2HQ0A

Structure of rafe from streptococcus pneumoniae
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
388
structure length
387
Chain Sequence
GPSSTVTIEYFNQKKEMTKTLEEITRDFEKENPIKVKVVNVPNAGEVLKTRVLAGDVPDVVNIYPQSIELQEWAKAGVFEDLSNKDYLKRVKNGYAEKYAVNEKVYNVPFTANAYGIYYNKDKFEELGLKVPETWDEFEQLVKDIVAKGQTPFGIAGADAWTLNGYNQLAFATATGGGKEANQYLRYSQPNAIKLSDPIMKDDIKVMDILRINGSKQKNWEGAGYTDVIGAFARGDVLMTPNGSWAITAINEQKPNFKIGTFMIPGKEKGQSLTVGAGDLAWSISATTKHPKEANAFVEYMTRPEVMQKYYDVDGSPTAIEGVKQAGEDSPLAGMTEYAFTDRHLVWLQQYWTSEADFHTLTMNYVLTGDKQGMVNDLNAFFNPMKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structures of RafE from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Sugar binding protein
molecule keywords Sugar ABC transporter, sugar-binding protein
total genus 136
structure length 387
sequence length 388
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hq0A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hq0A02
4FEBA 4G8HA 3K4UA 3CG1A 4MLVA 4EF1A 4MF3A 1GTKA 4JBZA 1FQCA 1O7TA 4DCYA 1VSOA 1LLSA 1B3HA 2THIA 2ZYOA 2DSFA 3JZJA 3Q25A 4GRKA 4KYSA 1OMPA 2XD3A 2WKYA 3KEIA 1BLFA 1Q1KA 1QUKA 2O1LA 2GHAA 4H1XA 1EZOA 4PP0A 4R9GA 3LC8A 4ISUA 2AL4A 2H4IA 3T22A 4IO5A 5CMKA 2GRVA 3IL1B 2Y7PA 1YTVA 2PMSA 4NMYA 4JWYA 1I6BA 4BDMA 1B46A 3MPKA 1NFTA 4YMBA 3H3GA 1WODA 2NWJA 1MXWA 3VVDA 2ZYKA 4ZECA 5KCJB 3FVNA 4G77A 4YU0A 1AH5A 2NVUB 2XD2A 4EQBA 2XXIA 4O3CA 4H5FA 2I4CA 2DWHA 3UORA 3RN8A 1B1HA 1SBPA 1USYE 2O6AA 4XIGQ 4R2BA 1OLAA 5H8QA 5L8DA 4ZEDA 4F3GA 1QVSA 4F1UA 3CVGA 3U93A 2D3IA 3KN7A 3OEMA 4MH5A 4OEUA 4OETA 3TCHA 3W9VA 3PU5A 1PB7A 2AIXA 4TLLB 1MPDA 2F35A 5I59A 4OFJA 3HO7A 1AOVA 2ABHA 1IIWA 3OOAA 4KCCA 4QRZA 4U1OA 1M5FA 2GFEA 2IA4A 3Q29A 4IO7A 3VFJA 3WAEA 4F22A 3U72A 2UVIA 4JSDA 1N7XA 2QMWA 3MP6A 4G2ZA 2FA7A 1Y4CA 4IO6A 1P1OA 1SDXA 3SEUA 2YJPA 4NWCA 1B52A 3KJTA 1HSEA 2NXOA 2X26A 2Q88A 1XOCA 1EU8A 1MRPA 1OVTA 3E9XA 4TLMB 5FHOA 3DLNA 3OO7A 4HCYA 1MDQA 2LAOA 2RKMA 3DELB 2DXYA 4LZ7A 4KCDA 4OQOA 4ZDMA 5JTYB 3U8QA 3LBSA 4GQOA 1MXYA 2O7IA 4X9TA 2B3FA 2PX1A 4G4PA 3IK6B 4KFQA 3B6TA 4R6KA 2O68A 1NH8A 2YPNA 4QFLA 5FTIA 3H6UA 4OZ9A 2RINA 3OENA 2OCUA 2VP1A 1FQFA 3K02A 2OJTA 4F1VA 3K1NA 1IXIA 2UXAA 3E4RA 1TXFA 4DXCA 3RTWB 5FTHA 3OMBA 4NF5A 5AA4A 1Y3QA 1B5HA 3PMXA 4QHQA 3MZBA 3U1OA 3FXQA 5H8HB 5AA1A 4R75A 4E0WA 2KLFA 3M8UA 5KZTA 3TYHA 2H5YA 1O64A 3FJ7A 3KBRA 2HZKA 5TU0A 4WKMA 4RPNA 3T93B 4HW8A 4YKIA 2OLBA 4WXJA 4OERA 3KFMA 4X1BA 1B5JA 3GXAA 1XVYA 3K6XA 3MAMA 3EN3A 4EQ7A 1JEUA 1YCJA 3VLUA 2F78A 3QUFA 4ONYA 1SQYA 3Q28A 4IO2A 1FTLA 1IXHA 3PMWA 3U92A 3N6UA 2QSXA 2QS3A 1Y4TA 2OZZA 4Z7EA 4IGTA 3OXNA 4DE8A 1H45A 3H7MA 4FATA 4JWXA 1NNFA 3TTLA 4PETA 5J1DA 4JXIA 1QUIA 2R71A 1FTJA 4DDDA 4LUBA 4Z0IA 2O1MA 4RXLA 3W15C 2DYXA 3HHGA 1SYIA 1XHYA 3VLWA 4H67A 1Y3NA 1N3WA 4ZZAA 1B2HA 1LCTA 1MQJA 3KSJA 4H5GA 4OMBA 2H9BA 1ZIUA 4QFKA 2F7AA 1JVXA 1YAEA 2XX9A 4OENA 4UA8A 4ZZEA 1IZ1A 1PB9A 3I5OA 3R26A 5H8FB 3WAFA 3Q26A 4RJZA 2RCAA 1UIUA 1A8FA 1AMFA 2QS4A 3OELA 3PUXE 4JB7A 5JEIA 3V83A 1A8EA 1I69A 2Z22A 4PFYA 3MP8A 1LFGA 1HSJA 3GLBA 1LAFE 3HCQA 3S9EA 4EXKA 3RTFB 3H6VA 4GXSB 3FV2A 5CI5A 1VR5A 1XVXA 2O84X 4P0GA 5CBRA 2QS1A 5JK4A 1B4ZA 5CMCA 1P1QA 3PMVA 2ANJA 5I2KA 3KGCA 2PYYA 3RPWA 3FVKA 1IUDA 1LGBC 1H43A 2DQVA 3K2DA 3BFTA 1URSA 3MZ9A 2VGQA 3T66A 1UTBA 1ZU0A 4RPOA 3VVFA 2Y84A 3OD7A 3KZGA 1LB9A 4N07A 1B51A 2F6PA 4ESXA 1MPBA 4NF4A 5ELVA 4KYDA 4KD5A 5BWJA 5I58B 1BP5A 1LSTA 4TQUQ 3ONMA 4HCWA 4OESA 2XXRA 1NNKA 3U94A 1Y20A 3H6WA 1T0KA 5CBSA 1R9LA 1NMUA 2D5WA 3MZ1A 4OXVA 3EQ1A 5TP9B 3K6WA 1A55A 2XXUA 3FASA 3HV1A 4F31B 4LZ8A 4U22A 2DVZA 3JYRA 4H0WA 1OLCA 1JW1A 2HXWA 1RYOA 3S4UA 2QS2A 5FHNA 5I58A 3B6QA 5BUUA 3CFXA 4NF4B 3RGYA 3FD3A 4X48A 1J1NA 2PT1A 5I56B 1GV8A 3QXMA 3EHUA 1JEVA 1B9JA 1XS5A 3N26A 3IJXB 2Q2CA 3Q27A 3LR1A 4G68C 2A5TB 4KPTA 3TAJA 2I58A 4I9DA 2YLNA 3O9PA 3EHSA 1MPCA 2P0SA 4XKRA 3ZKLA 2PBWA 1NL5A 4N6PA 3IOUA 4OTEA 3G3HA 1MQDA 5CMBA 3S9MC 3V8XB 1O63A 2V25A 3PPOA 1B40A 3G3IA 3IB2A 3MUQA 4LP2B 5KCJA 2F34A 1R9QA 1NKXA 3F11A 5A5XA 1CE2A 3ILUB 4KYEA 1B0LA 1PEBA 2E0SA 1NH7A 3K0VA 3OO8A 2M8CA 2V84A 3OSQA 4Q30B 1H44A 1DPEA 4U2RA 4KHZE 2I3VA 1TWYA 2V3QA 5F7VA 1Z7NE 4XTCQ 2O51A 1OIBA 4R6YA 5DVIA 4ELQA 4F18A 4OFOA 3PPQA 3CIJA 2OWSA 1URDA 3IR1A 4YB7A 1HSLA 3JV9A 3IO6A 5FHMA 3IJOB 4ZEBA 1B3LA 1USYH 2I49A 3N6TA 3G7WA 4QSDA 4MBPA 4YZZA 4NF8B 1FQEA 2F7BA 3BFUA 3SESA 3TFLA 1B6HA 4F2OA 3DP4A 4HS7A 4K3FA 2QL3A 2XXPA 4OWDA 1Z7ME 1II5A 3MVXA 3SERA 3PGFA 1S7YA 1ZKBA 1WVJA 1S50A 1POTA 3G3GA 5I2NB 4IO3A 1FTKA 3C31A 1IXGA 3A09A 4GIZA 4PQJA 3SDFA 4FECA 1B0HA 4H65A 4NEDA 2VD3A 3MC2A 3PUVE 2DWIA 4M1VA 4OHNA 1GVCA 2I0CA 2NOOA 2ZNTA 3FUZA 4H6DA 3N94A 1Y3PA 2RCBA 3K00A 3USDA 4MFIA 3O28A 1URGA 3FGSA 1SW2A 3FV1A 4BDLA 1SI1A 3FXUA 5HPQA 1BIYA 1MDP1 5I2NA 2HQ0A 3QIMA 1H3DA 5K2YA 2F6GA 2DE2A 5H8QB 3O29A 3LSWA 3ZSFA 3O2AA 1TT1A 2D21A 3M3FA 4DXUA 2RC8A 4XKPA 3RUMA 4POWA 1CB6A 3TTMA 4IO4A 4ELOA 5IKBA 2H99A 2ZXTA 5L9OA 1B05A 3E13X 4Q8RA 3HN0A 4FAJA 3ODBA 4FORA 1DTZA 2HAUA 2RF1A 1PBPA 2OBGA 1B32A 3KSXA 3MPLA 4GD5A 1R6ZA 4KI0E 3RLFE 1OVBA 3R7XA 1ZJLA 1UTBB 1DMBA 2RC9A 1WDNA 2DXRA 4YKPA 3RY3A 3TCGA 1XT8A 4U23A 4ZE8A 3GZGA 4G68B 3T9HB 4AB5A 3MVZA 3H03A 1B58A 4LA9A 4QSEA 2F8DA 3K6UA 4EDPA 3SEXA 1N84A 1M5BA 1TFAA 1SVXB 1NNPA 4LZ5A 3V5AA 5AA4B 2ALUA 1MY1A 1RYXA 3M3KA 4ZEFA 3MVWA 5DTBA 1KWHA 2DE3A 3UA8A 5CMMA 2XX8A 2Y7IA 3K6VA 4RNSA 4C1TA 2Q89A 1B1XA 1OQHA 5L9MA 2F36A 4NWDA 4DXBA 2ONSA 3KOSA 1UQWA 3D4CA 1QJMA 3H6TA 1FQBA 3I6VA 3L6HA 4LATA 4P11A 5ICQA 4R72A 4XXUA 3LSFB 5JTYA 2RC7A 1OQGA 3ECRA 3SEVA 4DLDA 3UGWA 1US5A 4GVOA 1FQDA 5ITOA 3TELA 5H8FA 2A5TA 3QUJA 3HPIA 2ESNA 1MY4A 4LVQA 2G93A 3TTKA 1XC1A 2ZMBA 1SW4A 1MQGA 1B3GA 3R6UA 1B7ZA 4EUOA 2XXHA 3C32A 3D4GA 3EPEA 4QFNA 4E0XA 2ZNSA 2QPQA 2DP8A 3IX1A 5AE4A 3A3CA 3T9XB 3EF7A 4F3BA 2UVHA 3T9VA 1AL3A 1QW0A 3OSRA 4TOZA 3DP8A 3IAZA 4POXA 3TTRA 4IY5A 1P1WA 2HZLA 4NF8A 3C34A 4RK2A 4F3PA 3RNNA 4DZ1A 4WEDA 4BDOA 2B65A 2Q8JA 3N5LA 2Y7WA 3VLVA 1FTOA 4IB2A 4N13A 4OEVA 3T9UA 4O3BA 2DS9A 3CR9A 3FIRA 5EHSA 2F97A 1I6AA 2VHAA 2DOJA 3UIFA 2DVCA 1B4HA 4U4SA 4YMAA 1DSNA 2B3BA 2Q9TA 5F1QA 4QF9A 3T96B 4F3SA 1N04A 3CI8A 4G68A 2BJJX 4Q0CA 3SEYA 4YB5A 3TCFA 3VDFA 2I48A 3SEWA 3FZVA 4NF5B 4P0IA 1QKAA 2Z23A 4FEDA 2Y7KA 1VFDA 2P2AA 4M4GA 4XKQA 5H8HA 3TQLA 1JQFA 1QKBA 3BBRA 5I2KB 3VXCA 4U4XA 1MH3A 3CSGA 1ZTYA 4H8IA 3TZAA 3FXRA 5AA2B 3KN3A 4ZEIA 1EH3A 1VE4A 3PPPA 1QUJA 1UTHB 2Z8FA 3ZS6A 1B5IA 5M2VA 3O97A 4U1ZA 1B3FA 1IEJA 1LAHE 1MQHA 2XXVA 1JW4A 2DWJA 1GGGA 2R9JA 2V3TA 4I1DA 4EXLA 4ZE9A 3PUWE 1PC3A 2CZLA 2XXTA 1RKMA 2HEUA 3PUYE 4EQ9A 5I56A 5I57B 4U21A 4F19A 3TEPA 1B7HA 2HCAA 2OK2A 3OO9A 3RT6B 3QYTA 3SETA 3VXBA 3A3UA 4H8JA 3HHFA 4NTLA 1ATGA 2I4BA 2R6GE 1IQ7A 3IOTA 3P7IA 4PFUA 4RK9A 3TDJA 3ILTB 1ELJA 1FQAA 1LCFA 1M5CA 1P99A 2F7CA 2UYFA 3MWBA 5B7DA 3CG3A 2H98A 5TPAB 3O66A 3E3KA 1MS7A 4BLAA 5KDTB 1Y9UA 3CRBA 3M3LA 1DTGA 3AXFA 3I3VA 4KR5A 4ZEKA 5TP9A 3QK6A 4GWOA 3RQTA 4EF2A 5I59B 4PFWA 3MW0A 3TUSA 3GBBA 4YAHX 5DEXA 5L9SA 1M5DA 4JSOA 1F9BA 1SD3A 3C4MA 4HTGA 4R73A 1N7WA 3KN8A 3PUZE 3PD8A 1LAXA 1QULA 2A5SA 4I8CA 4C0RA 4C1UA 4GOTA 2AL5A 4I62A 2W7YA 1A54A 2PVUA 4THIA 4RA1A 4JWOA 3O6IA 1ANFA 3FJGA 5I57A 1MG1A 1MM7A 3CFLA 5EHMA 4ELRA 1ZBMA 3MQ9A 4GLIA 3IB0A 2QJEA 3QAXA 1N3XA 1VFEA 2DE4A 4LQ2A 5EYFA 4YKJA 3UN6A 4GL8A 2CMOA 1BTJA 4ECFA 5AA3A 3LSXA 5CM6A 4FJPA 5DT6A 1LB8A 1AIVA 1P1NA 5CRYA 3OO6A 2Q2AA 1JNFA 1D9YA 1PBQA 2E1SA 1N76A 2AYSA 1NNTA 3MJNA 4RYAA 1LBBA 5HM4B 1M5EA 2FNCA 4YICA 4R74A 1A7LA 2G29A 1YPNA 5H8NA 3O6GA 2P1SA 2VD2A 2ZNUA 4NF6B 4LQ5A 3K1MA 1MM6A 3UK4A 4ND9A 5A5XB 5B70A 1MY3A 2XX7A 2XXWA 2GHBA 1PDAA 2NUVA 1DPPA 4G8MA 4QFOA 1FTMA 3IOVA 5IAIA 2XXYA 3PPRA 1PB8A 4BDNA 2V93A 4OFLA 5I84A 3PV0E 1IXCA 1POY1 2ONRA 4OVJA 4O3AA 4R6HA 4G8NA 2Z8DA 5DVJA 2GH9A 4NE4A 1US4A 5KDTA 4PE5B 4IGRA 2DWAA 2QRYA 4R9FA 3H4ZA 3TODA 5H8NB 1P1UA 2H25A 2UYEA 1IITA 2X7PA 2O69A 2ZYMA 3FJMA 3IO4A 3G3KA 1MQIA 2FYIA 5ICTA 3CFZA 1UIVA 4RY1A 5K2XA 4AQ4A 3S9NC 4UACA 2I3WA 1A40A 4ZS9A 3S9LC 1JETA 2VOZA 5LOMA 4NF6A 3GBAA 3LUYA 1Q35A 1TFDA 3H06B 3C33A 1JVYA 3DP6A 3C9HA 1A99A 1D3KA 4X1DA 3UP9A 3B6WA 2HAVA 3FVGA 1ZMGA 4L17A 3C36A 2I6EA 3VV5A 5HBCA 4BDQA 4LONB 3PD9A 1B7UA 1SYHA 1UTHA 3FATA 4DIGA 1LFHA 3FVOA 4GF8A 3QSLA 4GL0A 5AA2A 4IY6A 1MXUA 4GXAA 3HSTA 3L6GA 2ONKE 2ZYNA 4FIMA 2O7UA 3KOTA 5DVFA 3ZKKA 1MXXA 4PFTA 4ELPA 3S2VA 2XXXA 4DCXA 1B3EA 1H76A 1Y1ZA 1EZPA 3VVEA 4OYVA 3TQWA 2V3UA 4YB6A 1MXZA 5AA2D 5ITPA 1MY0A 3TMGA 1D9VA 1FW0A 1LAGE 2PT2A 2Z8EA 3PPNA 2Y7RA 4MLQA 5DEXB 4YKKA 2F5XA 2REJA 1LBCA 1I6QA 1Y1MA 2IEEA 3V89B 1FCKA 4WEPA 4F2QA 1BKAA 4FE8A 3VE1B 1N0TA 2XHDA 5TPAA 1D4NA 4JDFA 4ESWA 2QMXA 4QFPA 3RT8A 4F29A 1S9TA 4BDRA 2I0BA 2OWTA 1SW1A 3TTNA 1EZ9A 1JW5A 3KJ7A 5DYHA 3EHTA 3G3FA 1R1NA 4GFRA 3MP1A 2UVJA 1LFIA 2XXQA 5ISUA 1MY2A 3DM0A 3OEKA 3K01A 2UVGA 2HFBA 3TPAA 4R2FA 3IOWA 3BKIB 1GR2A 3CSBA 3LSLA 4Q5TA 3SKPA 4QSCA 4KQPA 3K1PA 4F1YA 5CC2A 2REGA 3IORA 3TKDA 1DOTA 4XKNA 3O6HA 1SI0A 3W9WA 1MH4A 4F39A 4AB6A 3G3JA 1ZLQA 3MVYA 3THIA 2X7QA 3B7DA 3C35A 3MBPA 1L5TA 3KG2A 5H8SA 1SW5A 1MXVA 3IB1A
chains in the Genus database with same CATH superfamily
3K4UA 4MLVA 4FBPA 1FQCA 3JZJA 2DSFA 1KZ8A 2XD3A 3KEIA 4H1XA 2O1LA 2GHAA 3ISPA 3LC8A 4ISUA 2PMSA 1IMBA 3MPKA 3ROJA 3VVDA 4ZECA 3FVNA 2XD2A 4P56A 4GWZA 3UORA 4XIGQ 4R2BA 1OLAA 1FTAA 4F3GA 4F1UA 3CVGA 3U93A 2JJKA 4TLLB 5I59A 3HO7A 1IIWA 3OOAA 4QRZA 1FPEA 2GFEA 4IO7A 3U72A 2QMWA 1P1OA 5DW8A 2YJPA 1VDWA 4HCYA 5JTYB 3LBSA 4GQOA 1MXYA 4R6KA 1NH8A 4QFLA 2OCUA 3RTWB 5AA4A 3PMXA 4PCDA 5H8HB 3M8UA 3KBRA 3T93B 4RPNA 4YKIA 4OERA 4AS4A 1B5JA 3EN3A 4N8YA 4IO2A 4NGUA 2OZZA 4Z7EA 1K9ZA 4IGTA 3H7MA 3PTYA 4PETA 1QUIA 1SYIA 1XHYA 1Y3NA 4QFKA 2H9BA 4ZZEA 1JVXA 4UA8A 1G0IA 5H8FB 3WAFA 4GBWA 3PUXE 3OELA 5IZ3B 3V83A 3GLBA 3HCQA 4EXKA 4GXSB 3FV2A 5CI5A 5CBRA 1B4ZA 2ZZVA 5I2KA 3KGCA 2VGQA 1FJ9A 2PFZA 1LBYA 1FPKA 3KZGA 2F6PA 2WEFA 1RDZA 5ELVA 1BP5A 1LSTA 2XXRA 1NNKA 3U94A 1T0KA 3FASA 3HV1A 2DVZA 3JYRA 4H0WA 2QS2A 5I58A 2WYPA 4MCOA 5I56B 1GV8A 1XS5A 4G68C 1LEVA 3LR1A 1IMEA 1LBVA 1MPCA 4UABA 3ZKLA 1NL5A 5CMBA 2Y5LA 1O63A 3F11A 1R9QA 5A5XA 4X04A 4DLDA 1PEBA 5I84A 1NH7A 2M8CA 1DPEA 1SPIA 2V3QA 5F7VA 4XTCQ 5DVIA 3CIJA 3IR1A 5FHMA 4DZ1A 4F2OA 3DP4A 3FXBA 3SERA 1FPIA 4IO3A 3A09A 4G61A 4H65A 1GVCA 3U65A 3MC2A 2DWIA 3FUZA 4N6KA 3O28A 1BIYA 3QIMA 1H3DA 2XWOA 1TT1A 2D21A 4O7IA 1CB6A 4ELOA 2CEYA 2RF1A 2OBGA 1R6ZA 5A5LA 1ZJLA 4YKPA 3TCGA 4U23A 1NI9A 1B58A 4QSEA 3K6UA 5EQ8A 3SEXA 1M5BA 1SVXB 4ZEFA 3M3KA 1OQHA 2XWKA 4DXBA 2ONSA 3L6HA 1QJMA 1FQBA 5JTYA 1US5A 3TELA 2BJIA 5H8FA 1MY4A 2G93A 3NOHA 2OX3A 3R6UA 1MQGA 4QFNA 4E0XA 2ZNSA 4NX1A 3IX1A 3OSRA 2OWZA 4OVPA 4WEDA 4O3BA 5EHSA 4PAFA 2F97A 2VHAA 4U4SA 1DSNA 5I7IA 3T96B 5EQAA 3VDFA 2I48A 4P9KA 1VFDA 4GWSA 4XKQA 4U4XA 4H8IA 4ZEIA 1UTHB 2Z8FA 1B3FA 3PUWE 1PC3A 2CZLA 2XXTA 1RKMA 2HEUA 3CHGA 4EQ9A 4F19A 4JVIA 3RT6B 4H8JA 1IQ7A 3IOTA 4PFUA 3ILTB 2UYFA 1M5CA 2H98A 4PFBA 5TPAB 2WX9A 3O66A 4BLAA 3CRBA 3M3LA 4PFWA 3MW0A 4YAHX 5IZ1A 1M5DA 3KN8A 2FBPA 3PUZE 3PD8A 4OA4A 4MEVA 1NUXA 4GOTA 5F24A 2W7YA 3FJGA 1MM7A 4GLIA 5AA2D 5EYFA 4YKJA 1BTJA 5AA3A 4FJPA 4HE0A 4XFEA 4PFIA 2L5VA 1NNTA 3MJNA 4RYAA 1LBBA 1A7LA 2G29A 4ND9A 5A5XB 2XX7A 2XXWA 3PV0E 1FBFA 1POY1 4O3AA 2QRYA 1FBCA 3H4ZA 3TODA 4KXPA 3FJMA 3IO4A 2B4MA 1MQIA 4RY1A 4ZS9A 5LOMA 4QXDA 3H06B 5EYGA 3UP9A 3B6WA 2HAVA 1ZMGA 3C36A 1LFHA 3HSTA 1FBEA 4ELPA 1MXXA 3S2VA 3TQWA 1MXZA 2Z8EA 5ESYA 2PT2A 3PPNA 4MLQA 2Y7RA 4OVRA 5DEXB 1Y1MA 1FCKA 3HFUA 1BKAA 4LN5A 2QMXA 4JVCA 2I0BA 2OWTA 1SW1A 3GYYA 3KJ7A 3EHTA 1R1NA 3OEKA 4Q5TA 3SKPA 3TKDA 4AB6A 1ZLQA 3MVYA 1L5TA 5H8SA 4FEBA 4G8HA 3CG1A 4EF1A 4MF3A 4JBZA 1VSOA 1LLSA 4KYSA 5H8NB 1FBPA 2WKYA 1BLFA 1EZOA 3T22A 1YTVA 4JWYA 1I6BA 4NQ8A 1NFTA 3H3GA 1MXWA 5KCJB 4YU0A 4O3CA 2DWHA 1G0HA 1B1HA 1SBPA 1USYE 2FHYA 2O6AA 3KN7A 4OEUA 3TCHA 2AIXA 1MPDA 2F35A 2ABHA 4U1OA 3RPLA 3Q29A 3VFJA 4F22A 4JSDA 5I3SA 4G2ZA 2FA7A 1Y4CA 1SDXA 3SEUA 3KJTA 2Q88A 1EU8A 1MRPA 3OO7A 3E79A 1MDQA 4PGNA 4OQOA 3U8QA 4ZDMA 2O7IA 2B3FA 2PX1A 4G4PA 3B6TA 2O68A 4OZ9A 1FQFA 2OJTA 2UXAA 5FTHA 3OMBA 4NF5A 3BIHA 3MZBA 3BIGA 5KZTA 5TU0A 2HZKA 4X1BA 1KA1A 3VLUA 3QUFA 1FTLA 3N6UA 4N17A 2QSXA 1Y4TA 5IZZA 4JWXA 5J1DA 5J16A 4P8BA 4Z0IA 4QBAA 3VLWA 4H67A 1LCTA 4OMBA 3KSJA 1ZIUA 1NUYA 4OENA 1YAEA 4P1EA 3RUMA 1IZ1A 1PB9A 1UIUA 2QS4A 1AMFA 4JB7A 1I69A 4PFYA 1LFGA 1LAFE 3H6VA 1VR5A 1XVXA 5JK4A 5CMCA 2PYYA 1LGBC 5ET7A 3T66A 1UTBA 3OD7A 1LB9A 4N07A 4KYDA 5BWJA 4HCWA 4OESA 1R9LA 4P3LA 4MX6A 1NV7A 5TP9B 2VPOA 1A55A 4PDHA 1OLCA 2HXWA 1RYOA 5FHNA 4MNCA 4NF4B 2PT1A 3EHUA 3B8BA 3TYHA 3Q27A 4I9DA 2YLNA 2P0SA 4NN3A 2VT5A 2PBWA 3IOUA 3G3HA 2V25A 3PPOA 4LP2B 5KCJA 1B0LA 4Q30B 3K0VA 3OO8A 3OSQA 1H44A 4U2RA 2I3VA 4P47A 4R6YA 4OFOA 3PPQA 1K9YA 2F3DA 1HSLA 3JV9A 3IO6A 3IJOB 1B3LA 4YZZA 4F18A 1B6HA 2QL3A 2XXPA 1Z7ME 3RPLB 1II5A 1S7YA 4H6DA 4DI4B 3N94A 1Y3PA 3K00A 2P3VA 4MFIA 3FGSA 1SW2A 3FXUA 5K2YA 2F6GA 2DE2A 4NAPA 3O2AA 3M3FA 4IO4A 3ODBA 2HAUA 4OANA 1UTBB 1DMBA 2RC9A 2DXRA 4G68B 1N84A 5AA4B 1NNPA 4LZ5A 1KWHA 3UA8A 2HXRA 3K6VA 4RNSA 4C1TA 4OVTA 2F36A 3VXBA 4LATA 3I6VA 4P11A 4R72A 3ECRA 4GVOA 3HPIA 3TTKA 2ZMBA 5AE4A 4PAIA 3T9VA 1AL3A 1QW0A 4TOZA 3IAZA 2FIXA 4IY5A 4NF8A 4F3PA 4O8MA 4BDOA 2B65A 2Q8JA 1JP4A 3FIRA 1NV3A 2DOJA 2Q9TA 1N04A 3CI8A 4Q0CA 1LBXA 4NF5B 1FPFA 2Z23A 4M4GA 2P2AA 5H8HA 1JQFA 5I2KB 3TZAA 1DBZA 4GWXA 3FXRA 1QUJA 1B5IA 1LAHE 2R9JA 5I56A 3TEPA 1B7HA 2HCAA 2P3NA 3P7IA 1CNQA 1FQAA 1P99A 3E3KA 5KDTB 4KR5A 4ZEKA 4EF2A 3QK6A 3GBBA 1IMAA 1SD3A 4HTGA 4R73A 1N7WA 3QMFA 1LAXA 4I8CA 1FBDA 2CZIA 4RA1A 4JWOA 1ANFA 3MQ9A 1N3XA 4GL8A 4ECFA 1AIVA 3OO6A 2Y5KA 1KA0A 5HM4B 4YICA 4R74A 1NUWA 3O6GA 4P1LA 2XWVA 4NF6B 4LQ5A 5B70A 2GHBA 2NUVA 4QFOA 2QFLA 3PPRA 4BDNA 1PB8A 4N4UA 2V93A 4OFLA 4G8NA 5IGAA 4NE4A 1US4A 4PE5B 2H25A 2UYEA 3CFZA 2CEXA 3S9LC 4NF6A 4MNPA 1A99A 4L17A 3PD9A 1BK4A 1B7UA 1UTHA 3FVOA 5AA2A 4IY6A 1MXUA 4HE1A 4GXAA 2ONKE 4N8GA 4FIMA 3KOTA 2WYKA 1MY0A 1D9VA 1FW0A 3KC0A 4YKKA 2REJA 1LBCA 3V89B 4WEPA 4F2QA 4FE8A 3VE1B 5I5PA 4F29A 3RT8A 5DYHA 1LFIA 3IOWA 3CSBA 4KQPA 5CC2A 2REGA 4MNIA 3W9WA 4F39A 3G3JA 2X7QA 3B7DA 3C35A 4H46A 1MXVA 1GTKA 1O7TA 1B3HA 2ZYOA 3UIFA 4DCYA 4GRKA 1QUKA 4PP0A 2AL4A 4BDMA 4YMBA 1FPBA 1AH5A 2NVUB 4EQBA 4H5FA 2I4CA 3KBZA 4ZEDA 5L8DA 1QVSA 2D3IA 3OEMA 4HXVA 4OETA 1PB7A 4OFJA 1RDYA 4GWYA 4KCCA 1M5FA 2IA4A 4O94A 4PGPA 3WAEA 1N7XA 3MP6A 2WBBA 4NWCA 1B52A 1HSEA 2NXOA 3E9XA 1OVTA 5FHOA 2DXYA 4KCDA 4X9TA 3D1RA 3IK6B 2YPNA 3H6UA 4GX6A 3K02A 4F1VA 1FPLA 1Y3QA 1Q9DA 3FXQA 5AA1A 5T3JA 4R75A 3A29A 4E0WA 2KLFA 3FJ7A 1O64A 4WXJA 3KFMA 3GXAA 3K6XA 1YCJA 2F78A 1DCUA 1SQYA 1IXHA 1RDXA 2QS3A 1AWBA 4AS5A 3OXNA 4DE8A 4HE2A 4JXIA 2R71A 1FTJA 4DDDA 4LUBA 4RXLA 3W15C 2DYXA 4O7MA 1N3WA 4ZZAA 1B2HA 1MQJA 5L9SA 2F7AA 2XX9A 4RJZA 2RCAA 4PFRA 3S9EA 2O84X 4P0GA 2QS1A 3PMVA 3FVKA 1H43A 3BFTA 1URSA 3MZ9A 1ZU0A 4RPOA 2R8TA 2Y84A 1B51A 1MPBA 4NF4A 4KD5A 5I58B 1YZ0A 3ONMA 5ET5A 3H6WA 2D5WA 4OXVA 3K6WA 4F31B 4PBQA 3S4UA 3B6QA 3FD3A 4X48A 4N15A 1JEVA 4KPTA 2A5TB 3O9PA 4I40A 5LTCA 4N6PA 4OTEA 1MQDA 3LUZA 2QVVA 1B40A 3G3IA 3MUQA 2F34A 1CE2A 3ILUB 2V4CA 2V84A 4I3YA 1OIBA 2OWSA 1URDA 4YB7A 1USYH 2I49A 4QSDA 4MBPA 4NF8B 3SESA 4HS7A 4K3FA 4OWDA 3MVXA 1ZKBA 1WVJA 1POTA 1IXGA 3SDFA 1B0HA 4NEDA 4OHNA 2VD3A 2I0CA 2CZKA 2NOOA 2RCBA 3FV1A 1SI1A 4PC9A 5HPQA 1MDP1 5I2NA 5H8QB 3O29A 3LSWA 3ZSFA 2QVUA 3TTMA 2H99A 2ZXTA 1B05A 3HN0A 4FAJA 4ESWA 3KSXA 1PBPA 3MPLA 4KI0E 1OVBA 3RY3A 4PAKA 1WDNA 1XT8A 2PCRA 3T9HB 4AB5A 3MVZA 3H03A 4LA9A 3V5AA 1MY1A 3MVWA 2DE3A 5CMMA 2Y7IA 2Q89A 3KOSA 1UQWA 3H6TA 5ICQA 1IMDA 1OQGA 3SEVA 2A5TA 3QUJA 2ESNA 4LVQA 1XC1A 5FBPA 1SW4A 1B3GA 1B7ZA 2XXHA 3EPEA 2QPQA 3T9XB 2UVHA 2HZLA 3C34A 3RNNA 4NG7A 1FRPA 2Y7WA 3VLVA 3T9UA 5IAIA 2DS9A 3CR9A 1I6AA 2DVCA 1B4HA 4YMAA 5F1QA 4QF9A 4F3SA 2QVRA 3SEYA 2BJJX 3TCFA 1LBZA 4P0IA 1QKAA 4FEDA 3TQLA 3VXCA 3BBRA 3CSGA 1VE4A 2XXVA 1JW4A 1GGGA 4EXLA 5I57B 3MSTA 3IFCA 5LDZA 3OO9A 3SETA 3A3UA 1LBWA 3HHFA 2I4BA 4NTLA 2R6GE 1INPA 1MS7A 1Y9UA 1DTGA 3I3VA 3KC1A 5I59B 4PDDA 3C4MA 3FBPA 1QULA 4I62A 4THIA 3O6IA 5I57A 3CFLA 5EHMA 1ZBMA 4LQ2A 2QJEA 3QAXA 4PBHA 3UN6A 3MYUA 2CMOA 5DT6A 5CRYA 5IZ3A 1D9YA 1PBQA 2E1SA 2AYSA 2FNCA 4NHBA 2HHMA 4JVDA 1YPNA 1NUZA 4IR8A 1MY3A 1PDAA 4G8MA 3IOVA 2XXYA 2DDKA 1IXCA 2ONRA 4OVJA 2Z8DA 2GH9A 4IGRA 4R9FA 1P1UA 1IITA 2X7PA 2ZYMA 4PF6A 2FYIA 1UIVA 4AQ4A 1A40A 4I3EA 1JETA 3GBAA 3LUYA 1Q35A 1TFDA 5ET8A 1FJ6A 1JVYA 3DP6A 3C9HA 3FVGA 3VV5A 4LONB 3QSLA 3L6GA 2O7UA 3ZKKA 2HPGA 4PFTA 1EZPA 2XXXA 4DCXA 1B3EA 1H76A 1Y1ZA 4GBVA 3VVEA 5EYHA 2V3UA 4YB6A 3TMGA 1LAGE 1XI6A 2IEEA 2XHDA 1NV0A 1D4NA 4JDFA 5TPAA 1S9TA 4BDRA 1JW5A 1NV5A 3RYDA 3MP1A 2UVJA 2XXQA 5ISUA 1MY2A 1EYJA 2HFBA 3BKIB 1GR2A 3LSLA 4F1YA 3IORA 4GWWA 3KG2A 3PUVE 1SW5A 3IB1A 1YYZA 2THIA 3ZS6A 3Q25A 1OMPA 1Q1KA 4R9GA 2H4IA 5CMKA 4IO5A 2GRVA 3IL1B 2Y7PA 4NMYA 1B46A 2NWJA 1WODA 2ZYKA 4G77A 2XXIA 4N81A 3RN8A 5H8QA 4MH5A 3W9VA 3PU5A 1NV6A 1DK4A 2UVIA 4IO6A 2X26A 1XOCA 4TLMB 3DLNA 2XA5A 2LAOA 2RKMA 3DELB 4LZ7A 4KFQA 5FTIA 2RINA 3OENA 2VP1A 3K1NA 1IXIA 3E4RA 4DXCA 1TXFA 4PE3A 1B5HA 4QHQA 3U1OA 4OVQA 2H5YA 3TUSA 4WKMA 4HW8A 2OLBA 3MAMA 1XVYA 1NV4A 4EQ7A 1JEUA 4ONYA 3Q28A 3PMWA 1FBHA 3U92A 1H45A 4FATA 1NNFA 3TTLA 2O1MA 4GX4A 3HHGA 4PTKA 4H5GA 3I5OA 3R26A 3Q26A 5JEIA 1EYIA 1A8FA 1A8EA 1YXIA 2Z22A 3MP8A 1HSJA 3RTFB 1P1QA 2ANJA 3RPWA 1IUDA 2DQVA 3K2DA 3VVFA 4ESXA 1NV1A 4TQUQ 2FIEA 1Y20A 5CBSA 1NMUA 2ZZWA 3MZ1A 3EQ1A 4DI3D 2XXUA 4LZ8A 4U22A 2KQZA 1JW1A 5BUUA 2XWIA 3CFXA 3RGYA 1J1NA 3QXMA 3N26A 1B9JA 3IJXB 2Q2CA 3TAJA 4MIJA 2I58A 3EHSA 1FPJA 4XKRA 5IM2A 3S9MC 3V8XB 3IB2A 1NKXA 4KYEA 2E0SA 4XF5A 4KHZE 1TWYA 1Z7NE 2O51A 4ELQA 2ZZXA 5EQ7A 4ZEBA 3N6TA 3G7WA 4F3BA 1FQEA 2F7BA 3BFUA 1FPDA 3TFLA 4H45A 2FVZA 3PGFA 1S50A 3G3GA 5I2NB 1FTKA 3C31A 4GIZA 4PQJA 4FECA 4MHFA 4M1VA 2ZNTA 3USDA 4N6DA 1NV2A 1URGA 4BDLA 3LV0A 2GQ1A 2HQ0A 4DXUA 2RC8A 4MMPA 4XKPA 4POWA 5IKBA 5L9OA 3E13X 4Q8RA 3B50A 1DTZA 4FORA 1B32A 4GD5A 3RLFE 1QGXA 3R7XA 1IMFA 4ZE8A 3GZGA 2F8DA 4EDPA 5ET6A 1TFAA 2ALUA 1RYXA 5DTBA 2XX8A 2Q74A 1B1XA 5L9MA 4NWDA 3D4CA 4MAGA 4GWUA 4XXUA 3LSFB 2RC7A 3UGWA 5ITOA 1FQDA 1EYKA 4EUOA 3C32A 3D4GA 2DP8A 2MKZA 3A3CA 3EF7A 3DP8A 4POXA 3TTRA 1P1WA 3SZPA 4RK2A 2KR0A 3N5LA 1FTOA 4IB2A 1FSAA 4N13A 4OEVA 2B3BA 4NF0A 1FPGA 4G68A 4YB5A 3SEWA 3FZVA 2Y7KA 1AOVA 4PF8A 1QKBA 1MH3A 5AA2B 1ZTYA 3KN3A 1EH3A 3PPPA 5M2VA 3O97A 4U1ZA 1IEJA 1MQHA 2DWJA 4ZE9A 4I1DA 2V3TA 3PUYE 4U21A 2OK2A 3QYTA 1ATGA 4RK9A 3TDJA 1ELJA 1LCFA 2F7CA 5B7DA 3MWBA 1IMCA 3CG3A 4GX3A 5TP9A 3AXFA 3RQTA 4GWOA 5DEXA 4JSOA 1F9BA 4MJOA 2A5SA 4C1UA 4C0RA 2AL5A 3T0JA 1A54A 2PVUA 1MG1A 4ELRA 3IB0A 1VFEA 2Q8MA 2DE4A 3LSXA 5CM6A 1LB8A 1P1NA 3EKIA 2Q2AA 1JNFA 1N76A 1M5EA 2XXKA 5H8NA 2P1SA 2VD2A 2ZNUA 2F3BA 3K1MA 2WBDA 1MM6A 3UK4A 4OVSA 1D9QA 2B4LA 1DPPA 1FTMA 4XEQA 4R6HA 5DVJA 5KDTA 2DWAA 3T1BA 2O69A 3G3KA 5ICTA 5K2XA 2VPNA 3S9NC 4UACA 2I3WA 4N91A 2VOZA 2CZHA 3C33A 4X1DA 5EQ9A 1D3KA 2I6EA 5HBCA 4BDQA 1SYHA 4DIGA 3FATA 3IFAA 4GF8A 4GL0A 2ZYNA 5DVFA 1FBGA 4OYVA 5ITPA 2F5XA 1I6QA 1N0TA 2PFYA 4QFPA 3TTNA 1EZ9A 3G3FA 4GFRA 3DM0A 3K01A 2UVGA 3TPAA 4R2FA 4X8RA 4QSCA 3K1PA 1DOTA 4XKNA 3O6HA 1SI0A 1MH4A 3THIA 3MBPA 3E78A
chains in the Genus database with same CATH topology
4FEBA 4G8HA 3K4UA 3CG1A 4MLVA 4EF1A 4MF3A 1GTKA 4JBZA 1FQCA 1O7TA 4DCYA 1VSOA 1LLSA 1B3HA 2THIA 2ZYOA 2DSFA 3JZJA 3Q25A 4GRKA 4KYSA 1OMPA 2XD3A 2WKYA 3KEIA 1BLFA 1Q1KA 1QUKA 2O1LA 2GHAA 4H1XA 1EZOA 4PP0A 4R9GA 3LC8A 4ISUA 2AL4A 2H4IA 3T22A 4IO5A 5CMKA 2GRVA 3IL1B 2Y7PA 1YTVA 2PMSA 4NMYA 4JWYA 1I6BA 4BDMA 1B46A 3MPKA 1NFTA 4YMBA 3H3GA 1WODA 2NWJA 1MXWA 3VVDA 2ZYKA 4ZECA 5KCJB 3FVNA 4G77A 4YU0A 1AH5A 2NVUB 2XD2A 4EQBA 2XXIA 4O3CA 4H5FA 2I4CA 2DWHA 3UORA 3RN8A 1B1HA 1SBPA 1USYE 2O6AA 4XIGQ 4R2BA 1OLAA 5H8QA 5L8DA 4ZEDA 4F3GA 1QVSA 4F1UA 3CVGA 3U93A 2D3IA 3KN7A 3OEMA 4MH5A 4OEUA 4OETA 3TCHA 3W9VA 3PU5A 1PB7A 2AIXA 4TLLB 1MPDA 2F35A 5I59A 4OFJA 3HO7A 1AOVA 2ABHA 1IIWA 3OOAA 4KCCA 4QRZA 4U1OA 1M5FA 2GFEA 2IA4A 3Q29A 4IO7A 3VFJA 3WAEA 4F22A 3U72A 2UVIA 4JSDA 1N7XA 2QMWA 3MP6A 4G2ZA 2FA7A 1Y4CA 4IO6A 1P1OA 1SDXA 3SEUA 2YJPA 4NWCA 1B52A 3KJTA 1HSEA 2NXOA 2X26A 2Q88A 1XOCA 1EU8A 1MRPA 1OVTA 3E9XA 4TLMB 5FHOA 3DLNA 3OO7A 4HCYA 1MDQA 2LAOA 2RKMA 3DELB 2DXYA 4LZ7A 4KCDA 4OQOA 4ZDMA 5JTYB 3U8QA 3LBSA 4GQOA 1MXYA 2O7IA 4X9TA 2B3FA 2PX1A 4G4PA 3IK6B 4KFQA 3B6TA 4R6KA 2O68A 1NH8A 2YPNA 4QFLA 5FTIA 3H6UA 4OZ9A 2RINA 3OENA 2OCUA 2VP1A 1FQFA 3K02A 2OJTA 4F1VA 3K1NA 1IXIA 2UXAA 3E4RA 1TXFA 4DXCA 3RTWB 5FTHA 3OMBA 4NF5A 5AA4A 1Y3QA 1B5HA 3PMXA 4QHQA 3MZBA 3U1OA 3FXQA 5H8HB 5AA1A 4R75A 4E0WA 2KLFA 3M8UA 5KZTA 3TYHA 2H5YA 1O64A 3FJ7A 3KBRA 2HZKA 5TU0A 4WKMA 4RPNA 3T93B 4HW8A 4YKIA 2OLBA 4WXJA 4OERA 3KFMA 4X1BA 1B5JA 3GXAA 1XVYA 3K6XA 3MAMA 3EN3A 4EQ7A 1JEUA 1YCJA 3VLUA 2F78A 3QUFA 4ONYA 1SQYA 3Q28A 4IO2A 1FTLA 1IXHA 3PMWA 3U92A 3N6UA 2QSXA 2QS3A 1Y4TA 2OZZA 4Z7EA 4IGTA 3OXNA 4DE8A 1H45A 3H7MA 4FATA 4JWXA 1NNFA 3TTLA 4PETA 5J1DA 4JXIA 1QUIA 2R71A 1FTJA 4DDDA 4LUBA 4Z0IA 2O1MA 4RXLA 3W15C 2DYXA 3HHGA 1SYIA 1XHYA 3VLWA 4H67A 1Y3NA 1N3WA 4ZZAA 1B2HA 1LCTA 1MQJA 3KSJA 4H5GA 4OMBA 2H9BA 1ZIUA 4QFKA 2F7AA 1JVXA 1YAEA 2XX9A 4OENA 4UA8A 4ZZEA 1IZ1A 1PB9A 3I5OA 3R26A 5H8FB 3WAFA 3Q26A 4RJZA 2RCAA 1UIUA 1A8FA 1AMFA 2QS4A 3OELA 3PUXE 4JB7A 5JEIA 3V83A 1A8EA 1I69A 2Z22A 4PFYA 3MP8A 1LFGA 1HSJA 3GLBA 1LAFE 3HCQA 3S9EA 4EXKA 3RTFB 3H6VA 4GXSB 3FV2A 5CI5A 1VR5A 1XVXA 2O84X 4P0GA 5CBRA 2QS1A 5JK4A 1B4ZA 5CMCA 1P1QA 3PMVA 2ANJA 5I2KA 3KGCA 2PYYA 3RPWA 3FVKA 1IUDA 1LGBC 1H43A 2DQVA 3K2DA 3BFTA 1URSA 3MZ9A 2VGQA 3T66A 1UTBA 1ZU0A 4RPOA 3VVFA 2Y84A 3OD7A 3KZGA 1LB9A 4N07A 1B51A 2F6PA 4ESXA 1MPBA 4NF4A 5ELVA 4KYDA 4KD5A 5BWJA 5I58B 1BP5A 1LSTA 4TQUQ 3ONMA 4HCWA 4OESA 2XXRA 1NNKA 3U94A 1Y20A 3H6WA 1T0KA 5CBSA 1R9LA 1NMUA 2D5WA 3MZ1A 4OXVA 3EQ1A 5TP9B 3K6WA 1A55A 2XXUA 3FASA 3HV1A 4F31B 4LZ8A 4U22A 2DVZA 3JYRA 4H0WA 1OLCA 1JW1A 2HXWA 1RYOA 3S4UA 2QS2A 5FHNA 5I58A 3B6QA 5BUUA 3CFXA 4NF4B 3RGYA 3FD3A 4X48A 1J1NA 2PT1A 5I56B 1GV8A 3QXMA 3EHUA 1JEVA 1B9JA 1XS5A 3N26A 3IJXB 2Q2CA 3Q27A 3LR1A 4G68C 2A5TB 4KPTA 3TAJA 2I58A 4I9DA 2YLNA 3O9PA 3EHSA 1MPCA 2P0SA 4XKRA 3ZKLA 2PBWA 1NL5A 4N6PA 3IOUA 4OTEA 3G3HA 1MQDA 5CMBA 3S9MC 3V8XB 1O63A 2V25A 3PPOA 1B40A 3G3IA 3IB2A 3MUQA 4LP2B 5KCJA 2F34A 1R9QA 1NKXA 3F11A 5A5XA 1CE2A 3ILUB 4KYEA 1B0LA 1PEBA 2E0SA 1NH7A 3K0VA 3OO8A 2M8CA 2V84A 3OSQA 4Q30B 1H44A 1DPEA 4U2RA 4KHZE 2I3VA 1TWYA 2V3QA 5F7VA 1Z7NE 4XTCQ 2O51A 1OIBA 4R6YA 5DVIA 4ELQA 4F18A 4OFOA 3PPQA 3CIJA 2OWSA 1URDA 3IR1A 4YB7A 1HSLA 3JV9A 3IO6A 5FHMA 3IJOB 4ZEBA 1B3LA 1USYH 2I49A 3N6TA 3G7WA 4QSDA 4MBPA 4YZZA 4NF8B 1FQEA 2F7BA 3BFUA 3SESA 3TFLA 1B6HA 4F2OA 3DP4A 4HS7A 4K3FA 2QL3A 2XXPA 4OWDA 1Z7ME 1II5A 3MVXA 3SERA 3PGFA 1S7YA 1ZKBA 1WVJA 1S50A 1POTA 3G3GA 5I2NB 4IO3A 1FTKA 3C31A 1IXGA 3A09A 4GIZA 4PQJA 3SDFA 4FECA 1B0HA 4H65A 4NEDA 2VD3A 3MC2A 3PUVE 2DWIA 4M1VA 4OHNA 1GVCA 2I0CA 2NOOA 2ZNTA 3FUZA 4H6DA 3N94A 1Y3PA 2RCBA 3K00A 3USDA 4MFIA 3O28A 1URGA 3FGSA 1SW2A 3FV1A 4BDLA 1SI1A 3FXUA 5HPQA 1BIYA 1MDP1 5I2NA 2HQ0A 3QIMA 1H3DA 5K2YA 2F6GA 2DE2A 5H8QB 3O29A 3LSWA 3ZSFA 3O2AA 1TT1A 2D21A 3M3FA 4DXUA 2RC8A 4XKPA 3RUMA 4POWA 1CB6A 3TTMA 4IO4A 4ELOA 5IKBA 2H99A 2ZXTA 5L9OA 1B05A 3E13X 4Q8RA 3HN0A 4FAJA 3ODBA 4FORA 1DTZA 2HAUA 2RF1A 1PBPA 2OBGA 1B32A 3KSXA 3MPLA 4GD5A 1R6ZA 4KI0E 3RLFE 1OVBA 3R7XA 1ZJLA 1UTBB 1DMBA 2RC9A 1WDNA 2DXRA 4YKPA 3RY3A 3TCGA 1XT8A 4U23A 4ZE8A 3GZGA 4G68B 3T9HB 4AB5A 3MVZA 3H03A 1B58A 4LA9A 4QSEA 2F8DA 3K6UA 4EDPA 3SEXA 1N84A 1M5BA 1TFAA 1SVXB 1NNPA 4LZ5A 3V5AA 5AA4B 2ALUA 1MY1A 1RYXA 3M3KA 4ZEFA 3MVWA 5DTBA 1KWHA 2DE3A 3UA8A 5CMMA 2XX8A 2Y7IA 3K6VA 4RNSA 4C1TA 2Q89A 1B1XA 1OQHA 5L9MA 2F36A 4NWDA 4DXBA 2ONSA 3KOSA 1UQWA 3D4CA 1QJMA 3H6TA 1FQBA 3I6VA 3L6HA 4LATA 4P11A 5ICQA 4R72A 4XXUA 3LSFB 5JTYA 2RC7A 1OQGA 3ECRA 3SEVA 4DLDA 3UGWA 1US5A 4GVOA 1FQDA 5ITOA 3TELA 5H8FA 2A5TA 3QUJA 3HPIA 2ESNA 1MY4A 4LVQA 2G93A 3TTKA 1XC1A 2ZMBA 1SW4A 1MQGA 1B3GA 3R6UA 1B7ZA 4EUOA 2XXHA 3C32A 3D4GA 3EPEA 4QFNA 4E0XA 2ZNSA 2QPQA 2DP8A 3IX1A 5AE4A 3A3CA 3T9XB 3EF7A 4F3BA 2UVHA 3T9VA 1AL3A 1QW0A 3OSRA 4TOZA 3DP8A 3IAZA 4POXA 3TTRA 4IY5A 1P1WA 2HZLA 4NF8A 3C34A 4RK2A 4F3PA 3RNNA 4DZ1A 4WEDA 4BDOA 2B65A 2Q8JA 3N5LA 2Y7WA 3VLVA 1FTOA 4IB2A 4N13A 4OEVA 3T9UA 4O3BA 2DS9A 3CR9A 3FIRA 5EHSA 2F97A 1I6AA 2VHAA 2DOJA 3UIFA 2DVCA 1B4HA 4U4SA 4YMAA 1DSNA 2B3BA 2Q9TA 5F1QA 4QF9A 3T96B 4F3SA 1N04A 3CI8A 4G68A 2BJJX 4Q0CA 3SEYA 4YB5A 3TCFA 3VDFA 2I48A 3SEWA 3FZVA 4NF5B 4P0IA 1QKAA 2Z23A 4FEDA 2Y7KA 1VFDA 2P2AA 4M4GA 4XKQA 5H8HA 3TQLA 1JQFA 1QKBA 3BBRA 5I2KB 3VXCA 4U4XA 1MH3A 3CSGA 1ZTYA 4H8IA 3TZAA 3FXRA 5AA2B 3KN3A 4ZEIA 1EH3A 1VE4A 3PPPA 1QUJA 1UTHB 2Z8FA 3ZS6A 1B5IA 5M2VA 3O97A 4U1ZA 1B3FA 1IEJA 1LAHE 1MQHA 2XXVA 1JW4A 2DWJA 1GGGA 2R9JA 2V3TA 4I1DA 4EXLA 4ZE9A 3PUWE 1PC3A 2CZLA 2XXTA 1RKMA 2HEUA 3PUYE 4EQ9A 5I56A 5I57B 4U21A 4F19A 3TEPA 1B7HA 2HCAA 2OK2A 3OO9A 3RT6B 3QYTA 3SETA 3VXBA 3A3UA 4H8JA 3HHFA 4NTLA 1ATGA 2I4BA 2R6GE 1IQ7A 3IOTA 3P7IA 4PFUA 4RK9A 3TDJA 3ILTB 1ELJA 1FQAA 1LCFA 1M5CA 1P99A 2F7CA 2UYFA 3MWBA 5B7DA 3CG3A 2H98A 5TPAB 3O66A 3E3KA 1MS7A 4BLAA 5KDTB 1Y9UA 3CRBA 3M3LA 1DTGA 3AXFA 3I3VA 4KR5A 4ZEKA 5TP9A 3QK6A 4GWOA 3RQTA 4EF2A 5I59B 4PFWA 3MW0A 3TUSA 3GBBA 4YAHX 5DEXA 5L9SA 1M5DA 4JSOA 1F9BA 1SD3A 3C4MA 4HTGA 4R73A 1N7WA 3KN8A 3PUZE 3PD8A 1LAXA 1QULA 2A5SA 4I8CA 4C0RA 4C1UA 4GOTA 2AL5A 4I62A 2W7YA 1A54A 2PVUA 4THIA 4RA1A 4JWOA 3O6IA 1ANFA 3FJGA 5I57A 1MG1A 1MM7A 3CFLA 5EHMA 4ELRA 1ZBMA 3MQ9A 4GLIA 3IB0A 2QJEA 3QAXA 1N3XA 1VFEA 2DE4A 4LQ2A 5EYFA 4YKJA 3UN6A 4GL8A 2CMOA 1BTJA 4ECFA 5AA3A 3LSXA 5CM6A 4FJPA 5DT6A 1LB8A 1AIVA 1P1NA 5CRYA 3OO6A 2Q2AA 1JNFA 1D9YA 1PBQA 2E1SA 1N76A 2AYSA 1NNTA 3MJNA 4RYAA 1LBBA 5HM4B 1M5EA 2FNCA 4YICA 4R74A 1A7LA 2G29A 1YPNA 5H8NA 3O6GA 2P1SA 2VD2A 2ZNUA 4NF6B 4LQ5A 3K1MA 1MM6A 3UK4A 4ND9A 5A5XB 5B70A 1MY3A 2XX7A 2XXWA 2GHBA 1PDAA 2NUVA 1DPPA 4G8MA 4QFOA 1FTMA 3IOVA 5IAIA 2XXYA 3PPRA 1PB8A 4BDNA 2V93A 4OFLA 5I84A 3PV0E 1IXCA 1POY1 2ONRA 4OVJA 4O3AA 4R6HA 4G8NA 2Z8DA 5DVJA 2GH9A 4NE4A 1US4A 5KDTA 4PE5B 4IGRA 2DWAA 2QRYA 4R9FA 3H4ZA 3TODA 5H8NB 1P1UA 2H25A 2UYEA 1IITA 2X7PA 2O69A 2ZYMA 3FJMA 3IO4A 3G3KA 1MQIA 2FYIA 5ICTA 3CFZA 1UIVA 4RY1A 5K2XA 4AQ4A 3S9NC 4UACA 2I3WA 1A40A 4ZS9A 3S9LC 1JETA 2VOZA 5LOMA 4NF6A 3GBAA 3LUYA 1Q35A 1TFDA 3H06B 3C33A 1JVYA 3DP6A 3C9HA 1A99A 1D3KA 4X1DA 3UP9A 3B6WA 2HAVA 3FVGA 1ZMGA 4L17A 3C36A 2I6EA 3VV5A 5HBCA 4BDQA 4LONB 3PD9A 1B7UA 1SYHA 1UTHA 3FATA 4DIGA 1LFHA 3FVOA 4GF8A 3QSLA 4GL0A 5AA2A 4IY6A 1MXUA 4GXAA 3HSTA 3L6GA 2ONKE 2ZYNA 4FIMA 2O7UA 3KOTA 5DVFA 3ZKKA 1MXXA 4PFTA 4ELPA 3S2VA 2XXXA 4DCXA 1B3EA 1H76A 1Y1ZA 1EZPA 3VVEA 4OYVA 3TQWA 2V3UA 4YB6A 1MXZA 5AA2D 5ITPA 1MY0A 3TMGA 1D9VA 1FW0A 1LAGE 2PT2A 2Z8EA 3PPNA 2Y7RA 4MLQA 5DEXB 4YKKA 2F5XA 2REJA 1LBCA 1I6QA 1Y1MA 2IEEA 3V89B 1FCKA 4WEPA 4F2QA 1BKAA 4FE8A 3VE1B 1N0TA 2XHDA 5TPAA 1D4NA 4JDFA 4ESWA 2QMXA 4QFPA 3RT8A 4F29A 1S9TA 4BDRA 2I0BA 2OWTA 1SW1A 3TTNA 1EZ9A 1JW5A 3KJ7A 5DYHA 3EHTA 3G3FA 1R1NA 4GFRA 3MP1A 2UVJA 1LFIA 2XXQA 5ISUA 1MY2A 3DM0A 3OEKA 3K01A 2UVGA 2HFBA 3TPAA 4R2FA 3IOWA 3BKIB 1GR2A 3CSBA 3LSLA 4Q5TA 3SKPA 4QSCA 4KQPA 3K1PA 4F1YA 5CC2A 2REGA 3IORA 3TKDA 1DOTA 4XKNA 3O6HA 1SI0A 3W9WA 1MH4A 4F39A 4AB6A 3G3JA 1ZLQA 3MVYA 3THIA 2X7QA 3B7DA 3C35A 3MBPA 1L5TA 3KG2A 5H8SA 1SW5A 1MXVA 3IB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FEB A;  4G8H A;  3K4U A;  3CG1 A;  4MLV A;  4EF1 A;  4MF3 A;  1GTK A;  4JBZ A;  1FQC A;  1O7T A;  4DCY A;  1VSO A;  1LLS A;  1B3H A;  2THI A;  2ZYO A;  2DSF A;  3JZJ A;  3Q25 A;  4GRK A;  4KYS A;  1OMP A;  2XD3 A;  2WKY A;  3KEI A;  1BLF A;  1Q1K A;  1QUK A;  2O1L A;  2GHA A;  4H1X A;  1EZO A;  4PP0 A;  4R9G A;  3LC8 A;  4ISU A;  2AL4 A;  2H4I A;  3T22 A;  4IO5 A;  5CMK A;  2GRV A;  3IL1 B;  2Y7P A;  1YTV A;  2PMS A;  4NMY A;  4JWY A;  1I6B A;  4BDM A;  1B46 A;  3MPK A;  1NFT A;  4YMB A;  3H3G A;  1WOD A;  2NWJ A;  1MXW A;  3VVD A;  2ZYK A;  4ZEC A;  5KCJ B;  3FVN A;  4G77 A;  4YU0 A;  1AH5 A;  2NVU B;  2XD2 A;  4EQB A;  2XXI A;  4O3C A;  4H5F A;  2I4C A;  2DWH A;  3UOR A;  3RN8 A;  1B1H A;  1SBP A;  1USY E;  2O6A A;  4XIG Q;  4R2B A;  1OLA A;  5H8Q A;  5L8D A;  4ZED A;  4F3G A;  1QVS A;  4F1U A;  3CVG A;  3U93 A;  2D3I A;  3KN7 A;  3OEM A;  4MH5 A;  4OEU A;  4OET A;  3TCH A;  3W9V A;  3PU5 A;  1PB7 A;  2AIX A;  4TLL B;  1MPD A;  2F35 A;  5I59 A;  4OFJ A;  3HO7 A;  1AOV A;  2ABH A;  1IIW A;  3OOA A;  4KCC A;  4QRZ A;  4U1O A;  1M5F A;  2GFE A;  2IA4 A;  3Q29 A;  4IO7 A;  3VFJ A;  3WAE A;  4F22 A;  3U72 A;  2UVI A;  4JSD A;  1N7X A;  2QMW A;  3MP6 A;  4G2Z A;  2FA7 A;  1Y4C A;  4IO6 A;  1P1O A;  1SDX A;  3SEU A;  2YJP A;  4NWC A;  1B52 A;  3KJT A;  1HSE A;  2NXO A;  2X26 A;  2Q88 A;  1XOC A;  1EU8 A;  1MRP A;  1OVT A;  3E9X A;  4TLM B;  5FHO A;  3DLN A;  3OO7 A;  4HCY A;  1MDQ A;  2LAO A;  2RKM A;  3DEL B;  2DXY A;  4LZ7 A;  4KCD A;  4OQO A;  4ZDM A;  5JTY B;  3U8Q A;  3LBS A;  4GQO A;  1MXY A;  2O7I A;  4X9T A;  2B3F A;  2PX1 A;  4G4P A;  3IK6 B;  4KFQ A;  3B6T A;  4R6K A;  2O68 A;  1NH8 A;  2YPN A;  4QFL A;  5FTI A;  3H6U A;  4OZ9 A;  2RIN A;  3OEN A;  2OCU A;  2VP1 A;  1FQF A;  3K02 A;  2OJT A;  4F1V A;  3K1N A;  1IXI A;  2UXA A;  3E4R A;  1TXF A;  4DXC A;  3RTW B;  5FTH A;  3OMB A;  4NF5 A;  5AA4 A;  1Y3Q A;  1B5H A;  3PMX A;  4QHQ A;  3MZB A;  3U1O A;  3FXQ A;  5H8H B;  5AA1 A;  4R75 A;  4E0W A;  2KLF A;  3M8U A;  5KZT A;  3TYH A;  2H5Y A;  1O64 A;  3FJ7 A;  3KBR A;  2HZK A;  5TU0 A;  4WKM A;  4RPN A;  3T93 B;  4HW8 A;  4YKI A;  2OLB A;  4WXJ A;  4OER A;  3KFM A;  4X1B A;  1B5J A;  3GXA A;  1XVY A;  3K6X A;  3MAM A;  3EN3 A;  4EQ7 A;  1JEU A;  1YCJ A;  3VLU A;  2F78 A;  3QUF A;  4ONY A;  1SQY A;  3Q28 A;  4IO2 A;  1FTL A;  1IXH A;  3PMW A;  3U92 A;  3N6U A;  2QSX A;  2QS3 A;  1Y4T A;  2OZZ A;  4Z7E A;  4IGT A;  3OXN A;  4DE8 A;  1H45 A;  3H7M A;  4FAT A;  4JWX A;  1NNF A;  3TTL A;  4PET A;  5J1D A;  4JXI A;  1QUI A;  2R71 A;  1FTJ A;  4DDD A;  4LUB A;  4Z0I A;  2O1M A;  4RXL A;  3W15 C;  2DYX A;  3HHG A;  1SYI A;  1XHY A;  3VLW A;  4H67 A;  1Y3N A;  1N3W A;  4ZZA A;  1B2H A;  1LCT A;  1MQJ A;  3KSJ A;  4H5G A;  4OMB A;  2H9B A;  1ZIU A;  4QFK A;  2F7A A;  1JVX A;  1YAE A;  2XX9 A;  4OEN A;  4UA8 A;  4ZZE A;  1IZ1 A;  1PB9 A;  3I5O A;  3R26 A;  5H8F B;  3WAF A;  3Q26 A;  4RJZ A;  2RCA A;  1UIU A;  1A8F A;  1AMF A;  2QS4 A;  3OEL A;  3PUX E;  4JB7 A;  5JEI A;  3V83 A;  1A8E A;  1I69 A;  2Z22 A;  4PFY A;  3MP8 A;  1LFG A;  1HSJ A;  3GLB A;  1LAF E;  3HCQ A;  3S9E A;  4EXK A;  3RTF B;  3H6V A;  4GXS B;  3FV2 A;  5CI5 A;  1VR5 A;  1XVX A;  2O84 X;  4P0G A;  5CBR A;  2QS1 A;  5JK4 A;  1B4Z A;  5CMC A;  1P1Q A;  3PMV A;  2ANJ A;  5I2K A;  3KGC A;  2PYY A;  3RPW A;  3FVK A;  1IUD A;  1LGB C;  1H43 A;  2DQV A;  3K2D A;  3BFT A;  1URS A;  3MZ9 A;  2VGQ A;  3T66 A;  1UTB A;  1ZU0 A;  4RPO A;  3VVF A;  2Y84 A;  3OD7 A;  3KZG A;  1LB9 A;  4N07 A;  1B51 A;  2F6P A;  4ESX A;  1MPB A;  4NF4 A;  5ELV A;  4KYD A;  4KD5 A;  5BWJ A;  5I58 B;  1BP5 A;  1LST A;  4TQU Q;  3ONM A;  4HCW A;  4OES A;  2XXR A;  1NNK A;  3U94 A;  1Y20 A;  3H6W A;  1T0K A;  5CBS A;  1R9L A;  1NMU A;  2D5W A;  3MZ1 A;  4OXV A;  3EQ1 A;  5TP9 B;  3K6W A;  1A55 A;  2XXU A;  3FAS A;  3HV1 A;  4F31 B;  4LZ8 A;  4U22 A;  2DVZ A;  3JYR A;  4H0W A;  1OLC A;  1JW1 A;  2HXW A;  1RYO A;  3S4U A;  2QS2 A;  5FHN A;  5I58 A;  3B6Q A;  5BUU A;  3CFX A;  4NF4 B;  3RGY A;  3FD3 A;  4X48 A;  1J1N A;  2PT1 A;  5I56 B;  1GV8 A;  3QXM A;  3EHU A;  1JEV A;  1B9J A;  1XS5 A;  3N26 A;  3IJX B;  2Q2C A;  3Q27 A;  3LR1 A;  4G68 C;  2A5T B;  4KPT A;  3TAJ A;  2I58 A;  4I9D A;  2YLN A;  3O9P A;  3EHS A;  1MPC A;  2P0S A;  4XKR A;  3ZKL A;  2PBW A;  1NL5 A;  4N6P A;  3IOU A;  4OTE A;  3G3H A;  1MQD A;  5CMB A;  3S9M C;  3V8X B;  1O63 A;  2V25 A;  3PPO A;  1B40 A;  3G3I A;  3IB2 A;  3MUQ A;  4LP2 B;  5KCJ A;  2F34 A;  1R9Q A;  1NKX A;  3F11 A;  5A5X A;  1CE2 A;  3ILU B;  4KYE A;  1B0L A;  1PEB A;  2E0S A;  1NH7 A;  3K0V A;  3OO8 A;  2M8C A;  2V84 A;  3OSQ A;  4Q30 B;  1H44 A;  1DPE A;  4U2R A;  4KHZ E;  2I3V A;  1TWY A;  2V3Q A;  5F7V A;  1Z7N E;  4XTC Q;  2O51 A;  1OIB A;  4R6Y A;  5DVI A;  4ELQ A;  4F18 A;  4OFO A;  3PPQ A;  3CIJ A;  2OWS A;  1URD A;  3IR1 A;  4YB7 A;  1HSL A;  3JV9 A;  3IO6 A;  5FHM A;  3IJO B;  4ZEB A;  1B3L A;  1USY H;  2I49 A;  3N6T A;  3G7W A;  4QSD A;  4MBP A;  4YZZ A;  4NF8 B;  1FQE A;  2F7B A;  3BFU A;  3SES A;  3TFL A;  1B6H A;  4F2O A;  3DP4 A;  4HS7 A;  4K3F A;  2QL3 A;  2XXP A;  4OWD A;  1Z7M E;  1II5 A;  3MVX A;  3SER A;  3PGF A;  1S7Y A;  1ZKB A;  1WVJ A;  1S50 A;  1POT A;  3G3G A;  5I2N B;  4IO3 A;  1FTK A;  3C31 A;  1IXG A;  3A09 A;  4GIZ A;  4PQJ A;  3SDF A;  4FEC A;  1B0H A;  4H65 A;  4NED A;  2VD3 A;  3MC2 A;  3PUV E;  2DWI A;  4M1V A;  4OHN A;  1GVC A;  2I0C A;  2NOO A;  2ZNT A;  3FUZ A;  4H6D A;  3N94 A;  1Y3P A;  2RCB A;  3K00 A;  3USD A;  4MFI A;  3O28 A;  1URG A;  3FGS A;  1SW2 A;  3FV1 A;  4BDL A;  1SI1 A;  3FXU A;  5HPQ A;  1BIY A;  1MDP 1;  5I2N A;  2HQ0 A;  3QIM A;  1H3D A;  5K2Y A;  2F6G A;  2DE2 A;  5H8Q B;  3O29 A;  3LSW A;  3ZSF A;  3O2A A;  1TT1 A;  2D21 A;  3M3F A;  4DXU A;  2RC8 A;  4XKP A;  3RUM A;  4POW A;  1CB6 A;  3TTM A;  4IO4 A;  4ELO A;  5IKB A;  2H99 A;  2ZXT A;  5L9O A;  1B05 A;  3E13 X;  4Q8R A;  3HN0 A;  4FAJ A;  3ODB A;  4FOR A;  1DTZ A;  2HAU A;  2RF1 A;  1PBP A;  2OBG A;  1B32 A;  3KSX A;  3MPL A;  4GD5 A;  1R6Z A;  4KI0 E;  3RLF E;  1OVB A;  3R7X A;  1ZJL A;  1UTB B;  1DMB A;  2RC9 A;  1WDN A;  2DXR A;  4YKP A;  3RY3 A;  3TCG A;  1XT8 A;  4U23 A;  4ZE8 A;  3GZG A;  4G68 B;  3T9H B;  4AB5 A;  3MVZ A;  3H03 A;  1B58 A;  4LA9 A;  4QSE A;  2F8D A;  3K6U A;  4EDP A;  3SEX A;  1N84 A;  1M5B A;  1TFA A;  1SVX B;  1NNP A;  4LZ5 A;  3V5A A;  5AA4 B;  2ALU A;  1MY1 A;  1RYX A;  3M3K A;  4ZEF A;  3MVW A;  5DTB A;  1KWH A;  2DE3 A;  3UA8 A;  5CMM A;  2XX8 A;  2Y7I A;  3K6V A;  4RNS A;  4C1T A;  2Q89 A;  1B1X A;  1OQH A;  5L9M A;  2F36 A;  4NWD A;  4DXB A;  2ONS A;  3KOS A;  1UQW A;  3D4C A;  1QJM A;  3H6T A;  1FQB A;  3I6V A;  3L6H A;  4LAT A;  4P11 A;  5ICQ A;  4R72 A;  4XXU A;  3LSF B;  5JTY A;  2RC7 A;  1OQG A;  3ECR A;  3SEV A;  4DLD A;  3UGW A;  1US5 A;  4GVO A;  1FQD A;  5ITO A;  3TEL A;  5H8F A;  2A5T A;  3QUJ A;  3HPI A;  2ESN A;  1MY4 A;  4LVQ A;  2G93 A;  3TTK A;  1XC1 A;  2ZMB A;  1SW4 A;  1MQG A;  1B3G A;  3R6U A;  1B7Z A;  4EUO A;  2XXH A;  3C32 A;  3D4G A;  3EPE A;  4QFN A;  4E0X A;  2ZNS A;  2QPQ A;  2DP8 A;  3IX1 A;  5AE4 A;  3A3C A;  3T9X B;  3EF7 A;  4F3B A;  2UVH A;  3T9V A;  1AL3 A;  1QW0 A;  3OSR A;  4TOZ A;  3DP8 A;  3IAZ A;  4POX A;  3TTR A;  4IY5 A;  1P1W A;  2HZL A;  4NF8 A;  3C34 A;  4RK2 A;  4F3P A;  3RNN A;  4DZ1 A;  4WED A;  4BDO A;  2B65 A;  2Q8J A;  3N5L A;  2Y7W A;  3VLV A;  1FTO A;  4IB2 A;  4N13 A;  4OEV A;  3T9U A;  4O3B A;  2DS9 A;  3CR9 A;  3FIR A;  5EHS A;  2F97 A;  1I6A A;  2VHA A;  2DOJ A;  3UIF A;  2DVC A;  1B4H A;  4U4S A;  4YMA A;  1DSN A;  2B3B A;  2Q9T A;  5F1Q A;  4QF9 A;  3T96 B;  4F3S A;  1N04 A;  3CI8 A;  4G68 A;  2BJJ X;  4Q0C A;  3SEY A;  4YB5 A;  3TCF A;  3VDF A;  2I48 A;  3SEW A;  3FZV A;  4NF5 B;  4P0I A;  1QKA A;  2Z23 A;  4FED A;  2Y7K A;  1VFD A;  2P2A A;  4M4G A;  4XKQ A;  5H8H A;  3TQL A;  1JQF A;  1QKB A;  3BBR A;  5I2K B;  3VXC A;  4U4X A;  1MH3 A;  3CSG A;  1ZTY A;  4H8I A;  3TZA A;  3FXR A;  5AA2 B;  3KN3 A;  4ZEI A;  1EH3 A;  1VE4 A;  3PPP A;  1QUJ A;  1UTH B;  2Z8F A;  3ZS6 A;  1B5I A;  5M2V A;  3O97 A;  4U1Z A;  1B3F A;  1IEJ A;  1LAH E;  1MQH A;  2XXV A;  1JW4 A;  2DWJ A;  1GGG A;  2R9J A;  2V3T A;  4I1D A;  4EXL A;  4ZE9 A;  3PUW E;  1PC3 A;  2CZL A;  2XXT A;  1RKM A;  2HEU A;  3PUY E;  4EQ9 A;  5I56 A;  5I57 B;  4U21 A;  4F19 A;  3TEP A;  1B7H A;  2HCA A;  2OK2 A;  3OO9 A;  3RT6 B;  3QYT A;  3SET A;  3VXB A;  3A3U A;  4H8J A;  3HHF A;  4NTL A;  1ATG A;  2I4B A;  2R6G E;  1IQ7 A;  3IOT A;  3P7I A;  4PFU A;  4RK9 A;  3TDJ A;  3ILT B;  1ELJ A;  1FQA A;  1LCF A;  1M5C A;  1P99 A;  2F7C A;  2UYF A;  3MWB A;  5B7D A;  3CG3 A;  2H98 A;  5TPA B;  3O66 A;  3E3K A;  1MS7 A;  4BLA A;  5KDT B;  1Y9U A;  3CRB A;  3M3L A;  1DTG A;  3AXF A;  3I3V A;  4KR5 A;  4ZEK A;  5TP9 A;  3QK6 A;  4GWO A;  3RQT A;  4EF2 A;  5I59 B;  4PFW A;  3MW0 A;  3TUS A;  3GBB A;  4YAH X;  5DEX A;  5L9S A;  1M5D A;  4JSO A;  1F9B A;  1SD3 A;  3C4M A;  4HTG A;  4R73 A;  1N7W A;  3KN8 A;  3PUZ E;  3PD8 A;  1LAX A;  1QUL A;  2A5S A;  4I8C A;  4C0R A;  4C1U A;  4GOT A;  2AL5 A;  4I62 A;  2W7Y A;  1A54 A;  2PVU A;  4THI A;  4RA1 A;  4JWO A;  3O6I A;  1ANF A;  3FJG A;  5I57 A;  1MG1 A;  1MM7 A;  3CFL A;  5EHM A;  4ELR A;  1ZBM A;  3MQ9 A;  4GLI A;  3IB0 A;  2QJE A;  3QAX A;  1N3X A;  1VFE A;  2DE4 A;  4LQ2 A;  5EYF A;  4YKJ A;  3UN6 A;  4GL8 A;  2CMO A;  1BTJ A;  4ECF A;  5AA3 A;  3LSX A;  5CM6 A;  4FJP A;  5DT6 A;  1LB8 A;  1AIV A;  1P1N A;  5CRY A;  3OO6 A;  2Q2A A;  1JNF A;  1D9Y A;  1PBQ A;  2E1S A;  1N76 A;  2AYS A;  1NNT A;  3MJN A;  4RYA A;  1LBB A;  5HM4 B;  1M5E A;  2FNC A;  4YIC A;  4R74 A;  1A7L A;  2G29 A;  1YPN A;  5H8N A;  3O6G A;  2P1S A;  2VD2 A;  2ZNU A;  4NF6 B;  4LQ5 A;  3K1M A;  1MM6 A;  3UK4 A;  4ND9 A;  5A5X B;  5B70 A;  1MY3 A;  2XX7 A;  2XXW A;  2GHB A;  1PDA A;  2NUV A;  1DPP A;  4G8M A;  4QFO A;  1FTM A;  3IOV A;  5IAI A;  2XXY A;  3PPR A;  1PB8 A;  4BDN A;  2V93 A;  4OFL A;  5I84 A;  3PV0 E;  1IXC A;  1POY 1;  2ONR A;  4OVJ A;  4O3A A;  4R6H A;  4G8N A;  2Z8D A;  5DVJ A;  2GH9 A;  4NE4 A;  1US4 A;  5KDT A;  4PE5 B;  4IGR A;  2DWA A;  2QRY A;  4R9F A;  3H4Z A;  3TOD A;  5H8N B;  1P1U A;  2H25 A;  2UYE A;  1IIT A;  2X7P A;  2O69 A;  2ZYM A;  3FJM A;  3IO4 A;  3G3K A;  1MQI A;  2FYI A;  5ICT A;  3CFZ A;  1UIV A;  4RY1 A;  5K2X A;  4AQ4 A;  3S9N C;  4UAC A;  2I3W A;  1A40 A;  4ZS9 A;  3S9L C;  1JET A;  2VOZ A;  5LOM A;  4NF6 A;  3GBA A;  3LUY A;  1Q35 A;  1TFD A;  3H06 B;  3C33 A;  1JVY A;  3DP6 A;  3C9H A;  1A99 A;  1D3K A;  4X1D A;  3UP9 A;  3B6W A;  2HAV A;  3FVG A;  1ZMG A;  4L17 A;  3C36 A;  2I6E A;  3VV5 A;  5HBC A;  4BDQ A;  4LON B;  3PD9 A;  1B7U A;  1SYH A;  1UTH A;  3FAT A;  4DIG A;  1LFH A;  3FVO A;  4GF8 A;  3QSL A;  4GL0 A;  5AA2 A;  4IY6 A;  1MXU A;  4GXA A;  3HST A;  3L6G A;  2ONK E;  2ZYN A;  4FIM A;  2O7U A;  3KOT A;  5DVF A;  3ZKK A;  1MXX A;  4PFT A;  4ELP A;  3S2V A;  2XXX A;  4DCX A;  1B3E A;  1H76 A;  1Y1Z A;  1EZP A;  3VVE A;  4OYV A;  3TQW A;  2V3U A;  4YB6 A;  1MXZ A;  5AA2 D;  5ITP A;  1MY0 A;  3TMG A;  1D9V A;  1FW0 A;  1LAG E;  2PT2 A;  2Z8E A;  3PPN A;  2Y7R A;  4MLQ A;  5DEX B;  4YKK A;  2F5X A;  2REJ A;  1LBC A;  1I6Q A;  1Y1M A;  2IEE A;  3V89 B;  1FCK A;  4WEP A;  4F2Q A;  1BKA A;  4FE8 A;  3VE1 B;  1N0T A;  2XHD A;  5TPA A;  1D4N A;  4JDF A;  4ESW A;  2QMX A;  4QFP A;  3RT8 A;  4F29 A;  1S9T A;  4BDR A;  2I0B A;  2OWT A;  1SW1 A;  3TTN A;  1EZ9 A;  1JW5 A;  3KJ7 A;  5DYH A;  3EHT A;  3G3F A;  1R1N A;  4GFR A;  3MP1 A;  2UVJ A;  1LFI A;  2XXQ A;  5ISU A;  1MY2 A;  3DM0 A;  3OEK A;  3K01 A;  2UVG A;  2HFB A;  3TPA A;  4R2F A;  3IOW A;  3BKI B;  1GR2 A;  3CSB A;  3LSL A;  4Q5T A;  3SKP A;  4QSC A;  4KQP A;  3K1P A;  4F1Y A;  5CC2 A;  2REG A;  3IOR A;  3TKD A;  1DOT A;  4XKN A;  3O6H A;  1SI0 A;  3W9W A;  1MH4 A;  4F39 A;  4AB6 A;  3G3J A;  1ZLQ A;  3MVY A;  3THI A;  2X7Q A;  3B7D A;  3C35 A;  3MBP A;  1L5T A;  3KG2 A;  5H8S A;  1SW5 A;  1MXV A;  3IB1 A; 
#chains in the Genus database with same CATH topology
 3K4U A;  4MLV A;  4FBP A;  1FQC A;  3JZJ A;  2DSF A;  1KZ8 A;  2XD3 A;  3KEI A;  4H1X A;  2O1L A;  2GHA A;  3ISP A;  3LC8 A;  4ISU A;  2PMS A;  1IMB A;  3MPK A;  3ROJ A;  3VVD A;  4ZEC A;  3FVN A;  2XD2 A;  4P56 A;  4GWZ A;  3UOR A;  4XIG Q;  4R2B A;  1OLA A;  1FTA A;  4F3G A;  4F1U A;  3CVG A;  3U93 A;  2JJK A;  4TLL B;  5I59 A;  3HO7 A;  1IIW A;  3OOA A;  4QRZ A;  1FPE A;  2GFE A;  4IO7 A;  3U72 A;  2QMW A;  1P1O A;  5DW8 A;  2YJP A;  1VDW A;  4HCY A;  5JTY B;  3LBS A;  4GQO A;  1MXY A;  4R6K A;  1NH8 A;  4QFL A;  2OCU A;  3RTW B;  5AA4 A;  3PMX A;  4PCD A;  5H8H B;  3M8U A;  3KBR A;  3T93 B;  4RPN A;  4YKI A;  4OER A;  4AS4 A;  1B5J A;  3EN3 A;  4N8Y A;  4IO2 A;  4NGU A;  2OZZ A;  4Z7E A;  1K9Z A;  4IGT A;  3H7M A;  3PTY A;  4PET A;  1QUI A;  1SYI A;  1XHY A;  1Y3N A;  4QFK A;  2H9B A;  4ZZE A;  1JVX A;  4UA8 A;  1G0I A;  5H8F B;  3WAF A;  4GBW A;  3PUX E;  3OEL A;  5IZ3 B;  3V83 A;  3GLB A;  3HCQ A;  4EXK A;  4GXS B;  3FV2 A;  5CI5 A;  5CBR A;  1B4Z A;  2ZZV A;  5I2K A;  3KGC A;  2VGQ A;  1FJ9 A;  2PFZ A;  1LBY A;  1FPK A;  3KZG A;  2F6P A;  2WEF A;  1RDZ A;  5ELV A;  1BP5 A;  1LST A;  2XXR A;  1NNK A;  3U94 A;  1T0K A;  3FAS A;  3HV1 A;  2DVZ A;  3JYR A;  4H0W A;  2QS2 A;  5I58 A;  2WYP A;  4MCO A;  5I56 B;  1GV8 A;  1XS5 A;  4G68 C;  1LEV A;  3LR1 A;  1IME A;  1LBV A;  1MPC A;  4UAB A;  3ZKL A;  1NL5 A;  5CMB A;  2Y5L A;  1O63 A;  3F11 A;  1R9Q A;  5A5X A;  4X04 A;  4DLD A;  1PEB A;  5I84 A;  1NH7 A;  2M8C A;  1DPE A;  1SPI A;  2V3Q A;  5F7V A;  4XTC Q;  5DVI A;  3CIJ A;  3IR1 A;  5FHM A;  4DZ1 A;  4F2O A;  3DP4 A;  3FXB A;  3SER A;  1FPI A;  4IO3 A;  3A09 A;  4G61 A;  4H65 A;  1GVC A;  3U65 A;  3MC2 A;  2DWI A;  3FUZ A;  4N6K A;  3O28 A;  1BIY A;  3QIM A;  1H3D A;  2XWO A;  1TT1 A;  2D21 A;  4O7I A;  1CB6 A;  4ELO A;  2CEY A;  2RF1 A;  2OBG A;  1R6Z A;  5A5L A;  1ZJL A;  4YKP A;  3TCG A;  4U23 A;  1NI9 A;  1B58 A;  4QSE A;  3K6U A;  5EQ8 A;  3SEX A;  1M5B A;  1SVX B;  4ZEF A;  3M3K A;  1OQH A;  2XWK A;  4DXB A;  2ONS A;  3L6H A;  1QJM A;  1FQB A;  5JTY A;  1US5 A;  3TEL A;  2BJI A;  5H8F A;  1MY4 A;  2G93 A;  3NOH A;  2OX3 A;  3R6U A;  1MQG A;  4QFN A;  4E0X A;  2ZNS A;  4NX1 A;  3IX1 A;  3OSR A;  2OWZ A;  4OVP A;  4WED A;  4O3B A;  5EHS A;  4PAF A;  2F97 A;  2VHA A;  4U4S A;  1DSN A;  5I7I A;  3T96 B;  5EQA A;  3VDF A;  2I48 A;  4P9K A;  1VFD A;  4GWS A;  4XKQ A;  4U4X A;  4H8I A;  4ZEI A;  1UTH B;  2Z8F A;  1B3F A;  3PUW E;  1PC3 A;  2CZL A;  2XXT A;  1RKM A;  2HEU A;  3CHG A;  4EQ9 A;  4F19 A;  4JVI A;  3RT6 B;  4H8J A;  1IQ7 A;  3IOT A;  4PFU A;  3ILT B;  2UYF A;  1M5C A;  2H98 A;  4PFB A;  5TPA B;  2WX9 A;  3O66 A;  4BLA A;  3CRB A;  3M3L A;  4PFW A;  3MW0 A;  4YAH X;  5IZ1 A;  1M5D A;  3KN8 A;  2FBP A;  3PUZ E;  3PD8 A;  4OA4 A;  4MEV A;  1NUX A;  4GOT A;  5F24 A;  2W7Y A;  3FJG A;  1MM7 A;  4GLI A;  5AA2 D;  5EYF A;  4YKJ A;  1BTJ A;  5AA3 A;  4FJP A;  4HE0 A;  4XFE A;  4PFI A;  2L5V A;  1NNT A;  3MJN A;  4RYA A;  1LBB A;  1A7L A;  2G29 A;  4ND9 A;  5A5X B;  2XX7 A;  2XXW A;  3PV0 E;  1FBF A;  1POY 1;  4O3A A;  2QRY A;  1FBC A;  3H4Z A;  3TOD A;  4KXP A;  3FJM A;  3IO4 A;  2B4M A;  1MQI A;  4RY1 A;  4ZS9 A;  5LOM A;  4QXD A;  3H06 B;  5EYG A;  3UP9 A;  3B6W A;  2HAV A;  1ZMG A;  3C36 A;  1LFH A;  3HST A;  1FBE A;  4ELP A;  1MXX A;  3S2V A;  3TQW A;  1MXZ A;  2Z8E A;  5ESY A;  2PT2 A;  3PPN A;  4MLQ A;  2Y7R A;  4OVR A;  5DEX B;  1Y1M A;  1FCK A;  3HFU A;  1BKA A;  4LN5 A;  2QMX A;  4JVC A;  2I0B A;  2OWT A;  1SW1 A;  3GYY A;  3KJ7 A;  3EHT A;  1R1N A;  3OEK A;  4Q5T A;  3SKP A;  3TKD A;  4AB6 A;  1ZLQ A;  3MVY A;  1L5T A;  5H8S A;  4FEB A;  4G8H A;  3CG1 A;  4EF1 A;  4MF3 A;  4JBZ A;  1VSO A;  1LLS A;  4KYS A;  5H8N B;  1FBP A;  2WKY A;  1BLF A;  1EZO A;  3T22 A;  1YTV A;  4JWY A;  1I6B A;  4NQ8 A;  1NFT A;  3H3G A;  1MXW A;  5KCJ B;  4YU0 A;  4O3C A;  2DWH A;  1G0H A;  1B1H A;  1SBP A;  1USY E;  2FHY A;  2O6A A;  3KN7 A;  4OEU A;  3TCH A;  2AIX A;  1MPD A;  2F35 A;  2ABH A;  4U1O A;  3RPL A;  3Q29 A;  3VFJ A;  4F22 A;  4JSD A;  5I3S A;  4G2Z A;  2FA7 A;  1Y4C A;  1SDX A;  3SEU A;  3KJT A;  2Q88 A;  1EU8 A;  1MRP A;  3OO7 A;  3E79 A;  1MDQ A;  4PGN A;  4OQO A;  3U8Q A;  4ZDM A;  2O7I A;  2B3F A;  2PX1 A;  4G4P A;  3B6T A;  2O68 A;  4OZ9 A;  1FQF A;  2OJT A;  2UXA A;  5FTH A;  3OMB A;  4NF5 A;  3BIH A;  3MZB A;  3BIG A;  5KZT A;  5TU0 A;  2HZK A;  4X1B A;  1KA1 A;  3VLU A;  3QUF A;  1FTL A;  3N6U A;  4N17 A;  2QSX A;  1Y4T A;  5IZZ A;  4JWX A;  5J1D A;  5J16 A;  4P8B A;  4Z0I A;  4QBA A;  3VLW A;  4H67 A;  1LCT A;  4OMB A;  3KSJ A;  1ZIU A;  1NUY A;  4OEN A;  1YAE A;  4P1E A;  3RUM A;  1IZ1 A;  1PB9 A;  1UIU A;  2QS4 A;  1AMF A;  4JB7 A;  1I69 A;  4PFY A;  1LFG A;  1LAF E;  3H6V A;  1VR5 A;  1XVX A;  5JK4 A;  5CMC A;  2PYY A;  1LGB C;  5ET7 A;  3T66 A;  1UTB A;  3OD7 A;  1LB9 A;  4N07 A;  4KYD A;  5BWJ A;  4HCW A;  4OES A;  1R9L A;  4P3L A;  4MX6 A;  1NV7 A;  5TP9 B;  2VPO A;  1A55 A;  4PDH A;  1OLC A;  2HXW A;  1RYO A;  5FHN A;  4MNC A;  4NF4 B;  2PT1 A;  3EHU A;  3B8B A;  3TYH A;  3Q27 A;  4I9D A;  2YLN A;  2P0S A;  4NN3 A;  2VT5 A;  2PBW A;  3IOU A;  3G3H A;  2V25 A;  3PPO A;  4LP2 B;  5KCJ A;  1B0L A;  4Q30 B;  3K0V A;  3OO8 A;  3OSQ A;  1H44 A;  4U2R A;  2I3V A;  4P47 A;  4R6Y A;  4OFO A;  3PPQ A;  1K9Y A;  2F3D A;  1HSL A;  3JV9 A;  3IO6 A;  3IJO B;  1B3L A;  4YZZ A;  4F18 A;  1B6H A;  2QL3 A;  2XXP A;  1Z7M E;  3RPL B;  1II5 A;  1S7Y A;  4H6D A;  4DI4 B;  3N94 A;  1Y3P A;  3K00 A;  2P3V A;  4MFI A;  3FGS A;  1SW2 A;  3FXU A;  5K2Y A;  2F6G A;  2DE2 A;  4NAP A;  3O2A A;  3M3F A;  4IO4 A;  3ODB A;  2HAU A;  4OAN A;  1UTB B;  1DMB A;  2RC9 A;  2DXR A;  4G68 B;  1N84 A;  5AA4 B;  1NNP A;  4LZ5 A;  1KWH A;  3UA8 A;  2HXR A;  3K6V A;  4RNS A;  4C1T A;  4OVT A;  2F36 A;  3VXB A;  4LAT A;  3I6V A;  4P11 A;  4R72 A;  3ECR A;  4GVO A;  3HPI A;  3TTK A;  2ZMB A;  5AE4 A;  4PAI A;  3T9V A;  1AL3 A;  1QW0 A;  4TOZ A;  3IAZ A;  2FIX A;  4IY5 A;  4NF8 A;  4F3P A;  4O8M A;  4BDO A;  2B65 A;  2Q8J A;  1JP4 A;  3FIR A;  1NV3 A;  2DOJ A;  2Q9T A;  1N04 A;  3CI8 A;  4Q0C A;  1LBX A;  4NF5 B;  1FPF A;  2Z23 A;  4M4G A;  2P2A A;  5H8H A;  1JQF A;  5I2K B;  3TZA A;  1DBZ A;  4GWX A;  3FXR A;  1QUJ A;  1B5I A;  1LAH E;  2R9J A;  5I56 A;  3TEP A;  1B7H A;  2HCA A;  2P3N A;  3P7I A;  1CNQ A;  1FQA A;  1P99 A;  3E3K A;  5KDT B;  4KR5 A;  4ZEK A;  4EF2 A;  3QK6 A;  3GBB A;  1IMA A;  1SD3 A;  4HTG A;  4R73 A;  1N7W A;  3QMF A;  1LAX A;  4I8C A;  1FBD A;  2CZI A;  4RA1 A;  4JWO A;  1ANF A;  3MQ9 A;  1N3X A;  4GL8 A;  4ECF A;  1AIV A;  3OO6 A;  2Y5K A;  1KA0 A;  5HM4 B;  4YIC A;  4R74 A;  1NUW A;  3O6G A;  4P1L A;  2XWV A;  4NF6 B;  4LQ5 A;  5B70 A;  2GHB A;  2NUV A;  4QFO A;  2QFL A;  3PPR A;  4BDN A;  1PB8 A;  4N4U A;  2V93 A;  4OFL A;  4G8N A;  5IGA A;  4NE4 A;  1US4 A;  4PE5 B;  2H25 A;  2UYE A;  3CFZ A;  2CEX A;  3S9L C;  4NF6 A;  4MNP A;  1A99 A;  4L17 A;  3PD9 A;  1BK4 A;  1B7U A;  1UTH A;  3FVO A;  5AA2 A;  4IY6 A;  1MXU A;  4HE1 A;  4GXA A;  2ONK E;  4N8G A;  4FIM A;  3KOT A;  2WYK A;  1MY0 A;  1D9V A;  1FW0 A;  3KC0 A;  4YKK A;  2REJ A;  1LBC A;  3V89 B;  4WEP A;  4F2Q A;  4FE8 A;  3VE1 B;  5I5P A;  4F29 A;  3RT8 A;  5DYH A;  1LFI A;  3IOW A;  3CSB A;  4KQP A;  5CC2 A;  2REG A;  4MNI A;  3W9W A;  4F39 A;  3G3J A;  2X7Q A;  3B7D A;  3C35 A;  4H46 A;  1MXV A;  1GTK A;  1O7T A;  1B3H A;  2ZYO A;  3UIF A;  4DCY A;  4GRK A;  1QUK A;  4PP0 A;  2AL4 A;  4BDM A;  4YMB A;  1FPB A;  1AH5 A;  2NVU B;  4EQB A;  4H5F A;  2I4C A;  3KBZ A;  4ZED A;  5L8D A;  1QVS A;  2D3I A;  3OEM A;  4HXV A;  4OET A;  1PB7 A;  4OFJ A;  1RDY A;  4GWY A;  4KCC A;  1M5F A;  2IA4 A;  4O94 A;  4PGP A;  3WAE A;  1N7X A;  3MP6 A;  2WBB A;  4NWC A;  1B52 A;  1HSE A;  2NXO A;  3E9X A;  1OVT A;  5FHO A;  2DXY A;  4KCD A;  4X9T A;  3D1R A;  3IK6 B;  2YPN A;  3H6U A;  4GX6 A;  3K02 A;  4F1V A;  1FPL A;  1Y3Q A;  1Q9D A;  3FXQ A;  5AA1 A;  5T3J A;  4R75 A;  3A29 A;  4E0W A;  2KLF A;  3FJ7 A;  1O64 A;  4WXJ A;  3KFM A;  3GXA A;  3K6X A;  1YCJ A;  2F78 A;  1DCU A;  1SQY A;  1IXH A;  1RDX A;  2QS3 A;  1AWB A;  4AS5 A;  3OXN A;  4DE8 A;  4HE2 A;  4JXI A;  2R71 A;  1FTJ A;  4DDD A;  4LUB A;  4RXL A;  3W15 C;  2DYX A;  4O7M A;  1N3W A;  4ZZA A;  1B2H A;  1MQJ A;  5L9S A;  2F7A A;  2XX9 A;  4RJZ A;  2RCA A;  4PFR A;  3S9E A;  2O84 X;  4P0G A;  2QS1 A;  3PMV A;  3FVK A;  1H43 A;  3BFT A;  1URS A;  3MZ9 A;  1ZU0 A;  4RPO A;  2R8T A;  2Y84 A;  1B51 A;  1MPB A;  4NF4 A;  4KD5 A;  5I58 B;  1YZ0 A;  3ONM A;  5ET5 A;  3H6W A;  2D5W A;  4OXV A;  3K6W A;  4F31 B;  4PBQ A;  3S4U A;  3B6Q A;  3FD3 A;  4X48 A;  4N15 A;  1JEV A;  4KPT A;  2A5T B;  3O9P A;  4I40 A;  5LTC A;  4N6P A;  4OTE A;  1MQD A;  3LUZ A;  2QVV A;  1B40 A;  3G3I A;  3MUQ A;  2F34 A;  1CE2 A;  3ILU B;  2V4C A;  2V84 A;  4I3Y A;  1OIB A;  2OWS A;  1URD A;  4YB7 A;  1USY H;  2I49 A;  4QSD A;  4MBP A;  4NF8 B;  3SES A;  4HS7 A;  4K3F A;  4OWD A;  3MVX A;  1ZKB A;  1WVJ A;  1POT A;  1IXG A;  3SDF A;  1B0H A;  4NED A;  4OHN A;  2VD3 A;  2I0C A;  2CZK A;  2NOO A;  2RCB A;  3FV1 A;  1SI1 A;  4PC9 A;  5HPQ A;  1MDP 1;  5I2N A;  5H8Q B;  3O29 A;  3LSW A;  3ZSF A;  2QVU A;  3TTM A;  2H99 A;  2ZXT A;  1B05 A;  3HN0 A;  4FAJ A;  4ESW A;  3KSX A;  1PBP A;  3MPL A;  4KI0 E;  1OVB A;  3RY3 A;  4PAK A;  1WDN A;  1XT8 A;  2PCR A;  3T9H B;  4AB5 A;  3MVZ A;  3H03 A;  4LA9 A;  3V5A A;  1MY1 A;  3MVW A;  2DE3 A;  5CMM A;  2Y7I A;  2Q89 A;  3KOS A;  1UQW A;  3H6T A;  5ICQ A;  1IMD A;  1OQG A;  3SEV A;  2A5T A;  3QUJ A;  2ESN A;  4LVQ A;  1XC1 A;  5FBP A;  1SW4 A;  1B3G A;  1B7Z A;  2XXH A;  3EPE A;  2QPQ A;  3T9X B;  2UVH A;  2HZL A;  3C34 A;  3RNN A;  4NG7 A;  1FRP A;  2Y7W A;  3VLV A;  3T9U A;  5IAI A;  2DS9 A;  3CR9 A;  1I6A A;  2DVC A;  1B4H A;  4YMA A;  5F1Q A;  4QF9 A;  4F3S A;  2QVR A;  3SEY A;  2BJJ X;  3TCF A;  1LBZ A;  4P0I A;  1QKA A;  4FED A;  3TQL A;  3VXC A;  3BBR A;  3CSG A;  1VE4 A;  2XXV A;  1JW4 A;  1GGG A;  4EXL A;  5I57 B;  3MST A;  3IFC A;  5LDZ A;  3OO9 A;  3SET A;  3A3U A;  1LBW A;  3HHF A;  2I4B A;  4NTL A;  2R6G E;  1INP A;  1MS7 A;  1Y9U A;  1DTG A;  3I3V A;  3KC1 A;  5I59 B;  4PDD A;  3C4M A;  3FBP A;  1QUL A;  4I62 A;  4THI A;  3O6I A;  5I57 A;  3CFL A;  5EHM A;  1ZBM A;  4LQ2 A;  2QJE A;  3QAX A;  4PBH A;  3UN6 A;  3MYU A;  2CMO A;  5DT6 A;  5CRY A;  5IZ3 A;  1D9Y A;  1PBQ A;  2E1S A;  2AYS A;  2FNC A;  4NHB A;  2HHM A;  4JVD A;  1YPN A;  1NUZ A;  4IR8 A;  1MY3 A;  1PDA A;  4G8M A;  3IOV A;  2XXY A;  2DDK A;  1IXC A;  2ONR A;  4OVJ A;  2Z8D A;  2GH9 A;  4IGR A;  4R9F A;  1P1U A;  1IIT A;  2X7P A;  2ZYM A;  4PF6 A;  2FYI A;  1UIV A;  4AQ4 A;  1A40 A;  4I3E A;  1JET A;  3GBA A;  3LUY A;  1Q35 A;  1TFD A;  5ET8 A;  1FJ6 A;  1JVY A;  3DP6 A;  3C9H A;  3FVG A;  3VV5 A;  4LON B;  3QSL A;  3L6G A;  2O7U A;  3ZKK A;  2HPG A;  4PFT A;  1EZP A;  2XXX A;  4DCX A;  1B3E A;  1H76 A;  1Y1Z A;  4GBV A;  3VVE A;  5EYH A;  2V3U A;  4YB6 A;  3TMG A;  1LAG E;  1XI6 A;  2IEE A;  2XHD A;  1NV0 A;  1D4N A;  4JDF A;  5TPA A;  1S9T A;  4BDR A;  1JW5 A;  1NV5 A;  3RYD A;  3MP1 A;  2UVJ A;  2XXQ A;  5ISU A;  1MY2 A;  1EYJ A;  2HFB A;  3BKI B;  1GR2 A;  3LSL A;  4F1Y A;  3IOR A;  4GWW A;  3KG2 A;  3PUV E;  1SW5 A;  3IB1 A;  1YYZ A;  2THI A;  3ZS6 A;  3Q25 A;  1OMP A;  1Q1K A;  4R9G A;  2H4I A;  5CMK A;  4IO5 A;  2GRV A;  3IL1 B;  2Y7P A;  4NMY A;  1B46 A;  2NWJ A;  1WOD A;  2ZYK A;  4G77 A;  2XXI A;  4N81 A;  3RN8 A;  5H8Q A;  4MH5 A;  3W9V A;  3PU5 A;  1NV6 A;  1DK4 A;  2UVI A;  4IO6 A;  2X26 A;  1XOC A;  4TLM B;  3DLN A;  2XA5 A;  2LAO A;  2RKM A;  3DEL B;  4LZ7 A;  4KFQ A;  5FTI A;  2RIN A;  3OEN A;  2VP1 A;  3K1N A;  1IXI A;  3E4R A;  4DXC A;  1TXF A;  4PE3 A;  1B5H A;  4QHQ A;  3U1O A;  4OVQ A;  2H5Y A;  3TUS A;  4WKM A;  4HW8 A;  2OLB A;  3MAM A;  1XVY A;  1NV4 A;  4EQ7 A;  1JEU A;  4ONY A;  3Q28 A;  3PMW A;  1FBH A;  3U92 A;  1H45 A;  4FAT A;  1NNF A;  3TTL A;  2O1M A;  4GX4 A;  3HHG A;  4PTK A;  4H5G A;  3I5O A;  3R26 A;  3Q26 A;  5JEI A;  1EYI A;  1A8F A;  1A8E A;  1YXI A;  2Z22 A;  3MP8 A;  1HSJ A;  3RTF B;  1P1Q A;  2ANJ A;  3RPW A;  1IUD A;  2DQV A;  3K2D A;  3VVF A;  4ESX A;  1NV1 A;  4TQU Q;  2FIE A;  1Y20 A;  5CBS A;  1NMU A;  2ZZW A;  3MZ1 A;  3EQ1 A;  4DI3 D;  2XXU A;  4LZ8 A;  4U22 A;  2KQZ A;  1JW1 A;  5BUU A;  2XWI A;  3CFX A;  3RGY A;  1J1N A;  3QXM A;  3N26 A;  1B9J A;  3IJX B;  2Q2C A;  3TAJ A;  4MIJ A;  2I58 A;  3EHS A;  1FPJ A;  4XKR A;  5IM2 A;  3S9M C;  3V8X B;  3IB2 A;  1NKX A;  4KYE A;  2E0S A;  4XF5 A;  4KHZ E;  1TWY A;  1Z7N E;  2O51 A;  4ELQ A;  2ZZX A;  5EQ7 A;  4ZEB A;  3N6T A;  3G7W A;  4F3B A;  1FQE A;  2F7B A;  3BFU A;  1FPD A;  3TFL A;  4H45 A;  2FVZ A;  3PGF A;  1S50 A;  3G3G A;  5I2N B;  1FTK A;  3C31 A;  4GIZ A;  4PQJ A;  4FEC A;  4MHF A;  4M1V A;  2ZNT A;  3USD A;  4N6D A;  1NV2 A;  1URG A;  4BDL A;  3LV0 A;  2GQ1 A;  2HQ0 A;  4DXU A;  2RC8 A;  4MMP A;  4XKP A;  4POW A;  5IKB A;  5L9O A;  3E13 X;  4Q8R A;  3B50 A;  1DTZ A;  4FOR A;  1B32 A;  4GD5 A;  3RLF E;  1QGX A;  3R7X A;  1IMF A;  4ZE8 A;  3GZG A;  2F8D A;  4EDP A;  5ET6 A;  1TFA A;  2ALU A;  1RYX A;  5DTB A;  2XX8 A;  2Q74 A;  1B1X A;  5L9M A;  4NWD A;  3D4C A;  4MAG A;  4GWU A;  4XXU A;  3LSF B;  2RC7 A;  3UGW A;  5ITO A;  1FQD A;  1EYK A;  4EUO A;  3C32 A;  3D4G A;  2DP8 A;  2MKZ A;  3A3C A;  3EF7 A;  3DP8 A;  4POX A;  3TTR A;  1P1W A;  3SZP A;  4RK2 A;  2KR0 A;  3N5L A;  1FTO A;  4IB2 A;  1FSA A;  4N13 A;  4OEV A;  2B3B A;  4NF0 A;  1FPG A;  4G68 A;  4YB5 A;  3SEW A;  3FZV A;  2Y7K A;  1AOV A;  4PF8 A;  1QKB A;  1MH3 A;  5AA2 B;  1ZTY A;  3KN3 A;  1EH3 A;  3PPP A;  5M2V A;  3O97 A;  4U1Z A;  1IEJ A;  1MQH A;  2DWJ A;  4ZE9 A;  4I1D A;  2V3T A;  3PUY E;  4U21 A;  2OK2 A;  3QYT A;  1ATG A;  4RK9 A;  3TDJ A;  1ELJ A;  1LCF A;  2F7C A;  5B7D A;  3MWB A;  1IMC A;  3CG3 A;  4GX3 A;  5TP9 A;  3AXF A;  3RQT A;  4GWO A;  5DEX A;  4JSO A;  1F9B A;  4MJO A;  2A5S A;  4C1U A;  4C0R A;  2AL5 A;  3T0J A;  1A54 A;  2PVU A;  1MG1 A;  4ELR A;  3IB0 A;  1VFE A;  2Q8M A;  2DE4 A;  3LSX A;  5CM6 A;  1LB8 A;  1P1N A;  3EKI A;  2Q2A A;  1JNF A;  1N76 A;  1M5E A;  2XXK A;  5H8N A;  2P1S A;  2VD2 A;  2ZNU A;  2F3B A;  3K1M A;  2WBD A;  1MM6 A;  3UK4 A;  4OVS A;  1D9Q A;  2B4L A;  1DPP A;  1FTM A;  4XEQ A;  4R6H A;  5DVJ A;  5KDT A;  2DWA A;  3T1B A;  2O69 A;  3G3K A;  5ICT A;  5K2X A;  2VPN A;  3S9N C;  4UAC A;  2I3W A;  4N91 A;  2VOZ A;  2CZH A;  3C33 A;  4X1D A;  5EQ9 A;  1D3K A;  2I6E A;  5HBC A;  4BDQ A;  1SYH A;  4DIG A;  3FAT A;  3IFA A;  4GF8 A;  4GL0 A;  2ZYN A;  5DVF A;  1FBG A;  4OYV A;  5ITP A;  2F5X A;  1I6Q A;  1N0T A;  2PFY A;  4QFP A;  3TTN A;  1EZ9 A;  3G3F A;  4GFR A;  3DM0 A;  3K01 A;  2UVG A;  3TPA A;  4R2F A;  4X8R A;  4QSC A;  3K1P A;  1DOT A;  4XKN A;  3O6H A;  1SI0 A;  1MH4 A;  3THI A;  3MBP A;  3E78 A; 
#chains in the Genus database with same CATH homology
 4FEB A;  4G8H A;  3K4U A;  3CG1 A;  4MLV A;  4EF1 A;  4MF3 A;  1GTK A;  4JBZ A;  1FQC A;  1O7T A;  4DCY A;  1VSO A;  1LLS A;  1B3H A;  2THI A;  2ZYO A;  2DSF A;  3JZJ A;  3Q25 A;  4GRK A;  4KYS A;  1OMP A;  2XD3 A;  2WKY A;  3KEI A;  1BLF A;  1Q1K A;  1QUK A;  2O1L A;  2GHA A;  4H1X A;  1EZO A;  4PP0 A;  4R9G A;  3LC8 A;  4ISU A;  2AL4 A;  2H4I A;  3T22 A;  4IO5 A;  5CMK A;  2GRV A;  3IL1 B;  2Y7P A;  1YTV A;  2PMS A;  4NMY A;  4JWY A;  1I6B A;  4BDM A;  1B46 A;  3MPK A;  1NFT A;  4YMB A;  3H3G A;  1WOD A;  2NWJ A;  1MXW A;  3VVD A;  2ZYK A;  4ZEC A;  5KCJ B;  3FVN A;  4G77 A;  4YU0 A;  1AH5 A;  2NVU B;  2XD2 A;  4EQB A;  2XXI A;  4O3C A;  4H5F A;  2I4C A;  2DWH A;  3UOR A;  3RN8 A;  1B1H A;  1SBP A;  1USY E;  2O6A A;  4XIG Q;  4R2B A;  1OLA A;  5H8Q A;  5L8D A;  4ZED A;  4F3G A;  1QVS A;  4F1U A;  3CVG A;  3U93 A;  2D3I A;  3KN7 A;  3OEM A;  4MH5 A;  4OEU A;  4OET A;  3TCH A;  3W9V A;  3PU5 A;  1PB7 A;  2AIX A;  4TLL B;  1MPD A;  2F35 A;  5I59 A;  4OFJ A;  3HO7 A;  1AOV A;  2ABH A;  1IIW A;  3OOA A;  4KCC A;  4QRZ A;  4U1O A;  1M5F A;  2GFE A;  2IA4 A;  3Q29 A;  4IO7 A;  3VFJ A;  3WAE A;  4F22 A;  3U72 A;  2UVI A;  4JSD A;  1N7X A;  2QMW A;  3MP6 A;  4G2Z A;  2FA7 A;  1Y4C A;  4IO6 A;  1P1O A;  1SDX A;  3SEU A;  2YJP A;  4NWC A;  1B52 A;  3KJT A;  1HSE A;  2NXO A;  2X26 A;  2Q88 A;  1XOC A;  1EU8 A;  1MRP A;  1OVT A;  3E9X A;  4TLM B;  5FHO A;  3DLN A;  3OO7 A;  4HCY A;  1MDQ A;  2LAO A;  2RKM A;  3DEL B;  2DXY A;  4LZ7 A;  4KCD A;  4OQO A;  4ZDM A;  5JTY B;  3U8Q A;  3LBS A;  4GQO A;  1MXY A;  2O7I A;  4X9T A;  2B3F A;  2PX1 A;  4G4P A;  3IK6 B;  4KFQ A;  3B6T A;  4R6K A;  2O68 A;  1NH8 A;  2YPN A;  4QFL A;  5FTI A;  3H6U A;  4OZ9 A;  2RIN A;  3OEN A;  2OCU A;  2VP1 A;  1FQF A;  3K02 A;  2OJT A;  4F1V A;  3K1N A;  1IXI A;  2UXA A;  3E4R A;  1TXF A;  4DXC A;  3RTW B;  5FTH A;  3OMB A;  4NF5 A;  5AA4 A;  1Y3Q A;  1B5H A;  3PMX A;  4QHQ A;  3MZB A;  3U1O A;  3FXQ A;  5H8H B;  5AA1 A;  4R75 A;  4E0W A;  2KLF A;  3M8U A;  5KZT A;  3TYH A;  2H5Y A;  1O64 A;  3FJ7 A;  3KBR A;  2HZK A;  5TU0 A;  4WKM A;  4RPN A;  3T93 B;  4HW8 A;  4YKI A;  2OLB A;  4WXJ A;  4OER A;  3KFM A;  4X1B A;  1B5J A;  3GXA A;  1XVY A;  3K6X A;  3MAM A;  3EN3 A;  4EQ7 A;  1JEU A;  1YCJ A;  3VLU A;  2F78 A;  3QUF A;  4ONY A;  1SQY A;  3Q28 A;  4IO2 A;  1FTL A;  1IXH A;  3PMW A;  3U92 A;  3N6U A;  2QSX A;  2QS3 A;  1Y4T A;  2OZZ A;  4Z7E A;  4IGT A;  3OXN A;  4DE8 A;  1H45 A;  3H7M A;  4FAT A;  4JWX A;  1NNF A;  3TTL A;  4PET A;  5J1D A;  4JXI A;  1QUI A;  2R71 A;  1FTJ A;  4DDD A;  4LUB A;  4Z0I A;  2O1M A;  4RXL A;  3W15 C;  2DYX A;  3HHG A;  1SYI A;  1XHY A;  3VLW A;  4H67 A;  1Y3N A;  1N3W A;  4ZZA A;  1B2H A;  1LCT A;  1MQJ A;  3KSJ A;  4H5G A;  4OMB A;  2H9B A;  1ZIU A;  4QFK A;  2F7A A;  1JVX A;  1YAE A;  2XX9 A;  4OEN A;  4UA8 A;  4ZZE A;  1IZ1 A;  1PB9 A;  3I5O A;  3R26 A;  5H8F B;  3WAF A;  3Q26 A;  4RJZ A;  2RCA A;  1UIU A;  1A8F A;  1AMF A;  2QS4 A;  3OEL A;  3PUX E;  4JB7 A;  5JEI A;  3V83 A;  1A8E A;  1I69 A;  2Z22 A;  4PFY A;  3MP8 A;  1LFG A;  1HSJ A;  3GLB A;  1LAF E;  3HCQ A;  3S9E A;  4EXK A;  3RTF B;  3H6V A;  4GXS B;  3FV2 A;  5CI5 A;  1VR5 A;  1XVX A;  2O84 X;  4P0G A;  5CBR A;  2QS1 A;  5JK4 A;  1B4Z A;  5CMC A;  1P1Q A;  3PMV A;  2ANJ A;  5I2K A;  3KGC A;  2PYY A;  3RPW A;  3FVK A;  1IUD A;  1LGB C;  1H43 A;  2DQV A;  3K2D A;  3BFT A;  1URS A;  3MZ9 A;  2VGQ A;  3T66 A;  1UTB A;  1ZU0 A;  4RPO A;  3VVF A;  2Y84 A;  3OD7 A;  3KZG A;  1LB9 A;  4N07 A;  1B51 A;  2F6P A;  4ESX A;  1MPB A;  4NF4 A;  5ELV A;  4KYD A;  4KD5 A;  5BWJ A;  5I58 B;  1BP5 A;  1LST A;  4TQU Q;  3ONM A;  4HCW A;  4OES A;  2XXR A;  1NNK A;  3U94 A;  1Y20 A;  3H6W A;  1T0K A;  5CBS A;  1R9L A;  1NMU A;  2D5W A;  3MZ1 A;  4OXV A;  3EQ1 A;  5TP9 B;  3K6W A;  1A55 A;  2XXU A;  3FAS A;  3HV1 A;  4F31 B;  4LZ8 A;  4U22 A;  2DVZ A;  3JYR A;  4H0W A;  1OLC A;  1JW1 A;  2HXW A;  1RYO A;  3S4U A;  2QS2 A;  5FHN A;  5I58 A;  3B6Q A;  5BUU A;  3CFX A;  4NF4 B;  3RGY A;  3FD3 A;  4X48 A;  1J1N A;  2PT1 A;  5I56 B;  1GV8 A;  3QXM A;  3EHU A;  1JEV A;  1B9J A;  1XS5 A;  3N26 A;  3IJX B;  2Q2C A;  3Q27 A;  3LR1 A;  4G68 C;  2A5T B;  4KPT A;  3TAJ A;  2I58 A;  4I9D A;  2YLN A;  3O9P A;  3EHS A;  1MPC A;  2P0S A;  4XKR A;  3ZKL A;  2PBW A;  1NL5 A;  4N6P A;  3IOU A;  4OTE A;  3G3H A;  1MQD A;  5CMB A;  3S9M C;  3V8X B;  1O63 A;  2V25 A;  3PPO A;  1B40 A;  3G3I A;  3IB2 A;  3MUQ A;  4LP2 B;  5KCJ A;  2F34 A;  1R9Q A;  1NKX A;  3F11 A;  5A5X A;  1CE2 A;  3ILU B;  4KYE A;  1B0L A;  1PEB A;  2E0S A;  1NH7 A;  3K0V A;  3OO8 A;  2M8C A;  2V84 A;  3OSQ A;  4Q30 B;  1H44 A;  1DPE A;  4U2R A;  4KHZ E;  2I3V A;  1TWY A;  2V3Q A;  5F7V A;  1Z7N E;  4XTC Q;  2O51 A;  1OIB A;  4R6Y A;  5DVI A;  4ELQ A;  4F18 A;  4OFO A;  3PPQ A;  3CIJ A;  2OWS A;  1URD A;  3IR1 A;  4YB7 A;  1HSL A;  3JV9 A;  3IO6 A;  5FHM A;  3IJO B;  4ZEB A;  1B3L A;  1USY H;  2I49 A;  3N6T A;  3G7W A;  4QSD A;  4MBP A;  4YZZ A;  4NF8 B;  1FQE A;  2F7B A;  3BFU A;  3SES A;  3TFL A;  1B6H A;  4F2O A;  3DP4 A;  4HS7 A;  4K3F A;  2QL3 A;  2XXP A;  4OWD A;  1Z7M E;  1II5 A;  3MVX A;  3SER A;  3PGF A;  1S7Y A;  1ZKB A;  1WVJ A;  1S50 A;  1POT A;  3G3G A;  5I2N B;  4IO3 A;  1FTK A;  3C31 A;  1IXG A;  3A09 A;  4GIZ A;  4PQJ A;  3SDF A;  4FEC A;  1B0H A;  4H65 A;  4NED A;  2VD3 A;  3MC2 A;  3PUV E;  2DWI A;  4M1V A;  4OHN A;  1GVC A;  2I0C A;  2NOO A;  2ZNT A;  3FUZ A;  4H6D A;  3N94 A;  1Y3P A;  2RCB A;  3K00 A;  3USD A;  4MFI A;  3O28 A;  1URG A;  3FGS A;  1SW2 A;  3FV1 A;  4BDL A;  1SI1 A;  3FXU A;  5HPQ A;  1BIY A;  1MDP 1;  5I2N A;  2HQ0 A;  3QIM A;  1H3D A;  5K2Y A;  2F6G A;  2DE2 A;  5H8Q B;  3O29 A;  3LSW A;  3ZSF A;  3O2A A;  1TT1 A;  2D21 A;  3M3F A;  4DXU A;  2RC8 A;  4XKP A;  3RUM A;  4POW A;  1CB6 A;  3TTM A;  4IO4 A;  4ELO A;  5IKB A;  2H99 A;  2ZXT A;  5L9O A;  1B05 A;  3E13 X;  4Q8R A;  3HN0 A;  4FAJ A;  3ODB A;  4FOR A;  1DTZ A;  2HAU A;  2RF1 A;  1PBP A;  2OBG A;  1B32 A;  3KSX A;  3MPL A;  4GD5 A;  1R6Z A;  4KI0 E;  3RLF E;  1OVB A;  3R7X A;  1ZJL A;  1UTB B;  1DMB A;  2RC9 A;  1WDN A;  2DXR A;  4YKP A;  3RY3 A;  3TCG A;  1XT8 A;  4U23 A;  4ZE8 A;  3GZG A;  4G68 B;  3T9H B;  4AB5 A;  3MVZ A;  3H03 A;  1B58 A;  4LA9 A;  4QSE A;  2F8D A;  3K6U A;  4EDP A;  3SEX A;  1N84 A;  1M5B A;  1TFA A;  1SVX B;  1NNP A;  4LZ5 A;  3V5A A;  5AA4 B;  2ALU A;  1MY1 A;  1RYX A;  3M3K A;  4ZEF A;  3MVW A;  5DTB A;  1KWH A;  2DE3 A;  3UA8 A;  5CMM A;  2XX8 A;  2Y7I A;  3K6V A;  4RNS A;  4C1T A;  2Q89 A;  1B1X A;  1OQH A;  5L9M A;  2F36 A;  4NWD A;  4DXB A;  2ONS A;  3KOS A;  1UQW A;  3D4C A;  1QJM A;  3H6T A;  1FQB A;  3I6V A;  3L6H A;  4LAT A;  4P11 A;  5ICQ A;  4R72 A;  4XXU A;  3LSF B;  5JTY A;  2RC7 A;  1OQG A;  3ECR A;  3SEV A;  4DLD A;  3UGW A;  1US5 A;  4GVO A;  1FQD A;  5ITO A;  3TEL A;  5H8F A;  2A5T A;  3QUJ A;  3HPI A;  2ESN A;  1MY4 A;  4LVQ A;  2G93 A;  3TTK A;  1XC1 A;  2ZMB A;  1SW4 A;  1MQG A;  1B3G A;  3R6U A;  1B7Z A;  4EUO A;  2XXH A;  3C32 A;  3D4G A;  3EPE A;  4QFN A;  4E0X A;  2ZNS A;  2QPQ A;  2DP8 A;  3IX1 A;  5AE4 A;  3A3C A;  3T9X B;  3EF7 A;  4F3B A;  2UVH A;  3T9V A;  1AL3 A;  1QW0 A;  3OSR A;  4TOZ A;  3DP8 A;  3IAZ A;  4POX A;  3TTR A;  4IY5 A;  1P1W A;  2HZL A;  4NF8 A;  3C34 A;  4RK2 A;  4F3P A;  3RNN A;  4DZ1 A;  4WED A;  4BDO A;  2B65 A;  2Q8J A;  3N5L A;  2Y7W A;  3VLV A;  1FTO A;  4IB2 A;  4N13 A;  4OEV A;  3T9U A;  4O3B A;  2DS9 A;  3CR9 A;  3FIR A;  5EHS A;  2F97 A;  1I6A A;  2VHA A;  2DOJ A;  3UIF A;  2DVC A;  1B4H A;  4U4S A;  4YMA A;  1DSN A;  2B3B A;  2Q9T A;  5F1Q A;  4QF9 A;  3T96 B;  4F3S A;  1N04 A;  3CI8 A;  4G68 A;  2BJJ X;  4Q0C A;  3SEY A;  4YB5 A;  3TCF A;  3VDF A;  2I48 A;  3SEW A;  3FZV A;  4NF5 B;  4P0I A;  1QKA A;  2Z23 A;  4FED A;  2Y7K A;  1VFD A;  2P2A A;  4M4G A;  4XKQ A;  5H8H A;  3TQL A;  1JQF A;  1QKB A;  3BBR A;  5I2K B;  3VXC A;  4U4X A;  1MH3 A;  3CSG A;  1ZTY A;  4H8I A;  3TZA A;  3FXR A;  5AA2 B;  3KN3 A;  4ZEI A;  1EH3 A;  1VE4 A;  3PPP A;  1QUJ A;  1UTH B;  2Z8F A;  3ZS6 A;  1B5I A;  5M2V A;  3O97 A;  4U1Z A;  1B3F A;  1IEJ A;  1LAH E;  1MQH A;  2XXV A;  1JW4 A;  2DWJ A;  1GGG A;  2R9J A;  2V3T A;  4I1D A;  4EXL A;  4ZE9 A;  3PUW E;  1PC3 A;  2CZL A;  2XXT A;  1RKM A;  2HEU A;  3PUY E;  4EQ9 A;  5I56 A;  5I57 B;  4U21 A;  4F19 A;  3TEP A;  1B7H A;  2HCA A;  2OK2 A;  3OO9 A;  3RT6 B;  3QYT A;  3SET A;  3VXB A;  3A3U A;  4H8J A;  3HHF A;  4NTL A;  1ATG A;  2I4B A;  2R6G E;  1IQ7 A;  3IOT A;  3P7I A;  4PFU A;  4RK9 A;  3TDJ A;  3ILT B;  1ELJ A;  1FQA A;  1LCF A;  1M5C A;  1P99 A;  2F7C A;  2UYF A;  3MWB A;  5B7D A;  3CG3 A;  2H98 A;  5TPA B;  3O66 A;  3E3K A;  1MS7 A;  4BLA A;  5KDT B;  1Y9U A;  3CRB A;  3M3L A;  1DTG A;  3AXF A;  3I3V A;  4KR5 A;  4ZEK A;  5TP9 A;  3QK6 A;  4GWO A;  3RQT A;  4EF2 A;  5I59 B;  4PFW A;  3MW0 A;  3TUS A;  3GBB A;  4YAH X;  5DEX A;  5L9S A;  1M5D A;  4JSO A;  1F9B A;  1SD3 A;  3C4M A;  4HTG A;  4R73 A;  1N7W A;  3KN8 A;  3PUZ E;  3PD8 A;  1LAX A;  1QUL A;  2A5S A;  4I8C A;  4C0R A;  4C1U A;  4GOT A;  2AL5 A;  4I62 A;  2W7Y A;  1A54 A;  2PVU A;  4THI A;  4RA1 A;  4JWO A;  3O6I A;  1ANF A;  3FJG A;  5I57 A;  1MG1 A;  1MM7 A;  3CFL A;  5EHM A;  4ELR A;  1ZBM A;  3MQ9 A;  4GLI A;  3IB0 A;  2QJE A;  3QAX A;  1N3X A;  1VFE A;  2DE4 A;  4LQ2 A;  5EYF A;  4YKJ A;  3UN6 A;  4GL8 A;  2CMO A;  1BTJ A;  4ECF A;  5AA3 A;  3LSX A;  5CM6 A;  4FJP A;  5DT6 A;  1LB8 A;  1AIV A;  1P1N A;  5CRY A;  3OO6 A;  2Q2A A;  1JNF A;  1D9Y A;  1PBQ A;  2E1S A;  1N76 A;  2AYS A;  1NNT A;  3MJN A;  4RYA A;  1LBB A;  5HM4 B;  1M5E A;  2FNC A;  4YIC A;  4R74 A;  1A7L A;  2G29 A;  1YPN A;  5H8N A;  3O6G A;  2P1S A;  2VD2 A;  2ZNU A;  4NF6 B;  4LQ5 A;  3K1M A;  1MM6 A;  3UK4 A;  4ND9 A;  5A5X B;  5B70 A;  1MY3 A;  2XX7 A;  2XXW A;  2GHB A;  1PDA A;  2NUV A;  1DPP A;  4G8M A;  4QFO A;  1FTM A;  3IOV A;  5IAI A;  2XXY A;  3PPR A;  1PB8 A;  4BDN A;  2V93 A;  4OFL A;  5I84 A;  3PV0 E;  1IXC A;  1POY 1;  2ONR A;  4OVJ A;  4O3A A;  4R6H A;  4G8N A;  2Z8D A;  5DVJ A;  2GH9 A;  4NE4 A;  1US4 A;  5KDT A;  4PE5 B;  4IGR A;  2DWA A;  2QRY A;  4R9F A;  3H4Z A;  3TOD A;  5H8N B;  1P1U A;  2H25 A;  2UYE A;  1IIT A;  2X7P A;  2O69 A;  2ZYM A;  3FJM A;  3IO4 A;  3G3K A;  1MQI A;  2FYI A;  5ICT A;  3CFZ A;  1UIV A;  4RY1 A;  5K2X A;  4AQ4 A;  3S9N C;  4UAC A;  2I3W A;  1A40 A;  4ZS9 A;  3S9L C;  1JET A;  2VOZ A;  5LOM A;  4NF6 A;  3GBA A;  3LUY A;  1Q35 A;  1TFD A;  3H06 B;  3C33 A;  1JVY A;  3DP6 A;  3C9H A;  1A99 A;  1D3K A;  4X1D A;  3UP9 A;  3B6W A;  2HAV A;  3FVG A;  1ZMG A;  4L17 A;  3C36 A;  2I6E A;  3VV5 A;  5HBC A;  4BDQ A;  4LON B;  3PD9 A;  1B7U A;  1SYH A;  1UTH A;  3FAT A;  4DIG A;  1LFH A;  3FVO A;  4GF8 A;  3QSL A;  4GL0 A;  5AA2 A;  4IY6 A;  1MXU A;  4GXA A;  3HST A;  3L6G A;  2ONK E;  2ZYN A;  4FIM A;  2O7U A;  3KOT A;  5DVF A;  3ZKK A;  1MXX A;  4PFT A;  4ELP A;  3S2V A;  2XXX A;  4DCX A;  1B3E A;  1H76 A;  1Y1Z A;  1EZP A;  3VVE A;  4OYV A;  3TQW A;  2V3U A;  4YB6 A;  1MXZ A;  5AA2 D;  5ITP A;  1MY0 A;  3TMG A;  1D9V A;  1FW0 A;  1LAG E;  2PT2 A;  2Z8E A;  3PPN A;  2Y7R A;  4MLQ A;  5DEX B;  4YKK A;  2F5X A;  2REJ A;  1LBC A;  1I6Q A;  1Y1M A;  2IEE A;  3V89 B;  1FCK A;  4WEP A;  4F2Q A;  1BKA A;  4FE8 A;  3VE1 B;  1N0T A;  2XHD A;  5TPA A;  1D4N A;  4JDF A;  4ESW A;  2QMX A;  4QFP A;  3RT8 A;  4F29 A;  1S9T A;  4BDR A;  2I0B A;  2OWT A;  1SW1 A;  3TTN A;  1EZ9 A;  1JW5 A;  3KJ7 A;  5DYH A;  3EHT A;  3G3F A;  1R1N A;  4GFR A;  3MP1 A;  2UVJ A;  1LFI A;  2XXQ A;  5ISU A;  1MY2 A;  3DM0 A;  3OEK A;  3K01 A;  2UVG A;  2HFB A;  3TPA A;  4R2F A;  3IOW A;  3BKI B;  1GR2 A;  3CSB A;  3LSL A;  4Q5T A;  3SKP A;  4QSC A;  4KQP A;  3K1P A;  4F1Y A;  5CC2 A;  2REG A;  3IOR A;  3TKD A;  1DOT A;  4XKN A;  3O6H A;  1SI0 A;  3W9W A;  1MH4 A;  4F39 A;  4AB6 A;  3G3J A;  1ZLQ A;  3MVY A;  3THI A;  2X7Q A;  3B7D A;  3C35 A;  3MBP A;  1L5T A;  3KG2 A;  5H8S A;  1SW5 A;  1MXV A;  3IB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...