2HQ1A

Crystal structure of orf 1438 a putative glucose/ribitol dehydrogenase from clostridium thermocellum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
245
structure length
221
Chain Sequence
b'MQLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSPASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAWDDVLNTNLKSAYLCTKAVSKIMLKQKSGKIINITSQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVLPDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose/ribitol dehydrogenase
publication title Crystal Structure of ORF 1438 a putative Glucose/ ribitol dehydrogenase from Clostridium thermocellum
rcsb
source organism Clostridium thermocellum
molecule tags Oxidoreductase
total genus 84
structure length 221
sequence length 245
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hq1A00
3OJOA 4R16A 1DRWA 1LLCA 2EXXA 3FBTA 4HWKA 4XQGA 3BAZA 1U2GA 1YKFA 3JYQA 1WAMA 3PJGA 3S2EA 1U7HA 1BDMA 4E33A 2BELA 3DONA 3C7CB 2JHFA 4OKIA 4Y67A 4B3HA 1CQJA 1ONPA 4CR8A 2IZ0A 1GQYA 5A9SA 5IXYA 3EK2A 3U62A 2UUOA 1LSSA 4RPJA 1NX6A 2O4UX 3DB2A 1AGNA 4AJPA 3DBHA 1DXYA 4DBZA 9LDBA 1GAEO 2B35A 1NP3A 4AJ2A 4EEXA 3RBXA 4CQMA 4U0JA 2HAEA 4JN6B 1SZJG 3WBBA 3T4EA 4Z3KA 1ID1A 1KIFA 1X1EA 1JKIA 3KLMX 3BMOB 1B8VA 2F1KA 1JQBA 1SB9A 3F1KA 2ILTA 5F3RA 2Q4EA 1MXHA 7ADHA 5T6BA 5CP8A 2XXJA 2B36A 5G4KB 1PS8A 2AQIA 2O3JA 1EE9A 3KVOA 4NU6A 3K31A 3RU7A 4MVJE 4YT4A 1E7YA 1NPDA 5DT9A 1YJ8A 4PLTA 5IZCA 5A05A 3LQFA 4L0QA 2IZZA 3GDGA 5DN9A 3PHHA 4GX2A 3ZW9A 2D0IA 5B1YA 4RF4A 3H3JA 4I5EA 1LC0A 4JLWA 2ZQZA 4J91A 3KUXA 4WCFC 3UOGA 1PQUA 1JDJA 1VKOA 8LDHA 4PLHA 5JC1A 1FMCA 1JA9A 2A92A 3PJEA 1TT5B 4EUFA 4M55A 5C7LO 1M6HA 1XQ1A 3TFQA 4CM1A 1UXKA 3DHNA 1Q7BA 1BMDA 4BO4A 1V6AA 4RVUA 3E82A 4JBGA 3NTRA 2DUWA 2BF7A 3AFMA 3ASVA 1WPQA 3UUWA 4BO9A 4H16A 5I9NA 1MA0A 3OICA 3ZWPA 3FTNA 3MOIA 4JJFA 3RFTA 5B4TA 1ZCJA 3BZUA 5I9LA 1SEVA 3U4HA 3HHPA 1Y8QB 1ZW1A 2VOJA 4GVXA 4XA8A 3VH3A 1RM5A 5FFFA 5A02A 3BMQA 4RZIA 1UXJA 2Z5LA 1IL0A 1UAGA 2VNAA 4ITUA 4XQEA 4CMHA 3GN1A 2P91A 4KP7A 3DZKA 2HMWA 1B8UA 3EW7A 1CIVA 1R0SA 2NTVA 5KOIA 4FN4A 2B4QA 4BNTA 4LSWA 1P31A 2Q50A 4DYVA 1DO8A 4YDRA 3L9WA 1WDMA 3VDQA 4K6CA 4G65A 4XGIA 5F1PA 1J5PA 3GZNB 1PJCA 1N9GA 1ZMOA 5GMOA 2EJWA 1E1MA 2NV6A 3E03A 1AHHA 4FIZA 1A5ZA 3N7UA 4QX6A 3LU1A 3D0OA 3GMSA 1Z6ZA 2EGGA 4GKVA 3B1JA 3IP1A 5F21A 2GYYA 2B4RO 3QVXA 1VLLA 3ZW8A 1T2AA 2TMGA 3U49A 5L4SA 3RJ5A 3E9QA 1UXIA 4PG7A 4B79A 1P0FA 3P7MA 4J7CA 3ETDA 2NQ8A 3OETA 2CNBA 4PLYA 4INAA 4XQCA 3E8XA 2Z95A 3RVDA 3RSHA 1BW9A 3GT0A 2CVOA 1UR5A 3F1LA 1U4SA 3JCZA 2OBYA 2X1HA 2QRJA 4O5OA 1EK6A 3GY0A 3JSAA 1DOHA 4B3IA 3WDSA 1LUAA 1A4UA 3DBRB 1SPXA 1LRLA 1ZSNA 3KOUA 3U4IA 4OAQA 3ZHZA 1ZUD1 3UF0A 2XXBA 4L4SA 4UEJA 4DPLA 1DC3A 2NLOA 4HBGA 4AJLA 1LQTA 3WJ7A 3OM9A 5JYEA 1X7DA 4IJWA 4KZPA 3SC6A 4Q3CA 3PWZA 4O1MA 3ZWAA 4A2CA 3NJ4A 2PFGA 5TX7A 5DOVA 3WLEA 1CQIA 1EFKA 1Q0HA 3ZV6A 2YJZA 1QYDA 3ON5A 3TZCA 3DBLA 2NU6A 3IMFA 4UVHA 4H3VA 1NM5A 1Y8RB 6ADHA 1ZSVA 3KM0A 4ZA2A 3MCVA 1GDHA 1ZKMA 1H6AA 3A4VA 2EKLA 3GG2A 4G2NA 3FBGA 1KEPA 1UP6A 4NFYA 1M6WA 3SC4A 2AA3A 4TWRA 1T2EA 2OGUA 5A5FA 1C0IA 2O7SA 4JP2A 4ZQHA 4ZQFA 4E30A 4YRBA 3PGJA 1GPJA 2QZ9A 2YUTA 3ASUA 3GVCA 1LSJA 4NMHA 4TMFA 5JDIC 1LDMA 4L4XA 4FSHA 4BB6A 3MTGA 1HZJA 4N7RA 4B4VA 1WVGA 3TPCA 3HN2A 1XYGA 4L9RA 1LRKA 3SVTA 3BMNA 3HDHA 4IDAA 1E7QA 3HADA 4XB1A 1I24A 1XQ6A 3JQ8B 3EC7A 3BMCA 4WCFA 4EJ6A 1K89A 2YHIB 3L4BC 2PV7A 1TEHA 3CSDA 3I4FA 4KDEA 4CUKA 5IAAA 3VTZA 3KZVA 1DC4A 2X8LA 2C5AA 1B8PA 2JKVA 2PZKA 1A9ZA 1IE3A 3DFZA 5A3VA 1HDOA 3NDJA 5BSGA 5BR7A 1EMDA 3BHJA 5ES3A 4BO2A 2NVWA 3D5TA 4HFMA 2Z1MA 2VCYA 4IXTA 1LSOA 1UXGA 4TVBA 4CLOB 3VC7A 2CDBA 3GG9A 3CMCO 5B4VA 1LDYA 1DJNA 3JYOA 3V8BA 4RQUA 5EINA 5H82A 3RUIA 3ENKA 5CEEA 3R3JA 4PG4A 4S3MA 4GH5A 4CQLA 2AQ8A 3NGLA 1DEHA 4IQ0A 3FPCA 4MINA 4TZTA 1O95A 4GAEA 2DBQA 4BNJA 1T26A 5DBFA 4QO7A 3O8QB 1PJBA 4P22A 3V2HA 3MOGA 4WLUA 1YL6A 3ONDA 4GX0A 4D3SA 1E6EA 2NM0A 4BKOA 3IL2A 4XX0A 4NBRA 4BMNA 1IB6A 4B4OA 1QORA 4AJKA 1JAYA 1E7WA 3GGOA 5KKAA 3Q1LA 2ZIZA 4OH1A 4NBVA 3DMTC 2Q2QA 4R9SA 4TRMA 4ZU3A 5DCYA 2CF6A 3QVOA 4DTIA 4LW8A 3GUYA 4CL3A 5DCUA 4NFSA 4DLBA 1QYCA 3JQGB 4JP3A 2I65A 2I9PA 3NTQA 4AJIA 1GD1O 4UUOA 2X58A 1ENOA 3JD1A 1BG6A 4CUJA 4HNGA 4NPCA 4XYMA 4BIIA 5HM8A 4O0LA 3S55A 1LDEA 2V6BA 1HTBA 1TVEA 4YT2A 4ALJA 5IN4A 4M86A 1ZIDA 3LYLA 1BHSA 4FC7A 3W8FA 4R1TA 2CMDA 4GWKA 4J3FA 3PHGA 2BFMA 3CPSA 4A03A 1QP8A 2PWZA 3FSRA 3QVWA 1PWZA 3ORFA 4J0EA 3SX2A 1PJQA 4NG5A 1Y9AA 2EJVA 4TKLA 4CLEA 1C3VA 5KVVA 5TGDA 4JIGA 3VKVA 4TZKA 4E5NA 3H5NA 4HFJA 3UN1A 1L7DA 4UVDA 4TQGA 4YACA 3WFIA 3HUDA 4BV9A 2JAPA 3B70A 3BMOA 4Y6RA 2HSDA 4LRTB 1Z82A 5IJZA 3GPDG 4KTTE 4JJIA 1DC6A 4LMPA 4ZN6A 5G4KA 1C1DB 3OA2A 4RVHA 5COAA 3WWZA 3I6QA 4II3A 4OKNA 3TL2A 1NNUA 1LNQA 1HE2A 1YL7A 4U5QA 4WCDA 3K2EA 2GPTA 5JNLA 3I9MA 2O2YA 4TRNA 4YR9A 3NT2A 2PZJA 3HN7A 4OQZA 3DZGA 3LVFO 4CV3A 2D3TA 3I6IA 1HWYA 3H2ZA 4LRSB 1PL7A 2NTNA 3LT0A 1H5QA 1V3TA 1E1LA 2PNFA 3RFXA 1FDUA 3JYNA 4CM7A 1LC3A 5LDGA 1E3WA 4AJOA 4Y6SA 1RYDA 2BRUA 3VAZA 3WGTA 5ICMA 1KY5A 1N92A 2ZCUA 1DAPA 4DIFA 2TMDA 4IS2A 3D5QA 1DIRA 4CLHA 4D3DA 7MDHA 2B0JA 3AOEC 3ROQA 3QWAA 3SJ7A 5U4QA 3ANNA 1YWGO 3WQSB 4YRAA 1NR1A 1YB1A 2ZCVA 1KEUA 2Q1TA 3IC5A 3ONEA 2G17A 3H9EO 5JO0A 3NGXA 1HT0A 1UP4A 5A9RA 1SOWA 4IDFA 3ZWNA 1Y8QA 2HO5A 4R4JA 1I32A 2O4CA 2YQ4A 5JDIA 1BTOA 1G6KA 4CV2A 2BGMA 3GUCA 3I4CA 4IINA 4O63O 4UULA 3IDSA 4ND5A 3VPXA 4DGSA 4A26A 1O89A 4KTVE 4Q9NA 2WWRA 2FPIA 4BO8A 4BNKA 1UDBA 4OXKA 5DCWA 2EV9A 4Z9YA 3L4BA 1NQTA 1P33A 4MVJM 1JKFA 5JCJD 1BVRA 1YRLA 2QIOA 3IS3A 4BV8A 1ISGA 1ONNA 3GZNA 2FN7A 4JXKA 1BDBA 2GCGA 3PJFA 2Y93A 3KYDB 1NHGA 1C0LA 5H81A 2AEFA 2B83A 5JO9A 1NFQA 1E3EA 1YOVA 3HWRA 2P2SA 4OGWA 2NU9A 5L3ZA 1WZEA 3INGA 4EJMA 1I3NA 5THKA 3ZZNA 5CPBA 3GOHA 2Y1GA 4RPGA 4WKGA 3HDJA 5JBIA 1QYWA 1GZ4A 1I01A 3GVPA 1HRDA 2JFHA 2X5KO 3H9QA 3GZ4A 4DC1A 4JQCA 1HZZA 3PYXA 1IPFA 2DBVO 4YQZA 4EGFA 3W1VA 3PVZA 3QW2A 4QFDA 1T25A 4IIUA 4WK6A 3NEPX 2V6GA 5TS3A 4BO6A 2BI8A 3DBRA 3VPGA 1U1IA 3AUSA 1YO6A 1Y6JA 4PLWA 4DIOA 1O6ZA 2NNLD 3DMTA 4MIOA 1UAYA 3FHLA 5C3MA 5L9AA 3E1KA 4OXYA 3G49A 4GSLA 3WBFA 1GCUA 3ZU5A 4IXWA 4ROSA 1NR7A 3WMXA 1PS9A 5L53A 4WASA 3L6DA 1OOEA 3OQ6A 3L0DA 3BHIA 1IOLA 4OSPA 3WGOA 1JU9A 1PGQA 2HK7A 5GZ6A 1XGKA 4CMGA 4BO3A 1Y8RA 2ZB8A 4W7HA 4WLOA 2OO5A 4EJ0A 4W4TA 4MP8A 1OC2A 3FWZA 3JQ6A 1NQ5A 4BKRA 3INTA 1A4IA 2O48X 2DU8A 2Q1UA 4XJTA 5ER6A 3ETEA 1S7CA 3AW9A 1AXGA 5KKCA 2AMFA 4J16A 1GFSA 4GPD1 4PG8A 4H7PA 5JCJA 4BNMA 2DQ4A 4WLVA 4I9UA 5JCXA 4PG6A 4BKQA 1XSEA 1GCOA 1LRJA 1EVIA 2V6FA 4GLLA 4Q3DA 3UCFA 5A03A 4R69A 1MXFA 2R6JA 3DAPA 4UUPA 1HSZA 4HNHA 5COQA 4CMAA 5CG1A 2H63A 3DO5A 4TRRA 4KUHA 4DVJA 4FR5A 1LLDA 3RUCA 3O38A 3KO8A 1P1KA 2EG9A 1X13A 2YW9A 1P45A 2R2GA 3L77A 3D4PA 4FD3A 4PZEA 1UUFA 4RV9A 4ZQGA 5ILGA 1MLDA 4D79A 4Q3BA 4BNIA 5EMHA 4CUZA 2Y1CA 3JQ8A 4QFCA 1GYRA 3VHRA 4ALLA 5BSHA 5BNFA 4ILKA 4RPKA 2P68A 2YHIA 3Q2IA 3M6IA 3ADOA 3AUTA 5I9MA 3AI1A 3V5NA 2YY7A 4F6CA 5F1OA 1KETA 2FZEA 3GVIA 4LMRA 4QUKA 2I5PO 4HADA 2QHXA 2ZB3A 3AOEA 4GI2A 3DXFA 4R5HA 4CLOA 4ZICA 1MUUA 3JQBC 3U4DA 1I5RA 2HRZA 3KXDA 3HQ4O 2VHWA 2FY8A 3F46A 1DSSG 4DQVA 1MP0A 1UDAA 1DFHA 4AG3A 5KJ1A 1HDXA 1QG6A 2W2LD 2CSUA 3ZV5A 2OUIA 3RFVA 3CXRA 3CTMA 3EZLA 1T2DA 3O8QA 3TWOA 2EKPA 4A10A 1A7AA 2JHGA 3PHJA 3WQQA 1FF9A 1UZNA 3KRTA 3TN7A 1CRWG 4FGSA 2WD7B 2VWGA 3E5RA 2I67A 3GR6A 4M8SA 3F5QA 4UAGA 1EE2A 1YXMA 1Y81A 1Z7BA 2Q1SA 5L7YA 2HLPA 3EHEA 4YEDA 3FWNA 3F5SA 5KNLA 2B5WA 1KEVA 4NI5A 3ZWWA 1R4NB 4NDNE 1XG5A 2VHYA 2VTEA 1RM4A 3JQGA 3FN4A 1D1SA 1GTMA 4J90A 4IQGA 4CV1A 1IPEA 1FDSA 1H6DA 4BNGA 1QXSA 3ITDA 4KQXA 4J4TA 3OJEA 4JBIA 4XIJA 1I30A 2HQ1A 3P2OA 3H8VA 1VPDA 4YB8A 3O4RA 1R4MB 1Y5RA 3WB9A 1YQGA 1WDKA 4J1NA 1U3TA 3W8EA 3ZN2A 4C4OA 4CR6A 1QMGA 1GPDG 2R00C 4L4RA 4CPDA 3WFJA 2X23A 3GRKA 3CINA 4URFA 4B4WA 3JQAB 4LN1A 3WTBA 1P3DA 2JD2A 2VUSA 5G4LA 2JCXA 3DOCA 5AXDA 2W8ZA 2YV3A 2IE0A 3DZHA 2Q4BA 2W4QA 5IN5A 4ND1A 4CMEC 4J6FA 2VRBA 4XZ3A 5IDWA 1AE1A 1EDOA 5T8KC 1EQUA 4UVGA 1XU7A 2OBNA 3TOXA 4FGWA 1YE3A 4A27A 1UDCA 2CUKA 2HMVA 1Q0LA 4IDCA 1L7EA 2OL4A 5C37A 4ALMA 3AFNA 4HFNA 5B4UA 1C1DA 1ZXLA 3UCEA 1TXGA 5KJEA 2E4AA 3F4LA 3TOZA 3PDJA 3TDKA 3TFOA 1VL6A 2AE2A 1WW8A 4JK3A 4N5LA 3WYCA 1NXQA 1PIWA 2BFOA 1DLIA 1PWXA 4WEOA 1ISIA 2W2LA 2WTBA 4E5MA 4KQWA 3OMLA 2HK8A 3ZNQA 1MV8A 1EFLA 3RU9A 3WOHA 1CWUA 3ZWOA 3ZWYA 2HMUA 3QIVA 1ADBA 1DC5A 3DQPA 1UXHA 1EQ2A 1VJ1A 4ND2A 2PD3A 1CDOA 1ARZA 4HUJA 4PZCA 3UGKA 3NKLA 5EIOA 4DMMA 3BA1A 1NBOA 1E3LA 3DMYA 2CF5A 4N5MA 4KOAA 2B5VA 1KEWA 5G0UA 3IUPA 3DZFA 2O3QA 5TF4A 2EHDA 1V3UA 2DTEA 3MTJA 4XRGA 3GQVA 4F3YA 1ZNQO 3ZHYA 1DIHA 5LDHA 4BNYA 2V7PA 3GRPA 4ESOA 3IOYA 1PL6A 4FFNA 2PKQO 4QSMA 3RBVA 3WR5A 4CLXA 2HU2A 3PFFA 4Y8VA 1VSUA 2ZTUA 5L7WA 4IDDA 3W6UA 1GZ3A 1J49A 3JQDA 3GDFA 1WNTA 2FPGA 2I66A 5F5NA 3DZJA 1HLPA 3CMMA 2J5KA 2QRLA 2UYYA 2WDZA 3PIDA 4KUGA 2DPHA 2GZ2A 2FR0A 5HA5A 2NVUB 4FQ8A 4R1UA 4P4NA 4RF3A 1I8TA 3W6ZA 3AI2A 1NVGA 2DTXA 2X5JO 4OM8A 4NJMB 5CPFA 4XDYA 4BUCA 2QQ5A 1NVMB 2VUTA 2C07A 3O03A 4ZQBA 2H6EA 3VH4A 1KVTA 2VYND 1X0XA 3KYCB 5KIAA 2RBEA 2EGHA 3OQ1A 4A5OA 3RUHA 3K9QO 3EUWA 4TSKA 2C82A 4I5FA 3SBOA 6LDHA 3KYDA 1CJCA 3GDOA 3HB5X 1WMAA 1YB5A 3NDRA 2AG5A 4ZVVA 3JQBA 4YJGA 1ZEMA 1FDWA 4CM4B 4DL9A 5L4LA 1N8KA 3EDMA 1F12A 3NV9A 1E6WA 3B1KA 3ZH2A 4PLCA 1LLQA 2X0NA 4AVYA 1DLJA 1ZK0A 3DHYA 3EY4A 5JAIA 4K28A 4NNJA 1EVYA 2ZTMA 1HKUA 4PLZA 3HFSA 1E7SA 4MPDA 3F4BA 2BLLA 4IPTA 4HX5A 4D0SA 2I76A 2X9GA 3QY9A 5BNTA 5JAZA 3ICCA 4L73A 4BS9A 4CJXA 1WP4A 2H1SA 4H15A 1UJMA 1Z45A 3HFGA 3IJPA 5FEUA 4I1IA 5A3JA 3NT5A 4EITA 3RC9A 4OHUA 1I2ZA 4EUEA 1JKJA 3GLQA 1FXSA 1PGOA 3RIHA 4OXNA 2B4TO 1U8FO 2GGSA 1I2CA 3MEQA 4GSKA 4XYLA 1ENYA 2Y0EA 1V8BA 4E5PA 5LCXA 3V1YA 4FW8A 4R3WA 3QVTA 3DTTA 3PHIA 1ZK4A 2AE1A 3OECA 3T7CA 4E5YA 2NVBA 4XR9A 4IGEA 1H6CA 1BXGA 1HDZA 3I5MA 5F5LA 2GF2A 3BTVA 4S1VA 2EP5A 5TT0A 3TJRA 4D7AA 2ZYGA 2BKAA 3GA0A 1F8GA 4BNZA 2R00A 3C85A 4FJ1A 4NQZA 1ADCA 3NT4A 2Q2WA 3PDUA 2E82A 2CD9A 3ROPA 2X0IA 3K96A 1ZO8A 4Q3AA 1ADGA 2EIHA 4Q3EA 1P9LA 1U9JA 4GGPA 3GEMA 2WYUA 3QSGA 4KWIA 1WZIA 4MVJF 3PYLA 1V9LA 3U3XA 4CLRB 1OMOA 2HUNA 3TRIA 4CMEA 4DYDA 2VYNA 2A94A 4WE3A 5T8KA 4M87A 2D1YA 3LF1A 4L75A 2Y1EA 2GN4A 2Y1DA 3JQCA 1PX0A 3W4IA 5DBGA 1F0YA 1ML3A 3KYBA 1Z74A 2NSDA 4XGKA 3O9ZA 4LVUA 5ILOA 4YCAA 1GUZA 2X22A 2A35A 3V1UA 4I5DA 1BGVA 3NX4A 4DMLA 5HBRA 5C7IO 1LDBA 4MJLA 1LQUA 4BGEA 5TQVA 3DAGA 1YQXA 3QWFA 1XA0A 1LTHR 3FPLA 3WICA 1MFZA 4WUVA 4YT8A 4LISA 1G1AA 1P1IA 4YBZA 3GGPA 1JN0A 1E77A 2O23A 1LEHA 3F3SA 2VZ0A 5BSFA 4UVIA 1TI7A 4XD2A 1F14A 1DFIA 1H6BA 5KVSA 2FWMX 3QLJA 4B3JA 2CY0A 1YDWA 1CYDA 3MJSA 5DOZA 3GC6A 2GERA 3SXPA 4B7UA 1ISFA 4WJZA 4BMSA 3UCXA 3RC2A 4R5MA 1A7KA 2P4QA 4PLPA 1NPYA 2GR9A 5ICSA 1HDRA 2WD8A 3Q2KA 1PJ2A 1PZHA 1XKQA 2VWPA 1JLLA 1H2BA 4CL8A 4GWGA 3JQ7B 3S1LA 1IZ0A 2DPGA 1PQPA 2WD7A 4UUMA 1KY4A 2J6IA 1PGJA 2BGKA 2D5AA 3ZV3A 5AOVA 4UEOA 4W9NC 4MP6A 3FD8A 5BSEA 1R12A 2DBZA 3KETA 1P77A 4AICA 1E3JA 4IIVA 2GLXA 3GNSA 4HV4A 3RWBA 2VZ8A 3QHAA 2UV8A 3AU9A 1U4OA 2WMDA 4QEDA 3AI3A 2I3AA 2AW5A 4RPHA 3VZQA 1M2WA 1P0CA 4I5GA 1MC4A 4Z0TA 2QYSA 4PVDA 4FB5A 4MVJI 4CR7A 1PJ3A 1ORRA 4YRDA 5HS6A 4YTEA 2G82A 3MJTA 1KS9A 2E49A 2PGDA 5A9SB 1ZBQA 1BSVA 3MWDB 4NZ9A 1D1TA 4OOFA 3ZWBA 3TL3A 4YVFA 1AHIA 3ZWCA 1R4MA 4D46A 2NWQA 3DBHB 2C7VA 4WLEA 5TLSA 2X5OA 2NACA 2X4GA 4CMJA 3LDHA 4CQMB 5GZ3A 2OOSA 1BRMA 1GUFA 1HETA 4FFMA 5ENDA 5ITWA 3JQEA 2YHUA 2PGLA 3DR3A 1P1FA 5GY7A 4WOKA 2Y99A 3UH1A 3GPIA 3JQAA 1LXCA 1GUYA 4BMVA 1YBAA 4D41A 3ZU2A 2VYVD 5KJFA 1ZJZA 3PQEA 5LC1A 4YAIA 4ZJUA 1DHTA 2Y67A 2VUUA 4L76A 2G1UA 3FNHA 1LBEA 1SEPA 5IDXA 3HB4X 1LI4A 3C3XA 3WNQA 1E1KA 2BHLA 1SMKA 4K26A 4F46A 5FYDA 3WG9A 4R1SA 1RM0A 1I3KA 3C1TA 3WIDA 5CDTA 3ZNOA 1QRRA 2QX7A 1KVUA 1N1GA 1TT5A 3WLFA 2VT3A 3GAFA 2FSVA 4MVJH 4U7WA 1VJTA 2IRWA 1DRVA 1T1SA 4YAJA 1LX6A 1Q7GA 3L07A 1HL3A 5L7TA 1U28A 3L6EA 4DA9A 3AY7A 1KVRA 4DPMA 2OFPA 2PGJA 4RDIA 3ADPA 4BGIA 2JFFA 1QKIA 2Q2VA 4XDZA 4BQRA 1H9AA 2C2YA 2W98A 4WECA 3WGYA 4DBVO 2IXAA 2ZKLA 1EVJA 1KVQA 1MG5A 2AEJA 3ZHBA 4FPXA 5IXSA 1O9BA 4OQYA 4B8ZA 4D3FA 4DIBA 5EERA 1Q2XA 1B0AA 4WGGA 3OEYA 1PZFA 2GD1O 1N5DA 2CZCA 3ZWMA 1C0PA 3RKRA 3PK0A 5B37A 3F47A 5ENVA 4NIMA 5JSFA 1IUKA 4HY3A 4R51A 3U5TA 4RVDA 1DDOA 3U09A 3KHUA 3NRCA 1EZ4A 1B15A 1E5QA 5B12A 2C2XA 4PRKA 1Y9EA 3H7AA 4ZHSA 3S2FA 2Q49A 3A9WA 5AXCA 4P4GA 4OJNA 1SAYA 4PFJA 4QT0A 3AM3A 3I23A 1T24A 2NVUA 1E3IA 4BNHA 4ZGWA 3AOGA 3ONFA 1U5CA 4IZIA 4U8GA 5TJHA 3ZU3A 5K9ZA 1NQOA 4NJMA 1DHRA 3OF2A 4FJ2A 2GRAA 4GQAA 4PVCA 1HYEA 2JJYA 4RLHA 4XJSA 3FR8A 3LLVA 1O0SA 2VYVA 2Q1WA 3LC2O 1Y5MA 1KYQA 1UZMA 1X1TA 1QYVA 3UFXA 2HJSA 1YJQA 2D5CA 5F1KA 2Y1OA 3OIFA 1HEUA 1H2HA 4J0FA 4CM4A 3TZHA 1VM6A 2EF1A 1TLTA 4IJVA 3KB6A 3RUEA 3RI3A 1N1EA 1NASA 4OYRA 2EERA 1E6UA 3LT2A 5AXBA 3WS7A 5DP1A 1R6DA 3EGOA 1P44A 5JY6A 2NUAA 1X7GA 1M66A 3MJCA 4RDHA 1NFFA 5IDQA 1HSOA 2RHRA 2I99A 4NJOA 3G79A 2OXIA 2BI7A 5GZ1A 1RM3A 4OOEA 1PJSA 1GY8A 1VC2A 1IYZA 3U9LA 5CG2A 5IG2A 4I9NA 2YYYA 2UAGA 4W9NA 4Z6KA 5IFLA 1V35A 3OSUA 1GZ6A 2DFDA 3X2EA 3CKYA 3F6YA 3AM4A 3T7EA 5ITVA 3FNFA 5A06A 4PLFA 5IZ4A 2PZLA 4W82A 1QR6A 4YJDA 5TRTA 1SNYA 1VRWA 1RYEA 2Y0DA 4J4HA 4IGFA 4NBWA 4C7KA 3F9IA 1K6JA 3C24A 3OQBA 1GV0A 3JQFC 3AK4A 2YV1A 4LGVA 3BIOA 2QW8A 3ZWVA 3PP8A 5G0WA 4IM7A 2XAAA 1E5LA 4JGBA 3TSCA 3PI7A 3WGIA 2PLAA 1U3VA 1Z7EA 1BXZA 3JQ9C 5L45A 2JAHA 5EL0A 4P8RA 2PK3A 3GNQA 1W4ZA 1SO8A 4JJGA 4Q3NA 5L4NA 3VVBA 1D7OA 2GNAA 1GV1A 3JYPA 5A04A 1Y1PA 3P19A 3P2YA 3WXBA 3I9JA 4AJ4A 4QTZA 1ULUA 4PCVA 4L74A 4OO3A 1X15A 2YZ7A 4Z0PA 3WTCA 3GNTA 1EVZA 3CZMA 3QWIA 3K6JA 3ZI0A 1PJ4A 4OIMA 1RJWA 2YFQA 5CEFA 3G1UA 1V0JA 2PZMA 3NYWA 4J4BA 3UXYA 4LSMA 1U3UA 1MGOA 4RCVA 1MC5A 1QLHA 3E5MA 5G0TA 4Y9DA 1PL8A 4EI2A 3LLSA 1EBFA 3C7DB 3H6KA 1VL0A 1DFGA 2VN8A 2RIRA 1CEQA 1U3WA 2X9VA 2VT2A 1NWHA 3BXXA 4O6VA 4CM5A 2FR8A 4R9RA 2WJPA 3WYBA 2ZQYA 4E2XA 3OJ0A 4CM9D 1ENPA 1IHYA 3JD4A 4I8XA 3DOJA 5G0VA 1FDTA 3VPSA 2RH8A 1RKXA 3DEYX 4E6PA 2GDZA 4WEQA 5EN4A 2GZ3A 4CM6A 1T1RA 3RUAA 3R0IA 3KEOA 4XIYA 3UICA 1J4AA 2PD6A 5KWEA 5CDGA 2HKIA 3DL2A 1U7TA 5ER9A 5K6AC 3LC1O 4NBTA 2FHSA 4J1SA 2C7GA 1EEHA 1C14A 2RAFA 3UW3A 3P5SA 2GN6A 4CQLB 1DBVO 2ZJ0A 5IDYA 2G76A 2GZ1A 2VNSA 4AJ1A 5I8WA 2DT5A 3Q9NA 3PPIA 1N7HA 3ANMA 5T57A 3QWHA 4BKUA 4MKRA 5DP2A 4YA6A 3QWBA 2BMAA 1ZFNA 2WYVA 3EAGA 3WWYA 4II2A 1HXHA 1TB4A 1WWKA 3QQPA 3ANLA 3V2UA 4R1NA 3ETGA 4ALKA 3L9XA 4GL4A 1S6YA 3JQ7A 3OEWA 1GYPA 5CFZA 4GMFA 1HE4A 1NTOA 2Z1NA 4E2WA 3NAQA 1QLJA 2C5EA 4BO1A 5L51A 3IP3A 1SB8A 1YVEI 2WE8A 3GHHA 5TNXA 3V1TC 4CMCA 1E1NA 5U9CA 4DQXA 3OIGA 1DB3A 4JCOA 4P38A 3WJAA 1SOVA 3ZNPA 3JD0A 3RQSA 1T2CA 1UZLA 2O2SA 3KV3O 2YV2A 5DNAA 2H9IA 4IMPA 1FJHA 1AXEA 4MOWA 4N54A 3VH1A 2ZB7A 2ZTVA 2O7QA 3VKUA 3COSA 2PKRA 1HYGA 4MIYA 2X86A 1CERA 4MP3A 4Z9XA 3RD5A 4PN3A 1NYTA 4OSOA 4Z9FA 3C1AA 1OZAA 4GKBA 1BWSA 3C1OA 4RORA 1X0VA 2VWHA 1DIBA 1L1FA 1ZK3A 3JD2A 3NDIA 4TRJA 4C7JA 5THQA 2Y0CA 3R3SA 3I1JA 3I52A 3NTOA 4AL4A 2V6MA 4BO5A 3OP4A 5HS4A 4BL5A 4CM9A 4MKZA 5JC8A 3MJ4A 3ZNNA 4AFNA 3PRJA 4E2ZA 3QE3A 3VVCA 1QSGA 3WYEA 3ZCXA 4CMBA 1E3SA 4FC6A 1PJTA 4FOOA 5CEJA 2J5QA 4D43A 4YAKA 3OJFA 4NK5A 4XGNA 4BO0A 4ZQEA 4J1TA 2YQ5A 2ZYDA 4YJHB 2OZPA 3H3FA 1N7GA 2QG4A 5TJ9A 2JCYA 2OP1A 4JNKA 2IYPA 1NFRA 4R68A 1H0KA 2NADA 4EZBA 3OBBA 2Y66A 5H83A 3OH8A 5KVCA 1YB4A 1R66A 1GEEA 3FRJA 2A9FA 2NU7A 3JQFA 4K6FA 2RCYA 3UVEA 4ALIA 3BYZA 3GF4A 1BXKA 3LC7O 2WYWA 4IBOA 4W7IA 4XYBA 2CDCA 2Y68A 2AHRA 1E3WB 2IDZA 4HP8A 3VZPA 3ZV4A 4BNLA 3JQ9A 2GN9A 4E0BA 1E92A 4GGOA 4DREA 4CMKA 1GR0A 3HDQA 5IF3A 1ULSA 3I3OA 2Q46A 4D45A 1MX3A 3LF2A 1DAOA 3U4CA 1J6UA 3O26A 3AUUA 3OFSA 1B7GO 2ZK7A 4BNXA 2J3HA 2QZZA 3I9NA 3GEDA 2I3GA 1GQQA 4GVLA 2AG8A 1I10A 4BNFA 1F06A 2DM6A 3S2GA 4XYEA 3HNPA 3DBVO 1EK5A 3SLKA 4EEZA 4NH4A 5JMPA 2W2KB 1OI7A 4IY1A 2ZJ1A 4E21A 4XRRA 1JW9B 3K2BA 4ONEA 1YS4A 1N2SA 1ZZEA 5CDUA 1HDCA 4YPOA 3RBZA 3RUDA 3W4JA 3W8DA 5I7VA 3OJLA 4EYEA 4U6SA 4DWVA 3KTDA 4DRYA 5HTOA 3N58A 3SJUA 4PG5A 1AN9A 4LCJA 4WOJA 5DZSA 1C0KA 3HE3A 4CMIB 5KJ6A 1R15A 1IZ9A 2HDHA 3ROKA 3A14A 5T67A 1K0UA 1D4FA 4J2OA 3DWFA 2O3RA 3OIDA 1G0NA 4E12A 1ENZA 2VZ9A 1W0CA 2D8AA 3ROMA 1YQDA 1ZVMA 2DKNA 4J1QA 4A7PA 1PJLA 3HSKA 5CDSA 1QYXA 5HWSA 1HE3A 3PYMA 4RVFA 5L95A 2VHXA 3TNLA 1YBMA 1YOVB 5EJ2A 2Q99A 3FI9A 2FP4A 3H9JA 1VL8A 3PGXA 4L8VA 5K6AA 1PZGA 3E48A 3EYWA 2OP0A 4RZHA 4WLFA 2RH4A 2EWMA 4RLSA 2GN8A 5KCZA 4AJNA 2AEMA 1U5AA 2OMEA 5HRUA 3GFBA 4TKMA 3HG7A 2XF8A 1R16A 2IEDA 3WQRA 1PQWA 5G0SA 4BNNA 1YONA 4PGFA 4AJEA 5BT9A 2EEZA 1OBFO 3B1FA 3AY3A 2NTJA 1P1JA 3PFWO 3RC1A 5JFOA 4FFLA 1B14A 1B26A 4YT5A 1ONOA 1P1RA 2LDXA 2J8ZA 3RCBA 2AQHA 3DTYA 4AJHA 4WLNA 5JY1A 5JAMA 1I3LA 5CHEA 1ADFA 2NQTA 4FCCA 1ZEJA 3E9NA 4KMSA 4RPLA 4DLLA 1A72A 4FFRA 5TIIA 3CIFA 3EVNA 1K6IA 3D3WB 4J2HA 4BGVA 3H65A 4BNWA 5CAEA 4J49A 3K92A 1VE9A 4NBUA 2VRCD 4J7UA 3RASA 1UP7A 2B69A 2DUUA 4DLAA 3D4OA 3DOOA 2B37A 4Q39A 5EQFA 2I6TA 4D44A 1Q7CA 1NAHA 2VWQA 4QECA 3D4NA 2YDYA 4X54A 4XB2A 1SC6A 1WMBA 4RL6A 4EW6A 1C1XB 2DVMA 3TZQA 5JMWA 4E32A 1YGYA 2ZB4A 3CE6A 3C8MA 4FJ0A 2HJRA 1B16A 3PJDA 3JD3A 1K6XA 3GK3A 3H5AA 3Q3CA 3Q0EA 5ADHA 4MO2A 4YYZA 3D7LA 4RVGA 5JW6A 2H5LA 4U6QA 4FDAA 3B6ZA 4Z0HO 2EP7A 2HMTA 1I0ZA 1JWAB 3RAJA 5EPOA 3IKVA 3EVTA 2HCTA 4YWJA 4E4YA 5I7SA 1T2FA 1H9BA 2BH9A 3VZSA 5DBIA 2G0TA 3IUSA 1G0OA 3L6OO 3WMWA 2QRKA 1HYHA 3DDNA 4NFHA 3GAZA 1ZXBA 3JQAD 1PZEA 5COBA 2BFPA 2VTDA 3DZBA 4G81A 5JDCC 1NVTA 4GX5A 2JCVA 4BNUA 1M75A 1GEGA 4PZDA 1M67A 3MWEB 1AUPA 2CFCA 2E6UX 3PWKA 4NK4A 3GVHA 4R01A 1QV6A 1X14A 2J3IA 4FFPA 3CEAA 1VSVA 1KERA 3WSWA 1O8CA 4UREA 5A9TA 4D0RA 1XEAA 4M54A 4F45A 4MIEA 2POQX 3UKOA 2P9CA 3WX0A 1PR9A 3UAGA 3BHMA 1B3BA 3FTPA 1CETA 1MFPA 4GX1A 4N5NA 3E6AA 1XIVA 2DLDA 4B7CA 3A06A 3TZKA 1EUCA 5L40A 3CUKA 1NHWA 1XHLA 1YH3A 2GUGA 1XWFA 2C20A 4E3ZA 4OL9A 2PH5A 3H5RA 2FOIA 1Q1NA 1XR3A 4MVJG 2PTGA 3H9GA 3PXXA 2VRCA 4YJFB 1E0DA 1O94A 3GGGA 4ND4A 4XQ9A 3SEFA 2BFAA 3HZZA 4IUYA 9LDTA 2VHZA 1P74A 4UVEA 5C5IA 3ZGYA 4CM8B 3AUAA 4CLDA 4DQUA 1A9YA 1T4BA 1YL5A 2ZATA 3R6DA 3GEGA 4CM3A 1V3VA 2GASA 1IY8A 3BTOA 3FNEA 1K2WA 2DTDA 1R4NA 3PLRA 3A28A 3Q9UA 4MKXA 4YAEA 2FR1A 8ADHA 5JS6A 4BO7A 3FNGA 4RF2A 4J7XA 5EQDA 2QYTA 4RF5A 2A4KA 3G17A 3N74A 2VHVA 1B3RA 5T64A 1I3MA 3VPHA 2ET6A 4FFOA 4MVJD 2UDPA 3E18A 3V2GA 1EUZA 3JTMA 1YBVA 2DBRA 4BGUA 1ZH8A 2EW2A 1GU7A 3BTUA 4E31A 4KUEA 3VDRA 1W8DA 3K73O 4A0SA 1MB4A 3I9KA 4A73A 4HXYA 1BVUA 5JLAA 3GVXA 3OHSX 4K1LA 4GLOA 4R54A 3EMKA 2JL1A 5JXWA 4Z3DA 2UVDA 2ZTLA 5T5QA 1NAIA 4JROA 3DFUA 2E48A 3AY6A 4QO8A 3LSYA 1O5IA 2IODA 3KEQA 2WEKA 5A5EA 3ST7A 3Q6IA 1OC4A 3M1LA 1K3TA 3IKTA 5I8ZA 2C0CA 3IIEA 4U0KA 4XCVA 2X0JA 3ULKA 2D4AA 4TROA 5JAQA 4M49A 2JD0A 4HKTA 1NPTO 1KBZA 3JV7A 4YJHA 3DAFA 2LDBA 3G0OA 2RHCA 3LZ6A 4BB5A 4YQYA 4HFRA 5A1TA 4BOYA 5JYDA 3S8MA 4IDGA 2PR2A 3E9MA 1JVSA 4IDEA 5G2OA 1ZMTA 4B4UA 4UUNA 2E37A 5JPIA 5KVQA 2FPPA 4G5HA 1EBUA 1PU2A 2O3TA 3VOSA 1SCUA 1Y7TA 3ZU4A 1TT7A 2P9EA 1E7MA 1WDLA 3A1NA 2UUPA 5CDYA 4RGBA 1HDYA 1EDZA 1F8FA 2X0RA 4P4LA 1VJ0A 2EW8A 1U2DA 4BQPA 3W4KA 4E13A 3KLPX 1KC3A 2GO1A 2J3JA 1Z73A 4F6LA 4BVAA 3WGGA 4DPKA 1KOLA 4PRLA 3FCOA 4Y98A 1NQAO 3BMQB 1EUDA 4GMGA 3MJVA 1PR3A 2DC1A 4IS3A 1YDEA 4GBJA 4MVJA 2Q45A 3K30A 4JX8A 2PD4A 3RKUA 2X7HA 1D3AA 5DULA 2IXBA 3TF5A 2W2KA 2Y1FA 1RPNA 4BNVA 2CVQA 2V65A 1IHXA 4E5KA 1PGNA 3D1LA 5MGBA 1HDGO 1XU9A 1N9GB 5AVOA 3ZDFA 5JDCA 4IJKA 4FOSA 5AYVA 4CV0A 4MDHA 3GN2A 3WIEA 2X9NA 1XCBA 3Q11A 4NR0A 4ZRNA 5FI5A 2O50A 3KYCA 1E7RA 4BHTA 3PIIA 5I7EA 2HRBA 2YFHA 1U8XX 4ND3A 3K8ZA 4CMIA 3EZYA 3ITKA 3L4SO 1VI2A 4RJTA 2VQ3A 3PZRA 3LK7A 1H93A 4I08A 4ZRMA 5MDHA 5U1PA 2WM3A 2JD1A 3GHYA 3PLNA 5FI3A 2SCUA 2XPCA 5J23A 1BW9B 1LJ8A 1NWCA 1F17A 3CZRA 3FR7A 3GFGA 1XLTA 4E2YA 4YJGB 4IDBA 1XDWA 4XKJA 4DC0A 1W73A 2FSSA 2G5CA 4UEKA 1LSUA 4IMRA 3WSVA 3ZHXA 4O59O 1J0XO 2O3UA 5K0ZA 4ALNA 2WE7A 4LCEA 4W99A 5BQFA 5JE8A 1K5HA 3IAHA 4OMUA 3T4XA 3PWSA 3WGQA 1I2BA 3PEFA 1DRUA 1B2LA 2AQKA 1PS0A 2HK9A 3VH2A 2P9GA 1PGPA 3NUGA 3UHAA 3DZIA 5DDIP 3CH6A 4XR4A 5C7OO 4D42A 2GSDA 1ZK2A 3IJRA 1JWBB 1LU9A 3R1IA 1P1HA 5IZCC 4DXHA 2OHXA 4M1QA 3U0BA 2F00A 1PSDA 1GL3A 2ZYAA 1CF2O 2XOXA 3M1AA 4KWHA 2FRDA 1R37A 4XYGA 3FF4A 2PKQP 5KTKA 3G1TA 1R0KA 1KC1A 2J5RA 3D3WA 1ISMA 3DBLB 4PLVA 5AQ1A 1QV7A 2IEBA 4W6ZA 3RROA 2CDAA 1GYQA 3GH3A 2DFVA 3GMDA 1DJQA 5FF9A 5AXAA 3TZ6A 4J9UE 2PY6A 3PHLA 4MVJP 1ISHA 3QRWA 5TC4A 5I7FA 3OA0A 1BXGB 1W6UA 1PTJA 4J9VA 5A4DA 1HLDA 4ID9A 4DUPA 3H9UA 4B7XA 4FS3A 3JYLA 3M2PA 4WNCA 3D64A 1OFGA 3KBOA 3DHEA 3HJAA 1ZJYA 2D2IA 1HF3A 1M76A 5DF1A 1DIAA 2BGLA 2P4HX 1C1XA 1FDVA 3S2IA 5FWNA 1GADO 3RC7A 2YDXA 4NHEA 4WPGA 4PLGA 4CLRA 3WNVA 3H4VA 1SBYA 1X7HA 3AM5A 1RWBA 1JVBA 2WSBA 3DC2A 2HMSA 1R0LA 1HE5A 1WXDA 4QXMA 1WLYA 5EESA 3TQHA 3VPFA 3QV1A 4I9HA 3VZRA 1JAXA 2Q3EA 4M89A 1ZK1A 1ZSYA 3KSDO 4QQRA 4YAGA 2IZ1A 4B8WA 3QP9A 2W90A 2IYOA 1UH5A 3MJEA 3BMNB 4LK3A 2Y05A 2J3KA 2X6TA 4NU5A 4CQMD 4LVCA 4EDFA 3PTZA 1XELA 1MG0A 1OAAA 3AJRA 3BMCB 4WCFB 3G3EA 3K5PA 4RO0A 2FZWA 3M2TA 3RJ9A 4K9DA 4XWYA 5BNIA 2C54A 1JTVA 3ICPA 1KVSA 1A27A 3H2SA 3LT4A 4YXFA 3RUFA 4R3NA 2D59A 1PEDA 1Z75A 3INRA 3QVSA 2OORA 4RQTA 4RVSA 4WNIA 3KSZO 5TSDA 5TT1A 4J43A 4ZD6A 3SLGA 3AWDA 3ABIA 2BD0A 2P5YA 3PZBA 3LT1A 1T4DA 3ENNA 1ISJA 1LDGA 1DIGA 1D8AA 2VOEA 1H94A 2C29D 1TA4A 2P5UA 4EBFA 4IQ8A 1FK8A 3VTFA 3WGZA 4Y6PA 1DPGA 4AJJA 4XEHA 3BTSA 4TVOA 3C7AA 3KSUA 3I9OA 4R41A 3MZ0A 3AU8A 3QA9A 3PQFA 4EUHA 4N18A 2DAPA 2PA3A 4JBHA 4KDFA 1GQ2A 3PQDA 4FBGA 3I9LA 3WGHA 4PIVA 5KJCA 3QJ5A 2AXQA 1I33A 1LA2A 3NJ8A 4CODB 3B20A 4IZHA 3X2FA 1I36A 2CVZA 4YJFA 2EKQA 1LDNA 1IULA 3D3EA 1Q0QA 3I83A 3HDYA 3ZWXA 2O3SA 1VKNA 3IQDB 2JFGA 2NU8A 2FMUA 4IJUA 4CM8A 2PH3A 2C59A 3STHA 4BKPA 1A71A 1LLUA
chains in the Genus database with same CATH superfamily
4R16A 4YRQA 1YZFA 5E9AA 3BAZA 4IJ6A 3KOWA 1HNWB 4LRUA 5FPSA 1L6RA 4NSNA 4QOHA 1ACMA 1G5RA 1X94A 2IOFA 2R8RA 3PJGA 4P5DA 1JHZA 4LWPA 2UZIR 2NUBA 2BELA 3DONA 3C7CB 2JHFA 2Q8QA 2EOAA 3OAAA 4N0QA 1XQYA 4V3CA 1AKUA 3F3KA 1CQJA 3EN0A 1CZLA 3FKJA 2FMFA 4Q7QA 2OCAA 4X41A 3GEPA 3LKDA 3NM4A 3O5AA 3D3JA 3E2MA 3R7DA 3EK2A 3SYTA 5KNBH 1GL6A 2IXGA 4ZI7F 4K81B 2KLBA 1K75A 4AJPA 1JDPA 4INOA 1WO8A 3QUAA 1SIOA 4EEXA 2HAEA 4HZGA 4JN6B 1GFZA 4LPSA 3WBBA 2FFRA 3ESZA 2GPYA 2AOTA 2C5FA 3OSZA 4QU5A 4HS4A 1KIFA 3AHHA 1X1EA 1EIZA 3V7NA 4Z3KA 1UJ5A 3E27A 3KLMX 1GAWA 1JYSA 3WQHA 3RRNA 2F1KA 4UBLA 5HW0A 3NHSA 1R6AA 1SB9A 3QLVA 1AUOA 2ILTA 2BSXA 3DVLA 5ARCA 5F3RA 4BUJA 1OYYA 4WK4B 5BYKA 1HFWA 2Y1XA 3Q8LA 3L6CA 4I50B 2XXJA 2AQIA 3QX9A 3SSNA 3KVOA 5CIYA 4E6EA 5A2GA 3RU7A 2GSWA 1EG7A 4YT4A 3MLBA 1NPDA 5DT9A 1YJ8A 2QA5A 4HJXA 4JXJA 2ZJOA 4X6LA 2H2GA 5J59A 4CIYA 4LXHA 2OKGA 5DN9A 2MJLA 4DM4A 1VCHA 3ZW9A 1I6KA 1A9RA 1VSTA 3TB6A 2GAFA 4N65A 5B1YA 3MPOA 1VE3A 2X2PA 5LP6C 1N8NA 2PWPA 4RCYA 4WCFC 5JZ9A 1JDJA 1VKOA 2ECFA 5KOJA 2WUFA 3IBTA 1JA9A 2A92A 3HZOA 3ZIAA 2YNMD 4CQJA 4JP5A 2XDWA 4XPIA 2C57A 5JH7F 1JU4A 1TT5B 1RBYA 3QBVA 2F3SA 4X64B 4EUFA 3V32A 5C7LO 2G88A 3VC3A 2DPXA 4DA6A 1PCXA 4CM1A 4D57A 4HDKA 1FFGA 1UXKA 5F2NA 2R3SA 1V41E 1HEIA 2PYIA 2QMYA 1NRWA 4FYYA 5B5SA 2JDID 4EG1A 1X39A 4RVUA 1TVMA 2ZIEA 4CKWB 3ESDA 3NTRA 5JFTA 2R7KA 1M6YA 1JIIA 1Z4JA 3QFFA 2GD2A 3UTCA 3TGWA 4FM9A 4YGYA 3U80A 2GBLA 1YFJA 1IEXA 4PAGA 1JIJA 4KXNA 4HLNA 4N9QA 4LXGA 3VDNB 5I7SA 2ZSHA 3AJDA 1O95C 3AILA 1CE8B 5K4HA 3UGQA 2KB0A 4GVXA 2QT9A 3E3NA 4I4TB 2P6RA 3KKOA 5I7OA 1Z4LA 2I78A 4PANA 1XZGA 3U44B 2YJ6A 5JZBA 1DTSA 1CUAA 1GNPA 1NDUA 1NW9B 4DJFC 3SHFA 2BKEA 4F56A 4HPXB 1CIVA 1R0SA 5KAMA 4OQ4A 2R6GA 1R7RA 1F9AA 1DO8A 1SFRA 2QUKA 2FE1A 3IMKA 1QH8A 4G65A 1Z35A 1OXMA 1VHDA 1RJ9B 2O2GA 4ASUA 2YMQA 3W2IA 3NVKI 5E8JA 1SH7A 5G3YA 5GMOA 5JXGA 3W79A 4KN5A 4D81A 1S9DA 3FGNA 2W2TA 1AHHA 2Y1WA 4PFQA 4W1QA 3ODPA 4BZQA 4AJ9A 2H4XA 1ZIPA 1KSJA 2D74A 3L1VA 4GKVA 3IP1A 2RBKA 4MA0A 3RU3A 4NPHA 3SHVA 3W9YA 3D8SA 2V8OA 4QBHA 1JR6A 5JG7A 2WYOA 2P41A 4DQDA 2R48A 3NW9A 3VMFA 2J45A 1T2AA 1OY1A 2TMGA 1KAOA 3O21A 4X20B 3STVA 3T1TA 1TVKA 1D4ZA 4B79A 3C15C 1P0FA 3P7MA 4DDHA 2HF8A 2QR2A 3A1WA 2YFYA 3ETDA 3F97A 3I2JA 3OETA 4OQEA 4BZXA 4RQBA 3UFXB 4LZLA 4ZYWA 2VVTA 2MSEB 1IIRA 2PJZA 1U8YA 2Z95A 3E8XA 4HH4A 3RVDA 1TZ2A 1CUGA 1BW9A 1BJKA 2P3LA 2Q0QA 3I9V6 3DKIA 3LPLA 4WD3A 3RSHA 1E2MA 2UYHA 3QX3A 3R5JA 1USUA 5CYFA 4LV6A 1FFBA 4ARVA 2QRJA 4O5OA 1RXYA 2FWIA 5F35A 3FZEA 4D4GA 1DOHA 1PUJA 4B3IA 5IXJA 2D3WA 4MNTA 1LUAA 4H0CA 5LZ2A 4Z1MA 1IDN1 2XGOA 3UJ7A 4DIDA 1EDDA 2VXYA 5FPPA 1SPXA 3M6MD 2IYEA 1LRLA 3KOUA 4KMMA 3ZHQA 1W36B 4Q4HB 1E98A 3R0ZA 1ZUD1 4DFDA 1Q44A 3ABRB 4ZJPA 3GLHA 4L4SA 4UEJA 1QCDA 4PAOA 5HKKD 3FOEC 4HBGA 2CBGA 1Y4UA 1YR1A 4V0QA 1E1QA 2Y6UA 4IDOA 3MCZA 3DE1X 4HYTA 3BE5A 3REQB 3WJ7A 2DECA 2FXVA 3TOCA 1XCLA 1N0HA 5DGTA 3TTYA 1Z68A 1KMMA 4XWTA 4Q3CA 3TSAA 4F2HA 1LS6A 1ZCZA 4AJIA 1U5BB 1CX9B 5AO9A 3NJ4A 4TLCA 1KJ9A 3O9MA 3RRXA 5IEBA 4W5QA 5TX7A 2OFOA 5CURA 5ELLA 2J32A 5AVKA 3D59A 4BBJA 1SIUA 1FEZA 3TZCA 3DBLA 2RGYA 4UVHA 5CW1A 1Y8RB 3FA2A 4EMSA 2G70A 3N76A 3Q15C 1TFUA 3ILXA 1U6IA 1Y9JA 3B85A 3LCUA 2HLHA 5DYNA 1FTWA 4JL6A 4PNPA 4ER7A 2M6KA 1H6AA 2QZSA 4GXTA 3ZCQA 2CLDX 1S02A 3RAEC 3ML1A 2N0SA 2KX7A 2KM1A 1QO7A 3EG9A 3PQ4A 2VDOB 4GRDA 4NFYA 3SC4A 3VTAA 1EM8B 2VYQA 3BERA 3IIKA 2VI5A 2O7SA 4WXEA 2OZKA 4ZQHA 4BJHB 1XMPA 2HHCA 3CZ9A 4IHJB 3HKEB 4RNCA 3PGJA 3ROEA 4KKXB 3BKWA 2CJWB 4DYHA 1ZMBA 5CT8A 1N6IA 3OEHA 4LFAB 4JC5A 1QGZA 2MYUA 3IPYA 4PYRA 3ETCA 4QKQA 5JDIC 1J0AA 1WBDA 1MJHA 4L4XA 2M2IA 5ARDA 1ZOPA 3WDLA 5K8JB 3MTGA 4XIFA 1G16A 4ITRC 1WVGA 3TPCA 4LBVA 2GTPA 1KFCB 1T9CA 2VF2A 3AL3A 3SVTA 2BZ1A 3EVFA 1FUUA 4MAMA 2JLQA 2WTXA 4TLMB 4N3CA 2G7ZA 4LYYA 4XB1A 2JHCA 4WZAE 4XWOA 1DEAA 3EC7A 2A8YA 5I5GA 4UUQA 3WKAA 3BMCA 3KOZA 4EJ6A 4RIFA 3QIAA 3IA2A 2VXBA 4FYVA 1XP5A 3FTCA 2G9UA 3NOQA 3VTZA 2OSVA 5BWCA 2QN6A 1T3ZA 1V7CA 1YAJA 3DNMA 2C5AA 1YBFA 2VF7A 2H1WA 4WFKA 2Y6VA 4MUYA 4ZK6A 4Q00A 4TXHA 4C89A 3BWVA 2XOEA 2PZKA 3RRJA 2XQFA 4E5SA 4RHTA 2QTLA 1M10A 2PGAA 2P4UA 4CN8A 2NVWA 3EBLA 1W85A 3ILHA 2F3PA 4HFMA 4PZ0A 3IHKA 2A33A 4RJLA 2CMKA 4Q4DA 5B1SA 4Z2AA 2CDBA 1G1MA 1W4BA 4QL3A 1W76A 2ZG6A 3A6EA 3IEVA 3QVVA 4WN3A 4BUZA 5K8LA 4D8YA 5E7MA 3EF0A 1II0A 3DLCA 1RE0A 2AQ8A 3EMBA 4PQEA 4YMUA 1JTFA 1DEHA 4B3XA 2OILA 2ERXA 1V7PC 2C1ZA 5FHRA 1WVMA 4OBBA 4GAEA 4BN4A 5FI0B 5LZ4A 4QGSA 5DBFA 3DMRA 3RSCA 4QO7A 5FFMA 1PJBA 1XYVA 2GEFA 1OI4A 3V2HA 5EJMA 2FW7A 2B6HA 2FUG1 3PSAA 1I13A 1E6EA 2NM0A 2JH9A 3KEFA 3P5BA 4K3VA 4P3XA 3IUEA 1NP6A 2A3NA 3CLKA 4BMNA 1IB6A 1YDGA 2Q27A 3DOHA 3GGOA 2P75A 2GXUA 3LIPA 5KKAA 4RWEA 3BF7A 5E3HA 3PUZA 2F7SA 1NBMD 2E4UA 4OI0A 1Z0FA 2CT8A 3TDNA 4WOBA 3OZBA 1DXOA 4P9NA 2CF6A 3QVOA 1IXZA 1JEDA 1AKEA 3D3KA 4G0MA 1X77A 4EPWA 5BVHA 5DCUA 3B7PA 1QYCA 2XCOA 1KKUA 1VBNA 1CHDA 2OV2A 1KYTA 3B60A 3EGWA 2I9PA 3KDSE 1Q50A 2HA4A 2JJ2D 3T9AA 2VKTA 1NC3A 4FYKA 2CMGA 2QMOA 3VNQA 3W5DA 2VTBB 4MQBA 4TS9A 1GRQA 3UXEA 2BFFB 5FUYA 4HNGA 5HM8A 4GGMX 1H5UA 4OPMA 5EJ9A 2HA7A 5DTRA 2V6BA 1Y6GA 2ZJ2A 3WLKX 3BRWA 3N59A 1YK0A 2Q3MA 3DDCA 1R8XA 5DRTA 3FYTA 4GOND 5IN4A 1ZIDA 3PICA 5TGZA 1I4DD 1K7XB 1VYVA 4FDTA 4QE3A 5JWRA 2WMYA 3UJCA 1DG3A 2PRIA 5HNKA 2OO5C 3A1FA 2PWZA 4QXAA 4QGBA 3DAOA 2G1PA 1Z2CA 1JMKC 3INYA 1GCGA 4J0EA 1L4EA 3V3KA 1C8VB 2SKEA 3EOBI 3HLYA 4BFLA 1Q11A 1NI5A 621PA 1C3VA 3D6JA 3URKA 4YV1A 1VGQA 4IIXA 1CR1A 4EBBA 1BE1A 3HA3A 3R2JA 1B6SA 3UN1A 4DUYB 3IEMA 4LTDA 1SCNE 3AZQA 2WPDA 1XCMA 1NF2A 1KSGA 3NZEA 4PYLA 1RKVA 3SQOA 1H4TA 1CY2A 1EAYA 6AT1A 5EKSA 3TD6A 1THTA 5KWVA 1OV6A 3GPDG 1L7BA 4JJIA 5AI5A 4Y7DA 2YICA 4J6EA 3MBKA 1J2RA 4RVHA 1F7UA 3I6QA 3DC7A 4EFNA 4OKNA 1F6DA 1NNUA 4D5EA 1LNQA 1YL7A 4KXWA 1P4JA 5JNLA 1EESA 1TO2E 4L22A 3I9MA 2FPSA 4D98A 1PZMA 2ZWAA 5JADA 3T52A 3LBYA 1FFXB 1YA8A 2C0PA 3AJEA 3KQHA 2Z3WA 1Q19A 1TCBA 2FPMA 2NVOA 2PKWA 4Y2UA 3USZA 4S04A 1H5QA 1V3TA 2HSZA 3N9IA 4QYXA 3JYNA 2QL7A 2YZ2A 2XB2A 4CM7A 1LC3A 3ETLA 2C9CA 1G4HA 1G20A 5LDGA 2ZVQX 1LBQA 1Z26A 2JCBA 1RYDA 4AKGA 2IS4A 1FE8A 3H4TA 1JQEA 4LQLA 1C9DB 1PG0A 4IS2A 2CKMA 2V9PA 2VHCA 3IYLW 2CFOA 3E7DA 3FPEA 3HXPA 3LA8A 1R0YA 3NOXA 5BYBA 5C9ZA 2OHFA 3AZOA 4QJ3A 1YZNA 2XGSA 2PKYX 3QWAA 3R77A 5U4QA 3G8AA 4I55F 1YWGO 1S96A 4C7MA 1RHQA 2VUIB 4DDVA 2ORWA 1NR1A 3I72A 2H52A 4RYLA 2Z2IA 1J2YA 3ODGA 3DOEA 1WM1A 4LJLA 3WHLA 5JO0A 3GP8A 1WQ1R 2SKCA 2JGNA 5JLJA 4DGQA 4HDNA 5EHIA 3OMXA 4G1UC 3E8SA 2WG0A 3I6YA 1PBNA 1E20A 1BTOA 3EVZA 5FTNA 3ZGVA 2HWWA 1RHKA 2BGMA 3GUCA 4XASA 2O7RA 4O63O 4K2AA 2XB9A 4KX5A 1L8AA 1TAHA 2W71A 2DWPA 2VHTA 2CLOB 3I2GA 1ZI9A 4NYMQ 2B5OA 1O89A 2PX5A 4KTVE 4P5PA 5HDBB 4X85A 4TLEA 3BJMA 3OLZA 3RVOA 2O6LA 2ATXA 1UDBA 3HEAA 1GTL1 3PGMA 4FFBA 4OXKA 3P9SA 1UKCA 2G8NA 1P33A 5LQMA 1BCRB 4BLRA 1Z4NA 3WNDA 3I2KA 3CVXA 3IS3A 1SOMA 2AL7A 1ISGA 4V2UA 1ONNA 2EFDB 2RKWA 3GZNA 1KY2A 4LJ4A 5TPZD 5JU6A 4AI6A 4A23A 2PVPA 1JG7A 4UNNA 2ESRA 1BDBA 1NJ8A 2CHQA 4PHFA 5CYOA 2CV0A 2K2WA 3N87A 5DLDA 3WJ2A 1NFQA 2A0KA 2C61A 3ZDCA 5TDHA 1SCJA 1BC5A 2NU9A 3LBHA 3O9VA 4PONA 1DQZA 1MABB 4U7TB 3FMPB 4L9SA 4EJMA 1GU1A 4DHEA 5CM2Z 1I3NA 2QQFA 5THKA 4KXXA 5CPBA 4JOQA 4L5YA 4QLOA 4RYDA 2YH2A 2LZ0A 1E8MA 1KBOA 2X19A 4RPGA 3SZGA 1QYWA 2P9ZA 2MSLA 3IPCA 4KKVA 4BATA 3GVPA 3EDYA 1HTTA 1JEYB 1X80A 4MV0A 1UDRA 4DQ0A 4H0NA 1WKVA 3H11B 3IRVA 4KW7A 3GZ4A 2IU0A 5F76A 1DTEA 5HPYB 2WNIA 1SHJA 4Q9LA 3THSA 3RSQA 2QXUA 1E1YA 1L5ZA 4Q7KA 4JFAA 1UWLA 2YMPA 1T25A 1TMKA 3QW2A 4QFDA 4WQMA 4TLLB 4YMSA 5TS3A 4QG3A 3G0IA 2YC4C 3DBRA 5ALEA 2AZMA 1U1IA 2BUCA 3I6ZA 3O31A 4HTAA 4E70A 1IZ8A 1PNTA 1Y6JA 2ISSD 4PLWA 2XMPA 5ALTA 2NNLD 4BDSA 3FHLA 5C3MA 1J0BA 2QAGA 4RFSA 3TTUA 1S9HA 4OHYA 1PTKA 3OESA 5IWCA 1X1DA 3G49A 3P32A 2H4WA 4JY7A 4OB8A 4HF7A 3ZU5A 4EZEA 5LYJB 4ROSA 2P2NA 1FVFA 1NR7A 2ILVA 4C3ZA 4EA8A 3WMXA 1PS9A 3AJAA 3KKPA 1RW4A 3NWBA 1W48A 4WASA 1OOEA 2J4FA 1I1NA 1X9IA 4HVTA 5DWDA 2NZWA 5FR1A 3QTLA 3MQ4A 3N3BC 5C1OA 2IPOA 2LBPA 3BHIA 1KQPA 1IOLA 5F1YA 1S2GA 4HHEA 2OESA 4RHFA 4AY4A 4NCBA 2JRLA 1CFZA 2CXQA 3D54D 4OSPA 4U7FA 1JU9A 2E2WA 1H1LA 4PC1A 3QFHA 4FINA 5GZ6A 1KDZA 1XGKA 4J0GA 1RLJA 4P4SB 2MINA 2F48A 4Y0VA 2UVPA 3FWZA 4ZI7B 3JQ6A 4M99A 4BKRA 3CH5A 3KTOA 3L4JA 3SLRA 1SU7A 2O48X 1QMPA 3C98A 3GQBA 1YVDA 4ZT6A 1IUOA 4JZYA 1S7CA 3AW9A 5KKCA 1F51E 5AJYA 3S1AA 1ADYA 1DJOA 2FDRA 5K5EA 1GZHB 1MPTA 4PG8A 3UJ6A 5LJIA 4H7PA 2GJ4A 2ZJ6A 4YAFA 4BNMA 1CU1A 4I9UA 4OXXA 1YI8A 5AK0A 1LRJA 3VYTB 1D5WA 1Z6PA 4OV6B 2HQRA 4GLLA 3WYNA 3TRJA 4Q3DA 1WV1A 2FWBA 3JATA 4QYMA 3B3FA 4K8RB 4UUPA 1HSZA 4HNHA 2WAXA 5CDFA 1ZC3A 2H63A 4OMFG 4KUHA 4DVJA 2OHVA 2HA3A 4A9AA 4XSVA 2XV1A 4I1RA 3O38A 3RUCA 1P72A 4LZJA 1ZUWA 1P1KA 1XTSA 2X2OA 3DFFA 3O8OA 1TPYA 1E18A 1X13A 1LTKA 5GADl 3UPDA 1X86B 2R2GA 1EX6A 3FOCA 3ROZA 4D9FA 2EFEB 1YZTA 3D4PA 3NM5A 4FD3A 1B0PA 5DTEA 3CT4A 1OH5A 1KGSA 1FNMA 2QRGA 1NJ5A 1FTYA 4FOLA 1TC1A 4LNHA 5EMHA 4AW9A 2B4AA 2DY1A 2HNAA 2JFXA 4OY3A 5KI6A 4L0CA 2AN1A 2PBLA 3SR3A 1Z5UA 3Q2IA 5JH7B 1RACA 4WESB 1NBIA 2QDXA 2YY7A 4NJEA 1ZH4A 3V5NA 4DE5A 4DIKA 4N5IX 2HHHB 4H08A 4HLUC 1IVYA 2QMHA 1EHCA 4LMRA 4W5OA 2G09A 1A04A 3Q40A 3QPCA 4O4JA 4KRYA 5KNBD 5E6UA 2A5FA 4RHEA 3DXFA 4R5HA 4CLOA 3LAWA 1FCJA 1OASA 5IVKA 4Q9JA 4WADA 3JQBC 4AZVA 2HRZA 1V26A 2WKPA 3NBYC 2FY8A 1L5MA 4QFBA 1JECA 5I3ZA 4DQVA 1MP0A 1H2EA 1DFHA 3G6KA 2AOUA 3DUFB 3H9BA 2EKDA 4M9ZA 2W2LD 1CJKC 1PYOA 3HZRA 2CSUA 2XNSA 3ZLJA 3ZV5A 2ZI7A 3RFVA 1WUYA 3V7FA 1IZ7A 1RWPA 1MEOA 3K1TA 4CKEB 3PPWA 4C0XA 4AO7A 2GFHA 3NUZA 2GEDA 2ZOSA 3PC8C 3TN7A 3KRTA 4C0HA 2HN9A 4I3GA 4I3HA 4JYZA 5ALHA 3D0KA 4FKMA 4OKSA 1Q0SA 1RRVA 3OWHA 2I67A 2GO7A 2V5VA 5G1OA 1XI2A 4TN5A 3R24A 1MEEA 1N2CB 3F5QA 4UAGA 1WDWB 1YXMA 4N41A 3VSCA 2H2FA 2BDUA 1M2EA 1NYLA 4YEDA 3FWNA 4RDXA 2B8EA 2B5WA 1KEVA 1R4NB 4YV0A 4NDAA 1XG5A 2WFLB 1VBFA 1RM4A 4O2BA 1Q15A 3FN4A 4F1WA 3EWNA 2EF0A 4BASA 3A6HA 3HKCB 1IPEA 4IQGA 3WADA 2QYHA 1P60A 3UWOA 1WZNA 2ODBA 4P7FA 4KQXA 4U2EA 2XIJA 5EUMA 2CFTA 3SI7A 2P0YA 4CG2A 2Z6UA 2WFAA 4BPRA 1I9CA 2GAAA 3P2OA 4GBED 2J0VA 4ZU1X 2QRMA 3L7IA 4MW4A 4DUGD 1UFKA 5ALNA 5FBLB 1YUMA 2H4FA 1WDKA 1FRQA 4J1NA 4YWHA 4AAYA 4R9UC 4DOMA 4DLPA 4LRXA 4CR6A 5LDHA 2LCIA 3EDCA 1Z3IX 2R00C 4LDAA 4DZZA 3UJBA 1ZZGA 3WMRA 1T1JA 2A3RA 5JSYA 4KLRA 3RWMB 5K0JA 1Q6ZA 4S2EA 3TZBA 1NBME 5KUTA 4AP9A 5FULA 2JVIA 3EIQA 3MLEA 3JRXA 3HLTA 2BGGA 2GPAA 4XB6B 1W75A 4H60A 4S1PA 4BP9A 3CO0S 7REQA 4YECA 4LF9B 4HNTA 2ZP1A 2WRZA 3NRBA 2VRBA 3DTNA 1EQUA 3CNHA 1XU7A 3MVEA 3PE4A 1Z5OA 4R2JA 3STUA 4UMDA 3UWMA 3FOWA 3MAJA 4RACA 1VL2A 2YWJA 1GP2A 5EIAA 2IJGX 1T5OA 2OL4A 3QKUA 3AFNA 2QMZA 5B4UA 4KR6A 1SG0A 1HPLA 1O7JA 1TXGA 1UKZA 5KJEA 3IQWA 4N7BA 3TOZA 3TQRA 3VNBA 4E1AA 3L7DA 4DUZB 3BM5A 1VL6A 2W6ZA 4EW3A 1QPZA 3WGMA 5LP6F 2AE2A 4B71A 3VHLB 1M0WA 2VSOA 2FMHA 4N5LA 1NXQA 1L5LA 3WYCA 1DLIA 1FJXA 3D2BA 1ISIA 1ZBDA 2D0DA 2VRNA 2UVQA 3TR0A 3ZNQA 2F3TA 3OMLA 1EFLA 3R3ZA 4HZUA 4R2LA 1OLUA 3WOHA 4OFWA 4AWBA 1Y1KE 4FLFA 3LNTA 3QIVA 3WGVA 3EYAA 2N3ZA 3OP1A 3DOUA 2FQXA 1JQKA 4ND2A 4URXR 1CDOA 5KYUB 1Q17A 3B51X 1J00A 3NLLA 4MUAA 1RYZA 3VYRB 1SVMA 3NKLA 4DMMA 2FDXA 3ZCPA 1T2NA 5TMDA 2B8TA 1KK3A 5TMBA 5EP4A 3FTEA 3L0PA 3G2KA 3PEWA 2CF5A 3MTEA 4DR2B 4M0KA 4KFRA 3L49A 1SOUA 2B5VA 4MQ4A 1KEWA 3MILA 3N0XA 2E4VA 3IUPA 4MUIA 5G0UA 3HPRA 3VQTA 5IAJA 3MTJA 1C41A 3FZGA 4MQEA 4RPIA 3WLPA 3ZHYA 1NDHA 4BNYA 4TTSA 4FGLA 2FEWB 3PD7A 4ESOA 2XNJA 2XE8A 3IR7A 1ZINA 1LD3A 2PKQO 4CLXA 1T29A 2HU2A 2JGEA 2XH8A 2PT7A 2W8BB 2OEPA 3PFFA 4Y8VA 2XNDD 3E5HA 5ULLA 3G7NA 2I4MA 3BK7A 2DMRA 1RYMA 1QM5A 5E7QA 2BFDA 3IV9A 3RBAA 1GZ3A 2QENA 1VIVA 2FPGA 4B2LA 4RS4A 1COZA 2PWAA 1GLNA 1HLPA 1OLXB 3RVLA 3SIPA 2WDZA 4DV2B 1UM8A 4AROA 4DDUA 2FR0A 4RA6A 5HA5A 1QGUA 2ONJA 3W6ZA 1AS3A 4H6PA 4XLTA 4F3CA 3D6HA 2CFSA 3TAHA 1Z3CA 1I2MA 2N46A 5JZVA 4QZVA 4OM8A 1N6LA 4NJMB 2GM9A 3QLEA 1AM4D 3QELA 4XDYA 5IHPA 1J5EB 5K99A 5B2FA 2D1QA 5F52A 2C07A 3CEHA 5KX5A 4DV5B 5K8TA 3PLAE 2W6MA 1XQXA 1QTIA 2JIZD 1G4UR 2P6NA 2VYND 3GEBA 4NAUA 1SULA 1BE0A 2RBEA 1W9HA 1YACA 2EGHA 3FUWA 3RUHA 3ONWA 4KXLA 1GKLA 2H7YA 4D9BA 2ZTHA 4I5FA 1ZGGA 3RLFA 3X1YA 6LDHA 1I7DA 4EHAA 3HB5X 2RKOA 1G9XA 2ZYHA 1WMAA 3D9QX 5KYXB 3LTNC 4EPYA 1V1RB 2AG5A 2QQEA 4O4HB 5HK9A 1UMBA 4JI6B 1ZEMA 2Y1KA 4XPZA 4CM4B 3EDMA 1NXVA 1TQHA 1F12A 1VBMA 3ZY6A 1E6WA 1B8NA 1P4AA 1MB2A 2B2NA 2IPLA 3DGFC 4K1XA 1EDBA 4PLCA 3VUEA 1ZK0A 3CS3A 4B84A 5JAIA 3BB1A 3FIJA 4UMVA 3QG5A 2ZTMA 3B3QA 3R7AA 3HFSA 3HXOA 2FSIA 2QV0A 3JZAA 4MPDA 5EUBA 3MD0A 3OTHA 4DJAA 4F3RA 4LJ8A 4D0SA 2BLLA 3P26A 1SXJB 1AK9A 4C3VA 3OUZA 2DR2A 2XWBF 1JLSA 5BNTA 1SZDA 3R8CA 3JALB 4WN9B 5JAZA 4D25A 2HFJA 3F7TA 4WXMA 1WW2A 5KTPA 4L73A 3V2IA 1DEXA 4WL0A 3T94A 1WSAA 3KU4A 5JQWA 2WSIA 3ZLUA 1RVV1 1Z25A 1JQ3A 3UT0A 4I1IA 1QZ3A 3NT5A 1IJKA 4XFDA 3CUTA 4HTFA 4PHGA 1RAHA 2LCQA 4EITA 2XMCA 2Z8YM 4F3NA 3F96A 1UEXC 4K9QA 2UXDB 3RIHA 4QVGA 3F6SA 1BNCA 3RF7A 2B4TO 2GGSA 5IAOA 4XYLA 5EMJA 1D03A 1ODSA 4QELA 2IZ7A 2JFBA 3H8WA 3V1YA 5TQ0B 5KEIA 4FW8A 2O8EB 2A59A 4B6FA 5K6RA 1JL3A 2FLWA 4MITA 1U0JA 5AHXA 3PHIA 4M7PA 3REOA 4E5YA 4IGEA 2QJRA 4B7ZA 1BXGA 3CQ9A 4NYMR 1HDZA 2YVQA 3I5MA 3TJRA 3Q5DA 2O8FB 3NS7A 5LUBA 2RGUA 1RXCA 2A0YA 4O4IF 4ZI2A 1XRNA 2ADFA 5DKFA 2QF7A 1F8GA 1WUTA 4FVTA 3ZJYA 1JHQA 4AMGA 3C85A 3KL2A 1ADCA 3PFIA 5DBOA 4DA8A 2I29A 1WCIB 2BFCA 3WNZA 1U9IA 1XRLA 3FNRA 4ZAYA 2FF7A 4CI0B 1MEJA 3T3DA 4RETA 2XCRB 2BN4A 1MU0A 4FYHA 4NU8X 4NZMA 1ZO8A 3TVTA 4F4DA 2EIHA 2YWRA 1L9XA 5B6IA 3ES9A 2KQUA 4CLRB 1V9LA 2OYRA 4CMEA 4FZ3A 4TS3A 4XXHA 1H85A 2A94A 3LX6A 3PV0A 4JA0A 1CW2B 4M87A 2D1YA 1QQTA 1UM9A 2WHEA 5EIHA 1RQ2A 4D9JA 5C1PA 3C97A 5LQRA 4QU8A 4FYMA 4QBKA 5A4AA 3MUEA 1C4WA 3HWWA 3RTDA 2VHEA 1AKMA 4F2DA 4A4DA 1M1YE 3O9ZA 3LK6A 4LVUA 1I2AA 2HHLA 1WB9A 1JAIA 1S01A 1G8JA 2A35A 2ZM6B 1RJDA 3CXUA 3PX3A 4IUCS 4I5DA 5HILA 2J0UB 2R751 3HR7A 1BGVA 3JAKB 4S1NA 3L8DA 2D6FA 4MQFB 4POOA 3JVVA 3FLEA 1LQUA 1YIOA 3DAGA 4YS6A 2Z04A 1BOFA 1RCTE 2J3EA 2J1LA 1LTHR 1O5TA 3GL9A 3I58A 5EE9A 1D2HA 3N8IA 4HMPA 4BE7B 1ESMA 1P1IA 4UE3S 1WXFA 4GLFA 4PBRA 4IV5A 2O23A 5A7GA 1N2IA 3F3SA 3RR2A 2VZ0A 4GNRA 1H2AS 4HLCA 1Q1GA 4UVIA 3PUHA 4AZSA 1AN0A 4ECAA 5ITZA 3K9FC 3NHUA 5JS2A 2R86A 1GZUA 3DJYA 3IQEA 4EJSC 2G71A 4L5BA 5J2UF 4B3JA 1PV2A 3O4FA 1AKVA 4ZEMA 1E9CA 4I55B 2CNKA 3IAUA 4ND6A 3EFOB 4RK1A 5DOZA 4BFVA 5IU6A 1RXSA 1Q3KA 1K4YA 1YBHA 2GERA 3HU1A 4LV8B 5F64A 3SSAA 4ZZ3A 1J09A 1E2DA 2I1LA 4AYXA 1J56A 4NHOA 3CNBA 4U5XA 4CFYA 3W9UA 1XCOA 1T5IA 4PLPA 3NHKA 1NPYA 4NBKA 4K7JA 4JB8A 4D3ZA 3A9TA 1E89A 4LHSA 4JBYA 3VUFA 3TINA 2GARA 3ZE8A 4A36A 2VWPA 2OK8A 4U2CA 4AP6A 1W7AA 4Q9IA 5TPWA 3JQ7B 2ID7A 1G55A 3A9UA 3OCZA 4NIMA 1N4AA 2QYOA 1PQPA 5SYMA 4UUMA 2J6IA 4UCFA 1PGJA 2CMFA 1XZDA 2COEA 2ONCA 2X4DA 3QFTA 2BZSA 3QMMA 4UEOA 5IX8A 1RJGA 2NU8B 4W9NC 4C6HA 1DKQA 2DBZA 3KKEA 3LECA 3LCCA 1CJMA 1P77A 5E6SB 1Y4ZA 2ID4A 3TQFA 4C06A 1ECGA 2QTVA 3F3YA 3HDGA 2OR3A 4JYBA 4NG4A 2GLXA 5B6JA 2JASA 3RWBA 3VHXB 1RRCA 4KQ1A 4EB0A 2GA8A 2XTNA 4EQZA 3AU9A 4QYWA 3T06B 3C3DA 3CSUA 2C7OA 4MRMA 1G7CA 4BV2A 5T4BA 2ODWA 3AB7A 3EXAA 3MMXA 4WIAA 1NDQA 4H0FA 4PVDA 2FWJA 4HDOB 1ORRA 3LQRA 1SWVA 4JL5A 2FWPA 1T6BY 2EJCA 2G82A 3FYSA 1KS9A 5CXSA 4YTEA 4UXHA 4B6RA 4X63A 3BGSA 2PGDA 3OZGA 4NZ9A 2WJ6A 1KR2A 2PFSA 2HF2A 3TL3A 2CXTA 4GE3A 3JVIA 3U7FB 4AIRA 2HCBA 1KEEB 4ZEOA 4RKQA 5CA1F 2NWQA 1UJ6A 4JEIA 3BN3A 4WLEA 5K0FA 3T0IA 3SD7A 3IAS6 4YRIA 2HLDA 4FCWA 2ZSJA 5LQCA 3GIWA 2OHOA 4CZ2A 1BRMA 1GUFA 1HETA 1U3CA 1UK9A 1V5IA 3IOEA 4DJ5X 3A3PA 5ITWA 1RQ7A 2ZJ5A 2PGLA 3I2YX 4YY3B 3KSRA 5SZKB 4IFEA 3G5LA 1P1FA 1Y5IA 5GY7A 1ZQ9A 2Y99A 3GPIA 1LXCA 1JZTA 4FR2A 1LPSA 4YCNA 1YBAA 4B40A 3TFWA 4TUYA 2D8MA 2DKOA 2IQIA 2VR1A 1DDIA 3C6QA 4V1CA 3I37X 4G1FA 3HYSA 4QGAA 3R4CA 1DE0A 1PK9A 4GD3Q 4L76A 4O29A 4RXUA 3FNHA 3L7AA 3NNSA 3SQLA 1M34E 1SEPA 3HB4X 2R8EA 3B1YA 2AWNA 4WKOA 2XTMA 3C3XA 3PE6A 3QE2A 5SZHB 3SEAA 5D87A 3R75A 3BL6A 1SMKA 2HA0A 3MINA 4K26A 1G3UA 3WOVA 4F46A 1AURA 2FNAA 1QU3A 5J9FA 1MJGM 2NO0A 2ZAGA 1GUBA 4IVNA 4JQZA 5A4FS 1MO5A 3CWZA 3SKYA 2QX7A 4QXQA 4OHVA 3WLFA 1TT5A 4N5DA 1WKBA 5BQPA 2I6QA 2VT3A 2HZ7A 3EPLA 1VJTA 2IRWA 1T5DX 3DL7A 1UBRS 1MAAA 1P9OA 3LVQE 2C8LA 2FR8C 1FPQA 2R79A 1M83A 1LX6A 2OCXA 3MB8A 5H02A 5JQGF 2XCTB 5HX7A 3WRXA 1E79D 1U28A 2OCIA 2V1XA 3L6EA 2W4IA 3I2HA 4URUR 2AFHA 3TTWA 1JQAA 2OD2A 5CGQB 3C3BA 1UBLS 4NL4H 3SPXA 3ADPA 3D2CA 3X2SA 1KQFA 3HKBB 1RYFA 1T0UA 1XJ0A 1JDBB 2W98A 5FUVA 2YWCA 1BFUA 1F6BA 3C5WP 3R6TA 3AUKA 2I80A 4ZAVA 4IX1A 2P0AA 1HFKA 1MZVA 3MYYA 1SBIA 4FPXA 1XVVA 3E58A 3CWCA 3MIZA 5E38A 1O9BA 4OQYA 4IOKA 3VI3B 3W05A 4DIBA 5EMNA 1CR4A 1N2EA 4Y1EA 5A4MS 1WXEA 2BEWB 2QZ4A 5IK2D 4NV3A 1UKVY 1T3SA 4NV0A 2L69A 3PK0A 1OBVA 1GPWB 1N7IA 1W93A 4MWBA 4RVDA 3MTAA 3UMCA 3U09A 4NE7A 4YHBA 5EWMB 1B15A 4LRWA 4LJKA 3F5FA 2AUTA 4PRKA 1LGYA 4CNBA 1Z08A 2WIKA 1LWNA 3A9WA 1E2UA 3K70B 3TTTA 2BOVA 2XT9A 3VOBA 1T24A 1PFGA 4DNXA 1YR6A 3IQIX 3J7TA 3TR6A 4BNHA 3CF6R 2FLKA 1L5FA 2PUFA 5CCXA 1U5CA 4YLEA 2GCPA 2QAJA 2XCQA 3B6JA 1QE0A 1Z6TA 2FG6C 2OM6A 3M7IA 4MVYA 4K2HA 1M6EX 1YQWA 1W1WA 4AF7A 2PR7A 1E0AA 4UHHA 4FBMA 4GQAA 5FAKA 1N5MA 2E1RA 2V7EA 2JJYA 4MI1A 4ZJYA 5AW7A 3FR8A 3IP9A 4X20A 3DEIA 4TMTA 2LGJA 2Q1WA 1KP2A 1WSBA 2AZ4A 3GUHA 4B2IA 2V59A 1N0WA 1VJRA 1DBWA 3UFXA 1UK8A 3JQPA 3T7JA 3NEAA 4WT7A 3Q8MA 1NJFA 5AKZA 1UBTS 3FUVA 5F1KA 2Z6QA 1N2XA 3OIFA 5IAEA 1H2HA 5HF9A 4J0FA 1ZUNA 2X7XA 3N2GA 1VM6A 1AKQA 2EF1A 4IJVA 5A6SA 2NZVG 2BVNA 3KB6A 4Z2YA 2Z8XA 3HTXA 1JYFA 4DSUA 5A3QA 1A9PA 2EERA 1PLJA 1TZCA 2W6PA 3DZDA 3LT2A 4OYRA 3OFKA 4G85A 4W63A 2AOXA 3T3PB 2R85A 1H0HA 2DPYA 4ZZ1A 3OZIA 3C87A 4R81A 5B36A 4Q4HA 3T5CA 1PT9A 1M66A 1XRJA 4XTRA 3AEZA 1KDVA 1ZCBA 3T7TA 1VZ2A 4RD4A 1HSOA 2K2QB 1U0GA 2PLWA 3BXEA 4LC0A 3V97A 3B9PA 3VMMA 2VZEA 3G79A 2XVMA 3BZBA 1PT5A 1RM3A 1GY8A 2G7MC 3BUSA 5CNJA 5IAKA 1IYZA 3REQA 1XDSA 3U9LA 2YTZA 3IVMA 4N9WA 2W0MA 4YAWA 5BMVF 4RSHA 2ZUEA 1N1DA 3ZLBA 4DVGA 4Z6KA 1WPXA 1JJ7A 2YV5A 2XLCA 2IS2A 4FB4A 3CKYA 3F6YA 3T7EA 2Y27A 1K6EA 2X42A 1ST2A 3FNFA 4BX9A 3EJWA 3E1GA 4EYQA 3TM5A 2Z3ZA 4QTXA 4K40A 1QR6A 4Y2QA 1SNYA 2EYQA 1RYEA 2ZUTA 1XPUA 3AQIA 3EMDA 2ZBVA 3KSMA 4J4HA 4NCXA 4BVKA 4C7KA 2OYSA 3F98A 1JEQB 4RCZA 1WETA 3WLTA 3ILSA 2IIVA 3ZDBA 3C24A 2BR3A 2Y1LA 3EIEA 4KWTA 4Z4GA 4HAWA 1D0SA 3JQFC 2VC2B 4LGVA 3BIOA 2QW8A 1JAZA 1L7RA 3ZKWB 3ZWVA 1TECE 3E15A 1BS9A 4YCMA 2I2WA 4IIFA 1Z9BA 3TSCA 2FB9A 4P83A 1JJAA 1U04A 1ZR2A 1VG0B 2VQDA 4OHMA 5CB4B 2JNWA 3L7BA 5AKIA 4P8RA 3GNQA 5HXAA 3GWZA 1R8QA 2I3BA 3GGSA 4D97A 5I48A 1SQFA 2HWKA 3FYHA 3QK7A 1SM4A 1N0VC 3HKEA 4EY5A 1GV1A 5ELXA 2B92A 1Y1PA 1FQOA 2VDJA 2CJWA 1JFFA 3VHQA 4FFSA 4QTZA 5C4MA 5IASA 2YKGA 4ARZB 3II6X 4OFXA 3R7WB 4HB2A 1WXXA 4M7RA 4EATA 1TW3A 5HKLA 4BWVA 4FMCF 5CCEA 1VG1A 4GLBA 2QZPA 2VPTA 5GGXA 2O2EA 1R88A 3EMVA 4L4ZA 2YFQA 1BJRE 3F7MA 3NBXX 4AG6A 5KQRA 2UU9B 3G1UA 1XTVA 3HNRA 1V0JA 1VLZA 2O0MA 4E22A 1EX9A 1Z6GA 3IAXA 1O3YA 1P2SA 2Y77A 3AW8A 1U3UA 3KVNA 2EARA 3NFYA 3R3VA 4L08A 2X8BA 4LSMA 1VLJA 1KI4A 2BCJQ 4JI4B 2ZSUA 2W9XA 4DCCA 3AR7A 3HFJA 2PX8A 3BGWA 5K05A 5LP6B 2RIRA 2VN8A 4AKEA 3G0HA 1XQVA 5ICEA 3PUKA 4CKBB 3A8TA 3CVWA 1NWHA 1R8JA 3BXXA 2R4QA 4BPBA 2CE7A 2LIPA 2BEUA 4MUMA 1T43A 3U3DA 5LJLA 1G21E 2WJPA 2ZQYA 4ZOBA 3OJ0A 5EQTA 4CM9D 4ZALA 1PVOA 3R09A 1MW8X 2M32A 3Q1KA 1FDTA 3TI9A 3VPSA 1ECLA 1TEVA 2BGJA 3EFEA 3R5TA 4JYMA 2GZ3A 3C6YA