5CBSA 3FXUA 4AB5A 4I8CA 4YMBA 1FW0A 3TDJA 2HAUA 3P7IA 2F34A 4FECA 1SW4A 4C1UA 1PB8A 4GVOA 3CVGA 1QUJA 5I2NB 5I59B 4XKQA 1WVJA 2VOZA 3I5OA 3MVZA 3OD7A 2DWIA 1IXHA 5CMKA 4AB6A 2UXAA 1N3XA 1LFIA 1N3WA 2QS2A 2ZNTA 3CFXA 3UORA 4DXUA 4NF8B 5IKBA 1RKMA 4ZZAA 5A5XB 1FQBA 4MBPA 4JWOA 1B1HA 5DYHA 2OWTA 4YKIA 1TFDA 4KYSA 4ELRA 1YTVA 2E1SA 1TFAA 3OO8A 2R71A 3C34A
chains in the Genus database with same CATH superfamily
2ONRA 3PV0E 4YB5A 3S9NC 1AWBA 2B3FA 3RLFE 2FVZA 3OMBA 3IK6B 4M1VA 4PFTA 1LAFE 3U65A 3A29A 4R9GA 5DT6A 3OENA 3C9HA 4F39A 5ISUA 5EHSA 2HZLA 4HS7A 2XD3A 1MPBA 4XKPA 4YAHX 3T93B 1II5A 4OXVA 3VFJA 1QW0A 3N6TA 3KN3A 1POY1 4DCYA 1P1OA 2Q89A 3IFAA 1G0HA 3E9XA 4RJZA 2V84A 3BKIB 4PGPA 4ZEKA 1FBHA 5DVIA 1IXGA 1B0HA 4ZEDA 4MFIA 1FBCA 4R74A 1QULA 4HTGA 4PC9A 4X1BA 1NV3A 4PTKA 4X8RA 3SEUA 1FCKA 1YPNA 1ZTYA 1J1NA 4KHZE 2WX9A 4JB7A 4N8YA 1XHYA 2HHMA 4P47A 1NMUA 1SVXB 4NTLA 1WODA 1INPA 4G77A 1MH3A 1B4HA 3C33A 3H7MA 3JYRA 4HCWA 1Y3QA 1LAXA 5I2KB 5K2XA 5BWJA 2B3BA 3USDA 4H8JA 2AIXA 3MJNA 4G68C 5FHNA 5JTYA 4LZ5A 4NF4B 4FEBA 1USYE 4F3GA 1NV2A 3RTFB 1JVYA 4OZ9A 1OLCA 3FXQA 2DWAA 4QSDA 1LBWA 3ISPA 4L17A 3RT6B 3KC1A 3R26A 1IUDA 4C1TA 2O69A 4NN3A 1SYIA 1PEBA 3O6HA 4FATA 1A55A 1A8FA 5I2KA 4R6YA 3KOTA 1NNKA 5FHMA 5DVJA 5AA2D 1D9VA 4EUOA 3VDFA 3FJ7A 1GGGA 4PAFA 2ZYMA 4BDLA 4WKMA 3K6XA 5J1DA 5I56A 1B2HA 3HHFA 3WAFA 2B4LA 3O97A 4GWUA 1NNTA 3KOSA 1SW1A 2XXYA 1EYKA 3PUZE 4PP0A 3EKIA 2FYIA 1US5A 4NF6A 3TFLA 3QMFA 2FIEA 4QSCA 1I6QA 1YAEA 4JVCA 2OZZA 3DM0A 4NWCA 1MDQA 3FIRA 1VFDA 1B3HA 4I62A 4LZ8A 5EHMA 4LA9A 4NF6B 5K2YA 4GX6A 3ROJA 1YYZA 2DVCA 2O84X 3KJ7A 3TUSA 4OESA 2CEXA 3L6HA 3HCQA 4MIJA 1OVBA 3KC0A 4EF2A 3CHGA 4X48A 2Q2CA 2Y7RA 4KI0E 3ILUB 4FE8A 2XX8A 1LFHA 3MQ9A 4R2BA 3PUVE 2DXYA 1CNQA 1QGXA 2P0SA 4OQOA 3FVOA 3TTMA 4OTEA 2XXTA 2JJKA 1B05A 3RY3A 2HCAA 1RYXA 1SQYA 2DE4A 4N4UA 1XS5A 4N91A 2A5SA 1UTBA 3TCFA 3IJOB 1NV1A 1DMBA 3IL1B 1MXXA 1B40A 1N76A 3I6VA 3K2DA 5CMMA 4IGTA 5JTYB 1TWYA 4P11A 4FJPA 2I3WA 3TCGA 1MXVA 2CZKA 1NI9A 1MH4A 1RYOA 3MP6A 1JQFA 5F24A 3K01A 3JV9A 4NF8A 5AA4A 1JP4A 3R6UA 4NHBA 2DE2A 4U2RA 2GH9A 4IR8A 1SDXA 5ITOA 2QL3A 3LSWA 4ZDMA 2YLNA 5EYGA 3IB1A 4O7MA 4MNIA 3WAEA 1IXIA 5EQ9A 1A99A 2GHBA 3B7DA 4THIA 1AL3A 3IJXB 3E79A 3OO7A 4PGNA 2XX7A 4GOTA 4JSDA 2PT2A 3G7WA 4G8NA 1B3GA 5KCJA 2OX3A 4E0WA 1I6AA 2OWSA 3W9WA 3M8UA 1VSOA 5DTBA 1US4A 3PPPA 1MXYA 3H6UA 2ZZXA 2VT5A 3KN8A 2RCAA 1LGBC 1NNFA 3O6GA 4F1VA 5H8QA 2NVUB 4N81A 4KD5A 2KR0A 5H8NA 1D9QA 1ELJA 1B7UA 4IGRA 1H3DA 3Q29A 2Z23A 1SW2A 2DWHA 3CR9A 3MVWA 4NMYA 1A54A 2WYKA 4FAJA 2OLBA 3U94A 5JEIA 3V83A 3OXNA 4GWWA 2F97A 2PCRA 4F1UA 1QUIA 3H06B 1OLAA 4YU0A 2G93A 3T0JA 1Q9DA 3K4UA 3PPQA 4OVTA 1P1UA 2F7BA 4Q30B 3VLWA 1QUKA 2PX1A 1LAHE 3VVEA 4H5GA 3SESA 3FV1A 4POXA 1JEUA 2RCBA 4I9DA 4N6KA 4F2OA 3FZVA 4GBWA 3CG3A 2ZYKA 2Y7IA 3PPRA 1CE2A 2YJPA 1Y1ZA 1XC1A 5CBSA 4MAGA 4I8CA 3P7IA 4XKQA 2VOZA 2QVUA 5IZ1A 1LFIA 2ZNTA 4JWOA 1B1HA 5DYHA 1AOVA 1IMCA 3C34A 2ONSA 3B8BA 1XT8A 3MP8A 4PCDA 1P1NA 3K02A 2VHAA 4KXPA 1MQIA 5DW8A 4KCCA 4JBZA 3D4CA 3G3GA 1FBDA 3W15C 2FBPA 1FQCA 2ZZWA 2HPGA 4P1LA 3MVYA 4LP2B 2PYYA 2H98A 4FEDA 2D3IA 5ESYA 5I58B 3LUYA 2FA7A 4OA4A 3RTWB 3K0VA 1LBVA 2Y7WA 3MZBA 2GFEA 1Z7ME 4OFOA 1HSJA 1S9TA 5AA3A 3TAJA 4XEQA 4AS5A 1AIVA 5HPQA 4I3EA 2ALUA 3QUJA 4BDQA 4I40A 3BIHA 3SEVA 4MX6A 3MZ1A 2XWKA 1B46A 1FPEA 1Y1MA 2RF1A 4ELOA 5H8SA 1OVTA 3TKDA 3BIGA 5LTCA 3VV5A 1ZLQA 4N6PA 4NEDA 1A8EA 1R6ZA 1MY1A 2H9BA 4X9TA 3TYHA 1IIWA 2CZIA 2CZHA 1QVSA 4M4GA 3QIMA 3DP8A 2Y7PA 1EYIA 1L5TA 2MKZA 2F6PA 1BTJA 4RPOA 2X26A 1FBPA 3C4MA 4GWXA 3KSJA 5JK4A 4YICA 5CMKA 2XXRA 4DXCA 3MVXA 4DXBA 1Y3PA 2V3QA 4AS4A 1NL5A 1EZPA 4OVPA 5H8QB 1VR5A 4GFRA 5A5XA 3E4RA 2XXUA 3N26A 4IY6A 4PAKA 4Z7EA 3HSTA 3O2AA 3K00A 3E78A 4YKJA 1MDP1 3Q25A 1OQHA 3UN6A 2Q9TA 1WDNA 3UA8A 1LBCA 3Q27A 4RPNA 2V4CA 4NQ8A 3S9EA 3CRBA 4MLQA 3T96B 2QRYA 3KSXA 1P1WA 1DBZA 3FV2A 3IO4A 1B0LA 4ZEFA 4OEVA 3MAMA 3H03A 2FNCA 4F3BA 4GWOA 3ONMA 3F11A 3C36A 3EHTA 1XVXA 3O29A 4G68B 2V93A 2CEYA 2OK2A 3CI8A 4BDRA 4OANA 1XOCA 2NXOA 1YZ0A 3S9MC 4DCXA 1UIUA 4UA8A 4DI3D 3OSQA 2DDKA 1FPKA 3T22A 1DPPA 5H8HA 4HXVA 1LBYA 4ESXA 2BJJX 2E0SA 5I5PA 2WEFA 4NX1A 3TTLA 3LR1A 2XX9A 1Y4CA 2V3UA 1AMFA 4PQJA 2XXIA 3PUYE 1LAGE 5AE4A 3K6UA 2DYXA 4EQBA 2XWIA 2QVVA 2X7PA 2O1LA 2Q8JA 3SEWA 4JDFA 4QFNA 5H8FB 2DS9A 1FTLA 3KZGA 2DSFA 4ZECA 3KFMA 4GXAA 2G29A 3EN3A 4P0IA 4WEPA 5IZZA 4NGUA 1EU8A 4N6DA 4XXUA 3ILTB 4LN5A 3CSBA 3O6IA 3SETA 4NE4A 2RC8A 2VD3A 3TEPA 4NF0A 1M5BA 1NKXA 3QK6A 3RNNA 2A5TA 4JVIA 4PF8A 2OWZA 1IITA 5HBCA 4MCOA 4MJOA 3KN7A 3PMXA 2HFBA 2XXPA 1JW5A 5KCJB 1HSLA 4F31B 3TTRA 2THIA 1SI0A 3IO6A 2NUVA 3PUWE 4PE3A 3T9XB 3KJTA 4IO7A 4LZ7A 2H25A 3KEIA 1FPDA 5H8FA 3ZKLA 2QS3A 3VXCA 1SW5A 2Z8FA 3OELA 1JETA 2F5XA 1PC3A 1DPEA 1KA0A 2XWOA 4H8IA 2ZYNA 2P3NA 2Y7KA 4EQ9A 3UIFA 4EF1A 1H76A 4P9KA 2FIXA 5IZ3A 2GRVA 1GV8A 1NV7A 2VPOA 5FBPA 4GX3A 1QKAA 4F2QA 5DEXA 3MPKA 3K6VA 1PBQA 2X7QA 4GF8A 4QFOA 4MLVA 3MBPA 4KQPA 4LATA 4QSEA 3HV1A 3VXBA 2REJA 1JVXA 1FRPA 1Q1KA 5IM2A 4OERA 1A7LA 2O6AA 3SERA 5T3JA 2XXKA 1B5IA 4FORA 1B7HA 2ZMBA 2XD2A 3KBRA 4QRZA 4QF9A 5I3SA 1NV5A 5I58A 4UACA 5CBRA 2I4CA 2ZNUA 4GLIA 4PFBA 3U92A 3H3GA 3LV0A 1RDZA 2DWJA 3K1NA 2KQZA 3G3KA 3NOHA 3GBBA 4IB2A 4P1EA 4ZE8A 2FHYA 4U4XA 2XXVA 3FATA 1FW0A 4MHFA 4FECA 4C1UA 1PB8A 1DK4A 1QUJA 5I59B 1YXIA 1FTAA 4AB6A 2UXAA 1N3WA 3UORA 4O8MA 5A5XB 4YKIA 1TFDA 2E1SA 1LCFA 4OFJA 3OO8A 3B6TA 2GHAA 3PPNA 4PETA 3FUZA 4HW8A 4O94A 4BDMA 2Z8DA 3T9HB 4F22A 1XI6A 1CB6A 1FTJA 2LAOA 2IEEA 1NNPA 2BJIA 1IMFA 1R1NA 4NWDA 1IZ1A 1MM7A 4EDPA 2XXHA 3B6WA 2VP1A 1IMAA 1NUYA 2QJEA 3M3FA 4N17A 1PB9A 3LSFB 2I49A 5ICQA 2F7CA 5TPAA 3DLNA 3FGSA 4XF5A 1FBGA 1IMBA 4BDNA 3N6UA 4GQOA 1B5JA 4UABA 4ZEBA 4PBQA 1PDAA 3SDFA 2O7IA 5H8HB 2VPNA 1GTKA 4H1XA 4JXIA 4NF4A 3ZS6A 3DELB 4F29A 3BBRA 3G3IA 3U93A 2HXRA 3QXMA 4HE2A 2P1SA 4PDDA 3ODBA 3OOAA 1P1QA 4O3CA 4QFPA 1PBPA 5H8NB 1XVYA 1LSTA 1FTMA 1MQDA 4LONB 4DDDA 1VFEA 1FJ6A 3U1OA 1MM6A 4ZE9A 1SD3A 1Y9UA 3TQWA 2RINA 5I57B 3L6GA 5HM4B 3CG1A 2O68A 3MP1A 4KR5A 3BFTA 4OVQA 5I57A 5B7DA 3KG2A 3EF7A 4GL8A 4P0GA 3FVKA 4OWDA 3IFCA 1O7TA 1SBPA 4O3AA 2QPQA 4YZZA 4KCDA 5J16A 4IY5A 3EQ1A 4P56A 1HSEA 4R72A 5KDTA 3UP9A 3C32A 4GXSB 4TQUQ 1URDA 3THIA 4K3FA 3U8QA 4XIGQ 2UVJA 3PGFA 1NV4A 1FPFA 4PFUA 2I4BA 5CMCA 3FVNA 5L9MA 4FIMA 3H6TA 3TCHA 1EZ9A 1T0KA 3S4UA 3RYDA 5TU0A 1K9YA 1MY4A 4X1DA 2HQ0A 1ZKBA 4Q5TA 2L5VA 4ISUA 4YKKA 4XKRA 2ZZVA 1LLSA 3IAZA 1UTBB 4DIGA 4I3YA 2F7AA 4OHNA 1MG1A 1MPDA 4F3PA 3IORA 3IOUA 4U22A 5TPAB 3OEKA 3T66A 1EZOA 1BIYA 4QFLA 4PBHA 3T9VA 4JWXA 1PB7A 2WYPA 4ELQA 3Q28A 1B52A 4LVQA 2ZXTA 1IXCA 3QYTA 4IO4A 2WBBA 2QSXA 3O28A 3HN0A 2ZYOA 4LQ2A 3MUQA 4JVDA 4PFYA 5ELVA 1VE4A 3CFZA 4QFKA 2PFZA 4R6KA 4GX4A 4GWZA 1LEVA 4G61A 1JW4A 1FTKA 4OYVA 1ZJLA 2W7YA 2Q88A 2B4MA 5KDTB 2QS1A 4ELPA 1FQEA 5CC2A 1MQJA 3S9LC 3M3KA 3EHUA 1LBZA 4TLMB 1B1XA 4R75A 3KGCA 3TMGA 4OFLA 4TLLB 3LC8A 3ZKKA 4KYEA 1DTZA 3PD8A 4MNPA 4ZS9A 4F19A 3MW0A 4ZZEA 1FSAA 2PT1A 4AB5A 1I6BA 2CMOA 1M5DA 3JZJA 3V5AA 1UTHA 3D4GA 5CI5A 1I69A 4TOZA 2RC9A 3FJMA 5EYFA 3RN8A 1LFGA 3IR1A 2Z22A 3O66A 4KYDA 3VVFA 5L9SA 2Q74A 3W9VA 5AA4B 3G3JA 4XTCQ 4DLDA 4C0RA 5I84A 4YB7A 1S7YA 2Y5KA 3GXAA 3FASA 4N13A 3VLVA 3T9UA 1B5HA 2Z8EA 1QJMA 4DZ1A 2XHDA 2O1MA 4I1DA 3QUFA 5F7VA 3PMVA 4Z0IA 4P3LA 4IO2A 5F1QA 4NF5A 1IEJA 3LUZA 1FBEA 2F35A 1B4ZA 4MNCA 4OENA 3G3FA 3LBSA 1F9BA 2B65A 3K1PA 4WXJA 1Q35A 2QS4A 1LBBA 1SPIA 3DP4A 4LQ5A 1FBFA 4EXLA 2IA4A 1GR2A 2REGA 1IQ7A 4G4PA 1NUZA 1ZMGA 4R2FA 4PE5B 3GBAA 3OSRA 3PPOA 2F36A 4G2ZA 4POWA 5FTHA 2DQVA 1D3KA 4U21A 3IOTA 1M5EA 2A5TB 2DXRA 3DP6A 3GLBA 5I59A 3U72A 2I58A 4MF3A 2UVIA 3N94A 4KPTA 2YPNA 1BKAA 2I0CA 1URGA 2H4IA 1UQWA 4WEDA 1JNFA 4ZEIA 2PVUA 4E0XA 4OVSA 5LDZA 3MYUA 1EH3A 4GWSA 5CM6A 4RA1A 2KLFA 5IAIA 1B32A 3QSLA 1EYJA 3MPLA 1URSA 4XFEA 2F34A 4GVOA 1RDXA 5I2NB 3T1BA 1WVJA 3OD7A 1N3XA 2QS2A 1FPIA 2PFYA 4DXUA 5IKBA 4NF8B 1BK4A 4ZZAA 1FQBA 4MBPA 1YTVA 5CMBA 1TFAA 2R71A 3GZGA 3O9PA 1P99A 3K1MA 3MZ9A 1B6HA 1MQHA 4OVRA 2I3VA 2F8DA 4DE8A 4BDOA 1IMDA 5ICTA 4YB6A 5DEXB 3FBPA 1KZ8A 3LSXA 3H6VA 2XA5A 3Q26A 1B3EA 2F6GA 5IZ3B 4H65A 1B7ZA 3S2VA 4H45A 3CSGA 2AYSA 2H5YA 5EQ8A 1ZIUA 1MXWA 4ELRA 3TPAA 3PD9A 2D21A 1MY2A 2O51A 5I2NA 1UIVA 1BLFA 1B51A 5BUUA 2VD2A 4Q8RA 5L9OA 1ATGA 2HAVA 5CRYA 1KWHA 2QVRA 3R7XA 1H44A 5ET8A 4H67A 4PAIA 4R6HA 4O3BA 3PUXE 5LOMA 2ABHA 2UVGA 3RGYA 1FQFA 1BP5A 2QFLA 4IO3A 2H99A 4YKPA 1A40A 1JEVA 2AL5A 4AQ4A 1FQAA 3TODA 3PU5A 3MSTA 3H6WA 1R9LA 3MWBA 1QKBA 2R8TA 3SZPA 1DOTA 3OO9A 1USYH 4X04A 2DP8A 2HEUA 1G0IA 1B58A 4IO6A 4KFQA 2PBWA 2XXQA 1POTA 1MQGA 5M2VA 4U1ZA 4GL0A 5I56B 3UGWA 2WKYA 2V3TA 1NV6A 3FXBA 4PFWA 4ND9A 4EQ7A 1KA1A 1TT1A 3OEMA 4O7IA 3I3VA 4H46A 4QHQA 5EQAA 4H5FA 3LSLA 1N04A 1NH8A 3HPIA 4QXDA 2XXXA 2DE3A 4BLAA 2AL4A 4P8BA 2I48A 3SKPA 1LB8A 1N84A 1M5CA 1DCUA 1YCJA 5AA2A 3BFUA 1Y20A 3PTYA 4GD5A 2ONKE 3ECRA 2ESNA 4PFRA 2R9JA 5ET6A 2HZKA 4G8HA 3A3UA 1FPJA 4YMAA 1H45A 1MPCA 1NFTA 2UYFA 3B6QA 2NOOA 1H43A 3TTKA 3RPLA 2Q8MA 1OMPA 2XXWA 4N15A 3E3KA 5TP9B 1DTGA 4N8GA 4G68A 4F18A 2DVZA 2D5WA 4Q0CA 2HXWA 1AH5A 1MY0A 4RK9A 1B3FA 2DOJA 3PMWA 1MY3A 4MMPA 4GIZA 1FPGA 2F3DA 2M8CA 3M3LA 4F3SA 1NUWA 1IMEA 5ITPA 4JWYA 5EQ7A 3CIJA 4QBAA 4N07A 4H6DA 4OEUA 4R9FA 4F1YA 3FJGA 2Y84A 5IGAA 3EHSA 3IOVA 3RT8A 4ONYA 1FQDA 3HHGA 4NG7A 2OJTA 4PF6A 5AA1A 5KZTA 4NAPA 2I0BA 3VLUA 4DI4B 3TELA 1SYHA 2P3VA 4RNSA 5TP9A 5A5LA 1TXFA 3FVGA 1SI1A 1VDWA 3HFUA 4ESWA 3C35A 3C31A 4HE1A 1GVCA 5L8DA 5ET5A 1ZBMA 3H4ZA 3QAXA 3D1RA 1D9YA 1DSNA 5ET7A 3FXRA 3EPEA 3HO7A 4MEVA 4H0WA 5B70A 1MXZA 1ZU0A 1ANFA 2F78A 3A3CA 2PMSA 1NUXA 4RYAA 4NF5B 3V89B 3GYYA 1MRPA 3A09A 4JSOA 2R6GE 5EYHA 2GQ1A 1O64A 3KBZA 1FPBA 1Y4TA 3G3HA 4RY1A 3RQTA 1LBXA 2UYEA 2P2AA 4U1OA 3OO6A 4HCYA 4OVJA 5FHOA 1B9JA 2O7UA 4HE0A 4GWYA 3N5LA 3IB2A 3RUMA 4RK2A 2Q2AA 3FD3A 4R73A 3E13X 3IX1A 3SEYA 1NV0A 5FTIA 2V25A 2UVHA 4U4SA 2VGQA 1N7WA 1FPLA 3ZSFA 2Y5LA 3VE1B 1M5FA 1B3LA 1UTHB 2XWVA 3TZAA 4U23A 5I7IA 1FTOA 2NWJA 1R9QA 4FBPA 1K9ZA 2RKMA 4OMBA 3IB0A 2ZNSA 2OCUA 1O63A 3AXFA 2OBGA 1Y3NA 3SEXA 1OIBA 4PDHA 3RPWA 3IOWA 4G8MA 3TTNA 4ECFA 3MC2A 4GRKA 3K6WA 1LCTA 1N7XA 1N0TA 1NH7A 2I6EA 4RXLA 4LUBA 1MXUA 1JW1A 3RPLB 2RC7A 4EXKA 3V8XB 4IO5A 4XKNA 1OQGA 4MH5A 3TQLA 4OETA 2QMXA 1MS7A 3VVDA 3CFLA 2QMWA 5DVFA 1LB9A 1D4NA 1S50A 5AA2B 2ANJA 2WBDA 2CZLA 1Z7NE 4PFIA 3UK4A 1RDYA 3FXUA 4YMBA 3TDJA 2HAUA 1SW4A 3CVGA 3MVZA 3I5OA 2F3BA 2DWIA 1IXHA 1FJ9A 3CFXA 3B50A 1RKMA 4GBVA 2OWTA 4KYSA
chains in the Genus database with same CATH topology
3B6TA 3GZGA 3O9PA 2ONSA 2GHAA 3PPNA 1XT8A 1P99A 2ONRA 3K1MA 3MP8A 3PV0E 4YB5A 3S9NC 2B3FA 1B6HA 1MQHA 3MZ9A 2I3VA 4PETA 3RLFE 3FUZA 1P1NA 3K02A 2F8DA 4HW8A 2VHAA 3OMBA 1MQIA 3IK6B 4M1VA 4DE8A 4BDOA 5ICTA 4PFTA 4YB6A 5DEXB 4KCCA 1LAFE 4JBZA 3LSXA 3H6VA 3D4CA 3G3GA 4R9GA 3OENA 3C9HA 2Z8DA 3Q26A 5DT6A 3T9HB 4BDMA 4F22A 4F39A 5ISUA 1CB6A 1FTJA 2LAOA 3W15C 1B3EA 2IEEA 2F6GA 1FQCA 5EHSA 1NNPA 2HZLA 4HS7A 4H65A 2XD3A 1MPBA 1B7ZA 4XKPA 4YAHX 1II5A 3T93B 4OXVA 3VFJA 1QW0A 1R1NA 3MVYA 3N6TA 3S2VA 4NWDA 1IZ1A 1MM7A 4EDPA 3CSGA 4LP2B 2XXHA 3KN3A 2AYSA 2H5YA 3B6WA 1POY1 2PYYA 4DCYA 1P1OA 2H98A 2Q89A 2VP1A 1ZIUA 4FEDA 1MXWA 3E9XA 2QJEA 2D3IA 3M3FA 1PB9A 3LSFB 5CMBA 3PD9A 4RJZA 2I49A 2D21A 3TPAA 2V84A 1MY2A 3BKIB 5I58B 2O51A 5I2NA 5ICQA 4ZEKA 2F7CA 5TPAA 1UIVA 1IXGA 3DLNA 5DVIA 3LUYA 3FGSA 2FA7A 1B0HA 3RTWB 3K0VA 4ZEDA 4BDNA 2Y7WA 1BLFA 3N6UA 4GQOA 1B51A 1B5JA 3MZBA 4MFIA 3TMGA 5BUUA 4R74A 4ZEBA 1QULA 2GFEA 2VD2A 4Q8RA 4HTGA 1Z7ME 5L9OA 4OFOA 1HSJA 1ATGA 1S9TA 1PDAA 5AA3A 3TAJA 2HAVA 3SDFA 2O7IA 5H8HB 5CRYA 4X1BA 1KWHA 3R7XA 1AIVA 1GTKA 1H44A 4H1XA 5HPQA 4H67A 4JXIA 4NF4A 2ALUA 3SEUA 3ZS6A 3DELB 1FCKA 4F29A 3QUJA 4BDQA 4R6HA 1YPNA 1ZTYA 3PUXE 4O3BA 3BBRA 3G3IA 5LOMA 1J1NA 3U93A 2ABHA 4KHZE 3QXMA 2UVGA 3RGYA 4JB7A 3SEVA 1FQFA 2P1SA 3MZ1A 1BP5A 1B46A 1XHYA 1Y1MA 4IO3A 2RF1A 4ELOA 1NMUA 1SVXB 3ODBA 4NTLA 1WODA 2H99A 3OOAA 1A40A 1JEVA 1P1QA 1OVTA 4O3CA 4QFPA 4YKPA 4G77A 1MH3A 1PBPA 2AL5A 5H8NB 1B4HA 4AQ4A 1XVYA 3C33A 3TKDA 1FQAA 3TODA 3PU5A 3H7MA 3H6WA 1R9LA 3JYRA 3VV5A 1ZLQA 4HCWA 4N6PA 1Y3QA 4NEDA 1A8EA 1LSTA 1FTMA 1MQDA 3MWBA 1QKBA 4LONB 1LAXA 1R6ZA 1MY1A 2H9BA 5I2KB 1DOTA 5K2XA 1VFEA 3OO9A 1IIWA 1USYH 2B3BA 4X9TA 4H8JA 3TYHA 3U1OA 3USDA 5BWJA 2DP8A 2HEUA 1QVSA 3S9LC 4M4GA 1MM6A 1B58A 2AIXA 4IO6A 4DDDA 3QIMA 3MJNA 3DP8A 2Y7PA 4G68C 5FHNA 1L5TA 4KFQA 2PBWA 2XXQA 4ZE9A 1SD3A 1POTA 2F6PA 1MQGA 5JTYA 1Y9UA 1BTJA 4RPOA 3TQWA 2X26A 4LZ5A 5M2VA 4NF4B 4U1ZA 2RINA 4FEBA 4GL0A 1USYE 3C4MA 5I56B 5I57B 3UGWA 3L6GA 3KSJA 3CG1A 5HM4B 2O68A 2WKYA 3MP1A 4KR5A 4F3GA 5JK4A 2V3TA 3BFTA 4YICA 5I57A 3RTFB 2XXRA 4PFWA 5B7DA 1JVYA 4ND9A 4OZ9A 1OLCA 3KG2A 3EF7A 4DXCA 3FXQA 4EQ7A 4GL8A 4P0GA 3FVKA 2DWAA 4OWDA 4QSDA 3MVXA 1TT1A 3OEMA 4DXBA 1Y3PA 2V3QA 1O7TA 1NL5A 4L17A 3RT6B 1SBPA 1EZPA 4O3AA 2QPQA 4YZZA 3I3VA 3R26A 4KCDA 5H8QB 4QHQA 1VR5A 4IY5A 3EQ1A 4GFRA 4H5FA 1IUDA 1HSEA 4C1TA 4R72A 5A5XA 3E4RA 3UP9A 2XXUA 3C32A 2O69A 3N26A 5KDTA 3LSLA 1N04A 4GXSB 4TQUQ 1SYIA 1PEBA 3O6HA 4IY6A 4FATA 1A55A 1A8FA 1NH8A 1URDA 4Z7EA 3THIA 3HPIA 4K3FA 5I2KA 3U8QA 2XXXA 4XIGQ 2DE3A 4R6YA 2UVJA 3HSTA 3O2AA 3PGFA 3K00A 3KOTA 1NNKA 5FHMA 5DVJA 4BLAA 5AA2D 2AL4A 1D9VA 2I48A 3SKPA 4YKJA 1LB8A 1MDP1 4EUOA 3Q25A 1N84A 1M5CA 3VDFA 1OQHA 3FJ7A 4PFUA 2I4BA 3UN6A 1GGGA 2Q9TA 1YCJA 1WDNA 5CMCA 2ZYMA 4BDLA 3FVNA 4WKMA 5L9MA 4FIMA 3H6TA 3TCHA 3UA8A 1LBCA 3Q27A 4RPNA 5AA2A 1EZ9A 3K6XA 1T0KA 5J1DA 3S4UA 5I56A 1B2HA 3HHFA 3WAFA 3BFUA 5TU0A 1Y20A 3S9EA 4GD5A 3CRBA 2ONKE 3ECRA 2ESNA 3O97A 4MLQA 3T96B 2R9JA 2QRYA 2HZKA 1NNTA 1MY4A 4G8HA 4X1DA 3KSXA 3A3UA 1P1WA 3KOSA 1SW1A 2HQ0A 2XXYA 4YMAA 1ZKBA 3FV2A 3IO4A 1H45A 1MPCA 1NFTA 2UYFA 4Q5TA 1B0LA 3B6QA 3PUZE 2NOOA 5H8SA 4ZEFA 4PP0A 4OEVA 3MAMA 1H43A 4ISUA 4YKKA 2FYIA 1US5A 2FNCA 3H03A 4XKRA 3TTKA 4NF6A 3TFLA 1OMPA 4F3BA 1LLSA 3IAZA 1UTBB 4GWOA 4DIGA 3ONMA 2XXWA 4QSCA 2F7AA 1I6QA 1YAEA 3C36A 3E3KA 3F11A 4OHNA 5TP9B 1MG1A 3EHTA 1XVXA 3O29A 4G68B 1MPDA 4F3PA 1DTGA 3IOUA 3IORA 4G68A 4U22A 5TPAB 2OZZA 3DM0A 3OEKA 4NWCA 3T66A 2V93A 4F18A 2DVZA 2D5WA 4Q0CA 1MDQA 3FIRA 1BIYA 4QFLA 1VFDA 1EZOA 1B3HA 4I62A 4LZ8A 2HXWA 4LA9A 5EHMA 3T9VA 4NF6B 5K2YA 2OK2A 3CI8A 4JWXA 4BDRA 1PB7A 1XOCA 4ELQA 2NXOA 2DVCA 1AH5A 3Q28A 1B52A 4LVQA 3S9MC 1MY0A 2ZXTA 4DCXA 1UIUA 4RK9A 1B3FA 2O84X 3KJ7A 2DOJA 3TUSA 1IXCA 3PMWA 3QYTA 4IO4A 1MY3A 4GIZA 2M8CA 3M3LA 4OESA 4F3SA 4UA8A 5ITPA 2QSXA 3L6HA 4JWYA 3O28A 3HCQA 3OSQA 3HN0A 2ZYOA 3T22A 1DPPA 5H8HA 4ESXA 2BJJX 2E0SA 3CIJA 4LQ2A 4N07A 1OVBA 3MUQA 4H6DA 4OEUA 4EF2A 4R9FA 4PFYA 3FJGA 4F1YA 2Y84A 5ELVA 1VE4A 3CFZA 4QFKA 3TTLA 3LR1A 4X48A 2Q2CA 3EHSA 2XX9A 4R6KA 3IOVA 2Y7RA 3RT8A 4ONYA 1AOVA 1FQDA 1Y4CA 2V3UA 3HHGA 1AMFA 4KI0E 4PQJA 3ILUB 2XXIA 1JW4A 4FE8A 1FTKA 4OYVA 3PUYE 1ZJLA 1LAGE 2W7YA 2XX8A 1LFHA 2OJTA 2Q88A 3MQ9A 5AA1A 5AE4A 3K6UA 4R2BA 5KZTA 2DYXA 3PUVE 2DXYA 2QS1A 4ELPA 1FQEA 5KDTB 2I0BA 2P0SA 4OQOA 3FVOA 4EQBA 3TTMA 3VLUA 5CC2A 1MQJA 2X7PA 2O1LA 4OTEA 2Q8JA 3SEWA 4JDFA 3TELA 3M3KA 1SYHA 2XXTA 3EHUA 1B05A 4QFNA 4RNSA 4TLMB 5H8FB 1B1XA 2DS9A 4R75A 3RY3A 2HCAA 1FTLA 1RYXA 3KGCA 4OFJA 1SQYA 1TXFA 2DSFA 1XS5A 2DE4A 3KZGA 4OFLA 5TP9A 3FVGA 3KFMA 4GXAA 4ZECA 1SI1A 2A5SA 1UTBA 2G29A 4TLLB 3EN3A 3LC8A 3ZKKA 4ESWA 4KYEA 1DTZA 3C35A 3PD8A 3C31A 4P0IA 4ZS9A 4WEPA 3TCFA 3MW0A 4F19A 3IJOB 1GVCA 5L8DA 4ZZEA 1ZBMA 1DMBA 1EU8A 3IL1B 1MXXA 1B40A 1N76A 3I6VA 3K2DA 5CMMA 4IGTA 5JTYB 2PT1A 1TWYA 3H4ZA 3QAXA 4P11A 1D9YA 1I6BA 4FJPA 1DSNA 2CMOA 2I3WA 1M5DA 3ILTB 1MXVA 3JZJA 3TCGA 1UTHA 3CSBA 3V5AA 3FXRA 3D4GA 5CI5A 1I69A 1MH4A 3EPEA 1RYOA 3MP6A 1JQFA 4TOZA 2RC9A 3HO7A 3K01A 4H0WA 3JV9A 3O6IA 5B70A 3SETA 4NF8A 3FJMA 4NE4A 5AA4A 2RC8A 5EYFA 3RN8A 1LFGA 2VD3A 3R6UA 3IR1A 1MXZA 3TEPA 1ZU0A 2DE2A 4U2RA 1M5BA 1NKXA 2Z22A 2GH9A 1ANFA 3O66A 1SDXA 2F78A 2QL3A 3A3CA 4KYDA 5ITOA 3VVFA 3LSWA 2PMSA 4ZDMA 3QK6A 5L9SA 3RNNA 2A5TA 4RYAA 2YLNA 4NF5B 3W9VA 5AA4B 1IITA 3G3JA 5HBCA 3V89B 3IB1A 3KN7A 4XTCQ 3PMXA 4DLDA 4C0RA 5I84A 2HFBA 2XXPA 1JW5A 4XXUA 4YB7A 1MRPA 1S7YA 1LCFA 3A09A 5KCJB 4JSOA 1HSLA 3GXAA 3WAEA 2R6GE 1IXIA 4F31B 3FASA 1A99A 4N13A 2GHBA 3B7DA 1O64A 1AL3A 4THIA 3VLVA 3T9UA 1Y4TA 3G3HA 3IJXB 3OO7A 3TTRA 2THIA 1B5HA 1SI0A 2Z8EA 2XX7A 1QJMA 4GOTA 2PT2A 4JSDA 3G7WA 4G8NA 1B3GA 4RY1A 4DZ1A 2XHDA 3IO6A 3RQTA 2O1MA 5KCJA 4E0WA 1I6AA 4I1DA 3QUFA 2UYEA 2P2AA 3PMVA 4U1OA 2NUVA 5F7VA 4Z0IA 4IO2A 3PUWE 3OO6A 5F1QA 4HCYA 3T9XB 4NF5A 1IEJA 1B9JA 2OWSA 4OVJA 5FHOA 3W9WA 2O7UA 3KJTA 4IO7A 4LZ7A 3M8UA 2H25A 3N5LA 1VSOA 3IB2A 3RUMA 4RK2A 2F35A 3KEIA 2Q2AA 3FD3A 5DTBA 1B4ZA 2QS3A 4R73A 3ZKLA 3E13X 3VXCA 5H8FA 1US4A 1SW5A 2Z8FA 3PPPA 4OENA 3OELA 3IX1A 1JETA 1MXYA 3G3FA 2F5XA 3LBSA 3H6UA 3SEYA 5FTIA 2V25A 1F9BA 2B65A 2UVHA 4U4SA 1PC3A 2VGQA 3K1PA 3KN8A 1DPEA 1N7WA 1Q35A 2QS4A 2RCAA 4WXJA 3ZSFA 1LGBC 1NNFA 3O6GA 4H8IA 1LBBA 1M5FA 3VE1B 4F1VA 2ZYNA 3DP4A 4LQ5A 2Y7KA 1B3LA 5H8QA 2NVUB 1UTHB 3UIFA 4EF1A 1H76A 4EQ9A 4EXLA 3TZAA 2GRVA 2IA4A 4KD5A 1GV8A 4U23A 1GR2A 1FTOA 2REGA 1IQ7A 5H8NA 1R9QA 2NWJA 1ELJA 1B7UA 2RKMA 4G4PA 4OMBA 3IB0A 4IGRA 1H3DA 1ZMGA 1QKAA 3Q29A 4F2QA 2Z23A 5DEXA 1SW2A 2DWHA 3CR9A 3MPKA 4R2FA 3K6VA 1PBQA 2X7QA 4GF8A 3GBAA 2ZNSA 4PE5B 2OCUA 3OSRA 4MLVA 3MBPA 4QFOA 3MVWA 1O63A 3AXFA 4NMYA 1A54A 3PPOA 2OBGA 4KQPA 4LATA 4QSEA 3HV1A 1Y3NA 3VXBA 3SEXA 2OLBA 4FAJA 2REJA 3U94A 1JVXA 1OIBA 5JEIA 3V83A 3OXNA 1Q1KA 2F36A 4G2ZA 3RPWA 4POWA 5FTHA 3IOWA 2DQVA 1D3KA 2F97A 4U21A 4G8MA 3TTNA 3IOTA 4ECFA 4OERA 1A7LA 2O6AA 3MC2A 4GRKA 1M5EA 3K6WA 4F1UA 1QUIA 3H06B 3SERA 1LCTA 1OLAA 1N7XA 1B5IA 2A5TB 4FORA 2G93A 4YU0A 2DXRA 1B7HA 3K4UA 2ZMBA 3DP6A 3GLBA 2XD2A 1N0TA 3KBRA 4QRZA 4QF9A 5I59A 1NH7A 3PPQA 2I58A 3U72A 2I6EA 4MF3A 4RXLA 1P1UA 2F7BA 4LUBA 5I58A 4Q30B 4UACA 5CBRA 2I4CA 3VLWA 1MXUA 2ZNUA 4GLIA 1QUKA 2UVIA 3N94A 4KPTA 2YPNA 1BKAA 1JW1A 2PX1A 2I0CA 3U92A 1LAHE 3H3GA 3VVEA 2RC7A 1URGA 4H5GA 2H4IA 1UQWA 4WEDA 3SESA 4EXKA 3FV1A 1JNFA 4POXA 4ZEIA 1JEUA 2RCBA 4I9DA 4IO5A 4XKNA 3V8XB 1OQGA 4F2OA 3FZVA 2DWJA 2PVUA 4MH5A 3CG3A 4E0XA 3TQLA 4OETA 2QMXA 1MS7A 2ZYKA 2Y7IA 3CFLA 3K1NA 3VVDA 1EH3A 2QMWA 5DVFA 1LB9A 1D4NA 1S50A 5AA2B 5CM6A 2ANJA 3G3KA 3PPRA 3GBBA 4IB2A 4ZE8A 1CE2A 4U4XA 2CZLA 1Z7NE 2YJPA 4RA1A 2KLFA 5IAIA 1B32A 3QSLA 1Y1ZA 3UK4A 2XXVA 3FATA 3MPLA 1XC1A 1URSA 5CBSA 3FXUA 4AB5A 4I8CA 4YMBA 1FW0A 3TDJA 2HAUA 3P7IA 2F34A 4FECA 1SW4A 4C1UA 1PB8A 4GVOA 3CVGA 1QUJA 5I2NB 5I59B 4XKQA 1WVJA 2VOZA 3I5OA 3MVZA 3OD7A 2DWIA 1IXHA 5CMKA 4AB6A 2UXAA 1N3XA 1LFIA 1N3WA 2QS2A 2ZNTA 3CFXA 3UORA 4DXUA 4NF8B 5IKBA 1RKMA 4ZZAA 5A5XB 1FQBA 4MBPA 4JWOA 1B1HA 5DYHA 2OWTA 4YKIA 1TFDA 4KYSA 4ELRA 1YTVA 2E1SA 1TFAA 3OO8A 2R71A 3C34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6T A;  3GZG A;  3O9P A;  2ONS A;  2GHA A;  3PPN A;  1XT8 A;  1P99 A;  2ONR A;  3K1M A;  3MP8 A;  3PV0 E;  4YB5 A;  3S9N C;  2B3F A;  1B6H A;  1MQH A;  3MZ9 A;  2I3V A;  4PET A;  3RLF E;  3FUZ A;  1P1N A;  3K02 A;  2F8D A;  4HW8 A;  2VHA A;  3OMB A;  1MQI A;  3IK6 B;  4M1V A;  4DE8 A;  4BDO A;  5ICT A;  4PFT A;  4YB6 A;  5DEX B;  4KCC A;  1LAF E;  4JBZ A;  3LSX A;  3H6V A;  3D4C A;  3G3G A;  4R9G A;  3OEN A;  3C9H A;  2Z8D A;  3Q26 A;  5DT6 A;  3T9H B;  4BDM A;  4F22 A;  4F39 A;  5ISU A;  1CB6 A;  1FTJ A;  2LAO A;  3W15 C;  1B3E A;  2IEE A;  2F6G A;  1FQC A;  5EHS A;  1NNP A;  2HZL A;  4HS7 A;  4H65 A;  2XD3 A;  1MPB A;  1B7Z A;  4XKP A;  4YAH X;  1II5 A;  3T93 B;  4OXV A;  3VFJ A;  1QW0 A;  1R1N A;  3MVY A;  3N6T A;  3S2V A;  4NWD A;  1IZ1 A;  1MM7 A;  4EDP A;  3CSG A;  4LP2 B;  2XXH A;  3KN3 A;  2AYS A;  2H5Y A;  3B6W A;  1POY 1;  2PYY A;  4DCY A;  1P1O A;  2H98 A;  2Q89 A;  2VP1 A;  1ZIU A;  4FED A;  1MXW A;  3E9X A;  2QJE A;  2D3I A;  3M3F A;  1PB9 A;  3LSF B;  5CMB A;  3PD9 A;  4RJZ A;  2I49 A;  2D21 A;  3TPA A;  2V84 A;  1MY2 A;  3BKI B;  5I58 B;  2O51 A;  5I2N A;  5ICQ A;  4ZEK A;  2F7C A;  5TPA A;  1UIV A;  1IXG A;  3DLN A;  5DVI A;  3LUY A;  3FGS A;  2FA7 A;  1B0H A;  3RTW B;  3K0V A;  4ZED A;  4BDN A;  2Y7W A;  1BLF A;  3N6U A;  4GQO A;  1B51 A;  1B5J A;  3MZB A;  4MFI A;  3TMG A;  5BUU A;  4R74 A;  4ZEB A;  1QUL A;  2GFE A;  2VD2 A;  4Q8R A;  4HTG A;  1Z7M E;  5L9O A;  4OFO A;  1HSJ A;  1ATG A;  1S9T A;  1PDA A;  5AA3 A;  3TAJ A;  2HAV A;  3SDF A;  2O7I A;  5H8H B;  5CRY A;  4X1B A;  1KWH A;  3R7X A;  1AIV A;  1GTK A;  1H44 A;  4H1X A;  5HPQ A;  4H67 A;  4JXI A;  4NF4 A;  2ALU A;  3SEU A;  3ZS6 A;  3DEL B;  1FCK A;  4F29 A;  3QUJ A;  4BDQ A;  4R6H A;  1YPN A;  1ZTY A;  3PUX E;  4O3B A;  3BBR A;  3G3I A;  5LOM A;  1J1N A;  3U93 A;  2ABH A;  4KHZ E;  3QXM A;  2UVG A;  3RGY A;  4JB7 A;  3SEV A;  1FQF A;  2P1S A;  3MZ1 A;  1BP5 A;  1B46 A;  1XHY A;  1Y1M A;  4IO3 A;  2RF1 A;  4ELO A;  1NMU A;  1SVX B;  3ODB A;  4NTL A;  1WOD A;  2H99 A;  3OOA A;  1A40 A;  1JEV A;  1P1Q A;  1OVT A;  4O3C A;  4QFP A;  4YKP A;  4G77 A;  1MH3 A;  1PBP A;  2AL5 A;  5H8N B;  1B4H A;  4AQ4 A;  1XVY A;  3C33 A;  3TKD A;  1FQA A;  3TOD A;  3PU5 A;  3H7M A;  3H6W A;  1R9L A;  3JYR A;  3VV5 A;  1ZLQ A;  4HCW A;  4N6P A;  1Y3Q A;  4NED A;  1A8E A;  1LST A;  1FTM A;  1MQD A;  3MWB A;  1QKB A;  4LON B;  1LAX A;  1R6Z A;  1MY1 A;  2H9B A;  5I2K B;  1DOT A;  5K2X A;  1VFE A;  3OO9 A;  1IIW A;  1USY H;  2B3B A;  4X9T A;  4H8J A;  3TYH A;  3U1O A;  3USD A;  5BWJ A;  2DP8 A;  2HEU A;  1QVS A;  3S9L C;  4M4G A;  1MM6 A;  1B58 A;  2AIX A;  4IO6 A;  4DDD A;  3QIM A;  3MJN A;  3DP8 A;  2Y7P A;  4G68 C;  5FHN A;  1L5T A;  4KFQ A;  2PBW A;  2XXQ A;  4ZE9 A;  1SD3 A;  1POT A;  2F6P A;  1MQG A;  5JTY A;  1Y9U A;  1BTJ A;  4RPO A;  3TQW A;  2X26 A;  4LZ5 A;  5M2V A;  4NF4 B;  4U1Z A;  2RIN A;  4FEB A;  4GL0 A;  1USY E;  3C4M A;  5I56 B;  5I57 B;  3UGW A;  3L6G A;  3KSJ A;  3CG1 A;  5HM4 B;  2O68 A;  2WKY A;  3MP1 A;  4KR5 A;  4F3G A;  5JK4 A;  2V3T A;  3BFT A;  4YIC A;  5I57 A;  3RTF B;  2XXR A;  4PFW A;  5B7D A;  1JVY A;  4ND9 A;  4OZ9 A;  1OLC A;  3KG2 A;  3EF7 A;  4DXC A;  3FXQ A;  4EQ7 A;  4GL8 A;  4P0G A;  3FVK A;  2DWA A;  4OWD A;  4QSD A;  3MVX A;  1TT1 A;  3OEM A;  4DXB A;  1Y3P A;  2V3Q A;  1O7T A;  1NL5 A;  4L17 A;  3RT6 B;  1SBP A;  1EZP A;  4O3A A;  2QPQ A;  4YZZ A;  3I3V A;  3R26 A;  4KCD A;  5H8Q B;  4QHQ A;  1VR5 A;  4IY5 A;  3EQ1 A;  4GFR A;  4H5F A;  1IUD A;  1HSE A;  4C1T A;  4R72 A;  5A5X A;  3E4R A;  3UP9 A;  2XXU A;  3C32 A;  2O69 A;  3N26 A;  5KDT A;  3LSL A;  1N04 A;  4GXS B;  4TQU Q;  1SYI A;  1PEB A;  3O6H A;  4IY6 A;  4FAT A;  1A55 A;  1A8F A;  1NH8 A;  1URD A;  4Z7E A;  3THI A;  3HPI A;  4K3F A;  5I2K A;  3U8Q A;  2XXX A;  4XIG Q;  2DE3 A;  4R6Y A;  2UVJ A;  3HST A;  3O2A A;  3PGF A;  3K00 A;  3KOT A;  1NNK A;  5FHM A;  5DVJ A;  4BLA A;  5AA2 D;  2AL4 A;  1D9V A;  2I48 A;  3SKP A;  4YKJ A;  1LB8 A;  1MDP 1;  4EUO A;  3Q25 A;  1N84 A;  1M5C A;  3VDF A;  1OQH A;  3FJ7 A;  4PFU A;  2I4B A;  3UN6 A;  1GGG A;  2Q9T A;  1YCJ A;  1WDN A;  5CMC A;  2ZYM A;  4BDL A;  3FVN A;  4WKM A;  5L9M A;  4FIM A;  3H6T A;  3TCH A;  3UA8 A;  1LBC A;  3Q27 A;  4RPN A;  5AA2 A;  1EZ9 A;  3K6X A;  1T0K A;  5J1D A;  3S4U A;  5I56 A;  1B2H A;  3HHF A;  3WAF A;  3BFU A;  5TU0 A;  1Y20 A;  3S9E A;  4GD5 A;  3CRB A;  2ONK E;  3ECR A;  2ESN A;  3O97 A;  4MLQ A;  3T96 B;  2R9J A;  2QRY A;  2HZK A;  1NNT A;  1MY4 A;  4G8H A;  4X1D A;  3KSX A;  3A3U A;  1P1W A;  3KOS A;  1SW1 A;  2HQ0 A;  2XXY A;  4YMA A;  1ZKB A;  3FV2 A;  3IO4 A;  1H45 A;  1MPC A;  1NFT A;  2UYF A;  4Q5T A;  1B0L A;  3B6Q A;  3PUZ E;  2NOO A;  5H8S A;  4ZEF A;  4PP0 A;  4OEV A;  3MAM A;  1H43 A;  4ISU A;  4YKK A;  2FYI A;  1US5 A;  2FNC A;  3H03 A;  4XKR A;  3TTK A;  4NF6 A;  3TFL A;  1OMP A;  4F3B A;  1LLS A;  3IAZ A;  1UTB B;  4GWO A;  4DIG A;  3ONM A;  2XXW A;  4QSC A;  2F7A A;  1I6Q A;  1YAE A;  3C36 A;  3E3K A;  3F11 A;  4OHN A;  5TP9 B;  1MG1 A;  3EHT A;  1XVX A;  3O29 A;  4G68 B;  1MPD A;  4F3P A;  1DTG A;  3IOU A;  3IOR A;  4G68 A;  4U22 A;  5TPA B;  2OZZ A;  3DM0 A;  3OEK A;  4NWC A;  3T66 A;  2V93 A;  4F18 A;  2DVZ A;  2D5W A;  4Q0C A;  1MDQ A;  3FIR A;  1BIY A;  4QFL A;  1VFD A;  1EZO A;  1B3H A;  4I62 A;  4LZ8 A;  2HXW A;  4LA9 A;  5EHM A;  3T9V A;  4NF6 B;  5K2Y A;  2OK2 A;  3CI8 A;  4JWX A;  4BDR A;  1PB7 A;  1XOC A;  4ELQ A;  2NXO A;  2DVC A;  1AH5 A;  3Q28 A;  1B52 A;  4LVQ A;  3S9M C;  1MY0 A;  2ZXT A;  4DCX A;  1UIU A;  4RK9 A;  1B3F A;  2O84 X;  3KJ7 A;  2DOJ A;  3TUS A;  1IXC A;  3PMW A;  3QYT A;  4IO4 A;  1MY3 A;  4GIZ A;  2M8C A;  3M3L A;  4OES A;  4F3S A;  4UA8 A;  5ITP A;  2QSX A;  3L6H A;  4JWY A;  3O28 A;  3HCQ A;  3OSQ A;  3HN0 A;  2ZYO A;  3T22 A;  1DPP A;  5H8H A;  4ESX A;  2BJJ X;  2E0S A;  3CIJ A;  4LQ2 A;  4N07 A;  1OVB A;  3MUQ A;  4H6D A;  4OEU A;  4EF2 A;  4R9F A;  4PFY A;  3FJG A;  4F1Y A;  2Y84 A;  5ELV A;  1VE4 A;  3CFZ A;  4QFK A;  3TTL A;  3LR1 A;  4X48 A;  2Q2C A;  3EHS A;  2XX9 A;  4R6K A;  3IOV A;  2Y7R A;  3RT8 A;  4ONY A;  1AOV A;  1FQD A;  1Y4C A;  2V3U A;  3HHG A;  1AMF A;  4KI0 E;  4PQJ A;  3ILU B;  2XXI A;  1JW4 A;  4FE8 A;  1FTK A;  4OYV A;  3PUY E;  1ZJL A;  1LAG E;  2W7Y A;  2XX8 A;  1LFH A;  2OJT A;  2Q88 A;  3MQ9 A;  5AA1 A;  5AE4 A;  3K6U A;  4R2B A;  5KZT A;  2DYX A;  3PUV E;  2DXY A;  2QS1 A;  4ELP A;  1FQE A;  5KDT B;  2I0B A;  2P0S A;  4OQO A;  3FVO A;  4EQB A;  3TTM A;  3VLU A;  5CC2 A;  1MQJ A;  2X7P A;  2O1L A;  4OTE A;  2Q8J A;  3SEW A;  4JDF A;  3TEL A;  3M3K A;  1SYH A;  2XXT A;  3EHU A;  1B05 A;  4QFN A;  4RNS A;  4TLM B;  5H8F B;  1B1X A;  2DS9 A;  4R75 A;  3RY3 A;  2HCA A;  1FTL A;  1RYX A;  3KGC A;  4OFJ A;  1SQY A;  1TXF A;  2DSF A;  1XS5 A;  2DE4 A;  3KZG A;  4OFL A;  5TP9 A;  3FVG A;  3KFM A;  4GXA A;  4ZEC A;  1SI1 A;  2A5S A;  1UTB A;  2G29 A;  4TLL B;  3EN3 A;  3LC8 A;  3ZKK A;  4ESW A;  4KYE A;  1DTZ A;  3C35 A;  3PD8 A;  3C31 A;  4P0I A;  4ZS9 A;  4WEP A;  3TCF A;  3MW0 A;  4F19 A;  3IJO B;  1GVC A;  5L8D A;  4ZZE A;  1ZBM A;  1DMB A;  1EU8 A;  3IL1 B;  1MXX A;  1B40 A;  1N76 A;  3I6V A;  3K2D A;  5CMM A;  4IGT A;  5JTY B;  2PT1 A;  1TWY A;  3H4Z A;  3QAX A;  4P11 A;  1D9Y A;  1I6B A;  4FJP A;  1DSN A;  2CMO A;  2I3W A;  1M5D A;  3ILT B;  1MXV A;  3JZJ A;  3TCG A;  1UTH A;  3CSB A;  3V5A A;  3FXR A;  3D4G A;  5CI5 A;  1I69 A;  1MH4 A;  3EPE A;  1RYO A;  3MP6 A;  1JQF A;  4TOZ A;  2RC9 A;  3HO7 A;  3K01 A;  4H0W A;  3JV9 A;  3O6I A;  5B70 A;  3SET A;  4NF8 A;  3FJM A;  4NE4 A;  5AA4 A;  2RC8 A;  5EYF A;  3RN8 A;  1LFG A;  2VD3 A;  3R6U A;  3IR1 A;  1MXZ A;  3TEP A;  1ZU0 A;  2DE2 A;  4U2R A;  1M5B A;  1NKX A;  2Z22 A;  2GH9 A;  1ANF A;  3O66 A;  1SDX A;  2F78 A;  2QL3 A;  3A3C A;  4KYD A;  5ITO A;  3VVF A;  3LSW A;  2PMS A;  4ZDM A;  3QK6 A;  5L9S A;  3RNN A;  2A5T A;  4RYA A;  2YLN A;  4NF5 B;  3W9V A;  5AA4 B;  1IIT A;  3G3J A;  5HBC A;  3V89 B;  3IB1 A;  3KN7 A;  4XTC Q;  3PMX A;  4DLD A;  4C0R A;  5I84 A;  2HFB A;  2XXP A;  1JW5 A;  4XXU A;  4YB7 A;  1MRP A;  1S7Y A;  1LCF A;  3A09 A;  5KCJ B;  4JSO A;  1HSL A;  3GXA A;  3WAE A;  2R6G E;  1IXI A;  4F31 B;  3FAS A;  1A99 A;  4N13 A;  2GHB A;  3B7D A;  1O64 A;  1AL3 A;  4THI A;  3VLV A;  3T9U A;  1Y4T A;  3G3H A;  3IJX B;  3OO7 A;  3TTR A;  2THI A;  1B5H A;  1SI0 A;  2Z8E A;  2XX7 A;  1QJM A;  4GOT A;  2PT2 A;  4JSD A;  3G7W A;  4G8N A;  1B3G A;  4RY1 A;  4DZ1 A;  2XHD A;  3IO6 A;  3RQT A;  2O1M A;  5KCJ A;  4E0W A;  1I6A A;  4I1D A;  3QUF A;  2UYE A;  2P2A A;  3PMV A;  4U1O A;  2NUV A;  5F7V A;  4Z0I A;  4IO2 A;  3PUW E;  3OO6 A;  5F1Q A;  4HCY A;  3T9X B;  4NF5 A;  1IEJ A;  1B9J A;  2OWS A;  4OVJ A;  5FHO A;  3W9W A;  2O7U A;  3KJT A;  4IO7 A;  4LZ7 A;  3M8U A;  2H25 A;  3N5L A;  1VSO A;  3IB2 A;  3RUM A;  4RK2 A;  2F35 A;  3KEI A;  2Q2A A;  3FD3 A;  5DTB A;  1B4Z A;  2QS3 A;  4R73 A;  3ZKL A;  3E13 X;  3VXC A;  5H8F A;  1US4 A;  1SW5 A;  2Z8F A;  3PPP A;  4OEN A;  3OEL A;  3IX1 A;  1JET A;  1MXY A;  3G3F A;  2F5X A;  3LBS A;  3H6U A;  3SEY A;  5FTI A;  2V25 A;  1F9B A;  2B65 A;  2UVH A;  4U4S A;  1PC3 A;  2VGQ A;  3K1P A;  3KN8 A;  1DPE A;  1N7W A;  1Q35 A;  2QS4 A;  2RCA A;  4WXJ A;  3ZSF A;  1LGB C;  1NNF A;  3O6G A;  4H8I A;  1LBB A;  1M5F A;  3VE1 B;  4F1V A;  2ZYN A;  3DP4 A;  4LQ5 A;  2Y7K A;  1B3L A;  5H8Q A;  2NVU B;  1UTH B;  3UIF A;  4EF1 A;  1H76 A;  4EQ9 A;  4EXL A;  3TZA A;  2GRV A;  2IA4 A;  4KD5 A;  1GV8 A;  4U23 A;  1GR2 A;  1FTO A;  2REG A;  1IQ7 A;  5H8N A;  1R9Q A;  2NWJ A;  1ELJ A;  1B7U A;  2RKM A;  4G4P A;  4OMB A;  3IB0 A;  4IGR A;  1H3D A;  1ZMG A;  1QKA A;  3Q29 A;  4F2Q A;  2Z23 A;  5DEX A;  1SW2 A;  2DWH A;  3CR9 A;  3MPK A;  4R2F A;  3K6V A;  1PBQ A;  2X7Q A;  4GF8 A;  3GBA A;  2ZNS A;  4PE5 B;  2OCU A;  3OSR A;  4MLV A;  3MBP A;  4QFO A;  3MVW A;  1O63 A;  3AXF A;  4NMY A;  1A54 A;  3PPO A;  2OBG A;  4KQP A;  4LAT A;  4QSE A;  3HV1 A;  1Y3N A;  3VXB A;  3SEX A;  2OLB A;  4FAJ A;  2REJ A;  3U94 A;  1JVX A;  1OIB A;  5JEI A;  3V83 A;  3OXN A;  1Q1K A;  2F36 A;  4G2Z A;  3RPW A;  4POW A;  5FTH A;  3IOW A;  2DQV A;  1D3K A;  2F97 A;  4U21 A;  4G8M A;  3TTN A;  3IOT A;  4ECF A;  4OER A;  1A7L A;  2O6A A;  3MC2 A;  4GRK A;  1M5E A;  3K6W A;  4F1U A;  1QUI A;  3H06 B;  3SER A;  1LCT A;  1OLA A;  1N7X A;  1B5I A;  2A5T B;  4FOR A;  2G93 A;  4YU0 A;  2DXR A;  1B7H A;  3K4U A;  2ZMB A;  3DP6 A;  3GLB A;  2XD2 A;  1N0T A;  3KBR A;  4QRZ A;  4QF9 A;  5I59 A;  1NH7 A;  3PPQ A;  2I58 A;  3U72 A;  2I6E A;  4MF3 A;  4RXL A;  1P1U A;  2F7B A;  4LUB A;  5I58 A;  4Q30 B;  4UAC A;  5CBR A;  2I4C A;  3VLW A;  1MXU A;  2ZNU A;  4GLI A;  1QUK A;  2UVI A;  3N94 A;  4KPT A;  2YPN A;  1BKA A;  1JW1 A;  2PX1 A;  2I0C A;  3U92 A;  1LAH E;  3H3G A;  3VVE A;  2RC7 A;  1URG A;  4H5G A;  2H4I A;  1UQW A;  4WED A;  3SES A;  4EXK A;  3FV1 A;  1JNF A;  4POX A;  4ZEI A;  1JEU A;  2RCB A;  4I9D A;  4IO5 A;  4XKN A;  3V8X B;  1OQG A;  4F2O A;  3FZV A;  2DWJ A;  2PVU A;  4MH5 A;  3CG3 A;  4E0X A;  3TQL A;  4OET A;  2QMX A;  1MS7 A;  2ZYK A;  2Y7I A;  3CFL A;  3K1N A;  3VVD A;  1EH3 A;  2QMW A;  5DVF A;  1LB9 A;  1D4N A;  1S50 A;  5AA2 B;  5CM6 A;  2ANJ A;  3G3K A;  3PPR A;  3GBB A;  4IB2 A;  4ZE8 A;  1CE2 A;  4U4X A;  2CZL A;  1Z7N E;  2YJP A;  4RA1 A;  2KLF A;  5IAI A;  1B32 A;  3QSL A;  1Y1Z A;  3UK4 A;  2XXV A;  3FAT A;  3MPL A;  1XC1 A;  1URS A;  5CBS A;  3FXU A;  4AB5 A;  4I8C A;  4YMB A;  1FW0 A;  3TDJ A;  2HAU A;  3P7I A;  2F34 A;  4FEC A;  1SW4 A;  4C1U A;  1PB8 A;  4GVO A;  3CVG A;  1QUJ A;  5I2N B;  5I59 B;  4XKQ A;  1WVJ A;  2VOZ A;  3I5O A;  3MVZ A;  3OD7 A;  2DWI A;  1IXH A;  5CMK A;  4AB6 A;  2UXA A;  1N3X A;  1LFI A;  1N3W A;  2QS2 A;  2ZNT A;  3CFX A;  3UOR A;  4DXU A;  4NF8 B;  5IKB A;  1RKM A;  4ZZA A;  5A5X B;  1FQB A;  4MBP A;  4JWO A;  1B1H A;  5DYH A;  2OWT A;  4YKI A;  1TFD A;  4KYS A;  4ELR A;  1YTV A;  2E1S A;  1TFA A;  3OO8 A;  2R71 A;  3C34 A; 
#chains in the Genus database with same CATH topology
 2ONR A;  3PV0 E;  4YB5 A;  3S9N C;  1AWB A;  2B3F A;  3RLF E;  2FVZ A;  3OMB A;  3IK6 B;  4M1V A;  4PFT A;  1LAF E;  3U65 A;  3A29 A;  4R9G A;  5DT6 A;  3OEN A;  3C9H A;  4F39 A;  5ISU A;  5EHS A;  2HZL A;  4HS7 A;  2XD3 A;  1MPB A;  4XKP A;  4YAH X;  3T93 B;  1II5 A;  4OXV A;  3VFJ A;  1QW0 A;  3N6T A;  3KN3 A;  1POY 1;  4DCY A;  1P1O A;  2Q89 A;  3IFA A;  1G0H A;  3E9X A;  4RJZ A;  2V84 A;  3BKI B;  4PGP A;  4ZEK A;  1FBH A;  5DVI A;  1IXG A;  1B0H A;  4ZED A;  4MFI A;  1FBC A;  4R74 A;  1QUL A;  4HTG A;  4PC9 A;  4X1B A;  1NV3 A;  4PTK A;  4X8R A;  3SEU A;  1FCK A;  1YPN A;  1ZTY A;  1J1N A;  4KHZ E;  2WX9 A;  4JB7 A;  4N8Y A;  1XHY A;  2HHM A;  4P47 A;  1NMU A;  1SVX B;  4NTL A;  1WOD A;  1INP A;  4G77 A;  1MH3 A;  1B4H A;  3C33 A;  3H7M A;  3JYR A;  4HCW A;  1Y3Q A;  1LAX A;  5I2K B;  5K2X A;  5BWJ A;  2B3B A;  3USD A;  4H8J A;  2AIX A;  3MJN A;  4G68 C;  5FHN A;  5JTY A;  4LZ5 A;  4NF4 B;  4FEB A;  1USY E;  4F3G A;  1NV2 A;  3RTF B;  1JVY A;  4OZ9 A;  1OLC A;  3FXQ A;  2DWA A;  4QSD A;  1LBW A;  3ISP A;  4L17 A;  3RT6 B;  3KC1 A;  3R26 A;  1IUD A;  4C1T A;  2O69 A;  4NN3 A;  1SYI A;  1PEB A;  3O6H A;  4FAT A;  1A55 A;  1A8F A;  5I2K A;  4R6Y A;  3KOT A;  1NNK A;  5FHM A;  5DVJ A;  5AA2 D;  1D9V A;  4EUO A;  3VDF A;  3FJ7 A;  1GGG A;  4PAF A;  2ZYM A;  4BDL A;  4WKM A;  3K6X A;  5J1D A;  5I56 A;  1B2H A;  3HHF A;  3WAF A;  2B4L A;  3O97 A;  4GWU A;  1NNT A;  3KOS A;  1SW1 A;  2XXY A;  1EYK A;  3PUZ E;  4PP0 A;  3EKI A;  2FYI A;  1US5 A;  4NF6 A;  3TFL A;  3QMF A;  2FIE A;  4QSC A;  1I6Q A;  1YAE A;  4JVC A;  2OZZ A;  3DM0 A;  4NWC A;  1MDQ A;  3FIR A;  1VFD A;  1B3H A;  4I62 A;  4LZ8 A;  5EHM A;  4LA9 A;  4NF6 B;  5K2Y A;  4GX6 A;  3ROJ A;  1YYZ A;  2DVC A;  2O84 X;  3KJ7 A;  3TUS A;  4OES A;  2CEX A;  3L6H A;  3HCQ A;  4MIJ A;  1OVB A;  3KC0 A;  4EF2 A;  3CHG A;  4X48 A;  2Q2C A;  2Y7R A;  4KI0 E;  3ILU B;  4FE8 A;  2XX8 A;  1LFH A;  3MQ9 A;  4R2B A;  3PUV E;  2DXY A;  1CNQ A;  1QGX A;  2P0S A;  4OQO A;  3FVO A;  3TTM A;  4OTE A;  2XXT A;  2JJK A;  1B05 A;  3RY3 A;  2HCA A;  1RYX A;  1SQY A;  2DE4 A;  4N4U A;  1XS5 A;  4N91 A;  2A5S A;  1UTB A;  3TCF A;  3IJO B;  1NV1 A;  1DMB A;  3IL1 B;  1MXX A;  1B40 A;  1N76 A;  3I6V A;  3K2D A;  5CMM A;  4IGT A;  5JTY B;  1TWY A;  4P11 A;  4FJP A;  2I3W A;  3TCG A;  1MXV A;  2CZK A;  1NI9 A;  1MH4 A;  1RYO A;  3MP6 A;  1JQF A;  5F24 A;  3K01 A;  3JV9 A;  4NF8 A;  5AA4 A;  1JP4 A;  3R6U A;  4NHB A;  2DE2 A;  4U2R A;  2GH9 A;  4IR8 A;  1SDX A;  5ITO A;  2QL3 A;  3LSW A;  4ZDM A;  2YLN A;  5EYG A;  3IB1 A;  4O7M A;  4MNI A;  3WAE A;  1IXI A;  5EQ9 A;  1A99 A;  2GHB A;  3B7D A;  4THI A;  1AL3 A;  3IJX B;  3E79 A;  3OO7 A;  4PGN A;  2XX7 A;  4GOT A;  4JSD A;  2PT2 A;  3G7W A;  4G8N A;  1B3G A;  5KCJ A;  2OX3 A;  4E0W A;  1I6A A;  2OWS A;  3W9W A;  3M8U A;  1VSO A;  5DTB A;  1US4 A;  3PPP A;  1MXY A;  3H6U A;  2ZZX A;  2VT5 A;  3KN8 A;  2RCA A;  1LGB C;  1NNF A;  3O6G A;  4F1V A;  5H8Q A;  2NVU B;  4N81 A;  4KD5 A;  2KR0 A;  5H8N A;  1D9Q A;  1ELJ A;  1B7U A;  4IGR A;  1H3D A;  3Q29 A;  2Z23 A;  1SW2 A;  2DWH A;  3CR9 A;  3MVW A;  4NMY A;  1A54 A;  2WYK A;  4FAJ A;  2OLB A;  3U94 A;  5JEI A;  3V83 A;  3OXN A;  4GWW A;  2F97 A;  2PCR A;  4F1U A;  1QUI A;  3H06 B;  1OLA A;  4YU0 A;  2G93 A;  3T0J A;  1Q9D A;  3K4U A;  3PPQ A;  4OVT A;  1P1U A;  2F7B A;  4Q30 B;  3VLW A;  1QUK A;  2PX1 A;  1LAH E;  3VVE A;  4H5G A;  3SES A;  3FV1 A;  4POX A;  1JEU A;  2RCB A;  4I9D A;  4N6K A;  4F2O A;  3FZV A;  4GBW A;  3CG3 A;  2ZYK A;  2Y7I A;  3PPR A;  1CE2 A;  2YJP A;  1Y1Z A;  1XC1 A;  5CBS A;  4MAG A;  4I8C A;  3P7I A;  4XKQ A;  2VOZ A;  2QVU A;  5IZ1 A;  1LFI A;  2ZNT A;  4JWO A;  1B1H A;  5DYH A;  1AOV A;  1IMC A;  3C34 A;  2ONS A;  3B8B A;  1XT8 A;  3MP8 A;  4PCD A;  1P1N A;  3K02 A;  2VHA A;  4KXP A;  1MQI A;  5DW8 A;  4KCC A;  4JBZ A;  3D4C A;  3G3G A;  1FBD A;  3W15 C;  2FBP A;  1FQC A;  2ZZW A;  2HPG A;  4P1L A;  3MVY A;  4LP2 B;  2PYY A;  2H98 A;  4FED A;  2D3I A;  5ESY A;  5I58 B;  3LUY A;  2FA7 A;  4OA4 A;  3RTW B;  3K0V A;  1LBV A;  2Y7W A;  3MZB A;  2GFE A;  1Z7M E;  4OFO A;  1HSJ A;  1S9T A;  5AA3 A;  3TAJ A;  4XEQ A;  4AS5 A;  1AIV A;  5HPQ A;  4I3E A;  2ALU A;  3QUJ A;  4BDQ A;  4I40 A;  3BIH A;  3SEV A;  4MX6 A;  3MZ1 A;  2XWK A;  1B46 A;  1FPE A;  1Y1M A;  2RF1 A;  4ELO A;  5H8S A;  1OVT A;  3TKD A;  3BIG A;  5LTC A;  3VV5 A;  1ZLQ A;  4N6P A;  4NED A;  1A8E A;  1R6Z A;  1MY1 A;  2H9B A;  4X9T A;  3TYH A;  1IIW A;  2CZI A;  2CZH A;  1QVS A;  4M4G A;  3QIM A;  3DP8 A;  2Y7P A;  1EYI A;  1L5T A;  2MKZ A;  2F6P A;  1BTJ A;  4RPO A;  2X26 A;  1FBP A;  3C4M A;  4GWX A;  3KSJ A;  5JK4 A;  4YIC A;  5CMK A;  2XXR A;  4DXC A;  3MVX A;  4DXB A;  1Y3P A;  2V3Q A;  4AS4 A;  1NL5 A;  1EZP A;  4OVP A;  5H8Q B;  1VR5 A;  4GFR A;  5A5X A;  3E4R A;  2XXU A;  3N26 A;  4IY6 A;  4PAK A;  4Z7E A;  3HST A;  3O2A A;  3K00 A;  3E78 A;  4YKJ A;  1MDP 1;  3Q25 A;  1OQH A;  3UN6 A;  2Q9T A;  1WDN A;  3UA8 A;  1LBC A;  3Q27 A;  4RPN A;  2V4C A;  4NQ8 A;  3S9E A;  3CRB A;  4MLQ A;  3T96 B;  2QRY A;  3KSX A;  1P1W A;  1DBZ A;  3FV2 A;  3IO4 A;  1B0L A;  4ZEF A;  4OEV A;  3MAM A;  3H03 A;  2FNC A;  4F3B A;  4GWO A;  3ONM A;  3F11 A;  3C36 A;  3EHT A;  1XVX A;  3O29 A;  4G68 B;  2V93 A;  2CEY A;  2OK2 A;  3CI8 A;  4BDR A;  4OAN A;  1XOC A;  2NXO A;  1YZ0 A;  3S9M C;  4DCX A;  1UIU A;  4UA8 A;  4DI3 D;  3OSQ A;  2DDK A;  1FPK A;  3T22 A;  1DPP A;  5H8H A;  4HXV A;  1LBY A;  4ESX A;  2BJJ X;  2E0S A;  5I5P A;  2WEF A;  4NX1 A;  3TTL A;  3LR1 A;  2XX9 A;  1Y4C A;  2V3U A;  1AMF A;  4PQJ A;  2XXI A;  3PUY E;  1LAG E;  5AE4 A;  3K6U A;  2DYX A;  4EQB A;  2XWI A;  2QVV A;  2X7P A;  2O1L A;  2Q8J A;  3SEW A;  4JDF A;  4QFN A;  5H8F B;  2DS9 A;  1FTL A;  3KZG A;  2DSF A;  4ZEC A;  3KFM A;  4GXA A;  2G29 A;  3EN3 A;  4P0I A;  4WEP A;  5IZZ A;  4NGU A;  1EU8 A;  4N6D A;  4XXU A;  3ILT B;  4LN5 A;  3CSB A;  3O6I A;  3SET A;  4NE4 A;  2RC8 A;  2VD3 A;  3TEP A;  4NF0 A;  1M5B A;  1NKX A;  3QK6 A;  3RNN A;  2A5T A;  4JVI A;  4PF8 A;  2OWZ A;  1IIT A;  5HBC A;  4MCO A;  4MJO A;  3KN7 A;  3PMX A;  2HFB A;  2XXP A;  1JW5 A;  5KCJ B;  1HSL A;  4F31 B;  3TTR A;  2THI A;  1SI0 A;  3IO6 A;  2NUV A;  3PUW E;  4PE3 A;  3T9X B;  3KJT A;  4IO7 A;  4LZ7 A;  2H25 A;  3KEI A;  1FPD A;  5H8F A;  3ZKL A;  2QS3 A;  3VXC A;  1SW5 A;  2Z8F A;  3OEL A;  1JET A;  2F5X A;  1PC3 A;  1DPE A;  1KA0 A;  2XWO A;  4H8I A;  2ZYN A;  2P3N A;  2Y7K A;  4EQ9 A;  3UIF A;  4EF1 A;  1H76 A;  4P9K A;  2FIX A;  5IZ3 A;  2GRV A;  1GV8 A;  1NV7 A;  2VPO A;  5FBP A;  4GX3 A;  1QKA A;  4F2Q A;  5DEX A;  3MPK A;  3K6V A;  1PBQ A;  2X7Q A;  4GF8 A;  4QFO A;  4MLV A;  3MBP A;  4KQP A;  4LAT A;  4QSE A;  3HV1 A;  3VXB A;  2REJ A;  1JVX A;  1FRP A;  1Q1K A;  5IM2 A;  4OER A;  1A7L A;  2O6A A;  3SER A;  5T3J A;  2XXK A;  1B5I A;  4FOR A;  1B7H A;  2ZMB A;  2XD2 A;  3KBR A;  4QRZ A;  4QF9 A;  5I3S A;  1NV5 A;  5I58 A;  4UAC A;  5CBR A;  2I4C A;  2ZNU A;  4GLI A;  4PFB A;  3U92 A;  3H3G A;  3LV0 A;  1RDZ A;  2DWJ A;  3K1N A;  2KQZ A;  3G3K A;  3NOH A;  3GBB A;  4IB2 A;  4P1E A;  4ZE8 A;  2FHY A;  4U4X A;  2XXV A;  3FAT A;  1FW0 A;  4MHF A;  4FEC A;  4C1U A;  1PB8 A;  1DK4 A;  1QUJ A;  5I59 B;  1YXI A;  1FTA A;  4AB6 A;  2UXA A;  1N3W A;  3UOR A;  4O8M A;  5A5X B;  4YKI A;  1TFD A;  2E1S A;  1LCF A;  4OFJ A;  3OO8 A;  3B6T A;  2GHA A;  3PPN A;  4PET A;  3FUZ A;  4HW8 A;  4O94 A;  4BDM A;  2Z8D A;  3T9H B;  4F22 A;  1XI6 A;  1CB6 A;  1FTJ A;  2LAO A;  2IEE A;  1NNP A;  2BJI A;  1IMF A;  1R1N A;  4NWD A;  1IZ1 A;  1MM7 A;  4EDP A;  2XXH A;  3B6W A;  2VP1 A;  1IMA A;  1NUY A;  2QJE A;  3M3F A;  4N17 A;  1PB9 A;  3LSF B;  2I49 A;  5ICQ A;  2F7C A;  5TPA A;  3DLN A;  3FGS A;  4XF5 A;  1FBG A;  1IMB A;  4BDN A;  3N6U A;  4GQO A;  1B5J A;  4UAB A;  4ZEB A;  4PBQ A;  1PDA A;  3SDF A;  2O7I A;  5H8H B;  2VPN A;  1GTK A;  4H1X A;  4JXI A;  4NF4 A;  3ZS6 A;  3DEL B;  4F29 A;  3BBR A;  3G3I A;  3U93 A;  2HXR A;  3QXM A;  4HE2 A;  2P1S A;  4PDD A;  3ODB A;  3OOA A;  1P1Q A;  4O3C A;  4QFP A;  1PBP A;  5H8N B;  1XVY A;  1LST A;  1FTM A;  1MQD A;  4LON B;  4DDD A;  1VFE A;  1FJ6 A;  3U1O A;  1MM6 A;  4ZE9 A;  1SD3 A;  1Y9U A;  3TQW A;  2RIN A;  5I57 B;  3L6G A;  5HM4 B;  3CG1 A;  2O68 A;  3MP1 A;  4KR5 A;  3BFT A;  4OVQ A;  5I57 A;  5B7D A;  3KG2 A;  3EF7 A;  4GL8 A;  4P0G A;  3FVK A;  4OWD A;  3IFC A;  1O7T A;  1SBP A;  4O3A A;  2QPQ A;  4YZZ A;  4KCD A;  5J16 A;  4IY5 A;  3EQ1 A;  4P56 A;  1HSE A;  4R72 A;  5KDT A;  3UP9 A;  3C32 A;  4GXS B;  4TQU Q;  1URD A;  3THI A;  4K3F A;  3U8Q A;  4XIG Q;  2UVJ A;  3PGF A;  1NV4 A;  1FPF A;  4PFU A;  2I4B A;  5CMC A;  3FVN A;  5L9M A;  4FIM A;  3H6T A;  3TCH A;  1EZ9 A;  1T0K A;  3S4U A;  3RYD A;  5TU0 A;  1K9Y A;  1MY4 A;  4X1D A;  2HQ0 A;  1ZKB A;  4Q5T A;  2L5V A;  4ISU A;  4YKK A;  4XKR A;  2ZZV A;  1LLS A;  3IAZ A;  1UTB B;  4DIG A;  4I3Y A;  2F7A A;  4OHN A;  1MG1 A;  1MPD A;  4F3P A;  3IOR A;  3IOU A;  4U22 A;  5TPA B;  3OEK A;  3T66 A;  1EZO A;  1BIY A;  4QFL A;  4PBH A;  3T9V A;  4JWX A;  1PB7 A;  2WYP A;  4ELQ A;  3Q28 A;  1B52 A;  4LVQ A;  2ZXT A;  1IXC A;  3QYT A;  4IO4 A;  2WBB A;  2QSX A;  3O28 A;  3HN0 A;  2ZYO A;  4LQ2 A;  3MUQ A;  4JVD A;  4PFY A;  5ELV A;  1VE4 A;  3CFZ A;  4QFK A;  2PFZ A;  4R6K A;  4GX4 A;  4GWZ A;  1LEV A;  4G61 A;  1JW4 A;  1FTK A;  4OYV A;  1ZJL A;  2W7Y A;  2Q88 A;  2B4M A;  5KDT B;  2QS1 A;  4ELP A;  1FQE A;  5CC2 A;  1MQJ A;  3S9L C;  3M3K A;  3EHU A;  1LBZ A;  4TLM B;  1B1X A;  4R75 A;  3KGC A;  3TMG A;  4OFL A;  4TLL B;  3LC8 A;  3ZKK A;  4KYE A;  1DTZ A;  3PD8 A;  4MNP A;  4ZS9 A;  4F19 A;  3MW0 A;  4ZZE A;  1FSA A;  2PT1 A;  4AB5 A;  1I6B A;  2CMO A;  1M5D A;  3JZJ A;  3V5A A;  1UTH A;  3D4G A;  5CI5 A;  1I69 A;  4TOZ A;  2RC9 A;  3FJM A;  5EYF A;  3RN8 A;  1LFG A;  3IR1 A;  2Z22 A;  3O66 A;  4KYD A;  3VVF A;  5L9S A;  2Q74 A;  3W9V A;  5AA4 B;  3G3J A;  4XTC Q;  4DLD A;  4C0R A;  5I84 A;  4YB7 A;  1S7Y A;  2Y5K A;  3GXA A;  3FAS A;  4N13 A;  3VLV A;  3T9U A;  1B5H A;  2Z8E A;  1QJM A;  4DZ1 A;  2XHD A;  2O1M A;  4I1D A;  3QUF A;  5F7V A;  3PMV A;  4Z0I A;  4P3L A;  4IO2 A;  5F1Q A;  4NF5 A;  1IEJ A;  3LUZ A;  1FBE A;  2F35 A;  1B4Z A;  4MNC A;  4OEN A;  3G3F A;  3LBS A;  1F9B A;  2B65 A;  3K1P A;  4WXJ A;  1Q35 A;  2QS4 A;  1LBB A;  1SPI A;  3DP4 A;  4LQ5 A;  1FBF A;  4EXL A;  2IA4 A;  1GR2 A;  2REG A;  1IQ7 A;  4G4P A;  1NUZ A;  1ZMG A;  4R2F A;  4PE5 B;  3GBA A;  3OSR A;  3PPO A;  2F36 A;  4G2Z A;  4POW A;  5FTH A;  2DQV A;  1D3K A;  4U21 A;  3IOT A;  1M5E A;  2A5T B;  2DXR A;  3DP6 A;  3GLB A;  5I59 A;  3U72 A;  2I58 A;  4MF3 A;  2UVI A;  3N94 A;  4KPT A;  2YPN A;  1BKA A;  2I0C A;  1URG A;  2H4I A;  1UQW A;  4WED A;  1JNF A;  4ZEI A;  2PVU A;  4E0X A;  4OVS A;  5LDZ A;  3MYU A;  1EH3 A;  4GWS A;  5CM6 A;  4RA1 A;  2KLF A;  5IAI A;  1B32 A;  3QSL A;  1EYJ A;  3MPL A;  1URS A;  4XFE A;  2F34 A;  4GVO A;  1RDX A;  5I2N B;  3T1B A;  1WVJ A;  3OD7 A;  1N3X A;  2QS2 A;  1FPI A;  2PFY A;  4DXU A;  5IKB A;  4NF8 B;  1BK4 A;  4ZZA A;  1FQB A;  4MBP A;  1YTV A;  5CMB A;  1TFA A;  2R71 A;  3GZG A;  3O9P A;  1P99 A;  3K1M A;  3MZ9 A;  1B6H A;  1MQH A;  4OVR A;  2I3V A;  2F8D A;  4DE8 A;  4BDO A;  1IMD A;  5ICT A;  4YB6 A;  5DEX B;  3FBP A;  1KZ8 A;  3LSX A;  3H6V A;  2XA5 A;  3Q26 A;  1B3E A;  2F6G A;  5IZ3 B;  4H65 A;  1B7Z A;  3S2V A;  4H45 A;  3CSG A;  2AYS A;  2H5Y A;  5EQ8 A;  1ZIU A;  1MXW A;  4ELR A;  3TPA A;  3PD9 A;  2D21 A;  1MY2 A;  2O51 A;  5I2N A;  1UIV A;  1BLF A;  1B51 A;  5BUU A;  2VD2 A;  4Q8R A;  5L9O A;  1ATG A;  2HAV A;  5CRY A;  1KWH A;  2QVR A;  3R7X A;  1H44 A;  5ET8 A;  4H67 A;  4PAI A;  4R6H A;  4O3B A;  3PUX E;  5LOM A;  2ABH A;  2UVG A;  3RGY A;  1FQF A;  1BP5 A;  2QFL A;  4IO3 A;  2H99 A;  4YKP A;  1A40 A;  1JEV A;  2AL5 A;  4AQ4 A;  1FQA A;  3TOD A;  3PU5 A;  3MST A;  3H6W A;  1R9L A;  3MWB A;  1QKB A;  2R8T A;  3SZP A;  1DOT A;  3OO9 A;  1USY H;  4X04 A;  2DP8 A;  2HEU A;  1G0I A;  1B58 A;  4IO6 A;  4KFQ A;  2PBW A;  2XXQ A;  1POT A;  1MQG A;  5M2V A;  4U1Z A;  4GL0 A;  5I56 B;  3UGW A;  2WKY A;  2V3T A;  1NV6 A;  3FXB A;  4PFW A;  4ND9 A;  4EQ7 A;  1KA1 A;  1TT1 A;  3OEM A;  4O7I A;  3I3V A;  4H46 A;  4QHQ A;  5EQA A;  4H5F A;  3LSL A;  1N04 A;  1NH8 A;  3HPI A;  4QXD A;  2XXX A;  2DE3 A;  4BLA A;  2AL4 A;  4P8B A;  2I48 A;  3SKP A;  1LB8 A;  1N84 A;  1M5C A;  1DCU A;  1YCJ A;  5AA2 A;  3BFU A;  1Y20 A;  3PTY A;  4GD5 A;  2ONK E;  3ECR A;  2ESN A;  4PFR A;  2R9J A;  5ET6 A;  2HZK A;  4G8H A;  3A3U A;  1FPJ A;  4YMA A;  1H45 A;  1MPC A;  1NFT A;  2UYF A;  3B6Q A;  2NOO A;  1H43 A;  3TTK A;  3RPL A;  2Q8M A;  1OMP A;  2XXW A;  4N15 A;  3E3K A;  5TP9 B;  1DTG A;  4N8G A;  4G68 A;  4F18 A;  2DVZ A;  2D5W A;  4Q0C A;  2HXW A;  1AH5 A;  1MY0 A;  4RK9 A;  1B3F A;  2DOJ A;  3PMW A;  1MY3 A;  4MMP A;  4GIZ A;  1FPG A;  2F3D A;  2M8C A;  3M3L A;  4F3S A;  1NUW A;  1IME A;  5ITP A;  4JWY A;  5EQ7 A;  3CIJ A;  4QBA A;  4N07 A;  4H6D A;  4OEU A;  4R9F A;  4F1Y A;  3FJG A;  2Y84 A;  5IGA A;  3EHS A;  3IOV A;  3RT8 A;  4ONY A;  1FQD A;  3HHG A;  4NG7 A;  2OJT A;  4PF6 A;  5AA1 A;  5KZT A;  4NAP A;  2I0B A;  3VLU A;  4DI4 B;  3TEL A;  1SYH A;  2P3V A;  4RNS A;  5TP9 A;  5A5L A;  1TXF A;  3FVG A;  1SI1 A;  1VDW A;  3HFU A;  4ESW A;  3C35 A;  3C31 A;  4HE1 A;  1GVC A;  5L8D A;  5ET5 A;  1ZBM A;  3H4Z A;  3QAX A;  3D1R A;  1D9Y A;  1DSN A;  5ET7 A;  3FXR A;  3EPE A;  3HO7 A;  4MEV A;  4H0W A;  5B70 A;  1MXZ A;  1ZU0 A;  1ANF A;  2F78 A;  3A3C A;  2PMS A;  1NUX A;  4RYA A;  4NF5 B;  3V89 B;  3GYY A;  1MRP A;  3A09 A;  4JSO A;  2R6G E;  5EYH A;  2GQ1 A;  1O64 A;  3KBZ A;  1FPB A;  1Y4T A;  3G3H A;  4RY1 A;  3RQT A;  1LBX A;  2UYE A;  2P2A A;  4U1O A;  3OO6 A;  4HCY A;  4OVJ A;  5FHO A;  1B9J A;  2O7U A;  4HE0 A;  4GWY A;  3N5L A;  3IB2 A;  3RUM A;  4RK2 A;  2Q2A A;  3FD3 A;  4R73 A;  3E13 X;  3IX1 A;  3SEY A;  1NV0 A;  5FTI A;  2V25 A;  2UVH A;  4U4S A;  2VGQ A;  1N7W A;  1FPL A;  3ZSF A;  2Y5L A;  3VE1 B;  1M5F A;  1B3L A;  1UTH B;  2XWV A;  3TZA A;  4U23 A;  5I7I A;  1FTO A;  2NWJ A;  1R9Q A;  4FBP A;  1K9Z A;  2RKM A;  4OMB A;  3IB0 A;  2ZNS A;  2OCU A;  1O63 A;  3AXF A;  2OBG A;  1Y3N A;  3SEX A;  1OIB A;  4PDH A;  3RPW A;  3IOW A;  4G8M A;  3TTN A;  4ECF A;  3MC2 A;  4GRK A;  3K6W A;  1LCT A;  1N7X A;  1N0T A;  1NH7 A;  2I6E A;  4RXL A;  4LUB A;  1MXU A;  1JW1 A;  3RPL B;  2RC7 A;  4EXK A;  3V8X B;  4IO5 A;  4XKN A;  1OQG A;  4MH5 A;  3TQL A;  4OET A;  2QMX A;  1MS7 A;  3VVD A;  3CFL A;  2QMW A;  5DVF A;  1LB9 A;  1D4N A;  1S50 A;  5AA2 B;  2ANJ A;  2WBD A;  2CZL A;  1Z7N E;  4PFI A;  3UK4 A;  1RDY A;  3FXU A;  4YMB A;  3TDJ A;  2HAU A;  1SW4 A;  3CVG A;  3MVZ A;  3I5O A;  2F3B A;  2DWI A;  1IXH A;  1FJ9 A;  3CFX A;  3B50 A;  1RKM A;  4GBV A;  2OWT A;  4KYS A; 
#chains in the Genus database with same CATH homology
 3B6T A;  3GZG A;  3O9P A;  2ONS A;  2GHA A;  3PPN A;  1XT8 A;  1P99 A;  2ONR A;  3K1M A;  3MP8 A;  3PV0 E;  4YB5 A;  3S9N C;  2B3F A;  1B6H A;  1MQH A;  3MZ9 A;  2I3V A;  4PET A;  3RLF E;  3FUZ A;  1P1N A;  3K02 A;  2F8D A;  4HW8 A;  2VHA A;  3OMB A;  1MQI A;  3IK6 B;  4M1V A;  4DE8 A;  4BDO A;  5ICT A;  4PFT A;  4YB6 A;  5DEX B;  4KCC A;  1LAF E;  4JBZ A;  3LSX A;  3H6V A;  3D4C A;  3G3G A;  4R9G A;  3OEN A;  3C9H A;  2Z8D A;  3Q26 A;  5DT6 A;  3T9H B;  4BDM A;  4F22 A;  4F39 A;  5ISU A;  1CB6 A;  1FTJ A;  2LAO A;  3W15 C;  1B3E A;  2IEE A;  2F6G A;  1FQC A;  5EHS A;  1NNP A;  2HZL A;  4HS7 A;  4H65 A;  2XD3 A;  1MPB A;  1B7Z A;  4XKP A;  4YAH X;  1II5 A;  3T93 B;  4OXV A;  3VFJ A;  1QW0 A;  1R1N A;  3MVY A;  3N6T A;  3S2V A;  4NWD A;  1IZ1 A;  1MM7 A;  4EDP A;  3CSG A;  4LP2 B;  2XXH A;  3KN3 A;  2AYS A;  2H5Y A;  3B6W A;  1POY 1;  2PYY A;  4DCY A;  1P1O A;  2H98 A;  2Q89 A;  2VP1 A;  1ZIU A;  4FED A;  1MXW A;  3E9X A;  2QJE A;  2D3I A;  3M3F A;  1PB9 A;  3LSF B;  5CMB A;  3PD9 A;  4RJZ A;  2I49 A;  2D21 A;  3TPA A;  2V84 A;  1MY2 A;  3BKI B;  5I58 B;  2O51 A;  5I2N A;  5ICQ A;  4ZEK A;  2F7C A;  5TPA A;  1UIV A;  1IXG A;  3DLN A;  5DVI A;  3LUY A;  3FGS A;  2FA7 A;  1B0H A;  3RTW B;  3K0V A;  4ZED A;  4BDN A;  2Y7W A;  1BLF A;  3N6U A;  4GQO A;  1B51 A;  1B5J A;  3MZB A;  4MFI A;  3TMG A;  5BUU A;  4R74 A;  4ZEB A;  1QUL A;  2GFE A;  2VD2 A;  4Q8R A;  4HTG A;  1Z7M E;  5L9O A;  4OFO A;  1HSJ A;  1ATG A;  1S9T A;  1PDA A;  5AA3 A;  3TAJ A;  2HAV A;  3SDF A;  2O7I A;  5H8H B;  5CRY A;  4X1B A;  1KWH A;  3R7X A;  1AIV A;  1GTK A;  1H44 A;  4H1X A;  5HPQ A;  4H67 A;  4JXI A;  4NF4 A;  2ALU A;  3SEU A;  3ZS6 A;  3DEL B;  1FCK A;  4F29 A;  3QUJ A;  4BDQ A;  4R6H A;  1YPN A;  1ZTY A;  3PUX E;  4O3B A;  3BBR A;  3G3I A;  5LOM A;  1J1N A;  3U93 A;  2ABH A;  4KHZ E;  3QXM A;  2UVG A;  3RGY A;  4JB7 A;  3SEV A;  1FQF A;  2P1S A;  3MZ1 A;  1BP5 A;  1B46 A;  1XHY A;  1Y1M A;  4IO3 A;  2RF1 A;  4ELO A;  1NMU A;  1SVX B;  3ODB A;  4NTL A;  1WOD A;  2H99 A;  3OOA A;  1A40 A;  1JEV A;  1P1Q A;  1OVT A;  4O3C A;  4QFP A;  4YKP A;  4G77 A;  1MH3 A;  1PBP A;  2AL5 A;  5H8N B;  1B4H A;  4AQ4 A;  1XVY A;  3C33 A;  3TKD A;  1FQA A;  3TOD A;  3PU5 A;  3H7M A;  3H6W A;  1R9L A;  3JYR A;  3VV5 A;  1ZLQ A;  4HCW A;  4N6P A;  1Y3Q A;  4NED A;  1A8E A;  1LST A;  1FTM A;  1MQD A;  3MWB A;  1QKB A;  4LON B;  1LAX A;  1R6Z A;  1MY1 A;  2H9B A;  5I2K B;  1DOT A;  5K2X A;  1VFE A;  3OO9 A;  1IIW A;  1USY H;  2B3B A;  4X9T A;  4H8J A;  3TYH A;  3U1O A;  3USD A;  5BWJ A;  2DP8 A;  2HEU A;  1QVS A;  3S9L C;  4M4G A;  1MM6 A;  1B58 A;  2AIX A;  4IO6 A;  4DDD A;  3QIM A;  3MJN A;  3DP8 A;  2Y7P A;  4G68 C;  5FHN A;  1L5T A;  4KFQ A;  2PBW A;  2XXQ A;  4ZE9 A;  1SD3 A;  1POT A;  2F6P A;  1MQG A;  5JTY A;  1Y9U A;  1BTJ A;  4RPO A;  3TQW A;  2X26 A;  4LZ5 A;  5M2V A;  4NF4 B;  4U1Z A;  2RIN A;  4FEB A;  4GL0 A;  1USY E;  3C4M A;  5I56 B;  5I57 B;  3UGW A;  3L6G A;  3KSJ A;  3CG1 A;  5HM4 B;  2O68 A;  2WKY A;  3MP1 A;  4KR5 A;  4F3G A;  5JK4 A;  2V3T A;  3BFT A;  4YIC A;  5I57 A;  3RTF B;  2XXR A;  4PFW A;  5B7D A;  1JVY A;  4ND9 A;  4OZ9 A;  1OLC A;  3KG2 A;  3EF7 A;  4DXC A;  3FXQ A;  4EQ7 A;  4GL8 A;  4P0G A;  3FVK A;  2DWA A;  4OWD A;  4QSD A;  3MVX A;  1TT1 A;  3OEM A;  4DXB A;  1Y3P A;  2V3Q A;  1O7T A;  1NL5 A;  4L17 A;  3RT6 B;  1SBP A;  1EZP A;  4O3A A;  2QPQ A;  4YZZ A;  3I3V A;  3R26 A;  4KCD A;  5H8Q B;  4QHQ A;  1VR5 A;  4IY5 A;  3EQ1 A;  4GFR A;  4H5F A;  1IUD A;  1HSE A;  4C1T A;  4R72 A;  5A5X A;  3E4R A;  3UP9 A;  2XXU A;  3C32 A;  2O69 A;  3N26 A;  5KDT A;  3LSL A;  1N04 A;  4GXS B;  4TQU Q;  1SYI A;  1PEB A;  3O6H A;  4IY6 A;  4FAT A;  1A55 A;  1A8F A;  1NH8 A;  1URD A;  4Z7E A;  3THI A;  3HPI A;  4K3F A;  5I2K A;  3U8Q A;  2XXX A;  4XIG Q;  2DE3 A;  4R6Y A;  2UVJ A;  3HST A;  3O2A A;  3PGF A;  3K00 A;  3KOT A;  1NNK A;  5FHM A;  5DVJ A;  4BLA A;  5AA2 D;  2AL4 A;  1D9V A;  2I48 A;  3SKP A;  4YKJ A;  1LB8 A;  1MDP 1;  4EUO A;  3Q25 A;  1N84 A;  1M5C A;  3VDF A;  1OQH A;  3FJ7 A;  4PFU A;  2I4B A;  3UN6 A;  1GGG A;  2Q9T A;  1YCJ A;  1WDN A;  5CMC A;  2ZYM A;  4BDL A;  3FVN A;  4WKM A;  5L9M A;  4FIM A;  3H6T A;  3TCH A;  3UA8 A;  1LBC A;  3Q27 A;  4RPN A;  5AA2 A;  1EZ9 A;  3K6X A;  1T0K A;  5J1D A;  3S4U A;  5I56 A;  1B2H A;  3HHF A;  3WAF A;  3BFU A;  5TU0 A;  1Y20 A;  3S9E A;  4GD5 A;  3CRB A;  2ONK E;  3ECR A;  2ESN A;  3O97 A;  4MLQ A;  3T96 B;  2R9J A;  2QRY A;  2HZK A;  1NNT A;  1MY4 A;  4G8H A;  4X1D A;  3KSX A;  3A3U A;  1P1W A;  3KOS A;  1SW1 A;  2HQ0 A;  2XXY A;  4YMA A;  1ZKB A;  3FV2 A;  3IO4 A;  1H45 A;  1MPC A;  1NFT A;  2UYF A;  4Q5T A;  1B0L A;  3B6Q A;  3PUZ E;  2NOO A;  5H8S A;  4ZEF A;  4PP0 A;  4OEV A;  3MAM A;  1H43 A;  4ISU A;  4YKK A;  2FYI A;  1US5 A;  2FNC A;  3H03 A;  4XKR A;  3TTK A;  4NF6 A;  3TFL A;  1OMP A;  4F3B A;  1LLS A;  3IAZ A;  1UTB B;  4GWO A;  4DIG A;  3ONM A;  2XXW A;  4QSC A;  2F7A A;  1I6Q A;  1YAE A;  3C36 A;  3E3K A;  3F11 A;  4OHN A;  5TP9 B;  1MG1 A;  3EHT A;  1XVX A;  3O29 A;  4G68 B;  1MPD A;  4F3P A;  1DTG A;  3IOU A;  3IOR A;  4G68 A;  4U22 A;  5TPA B;  2OZZ A;  3DM0 A;  3OEK A;  4NWC A;  3T66 A;  2V93 A;  4F18 A;  2DVZ A;  2D5W A;  4Q0C A;  1MDQ A;  3FIR A;  1BIY A;  4QFL A;  1VFD A;  1EZO A;  1B3H A;  4I62 A;  4LZ8 A;  2HXW A;  4LA9 A;  5EHM A;  3T9V A;  4NF6 B;  5K2Y A;  2OK2 A;  3CI8 A;  4JWX A;  4BDR A;  1PB7 A;  1XOC A;  4ELQ A;  2NXO A;  2DVC A;  1AH5 A;  3Q28 A;  1B52 A;  4LVQ A;  3S9M C;  1MY0 A;  2ZXT A;  4DCX A;  1UIU A;  4RK9 A;  1B3F A;  2O84 X;  3KJ7 A;  2DOJ A;  3TUS A;  1IXC A;  3PMW A;  3QYT A;  4IO4 A;  1MY3 A;  4GIZ A;  2M8C A;  3M3L A;  4OES A;  4F3S A;  4UA8 A;  5ITP A;  2QSX A;  3L6H A;  4JWY A;  3O28 A;  3HCQ A;  3OSQ A;  3HN0 A;  2ZYO A;  3T22 A;  1DPP A;  5H8H A;  4ESX A;  2BJJ X;  2E0S A;  3CIJ A;  4LQ2 A;  4N07 A;  1OVB A;  3MUQ A;  4H6D A;  4OEU A;  4EF2 A;  4R9F A;  4PFY A;  3FJG A;  4F1Y A;  2Y84 A;  5ELV A;  1VE4 A;  3CFZ A;  4QFK A;  3TTL A;  3LR1 A;  4X48 A;  2Q2C A;  3EHS A;  2XX9 A;  4R6K A;  3IOV A;  2Y7R A;  3RT8 A;  4ONY A;  1AOV A;  1FQD A;  1Y4C A;  2V3U A;  3HHG A;  1AMF A;  4KI0 E;  4PQJ A;  3ILU B;  2XXI A;  1JW4 A;  4FE8 A;  1FTK A;  4OYV A;  3PUY E;  1ZJL A;  1LAG E;  2W7Y A;  2XX8 A;  1LFH A;  2OJT A;  2Q88 A;  3MQ9 A;  5AA1 A;  5AE4 A;  3K6U A;  4R2B A;  5KZT A;  2DYX A;  3PUV E;  2DXY A;  2QS1 A;  4ELP A;  1FQE A;  5KDT B;  2I0B A;  2P0S A;  4OQO A;  3FVO A;  4EQB A;  3TTM A;  3VLU A;  5CC2 A;  1MQJ A;  2X7P A;  2O1L A;  4OTE A;  2Q8J A;  3SEW A;  4JDF A;  3TEL A;  3M3K A;  1SYH A;  2XXT A;  3EHU A;  1B05 A;  4QFN A;  4RNS A;  4TLM B;  5H8F B;  1B1X A;  2DS9 A;  4R75 A;  3RY3 A;  2HCA A;  1FTL A;  1RYX A;  3KGC A;  4OFJ A;  1SQY A;  1TXF A;  2DSF A;  1XS5 A;  2DE4 A;  3KZG A;  4OFL A;  5TP9 A;  3FVG A;  3KFM A;  4GXA A;  4ZEC A;  1SI1 A;  2A5S A;  1UTB A;  2G29 A;  4TLL B;  3EN3 A;  3LC8 A;  3ZKK A;  4ESW A;  4KYE A;  1DTZ A;  3C35 A;  3PD8 A;  3C31 A;  4P0I A;  4ZS9 A;  4WEP A;  3TCF A;  3MW0 A;  4F19 A;  3IJO B;  1GVC A;  5L8D A;  4ZZE A;  1ZBM A;  1DMB A;  1EU8 A;  3IL1 B;  1MXX A;  1B40 A;  1N76 A;  3I6V A;  3K2D A;  5CMM A;  4IGT A;  5JTY B;  2PT1 A;  1TWY A;  3H4Z A;  3QAX A;  4P11 A;  1D9Y A;  1I6B A;  4FJP A;  1DSN A;  2CMO A;  2I3W A;  1M5D A;  3ILT B;  1MXV A;  3JZJ A;  3TCG A;  1UTH A;  3CSB A;  3V5A A;  3FXR A;  3D4G A;  5CI5 A;  1I69 A;  1MH4 A;  3EPE A;  1RYO A;  3MP6 A;  1JQF A;  4TOZ A;  2RC9 A;  3HO7 A;  3K01 A;  4H0W A;  3JV9 A;  3O6I A;  5B70 A;  3SET A;  4NF8 A;  3FJM A;  4NE4 A;  5AA4 A;  2RC8 A;  5EYF A;  3RN8 A;  1LFG A;  2VD3 A;  3R6U A;  3IR1 A;  1MXZ A;  3TEP A;  1ZU0 A;  2DE2 A;  4U2R A;  1M5B A;  1NKX A;  2Z22 A;  2GH9 A;  1ANF A;  3O66 A;  1SDX A;  2F78 A;  2QL3 A;  3A3C A;  4KYD A;  5ITO A;  3VVF A;  3LSW A;  2PMS A;  4ZDM A;  3QK6 A;  5L9S A;  3RNN A;  2A5T A;  4RYA A;  2YLN A;  4NF5 B;  3W9V A;  5AA4 B;  1IIT A;  3G3J A;  5HBC A;  3V89 B;  3IB1 A;  3KN7 A;  4XTC Q;  3PMX A;  4DLD A;  4C0R A;  5I84 A;  2HFB A;  2XXP A;  1JW5 A;  4XXU A;  4YB7 A;  1MRP A;  1S7Y A;  1LCF A;  3A09 A;  5KCJ B;  4JSO A;  1HSL A;  3GXA A;  3WAE A;  2R6G E;  1IXI A;  4F31 B;  3FAS A;  1A99 A;  4N13 A;  2GHB A;  3B7D A;  1O64 A;  1AL3 A;  4THI A;  3VLV A;  3T9U A;  1Y4T A;  3G3H A;  3IJX B;  3OO7 A;  3TTR A;  2THI A;  1B5H A;  1SI0 A;  2Z8E A;  2XX7 A;  1QJM A;  4GOT A;  2PT2 A;  4JSD A;  3G7W A;  4G8N A;  1B3G A;  4RY1 A;  4DZ1 A;  2XHD A;  3IO6 A;  3RQT A;  2O1M A;  5KCJ A;  4E0W A;  1I6A A;  4I1D A;  3QUF A;  2UYE A;  2P2A A;  3PMV A;  4U1O A;  2NUV A;  5F7V A;  4Z0I A;  4IO2 A;  3PUW E;  3OO6 A;  5F1Q A;  4HCY A;  3T9X B;  4NF5 A;  1IEJ A;  1B9J A;  2OWS A;  4OVJ A;  5FHO A;  3W9W A;  2O7U A;  3KJT A;  4IO7 A;  4LZ7 A;  3M8U A;  2H25 A;  3N5L A;  1VSO A;  3IB2 A;  3RUM A;  4RK2 A;  2F35 A;  3KEI A;  2Q2A A;  3FD3 A;  5DTB A;  1B4Z A;  2QS3 A;  4R73 A;  3ZKL A;  3E13 X;  3VXC A;  5H8F A;  1US4 A;  1SW5 A;  2Z8F A;  3PPP A;  4OEN A;  3OEL A;  3IX1 A;  1JET A;  1MXY A;  3G3F A;  2F5X A;  3LBS A;  3H6U A;  3SEY A;  5FTI A;  2V25 A;  1F9B A;  2B65 A;  2UVH A;  4U4S A;  1PC3 A;  2VGQ A;  3K1P A;  3KN8 A;  1DPE A;  1N7W A;  1Q35 A;  2QS4 A;  2RCA A;  4WXJ A;  3ZSF A;  1LGB C;  1NNF A;  3O6G A;  4H8I A;  1LBB A;  1M5F A;  3VE1 B;  4F1V A;  2ZYN A;  3DP4 A;  4LQ5 A;  2Y7K A;  1B3L A;  5H8Q A;  2NVU B;  1UTH B;  3UIF A;  4EF1 A;  1H76 A;  4EQ9 A;  4EXL A;  3TZA A;  2GRV A;  2IA4 A;  4KD5 A;  1GV8 A;  4U23 A;  1GR2 A;  1FTO A;  2REG A;  1IQ7 A;  5H8N A;  1R9Q A;  2NWJ A;  1ELJ A;  1B7U A;  2RKM A;  4G4P A;  4OMB A;  3IB0 A;  4IGR A;  1H3D A;  1ZMG A;  1QKA A;  3Q29 A;  4F2Q A;  2Z23 A;  5DEX A;  1SW2 A;  2DWH A;  3CR9 A;  3MPK A;  4R2F A;  3K6V A;  1PBQ A;  2X7Q A;  4GF8 A;  3GBA A;  2ZNS A;  4PE5 B;  2OCU A;  3OSR A;  4MLV A;  3MBP A;  4QFO A;  3MVW A;  1O63 A;  3AXF A;  4NMY A;  1A54 A;  3PPO A;  2OBG A;  4KQP A;  4LAT A;  4QSE A;  3HV1 A;  1Y3N A;  3VXB A;  3SEX A;  2OLB A;  4FAJ A;  2REJ A;  3U94 A;  1JVX A;  1OIB A;  5JEI A;  3V83 A;  3OXN A;  1Q1K A;  2F36 A;  4G2Z A;  3RPW A;  4POW A;  5FTH A;  3IOW A;  2DQV A;  1D3K A;  2F97 A;  4U21 A;  4G8M A;  3TTN A;  3IOT A;  4ECF A;  4OER A;  1A7L A;  2O6A A;  3MC2 A;  4GRK A;  1M5E A;  3K6W A;  4F1U A;  1QUI A;  3H06 B;  3SER A;  1LCT A;  1OLA A;  1N7X A;  1B5I A;  2A5T B;  4FOR A;  2G93 A;  4YU0 A;  2DXR A;  1B7H A;  3K4U A;  2ZMB A;  3DP6 A;  3GLB A;  2XD2 A;  1N0T A;  3KBR A;  4QRZ A;  4QF9 A;  5I59 A;  1NH7 A;  3PPQ A;  2I58 A;  3U72 A;  2I6E A;  4MF3 A;  4RXL A;  1P1U A;  2F7B A;  4LUB A;  5I58 A;  4Q30 B;  4UAC A;  5CBR A;  2I4C A;  3VLW A;  1MXU A;  2ZNU A;  4GLI A;  1QUK A;  2UVI A;  3N94 A;  4KPT A;  2YPN A;  1BKA A;  1JW1 A;  2PX1 A;  2I0C A;  3U92 A;  1LAH E;  3H3G A;  3VVE A;  2RC7 A;  1URG A;  4H5G A;  2H4I A;  1UQW A;  4WED A;  3SES A;  4EXK A;  3FV1 A;  1JNF A;  4POX A;  4ZEI A;  1JEU A;  2RCB A;  4I9D A;  4IO5 A;  4XKN A;  3V8X B;  1OQG A;  4F2O A;  3FZV A;  2DWJ A;  2PVU A;  4MH5 A;  3CG3 A;  4E0X A;  3TQL A;  4OET A;  2QMX A;  1MS7 A;  2ZYK A;  2Y7I A;  3CFL A;  3K1N A;  3VVD A;  1EH3 A;  2QMW A;  5DVF A;  1LB9 A;  1D4N A;  1S50 A;  5AA2 B;  5CM6 A;  2ANJ A;  3G3K A;  3PPR A;  3GBB A;  4IB2 A;  4ZE8 A;  1CE2 A;  4U4X A;  2CZL A;  1Z7N E;  2YJP A;  4RA1 A;  2KLF A;  5IAI A;  1B32 A;  3QSL A;  1Y1Z A;  3UK4 A;  2XXV A;  3FAT A;  3MPL A;  1XC1 A;  1URS A;  5CBS A;  3FXU A;  4AB5 A;  4I8C A;  4YMB A;  1FW0 A;  3TDJ A;  2HAU A;  3P7I A;  2F34 A;  4FEC A;  1SW4 A;  4C1U A;  1PB8 A;  4GVO A;  3CVG A;  1QUJ A;  5I2N B;  5I59 B;  4XKQ A;  1WVJ A;  2VOZ A;  3I5O A;  3MVZ A;  3OD7 A;  2DWI A;  1IXH A;  5CMK A;  4AB6 A;  2UXA A;  1N3X A;  1LFI A;  1N3W A;  2QS2 A;  2ZNT A;  3CFX A;  3UOR A;  4DXU A;  4NF8 B;  5IKB A;  1RKM A;  4ZZA A;  5A5X B;  1FQB A;  4MBP A;  4JWO A;  1B1H A;  5DYH A;  2OWT A;  4YKI A;  1TFD A;  4KYS A;  4ELR A;  1YTV A;  2E1S A;  1TFA A;  3OO8 A;  2R71 A;  3C34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...