2HQSA

Crystal structure of tolb/pal complex
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
412
Chain Sequence
VRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYLHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mimicry enables competitive recruitment by a natively disordered protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/lipoprotein
molecule keywords Protein tolB
total genus 109
structure length 412
sequence length 414
chains with identical sequence B, D, F
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04052 TolB_N TolB amino-terminal domain
A PF07676 PD40 WD40-like Beta Propeller Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 2hqsA02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 2hqsA01
4GN7A 2IAWA 1CRZA 3LI4A 2GVUA 2FP8A 1H6LA 3SREA 2HQSA 3O4PA 3LI5A 3HLIA 3BYCA 2GVXA 3S8ZA 2IAOA 3SOVA 3Q6TA 1POOA 3FVZA 1CRUA 2FPBA 2IVZA 1QLGA 3I1CA 2GVVA 3V1SA 2W8BB 4GN8A 1PJXA 3IAXA 2DSOA 1RWLA 1RWIA 3G4EA 3S94A 3SOQA 3S8VA 2FPCA 1CVMA 2VAQA 4R40A 3AMSA 4JMLA 3S2KA 5FWWA 3KGGA 4GNBA 1N7DA 1CQ1A 3LI3A 3TC9A 3V65B 3V64C 2G8SA 2IAUA 2IAQA 5GX1A 3G4HA 3Q6PA 1NPEA 4GNCA 2IASA 1Q7FA 2IAVA 2IARA 2DG1A 1E1AA 3WW9A 1C9UA 3SRGA 3Q6KA 2GVWA 2IAXA 2IAPA 4IYGA 5GX3A 3A9HA 2QE8A 3HRPA 3SOBB 5D9CA 3WWAA 3KYAA 2P4OA 3DR2A 3U0SA 4DG6A 2ISMA 3E5ZA 1QBIA 2FP9A 2OJHA 4GN9A 5GTQA 3FW0A 5EX7A 2POOA 5GX4A 2W8BA 4HHOA 5GX5A 3HLHA 1V04A 2V91A 3A9GA 4PWZA 5D9DA 3DASA 1C5KA 3P5BL 2DG0A 3AMRA 4HW6A 5D9BA 1IJQA 4GNAA 4HHQA 4ZLRA 4IMBA 4O5SA 4A0PA 5GX2A 4Q1UA 4O5TA 2GHSA 2IATA
chains in the Genus database with same CATH superfamily
1J8MF 3EA5A 4LNAA 1Z8NA 4EHHA 4CBVA 2XGMA 1V16B 3GZTB 1IDN1 2GNAA 1C4XA 4UXJA 5L3ZA 2JF0A 3HADA 2YJGA 3QEAZ 1OFTA 2SNIE 4DR3B 3O9VA 5H80A 2IEAA 1K08A 1PT5A 4ZRMA 4B3BA 1GVHA 3MSCA 4DCMA 5A2QA 2VSFA 1ENYA 2DECA 1V3DA 1JHUA 2VYVD 4MVJH 2C2BA 3IJ5A 4GZPA 2QZJA 3SBXA 3IMGA 4EHIA 2H4XA 5M7EA 2WYUA 2V3CC 2YXDA 2F3TA 1F1BA 3PKJA 4B6FA 4DQ0A 5JAPA 4LXGA 1HE2A 4GKAA 2JFBA 4HGPA 221PA 3JWHA 1UJBA 4B9EA 4C89A 5JD5A 3OFVA 5DJ5A 4R6WA 3A9RA 3WAGA 5KYWB 4GPEA 2VKQA 4FBGA 3UB3A 4KS4A 4GOND 3LA8A 4HG2A 3VVMA 2YWXA 4C4YA 2D8MA 3CPHA 5CVEA 1W48A 4H1HA 1BHO1 1CJTC 2YFYA 1PBTA 3TQHA 4HRVA 1D2GA 3VOSA 1WHTB 2JAXA 2BZDA 3B7GA 2O2IA 1K7YA 1L9KA 3LC0A 1E3SA 4CHBA 2WKSA 4E09A 2RC5A 3FTFA 1TPYA 2E89A 2JW5A 4JODA 1SR8A 4CL2A 2JFHA 3MYRA 3MS4A 2D62A 1XHLA 4FYJA 5C35A 4CCAA 5AVSA 2GJAA 2Z98A 3EWSA 4RPCA 2WABA 1WBJB 5EC8A 3V1YA 4BO1A 2CMDA 1ZVJA 5LLTA 1NCCN 1KXJA 2GXAA 2LZ0A 4V3CA 1C3OA 2JAUA 2XCQA 1MNAA 1RIFA 4RWZA 1ZXBA 4TRJA 5F1YA 3RBZA 3KQYA 1VCNA 2JFUA 5JSUA 4M0MA 2Q46A 4IOMA 4YJGA 1T0IA 2PGXA 4M1WA 4YR9A 5BNIA 5K0FA 3A37A 2A14A 2A84A 2G83A 1TIPA 2HA2A 2RJNA 3JQ7B 2RH5A 4OLHA 1AHIA 1DL5A 4DS3A 3FPEA 5DT9A 3AKZA 2DLCX 2E18A 2GYUA 4O2BB 5CM9C 3HUEA 2CFIA 2PSSA 3DKVA 3NNNA 3RF6A 3RO7A 3W2GA 5BURA 5HQTA 2A5FA 4ZCPA 4Q1DA 3FCEA 3CLHA 3AW9A 2O2ZA 1PDOA 3JQBC 2PZAA 1FS4A 3OEYA 4B45A 1RZUA 2MYTA 1QCCA 3QBJA 4E5YA 1H1LA 1P74A 1KP3A 3GP8A 4FK8A 4JMPA 4E07A 3R7NA 1T2CA 1L5WA 4FDUA 5I9TA 2C3YA 3TECE 3A27A 4LPSA 1F4LA 1U0LA 2P4QA 1YBFA 3K6RA 4FIZA 4HMPA 4WLUA 2IRWA 1MAUA 3BBLA 3OM9A 1OYOA 4Z8YA 3SJ7A 3UF0A 4M99A 3JQGA 3E0QA 1U7ZA 1PG5A 2J5KA 3BJMA 4R0MA 3A2LA 1U04A 2A9VA 2HLDD 1Q0QA 4ATNA 3BD9A 2L17A 1NPYA 1X77A 4BLQA 3LBHA 2FN8A 1A98A 1RWMA 4IEFB 1AGPA 1JFFA 2QRZA 3COPA 1JJAA 1PT8A 5JWOA 3QWFA 2QWAA 4H1WA 1BXRA 2OQRA 2VNHA 1T3TA 1XEWX 2C77A 3N7TA 1JXQA 3R8FA 2FUG1 2VPZA 3GJ4A 4UPVA 1QHFA 1ZIOA 1R9JA 2CCGA 1SXIA 5KYXB 3DM5A 1PGQA 1Y3FE 5IVIA 3I6MA 2PUJA 1FDSA 2JA1A 3LX5A 3SX4A 3VR5D 5KNBH 4OHYA 1ZP6A 2IDMA 2PUVA 1XFAA 3I83A 1W5BA 4J4TA 1QGAA 2H4WA 4BO7A 1L8AA 2AX3A 2O14A 3LMKA 4CDMA 5E7JA 1YTUA 4XOGA 1ADJA 1E3TA 2XHEA 4P22A 3NC0C 1TLTA 2OA0A 3ZI7A 5D6NA 1KSGA 2JJ2D 3DPIA 1FX0B 1P8JA 2G5PA 3AUSA 3KELA 3KJQA 3WYCA 1BXGA 2PKRA 4ZGGA 1SCBA 2V5AA 2ZJ1A 2RCYA 1ENZA 4KLRA 4B47A 3VPAA 2G63A 3SFVA 2R1VB 4M9RA 4RUKA 1W0PA 5IN4A 2FZ4A 1ICEA 5FULA 1TJ3A 4C0JA 5B6JA 3AVTA 4YUYA 3N8HA 1N2CA 3ADDA 2DE0X 4DUGD 4MYTA 2JCGA 5G1PA 1V5GA 3UFXB 1GZ4A 1A8HA 3AEQA 3TX2A 2LNDA 5CEFA 2V7XA 4ZRNA 1GSHA 4Y2QA 3PTAA 4MAMA 4DRZA 2VJAA 2XMSA 3HXLA 5ALYA 3HV2A 1QAOA 2HWUA 3GI1A 2YV4A 2SCUA 4J4HA 4TKUB 4K0KB 1AKMA 2OLKA 2PGJA 4JB8A 3TW4A 1T8PA 3HA5A 1PWEA 2QD1A 4G0QA 4UCFA 1N1GA 1Y3BE 3H86A 4HGQA 5FBHA 4B4VA 1N77A 4S0XA 3UJHA 4HRXA 1HDZA 2ACWA 4Y9DA 5IC4A 1Z3IX 1Q14A 1QHHB 3AHCA 4FLEA 1KXZA 2AFIE 3OEED 3V6LA 4R51A 4Y8VA 4C0QC 4CR8A 1EWVA 2WMDA 4KGZA 3FJYA 1MHTA 1IONA 1UEXC 1HT1E 1P17A 1AV7A 4KQIA 1FQOA 4RQAA 4BFXA 4MWBA 3LHFA 3GO4A 3IE1A 4QDJA 4RYDA 5AOAA 2E4YA 2VEDA 2I1LA 2ZJBA 3MWDB 1Z5ZA 1RCUA 3HDJA 3ZHOA 4R8RA 3LZ6A 4PHGA 1EBUA 3SIPA 3BSSA 1QV9A 2J67A 2QD4A 1SXJC 3P9ZA 4HBGA 3CE6A 3Q7TA 2JHFA 2ERCA 3K0EA 4HRAA 4N0MA 4YALA 3T0GA 4EFDA 3GNLA 4BB6A 5LIRA 3A04A 4MVYA 4EYSA 3OLYA 2G1JA 2PEZA 1G55A 3UMFA 3HCBA 1N32B 4PR3A 3BWEA 3U19A 3LK6A 2HRRA 4L08A 4X00A 1QBIA 2H2IA 4XH9B 5DZSA 4ID3A 4ZHSA 1FS5A 1O54A 3FZQA 3V00A 2WP8J 2D2FA 5KNLA 4K03A 2YA7A 1H2YA 3DO6A 4MV5A 1J8DA 4XIKA 4CQJA 2HK9A 5MFZA 3QHAA 5ERGB 3V3KA 4JGGA 5HS4A 4DJJA 3KZOA 4N6GA 3MCVA 4K9MA 4YJFB 3TR6A 5AKJA 4I5GA 1H2ZA 1CUZA 1M6VA 4TRRA 4C6HA 1R0LA 1IY2A 1D3AA 3QVJA 4LI0A 1KDYA 2H48A 4EY8A 2PZBA 4K9NA 5AM1A 2D0PB 4YAJA 1W75A 3RYFA 4X24A 1KJNA 1WTCA 1Q6YA 3GY0A 4BKQA 1R8SA 1S96A 2NZVG 2ZB7A 4I1VA 3ROKA 3ORFA 4A2QA 3UV6A 1IYZA 4PXAA 4YMTA 3E9YA 1Z4ZA 4FGWA 4OY3A 4G4SO 5EQDA 4YWHA 1ODTC 5CPBA 2BGMA 1GADO 2A88A 5J4YA 3BE8A 1HLGA 3NUGA 3QEOA 1V3VA 3D0OA 2O2JA 5LP6C 3SZMA 4C06A 3DDZX 1C9YA 1N2BA 1KARA 2VA8A 1MJGM 4WMLA 2A9FA 3USCS 5JCJA 3AEUB 4W5RA 2GRJA 3FOBA 1UBEA 2Q1SA 2DFNA 2DQ4A 4MCIA 5AMXA 4DSAA 1I13A 2O8CA 1TD9A 1KJ9A 1RAGA 2ZSJA 1V45E 4C03A 1OBVA 3KUDA 1IE3A 4R9VA 5U1PA 5F1PA 4YS6A 3VYWA 2AFRA 1ID1A 3EH2A 1HZZA 1PFUA 4WAUA 2X0FA 1NQXA 3EIFA 3SF8A 4IDEA 1VCUA 4UHEA 2BFCA 3KHUA 4J16A 1NFQA 3NWBA 5JS7A 2H7CA 1OW3B 1HDRA 1QVVA 4DKJA 5TMEA 4CDGA 4K9DA 4JLPA 1L4YA 2XWSA 2EFCB 5ICGA 5EIBC 2F3QA 3MILA 3R5SA 1V0ZA 1AB5A 1ADBA 2CDBA 4LHSA 4NMXB 1ZINA 3WWZA 5C5EA 3ZDRA 1V7PC 2PL1A 4EBFA 2C4TA 1UJ5A 4R81A 4YRDA 3ZJ4A 4QAJA 1WCYA 1Q2UA 1MBZA 1Y8CA 3HP1A 4TSFD 2IEIA 4FYWA 1T8YA 3HJRA 4KJZA 3QUAA 4L4RA 2JASA 1W34A 4BDTA 3LM8A 2H0QA 4YV2A 3PLAE 4HS9A 2VDKB 5FL7A 1PWYE 2Q5LA 1RYDA 2HAEA 5ALJA 5DN6D 4IMPA 1JEJA 2OQ2A 5D1NA 2RD2A 3BILA 1GSAA 3TI3A 1AKQA 2FX5A 3AUKA 3FRIA 3IIKA 3O94A 4IILA 4YRJA 4ML3A 2IXEA 2PT6A 2JIQA 3G6WA 4NZNA 1C9JA 3EDMA 4KQEA 5DGHA 4C76A 3EX7C 3R6DA 4BO5A 1H4QA 2F13A 1A7KA 2XUDA 3VV2A 1RR6A 4RVGA 2MINB 2R6GA 4YMUA 2VTBA 1E2IA 1KFBB 1YAHA 3QUTA 3HJBA 3FKSD 3H4VA 3HBNA 5BW8A 4C2UA 5J4LA 3M82A 3ZQKA 2TECE 3LXRA 2IYRA 2O8BA 2PPLA 4A10A 2B3DA 3X1YA 2JGKA 5TEWA 1EG7A 3GIWA 3HKCB 3PC3A 1ZI6A 3TD6A 3QHPA 4A2CA 4NAUA 4LJRA 3I62A 1CDZA 1SUDA 1YBVA 4LG1A 5KYWA 4FFBA 3BL6A 3VM6A 2NV2B 4ZGWA 2IYUA 3OZEA 1Z4KA 4K6HA 4LGVA 3B2EA 1H5QA 2BMDA 3EWIA 3EGCA 4CPZA 2QGNA 3FHLA 4AU1A 4EEZA 3OT1A 1Y42X 1O95A 1KY3A 3M9XA 2VQEB 1UXJA 1ZUWA 2CVPA 5K3OA 4B31A 4NFYA 3C8HA 1II9A 4L7QA 2YWEA 4O33A 4UHKA 4FR2A 2VT2A 3B60A 1UM9A 1SNYA 4FKBA 5C34B 3S2UA 4M1EA 5I9MA 3V8EA 4HUTA 3R7FA 1ORDA 3M70A 1A8SA 1SVOA 4W5WA 4KLCA 3NGLA 4F8EA 5DTMA 2YJNA 4AC9A 4NDAA 5I4CA 3Q10A 2NSHA 5HQ3B 1DEOA 3AFIA 3M3PA 1BCRA 4JC4A 1ZR4A 5ED0A 2UV8A 5REQB 1F8YA 3HB7A 3QXGA 1JHOA 1WLSA 1D2NA 5EIXA 1PJLA 3LKVA 5LR6A 3A36A 4E12A 4F7DA 4DQKA 2YVKA 4RMIA 2BPOA 3ZZ1A 3HBJA 2VYCA 4CNBA 2B30A 1MX5A 3CEMA 4GI2A 4O1IA 2R8RA 3RJTA 1YVRA 3WV4A 4CGZA 5D84A 2G06A 5SZJA 2JJ1A 4YUWA 3HDVA 4U0JA 4UOZA 3S81A 4TVOA 2W4MA 2DB3A 4H6XA 1YQXA 3ODPA 3RYFB 5J2TB 2IHUA 3F0TA 5AVRA 3STWA 4K88A 1N6LA 2GEUA 3D81A 3IBGA 3H11A 1ODJA 1E20A 1V5IA 3L3BA 2QVZX 4HEA1 4KRYA 3RIEA 3KHSA 3U7EB 5K09A 3KZ1E 2PFGA 1R4MA 4NFSA 2BJWA 2WF9A 5D8DA 5EERA 4X84A 4BLUA 4BMSA 2Z9DA 4MWZA 4EIWA 2HHAA 4ENVA 4ZARA 5EZ5A 1PQUA 4KWHA 3A0UA 3L05A 5JADA 3L0IB 3OJFA 4J0FA 3BXPA 1RPAA 4EG1A 3U61B 1W94A 1HOXA 1IHDA 2JAWA 1LRJA 1I94B 4OIFA 4QOGA 4R16A 1SWVA 3QPDA 2WYIA 1QK4A 1YI1A 1NNAA 1YMUA 2X22A 3BUSA 1OHHA 1L5MA 2AW5A 2MSEB 3M1AA 4M0FA 1WZUA 4CLHA 3U49A 1R00A 3T9DA 2ZPAA 2CL6X 4CMEA 4EL0A 2V6IA 2HSEA 4KWTA 2XODA 2VN8A 5FBQB 2FFBA 2Q5QA 1EX9A 2YC4C 2Q5EA 1CQIA 4XVUA 5GJBA 4FDMA 3THWA 4OK3A 3AWIA 1NNEA 3R8XA 1IIRA 2ORWA 5KYXA 1CZLA 4NWIA 5EOVA 2RAVA 2V7BA 4J7UA 4KOEC 2UVDA 4TKZA 4Q3KA 4GQIA 3JYLA 4IJ6A 5CYPA 4A6XA 4AWXA 1GFZA 1SU7A 3F4LA 3WX0A 3SN6A 4FC6A 5EUMA 3AVXA 1M6YA 1QGUB 2P75A 4J03A 2ANBA 4QUDA 4M88A 4YRQA 5JCXA 3NATA 4LYGA 4DUPA 4MCHA 1Y4SA 2B3TA 1ZN9A 1W49A 2PNJA 1HYBA 2AC2A 4N01A 4URUR 4EY3A 4EG8A 4HTFA 1UZAA 4DGQA 1K8QA 5HRCA 1WE2A 4OAQA 5DLYA 1GQRA 5FPYA 2IV7A 1QIGA 1BROA 1UPTA 1EXVA 1UDAA 3GGOA 3U3DA 3CU5A 4BQQA 3W5CA 4W5QA 4GOLD 4QGGA 4CQLB 1D1SA 4BVHA 5CCXA 3L0YA 3NNDA 4C2TA 1JSXA 2WDPA 1F9EA 2ECQA 1U7UA 3OA0A 4MVJF 2IYEA 4V0RA 5A0TA 2FW0A 3TZEA 2CJFA 4H1UA 4GPTA 3QU7A 5FL7D 3UPDA 3D3QA 3B1VA 4E2WA 1L4KA 3C0KA 5LB4A 3RADC 1FP2A 1F2DA 2GN1A 4A23A 2OJHA 5BQPA 5AVVA 4ZQBA 5JNTA 4D7AA 4UBIA 1NQAO 2P3OA 1N9KA 2QUAA 1REQA 3HKBA 1Q3HA 2CCKA 3N07A 4LXUA 1L3IA 5DCLA 1SQ0A 4M1QA 1JLMA 1EX6A 1R7RA 1D1TA 2WHRA 2WU8A 1Z17A 3EXHA 3IDFA 4GDIA 1D6JA 1I1QB 3DO5A 3IIIA 2JLCA 4ZC8A 1QYCA 4XYXA 3BXXA 2I6TA 3H5LA 1TNDA 3FUWA 1R66A 4JP5A 4Y7DA 3QVKA 3RYHB 3PX3A 1FBTA 4KB5A 4QQKA 5JYYA 1T5LA 1QRAA 2EKLA 3G7SA 3VHRA 2XQFA 4MVJM 4N3BA 4J7CA 1STOA 1OIWA 4JR0A 3Q4GA 4MMXB 3N1UA 5JDCA 1DCMA 4KXQA 2XBMA 5GGXA 4GSYA 1J00A 1XPOA 1A96A 1J33A 1PR4A 1UKZA 3NYIA 4IDHA 3KQHA 1DKNA 2IZOA 4H0FA 1K6EA 4BNGA 3KQQA 2OECA 3DHVA 4YW4A 1AZSC 4P4NA 1Q0UA 3G85A 4S0ZA 5F4ZA 1HSZA 4N5DA 4MR8A 1JEYA 3BSFA 3KLBA 3N8DA 2VWGA 3FNGA 3DPSA 3RB8A 2D5CA 4YROA 4CPMA 1QTNA 1E2DA 4XFKA 4ZVVA 2QTVB 3CLUD 2EBFX 2RB4A 1D4ZA 1QRUA 4FTWA 1J07A 5B7GA 3M34A 5JNSA 4WA3A 5GJCA 3SJUA 2UVPA 4W1PA 5DISB 1LGYA 1PR3A 3G68A 2VPWA 1JWLA 2F10A 1P2DA 4MIEA 4EUEA 2AR7A 4LMPA 3RNOA 2QMHA 2ERYA 3NRCA 3KFXA 4JX9A 1CR2A 4N3GA 3HTXA 1AZTA 1WX1A 1Q74A 4UQOA 3AMSA 2CB9A 3GGPA 1Q77A 2QU7A 3BJEA 4N03A 4BNWA 1BX0A 1OXTA 3C5EA 3IBYA 3PL1A 3R7SA 4CLXA 1C8KA 4OBEA 3QU2A 4A4DA 3ENNA 1N3LA 2RI1A 2C9ZA 2HTQA 1P72A 3EZNA 1H0RA 1ZL2A 4NEGA 2WHPA 4UDOA 4BNKA 3HKDA 2NU7B 2Z3ZA 3P9PA 4KZKA 5AKGA 5FJIA 5T4FA 4C7MA 3LUDA 2QRUA 5AOCA 3LGXA 3OFJA 3GJ0A 3IDOA 2KYRA 2HV9A 2Z8XA 3EW7A 4R0VA 4TUYB 5HA5A 2WVHA 3ZDXB 3ZDEA 4TWBA 2NP6A 3VC3A 1G6OA 1C9MA 2ZWOA 4JJGA 4C7OA 5FBKA 1V41E 4HMOA 4QASA 4WNCA 1JDNA 1TAUA 2HSDA 1VLMA 1BGWA 1NF3A 4DC9A 4OAOA 2V1UA 4MYUA 1PDVA 3SJCA 2RGXA 3UK7A 4EJ2A 5HWSA 1AQ6A 1CEXA 4GOKA 3H0CA 2PLFA 1SIWA 2C9MA 1JWAB 5JI3E 1Y0BA 1F14A 4D8XA 2W2LD 3JWGA 1VMDA 4MYDA 1NJGA 3FDZA 1Z62A 5CFOA 5EYPB 4D52A 1TKBA 1OE0A 1ZM7A 3IODA 4ZA2A 4QO8A 4F6LA 5BYBA 1ZHOA 3U26A 4MWJA 3L8FA 5CB4F 5I9SA 2VPTA 4X8OA 1G4HA 4G65A 4LHYA 3JQRA 3WFIA 2Q1UA 4JJ7A 1G60A 3CNQS 3S70A 2ZBDA 3FMPB 4EW6A 2ID8A 5IAOA 4W5JA 2QWJA 4JOQA 2BATA 1NA5A 1JIIA 2LKCA 4KVZA 4RVUA 1XP8A 1USIA 3HLKA 3R0JA 4PU0A 4JQYA 1IBMB 1IY0A 3NTLA 3UATA 4WESA 5DNVA 1C4KA 1MFPA 2KSQA 2W83A 3DYIA 3R20A 3GDGA 2PX8A 1JP7A 3QVXA 5F52A 3TTUA 2ZCJA 1QVAA 1CPYA 2AE1A 4GOMD 2RFLA 1NOKA 1M1NA 2VBIA 3UMGA 1VYUA 1OC4A 1YCFA 2W22A 3PK0A 3W8EA 4A0HA 5GX5A 1YE8A 1LBSA 2JI8A 3EFOA 3OU6A 5D3MB 2O4UX 3GJZA 3K53A 1SGWA 4JLAA 4ME6A 3UFXA 3IR5A 3NYRA 3SYNA 5EIHA 1LTHR 1U2DA 4GGMX 2RK3A 2ZS8A 5G0SA 2I80A 4WNIA 3RRNA 4L8VA 3TG2A 1LDMA 6REQA 4U8HA 3N3AC 4PY2A 2O0JA 3JU3A 2W5NA 1T8SA 3OQHA 4ZAFA 3O31A 1F4VA 1E58A 2JIBA 1XJWA 2H4HA 3W5HA 4M7PA 1EG2A 4FB5A 1WOMA 2WJPA 3O1HB 3PLNA 3P52A 1ZJZA 2H1RA 4BMVA 3SQWA 2DETA 4CEIB 2CLCX 2QW0X 3VZRA 1J2TA 1HDEA 3GBVA 5TRTA 5C37A 4V2UA 2QN8A 4C87A 3OJ0A 4ROTA 4Z0TA 4AZ3B 1O2DA 2OD9A 1MB9A 2JLVA 3SC2A 1A4QA 4W6QA 1MS4A 1AKUA 4FFBB 4GDJA 4IVNA 1VPEA 3M6FA 2H85A 3MYYA 1SZJG 1KU0A 3SR0A 2QJTA 1FK8A 4BKRA 2I3DA 2YV1A 1M83A 3COVA 1QO0D 9MHTA 2NO6A 1M6HA 2WQ7A 1DJOA 1P4JA 1RRKA 4Q7JB 1IOZA 2XNDD 4HYTA 1ESZA 1YA6A 5KYKA 3D6HA 5UKDA 1P0MA 4UTPA 4UM7A 4A5SA 5IX8A 1ZLXA 3VDMA 5KYGA 5T8KC 2HR1A 1ZA2A 5ELXA 2VP0A 3I9KA 3Q7RA 4HP8A 1GA4A 3NI2A 3OEHD 2BM8A 2YR0A 3DDCA 4ZCQA 5AVTA 2CVZA 4YECA 1VMAA 1WUTA 3AFGA 3H9QA 3HEMA 5B30A 1XBTA 3LX6A 3SKYA 2BCGY 2V45A 3PI7A 2C2WA 1JG2A 3Q6PA 1T4CB 1UBOS 2A59A 3E15A 3K5HA 3Q2KA 4G63A 1UZNA 2PXHA 3B8EA 1E32A 4FBLA 2HV8A 4KAXA 4XGKA 3RFTA 1IBCA 2IASA 4HWGA 1OXSC 5C1IA 4Y2PA 1U3VA 2MYNA 1BH2A 4DXHA 1T0JB 4UU0A 3TKLA 3KV3O 1E2HA 2JIZD 4CUKA 2ONJA 2BVNA 3H9UA 1Z7GA 4OQFA 1AO0A 1ST3A 3F9CA 1DBVO 2I65A 2FQ1A 4B7AA 4D80A 1M0TA 1V26A 3PF8A 4KSCA 4EI9A 3U44A 4O2BA 1A9ZA 3M5DA 3DA8A 1T2UA 5EESA 4BP3A 2ZIAA 1CZRA 1F2UB 1RYHA 5E95A 3U44B 1DIGA 4M98A 4X62B 3BAFA 2X9VA 2PJRA 1AH2A 1Z5NA 2RHHA 3IAHA 1E4OA 2RGBA 2VOEA 1WEKA 4Z9BA 4ENPA 2Q3LA 4TYYA 3UCEA 4RMNA 3G8AA 4JUDX 5EO7A 2QRQA 1PR2A 1RW4A 1S2LA 1ML3A 4LJAA 4LI3X 4N8EA 2VCHA 1JTFA 4M9SA 3RAGA 3WKBA 4JI7B 2YQ4A 2WYHA 4OYLA 1KPIA 1NCDN 1Q20A 2O3RA 5AI8A 4YYZA 5IMSA 4EVIA 1L7FA 2HH9A 2P5UA 3I01A 3MB8A 1N1DA 1P9WA 3L41A 5T67A 3E9ZA 4YMVA 3SE7A 3ONDA 2ATEA 1YONA 1YUMA 3G59A 3DAGA 4XUEA 1SVWA 1WQ1R 2Q3EA 3PPYA 2DUWA 3RC7A 2GESA 3JW8A 4ENUA 2EIHA 3PUYA 3TD2A 3DDNA 1Q50A 2YHBA 4C0SA 1X38A 2P35A 2E3JA 3PJQA 2P4EA 4GRIA 4OQQA 3USZA 2G07A 4P3YA 4QM7A 1QZTA 1OD6A 1XMXA 3QF4B 3EUEA 4Q9HA 1SOMA 3SX2A 4O2AB 1XWFA 1VE6A 5KINB 1P31A 4LX0A 1CQIB 3F7TA 3WL3A 1T2AA 1YTLA 5JS2A 1KH1A 1LVGA 4X95A 2W98A 2QW1A 3VAYA 2X76A 3FUCA 1KAHA 3G2QA 1WNFA 2H1CA 3CLTC 721PA 2O8FB 2PRZA 5LOVB 2ZK7A 3JZDA 2TMGA 5EPEA 5DSXA 3ABRB 3K9WA 1APBA 1D7AA 1JAZA 1NF8A 3K9QO 3TEMA 5JNVA 1NXSA 4KNYA 4RJTA 3BFVA 3HI6A 3DE6X 1DV2A 4WECA 4YCJA 4PAQA 2ZZKA 5ECYA 1GTG1 1YCHA 2F1IA 2PYZA 3H6KA 3EJ6A 2HTYA 3PD0A 2VHEA 3ABZA 1N7JA 1IZZA 3IIJA 2IZ5A 5CBKA 5K8JB 2VYVA 1QHSA 2NO4A 3ZG6A 3G9QA 2LE0A 2JI4A 3AERB 5FF9A 1QM5A 1IVBA 1EVIA 4C21A 3KX2A 3B1YA 4XJAA 3O4VA 4N49A 2XSZD 4WVFA 1LVHA 5CD1A 3I58A 1RHQA 4HB3A 2IUTA 3KQOA 3GVCA 1J2JA 4BQNA 3L6VA 2FQQA 1O89A 2FZVA 2DCUA 2Y1KA 3EXHC 3LLCA 1JVBA 2H08A 4M7RA 4MLPA 1REQB 3F5MA 3LUFA 4Y1FA 5KYUA 4C0WA 1C1XA 4JVLA 4QJBA 4U63A 1GOTA 2Q7DA 1WULS 5LKRA 3FOFC 3U56A 3NIDB 1NSYA 4QOJA 1YO6A 2O59A 1V1MA 1EFRA 4EA7A 1BX1A 2OMKA 3G4HA 2P3SA 3TRHA 1ZVQA 3GCZA 3ZHVA 1XWWA 1ZI8A 2ORIA 2WWHA 4EH1A 3P2KA 3BMOB 3NHRA 4YJ3F 2GAOA 1KQPA 1SEVA 4MROA 1SXJE 1LJ8A 1F2TB 4GUAA 4EOGA 4MYCA 3E8XA 2BI8A 4QNMA 3R4VA 1U0GA 1NOJA 1O6BA 1VGQA 3OM1A 2YA6A 1E8DA 1A9RA 5TQ0B 3E7FA 3GZNA 4OVKA 4P7FA 1HR0B 1LI7A 1MIOA 4OM7A 3SYRA 1C7IA 3LP5A 1YKFA 2CXQA 2H9AA 3QIAA 2C1XA 3T5AA 3PIDA 3KR2A 1TZBA 1H0SA 2CVQA 2R25B 4IHJA 1K2VN 1GL9B 1KI7A 1OFVA 3GRVA 4GOOD 1WLYA 3GJRA 4JJFA 4NATA 4WBSA 3TUIC 4D9GA 2FGKA 5K6AA 3UAXA 2HSGA 2QTVA 2VSMA 1EWYA 2O9JA 4G1MB 1NYQA 3LCCA 3GD7A 4POOA 5KNBD 2IPAB 4H15A 4PEVA 3FZGA 2EZ4A 1KITA 1DMSA 1Z38A 3OP4A 4IOKA 2A6PA 5FNVF 3AJ8A 5C5CA 2Q3HA 4RIHA 1C7ZA 3B9BA 2FR0A 1Z4MA 4HJXA 3CKZA 4LY9A 1NN0A 2ZJ2A 2ZRBA 2GJKA 1L8QA 2LDXA 4BP8A 4D52C 3HKDB 2WD7B 4AQDA 3R8CA 4MV8A 4B7UA 2BE9A 5EEGA 3C7DB 1UK8A 3QWAA 4F97A 1XAJA 1TYCA 2XRYA 5JS8A 2MJLA 4FXPA 1OJLA 4UXIA 3RTGA 5I7FA 4P5DA 4CM9D 4ZDJA 4B84A 3TDMA 2AVDA 3BH7A 2R7MA 3L5KA 1L5GB 1KZ9A 2YXBA 5FH9A 4WJLA 5LIPA 1EZ4A 3F8TA 3LPCA 2EV9A 4OI0A 1E1QA 1CZOA 1PV1A 3GH3A 3OZDA 3FCSB 5KVAA 4OJNA 3MWEA 5DGCA 4YCAA 5JUWA 1NAHA 2VQSA 1CEQA 1ZH6A 2O3UA 1UM8A 1GT6A 4RH1A 5EQJB 4AUNA 1PV2A 2Y66A 1YIDA 1G42A 2COUA 4PE5B 2OVBA 4B7CA 4ZEVA 4KS1A 3PP8A 1FFXB 2GPAA 3CNEA 2OUIA 2ECFA 2XIQA 2YY7A 4JCOA 1E7RA 1NW6A 1QDUA 2HA3A 2YV2A 3ADOA 3JQ6A 1DMRA 1G66A 3GV0A 2GD1O 1SZPA 3BK1A 4FQ4A 4JYCA 4LJ7A 2EP8A 3FWPA 4G4JA 4PCUA 4FHCA 4LSZA 3LZCA 3HO1A 3K92A 3MWLA 1W4ZA 4JXKA 4MKGA 2I87A 3VKUA 1CRLA 4RH0A 1H85A 5CEJA 4C4TA 5AJZA 3N2KA 1B6SA 2PUHA 5JPCA 4BGVA 4M54A 3V1NA 5BN3B 1ESMA 3R7BA 4K1JA 2PH1A 2DJ5A 3UUFA 5IKXA 2GYYA 2MSNA 4H16A 2H51A 1SG6A 2PJDA 3FGOA 3DF9A 2PQ2A 1BVHA 2PD6A 2W00A 3DVLA 3N7AA 4P6VF 4WY8A 2GEDA 4RHYA 2ADOA 1Z4PX 5FOXA 2A5LA 2PXAA 3IO5A 4A82A 4HWKA 1UMDA 2OO7A 5EVJA 4NBWA 4BIIA 3OM8A 3V4LA 2B4QA 3LI3A 3G23A 3I2JA 4NBTA 3IEUA 4TSRA 5L6LB 2YJ6A 1HFKA 3ANTA 3SHOA 4KMSA 1C0LA 3GCWA 5F64A 4PGHA 4AM8A 1TTTA 1H94A 3F73A 2J9GA 3E9MA 5AKZA 1NQVA 2UYGA 1F8EA 2YZ2A 4DUYB 4UVHA 2EKQA 4FNMA 4YQEA 1BDBA 1S8NA 2B1IA 1TCBA 4DCCA 1EDEA 4QOSA 3SBEA 1XF1A 3SKXA 4RVFA 1AS3A 4HNVA 4MLDA 4GGPA 2PEYA 3MFQA 3MTDA 2GVWA 5DWVA 1ZD9A 2F1KA 3K72B 1WD7A 4X3CA 4F3NA 1WABA 1J5EB 1BE1A 4HK4A 4JU8A 2Q5OA 2BSQA 4BYMA 1NRJB 3DEIA 3L1VA 4JQZA 4X97A 4NBRA 2EZTA 2Z5LA 3BC1A 3NUQA 4WT7A 3W04A 3TS1A 2F4NA 1V1MB 2LBPA 3LUCA 1BWSA 2GM9A 3RKRA 1EK5A 1BSVA 2SICE 4LWPA 1ZFNA 2EJTA 3AY7A 3M1IA 2ACVA 3DLCA 4XLLA 1OZAA 5H4HA 3ZY2A 3L1KA 2EKZA 2FPKA 3EUAA 2I3BA 4I08A 1OILA 1XOGA 4HN9A 1OHHD 3EEFA 2YOGA 1QIJA 4AKEA 4BTVA 3PGVA 4ZOAA 3AR8A 2VDLB 1NJSA 1OQAA 1GYPA 2BSAA 2FJUA 2IYFA 2JGRA 2D3TA 4NABA 1IBKB 4KRFA 4JAVC 2FP3A 3LVFO 2FP9A 3MOIA 1YZFA 1E9SA 5TGTA 1QE3A 3OZVA 1C81A 2Q6TA 2WLSA 4J0KA 2PZMA 3HBFA 4HLDA 1UODA 1U8YA 4HDSB 3RF7A 3TMAA 1OROA 3TXYA 2QENA 3Q7PA 4IJQA 3K6JA 1JDPA 4FEGA 4CF5A 7ADHA 3K3AA 2V97A 3EK2A 4NOKA 4UDNA 2G9UA 2HHHB 2BFDA 1CJSA 2H5IA 4HBZA 2IITA 1IXYA 2Z95A 4F71A 2XR1A 3FTCA 1GUFA 3PSHA 5EO8A 1XRNA 3OQ1A 4R9NA 1OZGA 2AMYA 1HEUA 4IRMA 4O4HB 3WL7A 3KQNA 3GOHA 2GD6A 5TARA 1H8HD 3ABQB 2AEEA 1MS5A 2FPOA 3ESBA 3D6FA 4RELA 1PGNA 2YYAA 3HY3A 5FI3A 1RXIA 4AJ4A 5LJIA 3TFOA 3LUAA 4MQMA 2QTMA 3KAQA 4KBFA 3RRBA 2QSUA 2YUTA 1BWQA 3FCOA 5JY6A 2UYQA 3H19A 1MA3A 1W5AA 3GPCA 4WCDA 4BLSA 4EQ6A 1EA7A 2HBQA 4U3JA 3SIWA 1YI8A 2C95A 1XCMA 1Q92A 2CUZA 4YDHB 2GKGA 4TUYA 1IQRA 3GYGA 3IP7A 1ZI9A 3SOVA 2KMLA 2R8PA 4YAOA 3J7AC 3M4ZA 1OIXA 4X63A 1PEAA 3G8YA 1ZS9A 1HDYA 3OE7A 1A9PA 1FNBA 1NY5A 1RADA 2AVNA 2CK3A 3DD5A 1XEAA 2VZLA 4DV1B 4QXPA 4R2JA 2MSCB 1O5OA 4ZMRA 3B7EA 2J3MA 1FJGB 1S4QA 3E2IA 5KJCA 4HQKA 2VK1A 3IV7A 2VDNB 5DXAA 2IBSA 1INVA 1A71A 3SHWA 4EF6A 4LKOA 1RD4A 3R76A 2PNFA 1QJCA 2PL9A 3FJ1A 2XAUA 5GWXA 1YZ3A 4GYKA 2IPNA 3G3EA 1O94D 3PF9A 2AE2A 3NO4A 4ZIRA 3OIUA 2A9OA 1HWYA 3LHKA 4CFZA 4I9GA 2WSSA 4G4IA 2AFHB 2G36A 4JBGA 1BQEA 1FTSA 3PHBE 3EG9A 4QPZA 2ZT7A 3W9BA 1Z6ZA 3K70C 3LT0A 1QLJA 2NN3C 2Y1EA 4NU0A 2VK4A 1E1RA 1XAGA 3AR6A 3CG0A 1EVYA 1T4GA 5DI9A 4BGUA 1KYYA 3KJHA 4EY6A 4KWIA 3HFJA 2FSGA 3L82B 4F12A 5DHPA 4MICA 5BWBA 5BOSB 1KY4A 2C9DA 4ZO6A 4B82A 1E7YA 1Z73A 1MZ6A 4BVAA 4XFDA 2Y76A 5JD3A 4C7VA 1AQJA 4JL6A 3GHHA 3RSFA 4E15A 2DRIA 4BV8A 4Q18A 1R5BA 3KOZA 4LZAA 2DLNA 1JQKA 4XTRA 3DL0A 4P5EA 1VOTA 4Q3BA 1SBYA 4AGIA 3NETA 3PB3A 3ACCA 4WFQA 3KTAB 1C3VA 4ZEWA 5JASA 1T2NA 4ZVSA 1RLJA 3COZA 3A8TA 3V55A 1U5AA 3L9XA 2B37A 3AXSA 4YGXB 4HPXB 4NN9A 2A3NA 1UAYA 4N0PA 4ZCIA 4AJOA 1GNLA 3CFYA 1CZUA 1WNTA 2R751 3OQIB 1FQWA 3T4PA 1H6CA 4CL8A 1EVQA 3ZW9A 4Z2AA 4DCGA 2QTHA 1FNMA 4ZREA 2ST1A 1AHNA 3OQIA 1EUZA 2A5JA 2YRXA 4AZ3A 1LSSA 1DWUA 1RQ7A 1TZCA 3G2KA 3IQHX 5JROA 1YRLA 5DO9A 5AVKA 3HKCA 4YCMA 1ACJA 3PT5A 3QVMA 5DYGA 1YUBA 1P7CA 4XYBA 3DUFA 3G89A 2YINC 5KSPA 3N0TA 1DVRA 3RDPA 3AEKB 1TJYA 5CT6A 1ZGJA 5LBUA 3ZDYB 1TXGA 5IF9A 1TM2A 2IHJA 3IQGX 3TINA 3VR3D 2WJIA 2O1SA 1IL0A 2YWFA 4TV9F 5ESXA 2QBYA 1K0UA 2VDMB 4IFNX 2Z8YM 3QFTA 4HY3A 1S02A 3OM0A 4ZTUB 5LMNB 1R4AA 2XVZA 3QMVA 2NU8A 3BZUA 4EHLA 1MX3A 2ZETA 4KDRA 2DPGA 2R6CA 3C2QA 2IPXA 1VM6A 5BR8B 2ILTA 4L85A 1B15A 1C3LA 2K6GA 3SREA 3GVPA 4QUHA 1NURA 3JWIA 4QICA 5J58A 3DEFA 4ARVA 1N6PA 4G5GA 5EJ6A 5IFLA 1RQGA 1QIMA 4CKXA 1NG9A 1COZA 2XNDA 1I33A 1MR5A 3EXIA 3FYDA 1W8IA 5ILOA 3PNBA 1TAGA 1D8TA 2F1OA 3MWFA 3B7PA 1XNRB 3SZOA 2HJGA 2VAWA 2UZAA 3ADEA 3H5TA 4XVHA 3EXIB 4CPNA 1UJNA 1XEFA 1FUYB 4NMLA 5FT9A 3CEHA 3WGJA 4E0BA 5G1NA 3F5QA 4O4HA 5HE8A 2CNDA 2XE4A 2G1UA 3COWA 3DE0X 1PJXA 4M36A 5BNFA 3TLKA 2FWPA 1WB5A 3E9RA 3U9SA 3W1EA 3DKRA 3U39A 4DM7A 4OQLA 3KBBA 4H3HB 3NHLA 1H2BA 4IQKA 1ENPA 2PYIA 4YJFA 1AJEA 4LXIA 4K87A 2QXYA 4DJ5X 1MU0A 1CFZA 1TMYA 2NOAA 3C6QA 2GB4A 3HWWA 1LJLA 4G2NA 1GDHA 2GK7A 4UVEA 3BWCA 4F3YA 1NXTA 4ND2A 4P92A 3F6SA 5L7WA 5DYNA 3PENA 4UM9D 3RG8A 1VCMA 1EBBA 3CLTD 4MWTA 4QREA 4N48A 5GIPE 3EHDA 4JLOA 5CX1A 3G02A 4NK4A 4AW9A 1YVEI 4MWRA 2JL1A 2RKWA 5JS1A 1J0CA 5DHTA 3I9LA 4L1KA 5I3CA 2PLWA 2W38A 3NDRA 2RHMA 4YW5A 1FXWA 1ZGAA 2IYNA 3CGGA 2NACA 2FZ5A 4HWPA 3T5BA 3TQRA 4KN5A 3ER8A 1HX7A 1Q7TA 3JQ8A 4L4XA 4ZICA 1CR4A 4DLRA 4ALJA 4GXTA 3D2LA 1Z0SA 4MA5A 1OFHA 5CK5A 1SKMA 2JLWA 1SELA 3LUKA 1Q16A 4HR7A 4RTMA 4C7KA 1OCEA 5ITVA 5EP4A 3LO5A 1E2QA 3UJPA 4GYJA 1XCGB 1ND5A 1Y1SA 4A9AA 1JLLA 1KL7A 1MT3A 3S6JA 1GY8A 5KU1A 5AW9A 5LP6B 4PYRA 2AV6A 1LRLA 1ZD4A 2A58A 5JAUA 1EXWA 2BISA 4UFOA 2OV8A 3UMJA 4BU0A 1WXGA 1Z0FA 5E6UA 5J2TF 3A06A 3TM5A 4A8TA 4J1TC 2GOYA 1P3DA 1B1AA 2ANCA 2ZVDA 2D5IA 3JRWA 2V4ZA 3KO8A 4E1VA 4EELA 1NW3A 3O38A 3DUWA 4IMIB 4OGFA 4QULA 4WNAA 4BY9E 3G7UA 3KLOA 3NJ8A 3P2YA 3MS7A 1JHDA 1G5FA 4LBVA 3W9SA 1Q95A 2AW3A 3EEQA 1QFZA 2GTPA 3B5EA 3DBLB 3KC2A 4OL0A 1TU4A 4DXAA 1AV6A 4QX6A 2R4UA 2ZB4A 3NW9A 2DTEA 4BZPA 1GG2A 4NBVA 4QBTA 4FJ6A 4DLVA 2V91A 2IIBA 1UC4B 2QGFA 4ARZA 2HDHA 3FNHA 5BUZA 1X1QA 3X44A 4GG1A 3FB1A 2BYTA 1P91A 2JLYA 1WCXA 1XVUA 5BSGA 5J59A 4ZO7A 3LNTA 1K8ZB 1ZW6A 4WA7A 4K46A 3IOCA 5DU2A 3VSAA 1JJVA 1RXUA 1EGQA 1JJ7A 2HF2A 1ODSA 5NLLA 1YL6A 4S1PA 5H16A 5CHYA 1P61B 5BUCA 3OJWA 4MEAA 3B1WA 3TZQA 2O2CA 4AKIA 5CVVA 2BR3A 5JJKA 1RFGE 2XSZA 3JR7A 2QN2A 3KYCA 1IUBA 3E48A 5EWLA 5FWAA 4NZPA 1U6KA 3HYRA 3VUEA 4I14A 5E2IA 3U48A 1IEVA 1Q7EA 2HXYA 1P0QA 3OZXA 1B4DA 2NNWB 2ODQA 4G9EA 4MRMB 4G07A 1FL9A 1Z5GA 1JAYA 4X92A 4YRNA 1TO2E 4GWGA 4IKPA 4B6QA 3J80A 2B5OA 4Q01A 2PUDA 2X9GA 1NVKA 2J9FA 5AW6A 3GT7A 3T7KA 1XNJA 4GNRA 1SMKA 1G7TA 5K3FB 4U7DA 1B8UA 3HDYA 4MGHA 3TZKA 1USGA 4NMWA 3JATA 1DLIA 1T3LA 2GI4A 2LW7A 4W8GA 1ISPA 3U0BA 5KMGB 1XR3A 3TAXA 3VNBA 1D2MA 1OYWA 1Z3CA 2WDZA 5IJXA 3HCOA 3NWJA 2W11A 1L3BA 1RQRA 2W70A 1GNVA 1QHNA 3RFUA 4E5MA 5H47A 4MO2A 4S1NA 1ZQ9A 5T6BA 1RI5A 3AWDA 3U80A 4KI7A 4IHKA 5B2ZA 2PZLA 1E7WA 2NZ8A 4AS2A 1VE1A 4B6EA 4NF2A 1S2GA 2YJ4A 3WK4A 1PGPA 1Z5OA 1YOVB 2JVKA 4LHVA 1B8PA 3QXCA 3FCXA 1XDUA 2XYPA 3G0CA 3LIIA 1NMXA 1S89A 5F5LA 2FW9A 4I1YA 1NE7A 2WTMA 3NAQA 1E1CA 4IIUA 4RQBA 5H68A 3V33A 3VGJA 1DAGA 3EXG2 2VAVA 3SEZA 4P4SB 2AD5A 5HCIA 2ZU0C 3HXQA 1II8B 3VBEA 13PKA 1QG6A 1TW2A 1JBKA 4II2A 4OUDB 4W9NC 4F0JA 4H52A 4U0KA 1ECJA 1UKYA 1XTIA 4M1YA 2OXTA 2WYVA 3C4QA 3F67A 2ENUA 1AG9A 5GADl 2KM1A 4LJ8A 4EABA 4KLNA 1FP6A 2R1UA 2GEJA 2MYPA 1NJ6A 3NWOA 4K28A 1XZAA 4NH0A 3TCXB 3O8NA 5EJ9A 2NTVA 1VL5A 4LE0A 1TCAA 4XD7D 2C54A 2VJMA 1K6MA 1UPUA 4UZFA 5C51B 2I4OA 3DLIA 3JXEA 2D0IA 5IZCA 3O4JA 3GK3A 2AJLI 3WLPA 3H1PA 2BSXA 2WJGA 2VJMB 2XNHA 3JQBA 3M7IA 1UT6A 2FEOA 3MMSA 3KZXA 4MB0A 4ZAWA 5KYNA 2QWEA 3RC8A 4EA9A 3C3PA 1J6UA 2QQFA 3OFSA 2Q5FA 1FYXA 2A7QA 2VA9A 3AW8A 4TLAA 2ZVPX 3HE3A 4JOSA 1TVCA 4HQRA 5FADA 5JTUA 4D9CA 4XUCA 3PFNA 4TV9A 1FDRA 3P45A 3HXMA 3AV0B 4B33A 5LLSA 4GQBA 4B8ZA 4D98A 1IRIA 3II7A 2DAPA 4TTVA 5A3RA 3UN1A 2QRLA 3RODA 1EFUA 1SPXA 4XJSA 1U9IC 2SILA 4BX3A 3BH0A 4H27A 4M76B 3KV1A 3EGOA 2ZRHA 1UKCA 4F93B 5JCOC 3QU9A 4OJKA 1C4WA 3PEFA 1M0EA 3GAMA 3SJBA 4E14A 5F72C 1FTQA 4LYYA 3AFNA 1LZLA 1UC8A 3AI1A 3C98A 4OV6B 5B5SA 4X7PA 1AXEA 2IATA 2CJWA 2NZYA 1KI9A 4ZHQB 3P97A 1PHRA 2WQZA 1NW5A 4MIOA 4N5NA 5DNWA 1JH8A 2G9QA 4AN4A 2P67A 4GZTA 5C0OE 1KNQA 1W9HA 2H92A 3GLHE 3UOGA 4YRAA 5BPFA 2O8DB 2ONYA 2BD0A 4CM8A 2WU4A 1QH8A 2PKCA 4KQXA 4N8SA 4ARZB 1WWKA 2ZBEA 3OE5A 1SBIA 1THZA 1VL8A 2ENWA 3D4LA 4ZU1X 1ULHA 4UEKA 5EJGA 1LV8A 4RA9B 3D6UA 1BE8A 3NM6B 5I7AA 4NCIA 4NMHA 4BO0A 3QVGA 1JUDA 3O8DA 4M8LA 4N6OA 1B6TA 1MHPA 5AUPB 2HHLA 2MIIA 5ALWA 3STUA 1R1DA 4BEWA 3E3OA 2MSKA 3PR2B 1SVLA 4OCZA 1X2EA 1P1RA 4M0LA 2QZPA 1GKIA 3ADKA 1ZD8A 5FNSA 2W0MA 3I42A 2J3IA 4EITA 2WM9B 3M6WA 4I0WB 3BSYA 3H18A 1A8UA 5AKEA 3ABSB 3T7TA 4CDNA 4G0VA 1RC1A 2WVGA 1WZ2A 5DX0A 3MNFA 1M2KA 4WUVA 3D5EA 2Y1OA 5AR1A 3EE6A 1ZJ6A 2JKYA 1PK7A 1UJ4A 4ZOBA 3L84A 4ARAA 1ZM9A 3WWEA 3LHIA 2OPHA 1DQZA 2MYUA 4QYSA 2XHZA 1S2OA 3RC2A 2E2WA 5BSWA 2J9YB 3OJEA 3A9CA 3KAKA 5LFAA 1V37A 3B38A 4P53A 1HYGA 3IX7A 5KX5B 4QHTA 2HSJA 2A0WA 4C1YA 4AICA 1XD2A 1S0JA 3WGYA 3ECAA 1JIQA 3VXKA 3DCJA 4EFMA 2CF6A 2OYCA 1SNTA 1KAOA 2QQ0A 4EHKA 1ESNA 3IHTA 3MOSA 3AI3A 3S28A 1XTSA 3NDJA 4JP1A 4D9KA 3H1FA 4FYHA 4X93A 5ALUA 4ACBA 1RWVA 3GMSA 4RTPA 1DOAA 2ZBGA 4DEYA 3GUHA 2GNPA 5D7BA 5NULA 3HXKA 1I2CA 5ALKA 4I3GA 1PAUA 3KDSE 2QROA 4GUDA 4XGIA 4BMPB 1ZVVA 1IXSB 2GAIA 3QLVC 5A7FA 4FOQA 4YZ3A 4OI2A 3G8DA 2F90A 3UTDA 4DLNA 2GLUA 4EYGA 1G16A 1XZNA 3QSGA 3EZFA 5KNBA 3RYCA 1V11B 2E87A 2WHYA 2P4UA 3CINA 4TMTA 3SNKA 2EP7A 1OX4A 4BE7B 1JPNA 2KX7A 3CXUA 2FPWA 2XVMA 5KS2A 4ZPXA 4OEHA 4D3YA 3GN1A 1TZMA 4GEKA 4EK9A 2K87A 3DF7A 4FFDA 5I8ZA 3E1SA 2Q4OA 1EFRD 4DDHA 3D6JA 3HM2A 2M1XA 3HHEA 2IUYA 4JJ6A 1XA3A 2NQ8A 5IBQA 3VR0A 4B3IA 4FZ5A 3VR6A 4BQIA 3ZDBA 3ONFA 2Q49A 2PZJA 3NFRA 4YNBA 4US0R 2QWXA 3NYQA 4AO7A 2UYOA 3GJTA 4DY6A 1CZKA 4KACA 5K0JA 1E60A 3L7IA 4IH9A 5JZBA 4BQPA 3HLHA 1TK3A 5IEBA 3G2IA 2QQGA 1R4ZA 4CG3A 4QKQA 5IVPA 2WWRA 4KE9A 1Y3IA 2HHCA 4ED9A 1MIHA 1TVKA 3M1LA 1T8UA 2BFWA 1RU3A 5B1DA 4XMBA 1BJTA 5ICCA 3VNAA 5LA6F 4B7XA 4IFTA 4JP3A 3T9CA 5LXTA 1ZR2A 2DY1A 2KB0A 4Q1UA 3PQ4A 4NZMA 3QU5A 3QV2A 4IZOA 5B2DA 1G8HA 2P4HX 4Y6LA 3BREA 3DEKA 3TJZA 2OZLA 4I4TB 4A0QA 1DC3A 2HSWA 1UWKA 3PUHA 3IQIX 1GEGA 3FOCA 2B0JA 5ESDA 3RANA 3GX1A 1PNOA 3B20A 1PJBA 1EQUA 3GD5A 3KKPA 1W73A 4GICA 5EJ2A 4ZT6A 5B58T 3BH6A 4PPYA 2HYDA 1DV1A 3N3BC 3PPVA 2QWGA 3CZRA 5LP6A 2Z4RA 4R0NA 2DFVA 4PG7A 3SZLA 1G21E 2W8BB 2XE7A 1SB9A 2DTXA 1H8HA 5DX8A 4DNQA 2RH4A 1QHGA 2PG3A 3D3JA 3F8WA 4TTPA 1N6OA 1GAEO 2Y1XA 3T5DA 4A2PA 3IEKA 4RFVA 3ILSA 1H4SA 2BKLA 3LY5A 2NU9B 3WDSA 1ONBA 1PLJA 2J59A 2R8XA 4DMLA 3HH8A 3K32A 2R6ZA 4CCYA 3ENQA 3OZCA 4I5IA 4G67A 3UPTA 2OGTA 1NVUQ 5A3JA 2CZCA 4YEDA 5L3SA 4WFJA 1NVFA 2GN6A 4F5DA 2H2GA 4P4TA 3C6MA 1H1DA 1TEZA 2NVWA 1C7JA 3UC9A 2O3SA 2I6XA 4TLLB 1CUIA 4JFRA 2XOKD 3REGA 3PHCA 5K3EA 1WETA 2VHCA 3VJMA 1J9ZA 1H0KA 1K7FB 2PTHA 3IVCA 4BVLA 4MGYR 4CQMD 5KREA 2A0XA 2AXEA 4O2AF 5H8WA 2FN7A 1RZVA 3HXPA 3E18A 3KQVA 4P7KA 1U7DA 5KTTA 3UO8B 3CNNA 1N6NA 2AF4C 3R1IA 4BKPA 2R5NA 621PA 2REQA 3RYHA 3DMFA 2HD4A 1JZSA 1XJQA 2JH8A 2QAJA 2WKRA 4RWEA 5H3CA 4Y1RB 3WLIA 4J3NA 3OIYA 5IK2D 1NIJA 3DUFB 3GA0A 1VQ1A 3FUVA 1J90A 3KAPA 3V8QA 3IV6A 2OORA 3C8UA 3HO6A 3LU1A 2FJ0A 2GFQA 5EZYA 4GZ6A 4C7XA 2FP4A 1FPMA 5HZHA 2ONZA 5JECA 2GPJA 2VAXA 5DSZA 4CE6A 2CDCA 3KRTA 4FYXA 5D9CA 4UMEA 4WXHA 4DRYA 2Q0SA 3E82A 1ECCA 4P34A 4JITA 5JSZB 2L82A 2Y6VA 1SUIA 2ZIVB 3EEYA 4LV6A 5T6MA 1G21B 3DOFA 1DXYA 3RS4A 1H5NA 1YFKA 2C5BA 1OI3A 3S2FA 3B52X 4HDRB 3QSYA 4B35A 3S2GA 1JU9A 1E6EA 1EP9A 1Y1KE 1J5XA 5FI1B 3STYA 1CUEA 3KKEA 2I4LA 1F8XA 1Q17A 2YVUA 2X8WA 1MO3A 1IN8A 1RLTA 3PFCA 4F2DA 2AMJA 3H1AA 4D8UA 1NW7A 3C7KA 1MB0A 1PNRA 4C4XA 5GX4A 4U7JA 1WVGA 1YA8A 3PC6A 2RGAA 4J0IA 5CTJA 2QZSA 4I81A 4IYJA 1PT6A 2QRVA 4KKXB 1T2FA 4Z4GA 1E8UA 4RLQA 3R75A 5DYYA 4DLLA 4LNUB 4I8XA 1EEXB 4AMYA 1YB6A 2JKZA 4WI1A 5T4BA 4UKDA 3GQBA 5AW2A 4XGNA 1DJQA 1MUUA 1QHYA 3EQ6A 3SHVA 3UKOA 4DBZA 1XTJA 2WD9A 2NZUG 2QV7A 2CT8A 3NPAA 1EE2A 1II8A 2GHTA 1ZA1A 4H59A 2RARA 4YO8A 5FPHA 4LNHA 3C3XA 2FP8A 1GZ6A 2O0HA 1BRMA 4LF6B 2O8EA 3RS9A 1GPAA 3H1BA 1JR6A 3O1LA 1JXOA 4G5OA 4Z3DA 2Q2WA 4FHZA 2QAGC 4TYPA 3I0ZA 3A70A 2GCIA 4EJSB 2A35A 3HKEB 1QONA 3PV0A 1L7PA 3AF0A 1KE1A 1QZUA 1S0UA 2Q3MA 1WSAA 2ZYDA 3IAEA 2XCYA 3OLCX 5DSTA 5ADHA 1UDBA 3ZLBA 1Q15A 3QF7A 1VHLA 3QPAA 4HGOA 1NCAN 4LTMA 4B2IA 1KHHA 2WF7A 5JEEA 2ZB6A 1YL5A 2XGOA 4GE0A 4DABA 1NX9A 1TKCA 1XDBA 1ZIXA 4PG4A 4RV5A 1IBLB 3KCNA 4XPIA 3WJAA 4DLKA 5JMOA 2TS1A 3QFCA 4CT4B 4YAIA 1F9AA 4KMMA 2IU6A 1RYYA 1W0JA 4JA2A 4WADA 4HAZA 1DWOA 4OGLA 1CZHA 3VZDA 4CMKA 1GPDG 4QBFA 5FTKA 3SIXA 3MFYA 3HU1A 3O75A 5K6TA 5IM5A 1EBFA 3KE9A 2CNLA 3GLRA 5CXUA 4UBOA 5KQPA 1X3LA 4PVDA 1KC3A 8ABPA 3UXYA 3H6JA 1OFGA 1QYDA 1NVVQ 1E77A 3MM4A 4IQFA 1E1YA 4DJDC 4DQUA 1OWNA 2DKNA 3EGXB 4PC2A 4RENA 1BWRA 4ROSA 3DKPA 5J43A 2XZJA 1GFWA 2H5JA 2R1VA 3DTYA 2WG1A 3JVVA 4F9EA 4XIGS 5FUQA 1E59A 3VPXA 4H7IA 1OB2A 2WNIA 1XE3A 2JGMA 3WGZA 3GP5A 3OKPA 2G9VA 3D43A 1IUCA 1QF7A 3P5SA 3P2EA 2QTWB 2ZBQA 3MCWA 4K9KA 2P6UA 1CNFA 3D1VA 3ZV6A 6REQB 5JJ5A 1PUJA 1Y1QA 1TJPB 2GEKA 3GJSA 5T4HA 3STTA 1T9KA 4EGFA 4UE3S 1J2RA 2OM2A 4MS1A 1CDEA 4B3HA 1DQNA 1A1SA 4NCSA 1L4MA 2QWKA 3TKYA 1XRJA 3FVRA 1AGRA 2UUAB 1EUTA 2DEUA 4KBGA 3ZKAA 5LP6F 1XCBA 5CB0A 2JVIA 1S1DA 1ZRNA 4B6RA 3P19A 1NNUA 4BVFA 3HKBB 5LQUA 4CV3A 3M6MD 4H3KB 4NH4A 3U6KA 4YRLA 4P3OA 1TK9A 4D74A 2JEYA 4NHOA 4ZCSA 4IBOA 4QUJA 3WSWA 5LSAA 5JYBA 1PL8A 4V1CA 3WIBA 1XLUA 3W9YA 4J0GA 3WGVA 2JFXA 3KYCB 1P44A 2B5WA 1KETA 1HY3A 1L4EA 2H2UA 2O0LA 2WQ6A 1EYZA 2WJ4A 1ZWKA 4HNUA 5JLAA 3RRZA 1VLLA 3CEAA 2YUIA 1L6IA 4LWQA 1BFUA 2EFJA 2X1HA 5G4KA 4BRSA 5FTNA 2MSLA 4X6YA 3ZNNA 4E2FA 4MS4B 1V5FA 3SXUA 4ZI3A 3OO0A 1RVV1 1XB2A 2HU2A 3VSCA 5KQLA 4BV9A 3OZWA 4Y0NA 1ORTA 6Q21A 3KXLA 2VLBA 1ZUD1 2ID4A 1JBEA 1A7JA 1KK0A 2NXNA 5J1TB 1XZLA 1INLA 4ZI2A 5HTOA 3RJ5A 4HHQA 1RWBA 4R3NA 1NVDA 1KHTA 4KW7A 2X8AA 3I05A 2P30A 1RJFA 2HRDA 3TAUA 2MSWA 3ND8A 3NUZA 4HFMA 2ZRFA 2HN9A 3SNHA 1DI0A 2GPNA 4O2LA 3ZE9A 3N2NA 4ZVQA 5BWMA 1ZEMA 1C9NA 3ZDAA 2F8MA 3RU2A 4BWFB 2K4MA 5AW5A 4MW0A 2GPYA 4O0MA 5I9BA 2HRBA 5A3VA 6AT1A 1XTUA 2DPLA 2R4TA 1YZKA 4QLOA 1MP0A 1SIUA 3IAS6 4M0KA 5HJEA 3CO0S 3VU9A 3ITNA 2BM0A 2VK6A 3Q6TA 1EI9A 1PG2A 1ZM3A 2VBCA 3N2YA 3PI6A 2OL4A 1FU4A 4KQFA 2OGWA 2J5BA 1K68A 5JY1A 1G3RA 2HADA 4EPRA 4ZMBA 4WSOA 3KNZA 1B2LA 2OR3A 3ISTA 1ZOIA 1E18A 3OE7D 2VI5A 2COKA 5AK6A 1V1JA 4FFMA 4BDSA 1PVVA 3AH8A 1JIVA 4Z9XA 4AS1A 1DC7A 1FNNA 4MWWA 4KFCA 4CCWA 5DBOA 3RRXA 3A6LA 1PIWA 1AKWA 4JF7A 2VAQA 1PP4A 2OO5A 4OD0A 5T3UA 5ITSA 1O97D 4GX2A 3EPJA 1UIMA 3L4BA 3UFBA 5A9RA 4GNBA 3MMXA 2GCOB 4R05A 2UYCA 1T36B 1BU8A 1CJMA 1XZJA 4K5QA 4HAIA 2IELA 4PTZA 2NUTA 1D6MA 3DO8A 2YKGA 1I3KA 1UXKA 5G2OA 1E6LA 2G8SA 2FZEA 2R60A 3SP1A 1MC8A 2XMCA 4W9MC 4U02A 3CVVA 2QE7A 4R8SA 5IC5A 8OHMA 1EVEA 5DW0A 3U37A 3OHPA 2HF7A 4HAOA 4QO7A 4B3SB 3STXA 3L1UA 4M21A 5BQ5A 3WLAA 4GL4A 4FPXA 1F8FA 3K35A 3AG6A 1SQGA 2QM0A 3IB3A 4C2AA 1PZEA 2LIPA 3GJ8A 1H0HA 1RNLA 4FVTA 4PRKA 3QV1A 4MWQA 2E4UA 4Q1BA 1E89A 2JHAA 3A05A 4L6CA 1Q11A 1GGNA 1Z34A 1GG8A 2V5VA 5D5PA 2Q3JA 3WYNA 1XNHA 2V3VA 2CMLA 1ADYA 2FWIA 4PINA 4KUHA 3N2KB 1IK4A 5CBPA 3P96A 4FKZA 1KQOA 1C3JA 4DMKA 4OPMA 1PJZA 1GTL1 2QMYA 4WKCA 4NU8X 1NV9A 3KOXA 1P29A 1G7SA 2B8NA 1SOUA 5AI9A 2YMMA 2A92A 2BHSA 4PX3A 2C59A 3I8XA 3RABA 2VQ6A 3W6ZA 4DG6A 1PJAA 2BAGA 1I3MA 3HYNA 3SANA 2FETA 4Y98A 4EO9A 4HYEA 1UK6A 1XMPA 1PS9A 2W2PA 3WY9A 4NQZA 1LPBB 3AEXA 3EFOB 3EEOA 3KYDA 2IV2X 2QTLA 3DVQX 2Z57A 5D01A 4GN9A 4E6EA 2UXBB 2ZJZA 1X3SA 2QORA 4JYPA 1EURA 2HREA 4CR7A 5ARBA 3ANSA 4AZ0B 3NHJA 2SCUB 3A6ZA 5JIBA 3WHIA 1GTRA 2CDNA 3PFFA 4ENQA 4MJXA 1Z50A 3K0BA 5EFOA 4C0AC 5F3WB 4L7VA 3CNBA 3UPUA 1E66A 5T8KA 4B6OA 3P0JA 2XKKA 3H8VA 1JALA 1JWBB 5GM2A 8ADHA 1LI5A 3QHQA 3DHEA 3T1NA 4TUYF 2F1JA 1QU3A 1U0HC 2MINA 3BTSA 1GGMA 3GFVA 1HG0A 1Z18A 5D87A 3I23A 4JT4A 4MMYB 2WMNB 1V4VA 4ZI7F 4MDFA 2PJUA 4DSNA 5B2EA 2FPMA 4IPTA 3SY8A 4DHWA 4MQFA 5DEOA 2YWBA 2VW1A 3TLAA 3T5CA 4WY2A 4DQXA 1M7GA 1P9RA 1U11A 1NXQA 2P0YA 1QQBA 4RA6B 3UMCA 2NO9A 3KLMX 1JR3D 2F24A 1S18A 2VF7A 3HXTA 3HLIA 4G09A 3RK1A 1M72A 2NUAB 3TB4A 4CETA 4NARA 5JSZA 1NASA 1PW5A 2Q1XA 5ER9A 3A6EA 1NVXQ 2NUPA 3F6CA 3HDHA 3MJSA 2DFLA 1AUVA 5B3AA 4PYJA 4TT3D 2XBUA 5CM2Z 1PG0A 1SUSA 1DXQA 3C1OA 2QL7A 1GUYA 3ALXA 1N6KA 2REOA 3TO5A 1JR3E 2WVJA 4X41A 4NCBA 1Z0KA 3R44A 4J1TA 2E0IA 3LK7A 4I5EA 1AUQA 3MJDA 1IG3A 4LJ5A 1ONSA 3JAKA 4D2IA 1J1UA 5KVQA 3RU3A 4B0OA 2JIPA 2NVUB 3TIVA 1YDWA 2GBIA 3OH8A 1Q1ZA 3WZLA 3ISJA 5H5JA 5K0GA 2GF9A 2ZRAA 3PD7A 1QIDA 4CV1A 2NXCA 3C7CB 4F5WA 3WMEA 2H9IA 1KZ4A 4MVCA 2GJ9A 1TMKA 3ZNPA 3X2FA 1JI0A 1WBDA 2A5YB 4LZWA 2R1TA 3NIWA 2RHOA 3CZ9A 2BMAA 4LV8B 2I4RA 2OO3A 2YY6A 5ER6A 5P8WA 2HMUA 4G37A 2YMPA 1NZFA 2ZB8A 3PRKE 4MDHA 4MP6A 5KSYA 3PNMA 2CJPA 3QXJA 1Y1RA 2O05A 4XQGA 4L5JA 4UM5A 4IDPA 4DZTA 3RASA 4PNPA 5K8CA 3W8FA 1M5TA 1SB8A 1C0IA 3PXCX 1NWHA 2ID7A 3R74A 4XQCA 1DE0A 4Y6RA 1C1YA 3BORA 4IDAA 4K2AA 4K6MA 2YZMA 3RRJA 2A4KA 3SPXA 1X7WA 7GPBA 5K4GA 3SEFA 2HDWA 2JCSA 5E7QA 5IN5A 4H7HA 1L7AA 5E4TA 2IHTA 3PXBA 4CW7A 3GEGA 2EVWX 1CV2A 2IX9A 4OSPA 2YNMC 2XAAA 3EJWA 3H8WA 3LQQA 4OOEA 4QQRA 1RKXA 1W0KA 2MTBA 2ZDQA 1V0JA 3DMHA 4N9WA 3BD7A 5CURA 2C61A 5TIIA 3A4YA 3U1TA 4DV5B 2FHRA 1Z4OA 5JFOA 2VWHA 2OV2A 1LBIA 1WB6A 1JEEA 1CHNA 2A3RA 2HMAA 3BTVA 3CPEA 3JQEA 3MWGA 4ASUD 2I4TA 4DBLC 2XWBF 1DAEA 4NMMA 4DMMA 4IX1A 3IKJA 1QPBA 2P4OA 2QT9A 5EPUA 3RHTA 5KWJA 1OB5A 1MGPA 2HB6A 4C07A 4QUBA 1NP3A 1FSPA 4ZAXA 2PY6A 4AJ9A 3PUXA 1OYYA 2QTCA 5KHLB 4CQMA 3DBVO 1Y9ZA 2BFEB 4BVEA 4C1NA 2FY8A 3CUWA 3T3OA 4C3ZA 3NTXA 4PYKA 2F3PA 4TZKA 2ZXUA 1JQLB 1Z08A 3A26A 3B1JA 3QWHA 3N87A 1TX4B 4DSTA 3MRTA 2YDTA 3PDIB 5G1OA 3ZGCA 1YHYA 4EB3A 1Q1GA 1A04A 1AK2A 2VRCD 1GKUB 3JS5A 4JC5A 5C1DA 3KKOA 1RWXA 5DNAA 2XT0A 3ELDA 1YS1X 2VP2A 3AUYA 4F6RB 5MN6A 2GUWA 4QA9A 1KMCA 3BIJA 3DNPA 4S1OA 2QF7A 5HGXA 3U4AA 1R0SA 1X8JA 2Q5HA 2X8BA 4ZOEA 2D2IA 1K6JA 4CSDA 4KRGA 4XVQA 2ZXFA 2WTXA 2O2XA 1U94A 1BC5A 2NPIA 2QRHA 1PJQA 3CTMA 1KZ1A 1UFVA 2BBWA 5BY2A 1Y6FA 3W8DA 1WCIA 3D2CA 5J47A 1OXXK 2IY7A 3L4JA 5ETJA 5AM0A 1OKKD 2I03A 3KEQA 2DHRA 4JT8A 1Z45A 4O5TA 4C14A 5DHUA 4ZK2A 1YZTA 3DT9A 1N7GA 1GIAA 3TSWA 1GPNA 2E55A 4YCCA 1CUGA 1DUVG 3PYXA 4EW3A 2FWBA 3KPWA 3HJTA 1PNTA 1Y1LA 3N76A 4FPGA 2JZOA 3LPDA 3NFYA 1KRXA 2BGKA 1C1DB 1TDJA 2AOXA 4OXQA 1BD3A 1JKFA 4RACA 3T94A 2B99A 5LN1A 2AF3C 4LF9B 3Q3GE 3AF6A 5H59A 1HEIA 1MV8A 4ZAVA 2G8NA 3EAGA 1I7QB 2X5KO 4GF5A 2C4HA 2X9QA 3H87A 4BZQA 4MUKA 4LXTA 3WRVA 2Y05A 3ZCXA 3AVOA 1L1EA 4IGIA 1F06A 4ZT5A 4R2WA 4ESHA 4BS9A 4Z1MD 5K8TA 3CNOA 5E0OA 1EVKA 4BP1A 4HVCA 3OZAA 3BF8A 3S8MA 2PWZA 1OZHA 2YDYA 3WGTA 1YULA 4JQCA 3U7RA 3WLJA 1IM8A 1UP7A 3TQQA 4K1IA 1LBHA 4AJLA 2XJ4A 5FWWA 2CHQA 4RK6A 2VVTA 5KC9A 5K3CA 1DJLA 4BL5A 1P60A 1VL1A 2RH9B 3F6PA 3FVTA 5LQNA 1RKQA 3Q3VA 3FMIA 4GM1A 2IV3A 1XA0A 5TEVA 3H5RA 4BNMA 2A9QA 3WGHA 4EARA 1UMBB 5L4NA 5AM4A 1U9IA 4Z9FA 2W5OA 3QKWA 5GVRA 2B2NA 2HFKA 4JYZA 2FEXA 2FLUX 1F1JA 5J5CA 4MV3A 3WTBA 2B2CA 5F9TA 3I9NA 1QANA 2F9LA 4UHFA 1A7AA 1KTIA 1O95D 2IF2A 4HDSA 3W1VA 1Z4QA 1WMEA 1OLSB 1IVFA 5DNYB 2WM3A 4BLWA 2C9YA 2QNIA 2X9LA 1OVMA 3J81k 3AB3A 1PR6A 3GL9A 3H6GA 3KCQA 4NCJA 3RGGA 4B48A 1M2OA 2ZSBA 1P1IA 4NYJR 4XDGA 2H2DA 3QFFA 1M2FA 1A8QA 4B8YA 1NT2A 1RWNA 3LSYA 3PUWA 3H16A 1LBTA 1UIRA 4E30A 3EIXA 2WIBA 1N36B 4WKOA 3KB2A 3TGWA 4G3NA 5IC6A 1KPGA 3QQ5A 3I0MA 2JLBA 3B13B 3WQQA 5FA8A 1BXZA 1JKXA 1T4MA 3P2OA 4JBHA 4BB0A 2QSJA 1HC7A 1Z5VA 1RZRD 3HRPA 2PHZA 3BF7A 2LTAA 4RKYA 1RYZA 1Q3TA 3BRWA 3DXXA 2JHPA 4XRGA 1RJEA 1F0YA 3D2BA 1MRNA 1CERA 3PWKA 3T99A 2WBLC 3TLXA 3TZBA 4FS8A 1UFRA 1FFEA 4ZYZA 3JAWA 3GRKA 1G0NA 3D7NA 1J8QA 3OOJA 1N7IA 1IZ8A 1HQYE 3GEEA 3FWYA 3OX3A 3ZDQA 2WB4A 2VXBA 3CLUC 4PPFA 5IK2A 3JAWB 4FOPA 5JU6A 2HJHA 3FD8A 3U3RA 2QWCA 1G2PA 1P19A 2HOQA 1U2DC 3HG7A 4JJZA 3K1YA 5BO5A 1DQYA 4IWYA 3MC1A 1N9GA 4KPYA 5L3RA 3CVYA 1I7PA 1T6YA 3M5WA 4OFBA 3IE0A 3GLGA 1OXUA 2HJVA 1OBOA 3E3NA 3MG9A 3WKAA 4KS3A 2P5TB 4B32A 4PN3A 4V03A 1U4OA 2F9FA 4J1NA 4WKPA 2CNNA 4HWTA 4NESA 4FJ2A 4XM2A 3GDHA 4KTVE 1V25A 5K8VA 1UH5A 3OD1A 5DOVA 3D02A 3LLSA 1O58A 4X1KA 3IUEA 3A4NA 3I1YA 4FE7A 5T64A 3RUAA 5IWAB 4QATA 2Z5FA 1J2UA 2BFBA 3EQ8A 5GV7A 4B0PA 3GVLA 1R9GA 2E1RA 4MV7A 3ROEA 2DBZA 2W71A 3ZU3A 2OB1A 4AO8A 1HDGO 3QX9A 3PD1A 3NHSA 3IIMA 4M7OA 2X19A 4PZDA 2CYBA 4DZZA 5TMPA 3ELWA 3PZRA 4UREA 1K0FA 4XQEA 5JSKA 4LDNA 2D7CA 4HTFB 4KL8S 3BB4A 4F72A 1Z8FA 1W19A 821PA 3QLVA 1YB4A 3DXFA 1SJ9A 1L7GA 2JB9A 2VZ9A 3K5WA 2PH7A 5A5DA 4D97A 3RTEA 3A6PC 1BW9A 1N1MA 2I3ZA 2DH6A 1OAOC 3CRMA 4KAAA 1U28A 3IAXA 2E9SA 1BEUB 4IIJF 4RW0A 2G76A 5B2CA 4QDUA 5JT1A 3DLHA 2QPTA 4KX5A 1W93A 3RHSA 4IUCS 1OKKA 2ZPTX 4A73A 4M6WB 1O3YA 4CMIA 3GPDG 4XWOA 3EBPA 3SAJA 2OBMA 4D4MA 4S05A 1BDHA 1U9JA 1NJ5A 5SYAA 1A0OA 3TLZA 1Z4WA 3A1NA 1EK2A 3QVGB 3TIFA 3WL8A 1ZXXA 4E94A 2AGSA 4CLOA 2IOQA 2YZ7A 1GRVA 1AUPA 4Y2VA 5AUNB 1I3NA 4ZCLA 5L4LA 5EE5B 4Y2HA 5H82A 1Z6AA 2HDOA 1TK2A 4UZEA 1R50A 5DRYA 1BJRE 3TDKA 1PSWA 3SQXA 4IW3B 4PICA 2UUCB 1LK7A 1QYIA 1XKXA 2QLBA 3U13A 3ZGXA 4Q1VA 2C3OA 2Q9UA 4GR5A 2NZ2A 1R15A 3PYLA 5CNJA 3KOYA 4EQZA 1MAAA 3ADBA 4XD2A 3Q6KA 1BJIA 2PR2A 4ZVMA 5FPSA 1M6EX 1A4IA 4OOFA 4MWVA 4PSAA 1VHJA 2VOJA 4W7HA 3VR2D 1VFPA 3FE2A 5KVVA 1SK8A 1YMQA 3BK2A 1YZLA 2OBLA 3DVAB 5J3JA 3U2QA 3IOBA 2NUAA 4R7GA 3L8YA 5A3QA 2HQRA 3AKDA 4MZXA 1Z88A 4MSUA 1ZNQO 1SUWA 3WB9A 2ZS9A 4OQNA 1G9SA 1A2KC 2H1LA 4RESA 2H11A 5DNCA 1X7YB 1UOOA 3CUUA 3GUVA 3FX2A 3M6IA 4XM1A 4IG4A 3ZD8A 4RTNA 3ET5A 5D2CA 2Y2UA 5IKOA 1G5PA 1I2MA 1WXIA 3FMGA 3GB9A 1W35A 4P3XA 3AF4A 3FYTA 3UICA 5CPFA 1A5SB 2FWJA 2GAFA 2WOJA 1JTEA 3FKSA 3L0BA 2CLLB 5C1OA 3CT4A 3ZD6A 4ARIA 1OXMA 3KKLA 2BFDB 3CR8A 3IS3A 3UQYS 3VHXB 5I7UA 4PC3A 1ZK2A 1Z82A 1Q0TA 2ZB3A 3OPZA 3T3EA 2OC9A 1Z6GA 1CR6A 1O94A 1AN9A 2B6NA 5BSRA 2QWFA 3P94A 3HJHA 5K8IA 3K0CC 4UE6A 3WZMA 3VR4H 4QD3A 3KOMA 1E2LA 4B6PA 2QTTA 2VDWB 4U2KA 1F2UA 3RIGA 1BZYA 2HCFA 4R8MA 1H69A 2F67A 2IEDA 2A9RA 3WLKX 2XXAB 4PGAA 4U3JB 5KQGA 3AMVA 5IP5A 2ZZNA 1L4HA 1T10A 1A4GA 2OQIA 4LQCA 4Q3CA 3W90A 4KWEA 2XXAA 1IHPA 3OVMA 4MPDA 5HUGA 3OTGA 4X5OA 1B26A 3HFRA 4MUAA 1V0FA 3VC7A 1RRPA 4UU7A 3R41A 3MT8A 4BBZA 3HFGA 4E6PA 4M9QA 3V7NA 4YCNA 2XWQA 3AB7A 1D4FA 5LCXA 3M4XA 3OCJA 3EQ7A 4P3NA 2IIVA 2BFFA 3ZCPA 4DV4B 3B9PA 1H9BA 3H2IA 5CGQB 1ZRHA 1QUEA 4ZT3A 4Y6SA 4E51A 5F35A 2CD9A 3PXDA 4J91A 5LB2A 1LWOA 2BTQB 2YXPX 1OC2A 2G40A 1ARZA 3EASA 2VNJA 5K01A 1R4NA 2VDOB 1HSOA 4GB1A 4OHKA 2AMVA 3IFSA 3PQ6A 1CEEA 1E0AA 3BCRA 1UC5B 4TRNA 1MAHA 5A7GA 1NUSA 1C3XA 2Q1WA 3GMIA 4N40A 2P6NA 3L6RA 3TW0A 3GCDA 2OYSA 4LCJA 5MGBA 5FXMA 4RJJA 3JZMA 1RKVA 3L7YA 1J1ZA 2WIGA 5MN5A 2V98A 3BHIA 3FSJX 4PLCA 2J5RA 2VUHB 3UJBA 4KN9S 5CUQA 3SVTA 4BHTA 4K1KA 2HIHA 2JDID 4HGNA 3U9TA 1TMOA 1HRKA 1Z8DA 2H07A 2UZIR 4DIFA 4E13A 3FUXA 4GBMA 1SAYA 4R83A 3JYNA 3BMQB 1J49A 1FLAA 1N2ZA 1SC6A 3IAS1 1AZLA 4TTTS 3T12A 3ZHQA 3PGLA 3W2EA 5I7VA 1IJEA 1L4GA 5DCUA 3ND5A 3OPYI 3BTUA 3RTDA 4BP9A 1SHZA 1F5SA 5ITZB 2V7VA 4UASA 5C7OO 1XL1A 4G24A 5BMOA 2XNCA 4OMFG 4XX1A 1ENOA 1TUBA 1GSIA 3DDHA 3HP7A 3GLIB 4I66A 4KE8A 4Q3LA 1ECLA 4V38A 2YOFA 5KTNA 3FWHA 3B48A 3HMKA 1DDIA 2GTHA 1CSEE 1DIHA 3OX1A 3MXTA 4LDJA 1MMFB 1IN6A 1ZITA 3BERA 4G0NA 2QN9A 4RO0A 4JL8A 3WS7A 4F06A 4JXZA 4AY6A 3GLHA 3OU7A 4FCTA 4MPPA 1ZO8A 2FPIA 5EHZA 4EGSA 3JR3A 2Q0HA 2QLFA 1DAIA 2WUDA 4KXXA 4GRAA 1FFWA 2P9GA 4RTSA 4KFSA 2AJTA 4NE7A 4NPCA 1DOZA 4LXXA 5EP2A 3WNCA 1ID8A 2EQ5A 4XILA 2WA2A 1NATA 1O8BA 2W2LA 4XR9A 3KVOA 3V32A 3HPQA 3U0SA 1ZNZA 3GRPA 5KDDA 5DGIA 4R9RA 1YJ8A 5EXSA 1WTAA 1NR5A 2KS6A 4DA9A 3I8SA 4I1OA 4C04A 2OV1A 2R6FA 2NTNA 2N1BA 4CKEB 4YC7A 3IPLA 3UCXA 4DNXA 5ICSA 1MPXA 3K1TA 4WD3A 4NBLA 3L7CA 5HMLA 4HAYA 3VR2A 4QC2A 4R1OA 4D4HA 4ER7A 2A2ZA 2BL4A 3LLUA 4Q66C 4QDXA 1E8MA 3MPOA 1VTKA 4EHJA 3AF2A 5JVDF 2H9YA 3HO8A 5EUCA 3KQUA 1DCKA 2J45A 3CPJB 4MJ3A 1V04A 3AJ9A 5EJAA 4PWZA 3E5RA 3O6VA 4I8IA 1ITZA 1LNQA 4TS4A 4ZQIA 3F3KA 3AUXA 1QQ6A 1BQ3A 4EW2A 3PDUA 2H1WA 5LUAA 3HNPA 2RMKA 4LZOA 1L5HA 5CT4A 1Y37A 2E49A 3DLPX 4YZ1A 2CLSA 3O4RA 3IQWA 3PDWA 3RVOA 3V7FA 4MR7B 3G88A 3R09A 5JXGA 2PUFA 4DCSA 3O7MA 1LKZA 4WCFA 4DLBA 1CQZA 4CRWB 4CODB 1FW8A 1O6CA 3DZKA 3JQDA 3OA2A 4RPGA 5K0TA 5ENVA 2ZYAA 3AUAA 4PX9A 3RGWS 5L53A 4HQLA 2O0MA 3O82A 4UAUA 5MF6A 2H2NA 1JG3A 1K5PA 4G0WA 1NMQA 3LUBA 1GAQA 4ITUA 8GPBA 3EW9A 1L8XA 5H3HA 4ZJUA 3TTWA 1XZKA 4LYDA 1SOAA 2GPSA 5A03A 3STVA 4NK5A 3U3OA 2HT5A 3SLIA 2OOKA 4BN4A 3UXMA 5ILGA 1XAHA 1FX1A 2FVXA 1TJNA 3ZHZA 1WW3A 4PWYA 4XAQA 2RIPA 3UZUA 4U2FA 1Z36A 1QX3A 2ALJA 4EATA 3IOEA 4YZ5A 1OV6A 4RF2A 2Q4DA 4UM9B 2D1RA 2VYQA 4HB2A 1VYTA 4OA5A 4N39A 4Q0MA 3DDUA 5B57C 3DOHA 5KMGA 1PEKE 1QGOA 2GARA 1RQLA 2LUOA 4BVBA 3W2HA 1CYEA 5FBZA 4B8WA 4HH4A 3M4NA 4TM7A 1MS3A 2OHVA 3CN7A 2PL5A 4TV9B 3KEOA 5F5NA 1S2MA 3TXXA 1YNOA 2PGLA 1J23A 2NUBA 3L0OA 3D0QA 2BM1A 1OPRA 4NYMR 1JAXA 5GONB 5HYVA 1A14N 5JRDS 3T52A 1JAHA 1H2XA 2JATA 2ZSEA 3R7WB 1AK1A 2AUTA 3HPRA 4L73A 2UU9B 4AKGA 3G2NA 5L3QB 3KUUA 2SKDA 3N70A 5J4VA 1DO0A 1VKNA 3OP1A 4OAPA 4JB2A 2Y8EA 2HLDA 3O3CA 4L0QA 3OJOA 1FLVA 3W3AH 5FWNA 4LYFA 3BZBA 3I28A 4FGKA 1NWCA 4E1BA 2PRJA 3WGUA 1F8BA 4I3HA 2R6AA 3W8NA 2VXOA 1ZY2A 4PPQA 1H42A 3PVSA 1Y3DE 5L45A 3UC1A 1MABB 2V1XA 5AW3A 4ZHQA 2NLOA 4M8SA 5TPWB 1QO9A 2PSDA 2OB2A 4GP6A 4LVUA 1QFXA 5HDQA 1F6WA 3A7DA 3BICA 3JQAA 4QGSA 2A1UB 3ELYA 5IUJC 1CRQA 1U0SY 2BOVA 1HE3A 5F23A 4FMPA 4JSYA 4MPTA 4R2KA 1Z4YA 3V1MA 4CGYA 4DARA 5HKOA 2ZJYA 2V58A 2XE8A 1YZHA 3BFPA 1SCQA 2HGSA 3Q0EA 5EHXA 1P62B 2ECKA 4RA9A 3RRMA 1MDFA 1YS2X 2E1PA 4RVDA 3VNQA 4G5HA 4WN3A 2ODTX 3VPCA 3WQRA 4B3GA 2ZSFA 4A92A 2O54A 2ZUWA 4LQLA 1RHJA 4I55F 4LYHA 2G08A 3EXFA 3GLHB 3W8RA 4XE9A 5JC1A 3PFKA 1RM0A 1TM3E 2I22A 3F1LA 2RSLA 3ESDA 2PPVA 2HQBA 2TRSB 9ATCA 4DLYA 1G7CA 2FF5A 1IQ0A 3AXTA 2LKDA 1CRPA 1EFPA 2BEUB 2C99A 3D8RA 1EHIA 3LLMA 4XGRA 1SO8A 4GWKA 2V0NA 3ZS8A 3AFMA 3THYB 5TNXA 4ZVTA 4MNTA 5F5XA 1JFSA 4ZT7A 2RK4A 3W06A 3BL5A 5B2FA 1WMBA 3CB2A 4QTZA 5LL6P 4K6OA 3JSXA 3E9EA </