2HQSA

Crystal structure of tolb/pal complex
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
412
Chain Sequence
VRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYLHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein tolB
publication title Molecular mimicry enables competitive recruitment by a natively disordered protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/lipoprotein
total genus 109
structure length 412
sequence length 414
chains with identical sequence B, D, F
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04052 TolB_N TolB amino-terminal domain
A PF07676 PD40 WD40-like Beta Propeller Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 2hqsA02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 2hqsA01
4IYGA 1Q7FA 1N7DA 2GVWA 1C5KA 4IMBA 4GN7A 3O4PA 3WWAA 1NPEA 1QLGA 2DSOA 2IATA 3LI3A 3G4HA 2ISMA 2GVVA 4O5TA 3S2KA 5GTQA 4GNCA 2FP9A 2IVZA 5GX4A 2W8BB 3P5BL 1QBIA 3AMRA 3LI4A 2VAQA 2FPCA 2IAQA 4A0PA 2V91A 1CVMA 3DASA 2G8SA 2GVXA 3V65B 2IARA 3LI5A 5GX1A 1C9UA 4HW6A 1IJQA 3AMSA 2GHSA 4ZLRA 3HLHA 4GNBA 1POOA 3A9HA 2IAWA 2IAPA 3KGGA 3V1SA 2POOA 3SOQA 4DG6A 2P4OA 3S8ZA 1E1AA 3TC9A 3U0SA 2FPBA 1CRUA 4Q1UA 1V04A 3V64C 5D9DA 3Q6KA 3SRGA 5D9CA 3Q6PA 2IAOA 2W8BA 1H6LA 2HQSA 3FVZA 4JMLA 4PWZA 3WW9A 2QE8A 3Q6TA 5EX7A 2IASA 1CRZA 3FW0A 1PJXA 4R40A 2DG0A 2FP8A 3G4EA 4HHQA 3S94A 4GN8A 5GX3A 3I1CA 3A9GA 1CQ1A 2IAVA 3E5ZA 4GNAA 3BYCA 5GX2A 5D9BA 3IAXA 3HRPA 2OJHA 4GN9A 1RWLA 2DG1A 2IAUA 3DR2A 3KYAA 4HHOA 4O5SA 3HLIA 3S8VA 2IAXA 2GVUA 5GX5A 3SREA 3SOVA 3SOBB 5FWWA 1RWIA
chains in the Genus database with same CATH superfamily
3NOVA 4CF3A 5JZMA 3BFPA 2C4HA 5FOTA 1ZLXA 1E1YA 4TLCA 3F1LA 2ZS9A 1Y3BE 4BLVA 4Z1OA 4IKEA 5HM6A 2BEWB 2DSOA 2O2JA 2IATA 2VYFA 1NQXA 3KRTA 3MT8A 3PGKA 4LOLA 2TMGA 3JQPA 3PRYA 3KM0A 1BRTA 4QYIA 4XVQA 5F4ZA 3RUFA 3C6ZA 4LJKA 3S4YA 1IMOA 1DKUA 3VOSA 1JSZA 2MDTA 3IMEA 3WYFA 1JWAB 4GNCA 3ZGYA 3DBLB 2O0JA 3QVGB 3DLCA 3SPXA 1BQ4A 1FNCA 2DBRA 2HNAA 1A71A 1VHJA 2Y1KA 4OLFA 4RNCA 5AKYA 5AI0A 5JNWA 3VM6A 3LX4A 4BE9A 1QP4A 2Z83A 4LTMA 3HB0A 2YHBA 1HXHA 1PGOA 1SD5A 3DT6A 3HCCA 4RWEA 4TZKA 2YVLA 1OAKA 2GJSA 1DFIA 2IBSA 1S8OA 3KX2A 4KWTA 1ZI0A 5JSFA 5IAOA 4JVNA 4JL8A 3PCTA 2XZJA 1QYDA 1Y5MA 4KPUB 4CTJA 1G8KA 1N9ZA 2V7VA 3TB6A 3SIPA 2P78A 3MG9A 4LIPD 1IZZA 5DFAA 3RKSA 3URMA 3ZWWA 2CUKA 3SF8A 2GDZA 3GIDA 2HZ7A 2EG9A 4H60A 4YHBA 5EJGA 3WGNA 1RP1A 5BRJA 5HPYB 3I34X 1EESA 4P08A 3A1VA 1JQJC 1UWCA 3D8HA 1GP2A 1OWMA 1XVAA 4RVDA 1QTNA 4IEFB 4BY9E 3BXPA 5LXTA 1C9MA 1YGPA 3AL0C 1FDTA 3ORRA 1C14A 4TRRA 4ASCA 1Y9AA 1CCWA 1SA0A 2R68A 1Y9ZA 3OZ7A 1CVIA 4TS9A 2IAWA 5EHIA 1BVHA 2HN9A 4H7IA 4NE2A 4MUAA 4DZTA 4M6WA 3LX5A 3ALWA 6YASA 2VWGA 1S5PA 2OHJA 4HYTA 3SDBA 1AVTA 2RH8A 3FI0A 2YJ3A 3QELA 2YDPA 4D56A 4DKXA 5HQ3A 4MVXA 3CW2A 6PFKA 4KXFB 5TB5A 4PAWA 1ESCA 1D4OA 2VQFB 5T6BA 2V9CA 1HZJA 1XZMA 3FYSA 3WO0A 1HQDA 1MAHA 2ZSUA 4P54A 3RVJA 3VJKA 4F2PA 3V64C 3DV9A 4IR7A 1L4FA 1VKOA 1OASA 1I3CA 4Y7DA 3AIKA 3CKMA 3VR3D 3RFVA 3WNBA 2ERYA 3JWIA 1HUQA 4MCAA 5D9CA 3B51X 3BG5A 3FPHA 3M33A 4NBWA 5B2DA 2IAOA 2QYTA 2N0SA 3L8HA 1LD3A 3Q4GA 2VNSA 3W05A 1U9YA 1ZS9A 4OO3A 1NRIA 4DA9A 3LLMA 3LY7A 2B0JA 1RXEA 4M9UA 3AJ8A 4IH9A 4JOCA 3ITDA 4MA4A 3N74A 4XSVA 6LDHA 1XROA 2OAEA 3ROGA 4WFIA 3VR0A 2X13A 2ZYAA 1KS2A 4LNAA 1PN3A 3LL4A 3MWKA 3QVXA 3SC6A 5IUJC 1MEEA 1X6VA 2V7QA 3GRKA 4XWGA 3ZBPA 4GZTA 3INTA 1VPTA 3PJFA 3PT9A 1S7GA 2GK7A 3FTCA 4GRDA 1R37A 2IEDA 2O5RA 2WU0A 1E2JA 2XUJA 4FGWA 1S2DA 1OX4A 4IQ4A 1KBZA 1E1QD 4LJYA 5GJCA 3K0BA 4OHXA 3MBOA 4NONA 4C87A 2PRJA 2XHZA 4H18A 4EP1A 3E5HA 3HRPA 3ZV7A 2P2GA 3QG1A 1TW3A 5ITWA 4QASA 1U63A 2CC2A 5DM4A 5G53C 1HK7A 4TROA 4V1CB 2CSXA 3L4BA 2ZR0A 1ZI8A 4PZEA 4RA6B 1DRUA 3FGZA 1NUPA 1PWXA 1ZVQA 1W36B 3COZA 3LDAA 2K2WA 4U2DA 3UFXB 3H5WA 1KFEB 3AFMA 4A8TA 3AF6A 4UHKA 3RUDA 1SUUA 2ZJ3A 1G2PA 1N25A 1USWA 1USXA 3KJNA 5JALA 4GN7A 3IJRA 2PUDA 2XBLA 1Z2DA 1IWOA 2A0XA 3BFXA 3DO8A 1TD1A 2GN1A 4DDVA 1CY8A 1UBHS 5KX5B 2W2MA 3IVXA 4TWAA 5GTQA 4YRFA 2QM0A 1NTOA 5EIWA 2HJVA 3OA0A 4DJAA 5BR7A 5FNVB 1RKUA 1X3LA 3DG9A 4X85A 1HO3A 4B5KA 2IHNA 1ICIA 3STWA 1ZHHA 4KDRA 4QYWA 4ZQBA 5A71A 2GTIA 2QUZA 2C42A 2AZMA 2XIQA 3ZY2A 2QGZA 4OY3A 2B34A 2C5EA 3P4YA 4G1FA 4OJNA 1OA0A 2FK8A 1KPGA 1ZUWA 3DZJA 2BHNA 2XB2A 3KQMA 1BW9B 1UIMA 2YWFA 1F8GA 3H9BA 2XR1A 4Q39A 3NHMA 5GONB 4NR0A 5FEMA 3V8MA 3TINA 1JHMA 2OCGA 1C3OA 1P72A 3A4IA 2E4XA 1YS7A 3H0CA 1U1IA 1O7JA 1VKNA 4PQEA 3ZCQA 1HY3A 2OGWA 3AMSA 3ZUPA 3NKVA 2G76A 5ER6A 4JEHA 3U17A 5A04A 4G0ZA 2O2GA 1QXSA 4LNUB 4F3NA 4YRGA 3TXAA 3BICA 1XMSA 3R44A 2C5BA 2VT6A 1XZEA 1M0WA 4B6PA 3DE3X 4NSNA 4WXPA 3PUKA 3U61B 1NMZA 3GMSA 2BM9A 2HA6A 4IHAA 1CFJA 2YYAA 3E3LA 5IT4A 1XNQB 3EEQA 1C1DA 1KU0A 2IOHA 4IVNA 2B0CA 3TC9A 2C03A 2J9YB 4F3RA 3C7CB 1T5DX 3MHTA 3PDHA 4HKTA 3JATB 1ZPDA 3IELA 4GOKA 4RVUA 4XLZA 5EZ6B 5JIBA 4D9HA 2PGDA 1OH5A 2XH8A 1EX1A 1EVEA 4NCBA 3LA8A 3V1YA 3OEEA 1E18A 4M0FA 1EAYA 4W1SA 4C0XA 1ZIDA 1XWIA 3FR8A 1G9SA 1THGA 2X9QA 3ZWMA 3AVYA 1Z17A 5IYZA 1KI2A 3BAFA 4YYZA 3QU2A 2C0QA 1EZZA 1WNFA 5ITVA 3B6ZA 4MEAA 5TF4A 3NYRA 4FVKA 2JLBA 2WTMA 1HX7A 1UZLA 2D1TA 2H5IA 2WU8A 2ZBEA 3O4JA 1WLSA 1SCBA 2I71A 3FAZA 2I9KA 4RK0A 4PQFA 2PA0A 4C4XA 4D8VA 3FCXA 4CLOB 1CRPA 3I2YX 2FWPA 3KDSE 4X54A 2X86A 3ANYB 4FOPA 5J58A 2EGUA 4TZTA 4CR6A 2VPQA 3CUVA 3PC6A 1L7PA 3SHWA 3ZHBA 1LW6E 4PLVA 4YACA 5BW6B 2OBMA 3GXBA 2W2NA 3ME5A 4UM9D 3LT5A 1KK0A 5FI1B 3Q9LA 4X49A 1P75A 1JDNA 1Z33A 2O57A 1D6JA 2ZVPX 4AX4A 3FYTA 4N5IX 4O08A 3TSAA 5JVDB 1NSYA 4JB8A 5B2EA 2DG1A 2C3OA 2GBGA 3GR6A 3EDRA 3HYCA 4G0OA 3RK4A 4D4HA 5K9ZA 4IVQA 4RD1A 4PLHA 4GRIA 3U5ZB 2V74B 2HSJA 2C9CA 4DQDA 4R3UC 3U7FB 3TEMA 5ERGB 3NT2A 3SREA 3O82A 4G0QA 3RRJA 5D84A 3KYJB 2FCRA 2BL4A 3MSCA 3U7QA 4HS4A 3FHOA 4AMUA 5HS4A 4GLJA 1QG4A 1M10A 3BWCA 3UK2A 4B3MB 3NAQA 1OD6A 1KOFA 2F4NA 5EOVA 2IHZA 2Y76A 3WHIA 1SQ6A 3ICWA 3QPAA 3E9RA 4EVSA 3JAWB 2VYVA 5L4LA 4OHPA 1I24A 1I2DA 3MM4A 3ABQB 3QLUA 4KTTE 3IT3A 2F3TA 1DKNA 4G5SA 5AP9A 4PYOA 1X87A 3EXIB 4AAYA 2P79A 2Y27A 5EKSA 4OJTA 4B3IA 3JAMA 1PJ2A 2A9JA 4P0TA 2P77A 4XIIA 1L5SA 4NATA 1MUUA 4TTIA 1JAYA 4MWTA 3HRIA 2B5OA 4PO9A 2CNLA 1I6MA 5GZ6A 1P74A 3W6ZA 2DWCA 3GL9A 4ZOQI 3A1SA 4CPOA 2BFFA 4NU0A 1CVMA 2A0YA 3EULA 4UKDA 5FCDA 2EQ5A 3R3WA 2GO7A 1UC8A 1FYFA 1YQWA 3IV6A 4TXNA 1JLLB 3TJZA 1TU0A 2OYCA 5K4GA 2DWQA 2HSEA 3HR8A 5TGZA 2CLIB 1NC1A 3RRXA 4ZK6A 2J3JA 1O8BA 4JLAA 4R3WA 2AV6A 3B3QA 3JVVA 5K8LA 4DSOA 3P94A 2H31A 3O26A 4L4SA 4M99A 4R81A 1YL7A 4XVUA 1WZUA 3FLAA 3BUSA 2ZT6A 2B7LA 4BRSA 2GCGA 4DAOA 4Y9DA 4AJOA 2MYNA 5ALLA 1P5ZB 4NULA 1KOJA 1C2YA 4TQUS 2RHDA 3P9IA 2WU3A 4E07A 2QTWB 1CTQA 2IODA 2AKYA 4ARSA 1U2DA 2ZUSA 1KR2A 1A4XA 3H0KA 1RHKA 5LMUB 1VJRA 3DR5A 3CH4B 3OM9A 2QWFA 4R69A 3A6FA 1CY0A 3GGOA 4JBHA 4I1YA 3F6RA 2HA3A 3G79A 5SY6A 2N9UA 4I9HA 4PN3A 1U65A 2I2XB 3NHFA 5JJ5A 2CSUA 3MTQA 1IQPA 1WG8A 4QYIB 2WVAA 4AP5A 3K39A 4MWYA 1YB2A 4GJTA 3CJTA 3W8DA 5KMGA 3LY9A 2P7HA 3Q5DA 1FDUA 3E2PA 1O0CA 4NBVA 4DABA 2GJ4A 1ZFNA 3LA6A 3UY4A 1IUNA 4H0FA 2XE6A 4EJ0A 3WAGA 1XG5A 4B7XA 2WUEA 1TIBA 3GYBA 4R41A 1QIIA 3AG5A 1V5FA 3DHNA 4U7FA 3A1UA 5SV2A 3R7LA 2C88A 4MWLA 5F35A 1ND6A 1ZD4A 4B9EA 3N2YA 3ND8A 4CFZA 3C6YA 1WDWB 1G6HA 3HDVA 3RIYA 2XY4A 1FP7A 3N6VA 5ALNA 2O7QA 1DAGA 3MT7A 4FI3F 1JEJA 3EF0A 1R64A 4AF7A 3F5SA 3H5RA 4KI7A 1N0IA 1B3BA 2OD7A 3DBVO 5C37A 4HHOA 3DWEX 1QVZA 3K70C 3ER6A 4RKEA 2VTKA 1HURA 3DMHA 4FGKA 4G1BA 1QGZA 2XTJA 3CISA 2WNHA 2O2DA 3ET5A 3M4YA 3MS2A 7REQA 4RD4A 1SA0B 5K51A 1YQUA 2JK0A 4H15A 4CMKA 3NETA 1UAYA 2Q62A 1DX9A 4IO1A 1QIKA 1V8FA 1QZUA 1TO2E 2QP3A 2ZROA 4B4DA 2Q21A 3QELB 2F27A 2AN5A 1Q15A 4PLWA 3WK8A 3NTXA 5HQ3B 1WABA 4ARZA 3JRWA 1JDBC 2W43A 3WBFA 2Y9MB 1GTSA 3NBZC 4YJ2B 8AT1A 4CR7A 1KVRA 3PEUA 1XSEA 3SYLA 3NP7A 4NOJA 1A9RA 4DCVA 3BF7A 1QGUA 3L4EA 3K3PA 4BU1A 4QO8A 3SYMA 4CKBA 4KDCA 3ZCXA 4Q4CA 3PHJA 3S8YA 4YW5A 1O97D 2WVHA 3NBMA 4FWTA 3GRPA 1Y6ZA 3LUFA 2D4AA 2I7VA 1I0LA 1XZNA 4M8SA 3ITEA 3TMYA 5CIQA 2CL7X 2E9SA 4HDCA 5CDFA 2JIRA 3O8OA 2PRSA 1NQOA 1KVUA 4IQGA 4ZCIA 3KT8A 4R1TA 4WLVA 2XODA 4FW9A 2Z4RA 4OQMA 3ZGNA 4UTRA 3JZFA 1NASA 4UDOA 1B8PA 1JMVA 2WB4A 5ALUA 4W5JA 5T4HA 2JA2A 3R0QA 2X0DA 1KITA 4DCCA 5JC8A 4MYHA 1NNBA 5TARA 3DCNA 2BJWA 3VSEA 4AYXA 4ZYUA 1IULA 4XRGA 1C9KA 4Z3OA 3PDUA 1B0ZA 1MJHA 2PYZA 4FEAA 1HNNA 3GN1A 4LHVA 3COJA 3DEAA 3QTTA 5EZYA 4Q9DA 2A1TR 2NUAA 1M5TA 1MABA 1PAUA 1KGDA 2CW5A 2OKCA 2P2YA 3QWHA 4QRDA 1PSWA 5CBKA 2J9FA 3IMFA 1OB2A 3K6SB 6ADHA 3OWOA 3QKSA 4OEHA 3W8FA 4IMPA 1J2TA 1ZN7A 2BHLA 3A3KA 1P1RA 3LX6A 4JUIA 4ZDIA 4CUJA 1XVVA 5IUNC 1L1QA 3KXDA 4ZVVA 1KZ7B 3TZBA 1CQJA 3T9DA 2NTVA 1SVLA 1KQFA 2H8GA 4IY1A 2XNSA 1AKRA 2PKWA 1OV4A 3IOYA 5KREA 4ARCA 3EC2A 4H59A 4C2AA 4PAOA 1I2ZA 3L77A 4ZDWA 2O8DA 3D7SA 2VNJA 2WICA 4KC0A 1Y80A 4OHVA 2FUEA 2RGWA 1V6SA 5ERYA 1D9XA 2XQGA 4JJEA 2COUA 1SBYA 2P3SA 4XJ8A 4FEEA 4KJZA 4BB9A 5IX8A 1ZRSA 1BCSA 3A9SA 2Z30A 4TWZA 2OM2A 1W73A 3ACDA 1CG6A 2FRVA 1OOEA 1XKTA 2HA7A 4V0RA 3B2EA 5FEUA 5G4LA 2ODWA 3QBVA 1JFLA 1A9OA 2FMXA 2SLIA 4GKJB 1A2OA 2ZKLA 4XH9B 4C6HA 4MRPA 2V9ZA 4NYMR 5BURA 5GINE 1WXQA 3K32A 1DCMA 2HV9A 3ZZUA 4S1OA 4I1UA 4XQ9A 3QI7A 2R86A 1PS8A 4A26A 4RDCA 1H9CA 3AFOA 3NDPA 1C3OB 1JW9B 1MIOA 1YJBA 2JHGA 4Y7CA 5EL0A 4ZU6X 4NIMA 3GRRA 4CPZA 3I53A 2ZAOA 2NADA 1L5QA 5AW0A 4YZ1A 2AI2A 2JJ1A 3MILA 1TM3E 4ZV4A 3HN2A 1A8UA 1LUAA 1G0OA 2CNOA 5K3DA 3UMSA 1WUIS 4Y6SA 1LX6A 5J23A 5FPYA 4HB2A 3TICA 1GGEA 2MT9A 4W6ZA 1RT9A 3GXOA 1OLXA 1F0PA 2WDZA 2GILA 3BF8A 4GYJA 4JZYA 1ZOLA 4CN9A 1C1DB 1A9QA 5JSHA 2K7FA 1LV8A 2P3LA 3IJPA 1BEEA 3GNQA 1V43A 1ZXXA 2ASVA 1YS6A 4MIYA 4Q1VA 3I5AA 5K0CA 2WAAA 1PVVA 4AL4A 5FD8A 4B3HA 2IYQA 4M76B 1WETA 2J0QA 4HVAA 5CDGA 2C2MA 3WV5A 2F9FA 2JIDA 1KO7A 4P2GA 1P6XA 4BVFA 5FNZA 4Q4DA 5CNKA 4BWFB 5G02A 1M34A 4NZMA 4X47A 1XCLA 1LDGA 5JSYA 2CYAA 3ZV3A 1N32B 4V0SA 3DOJA 2HK7A 1YV9A 3AL2A 4PC1A 4P7GA 2IF2A 5IYZB 4FMCF 1LK7A 2RKCA 1NAHA 3EF1A 3T1HB 1PNRA 1X7HA 1UK6A 5B4TA 4FNOA 2LWIA 3M4XA 5AI9A 2ZTHA 5HYVA 4U02A 3UC1A 2H0RA 5DM60 2XADA 3DAHA 5BQFA 2YN0A 1OH6A 1X1EA 1VSQA 2FRDC 1T5SA 4LCJA 1JKMA 2FEAA 2ZUUA 3RVKA 4J0FA 4POOA 1JV2B 3DNPA 3WB1A 2BHSA 3UKDA 3LQ1A 4N5MA 5AMXA 3SZOA 3EFBA 4I08A 2XUHA 3HKDA 5BV1A 3L40A 1FU7A 2PGJA 3MPUA 4GR5A 5AKIA 4PAQA 4IH4A 1JHUA 4MW7A 1F38A 5DBOA 3WNZA 4BNIA 2LGJA 3K5PA 1KBQA 1WY7A 3TIFA 4B7AA 4SLIA 4MOWA 1XEWX 1I5RA 3UJBA 5LDHA 2QMHA 1YL6A 3PFHA 2XXJA 2XX3A 2R00C 4JR2A 4NZ9A 1A14N 2C92A 2R8YA 5U4QA 2C5HA 2QL6A 3AF3A 3B3FA 4EYGA 9MHTA 4PFQA 2PH1A 1YACA 1VMDA 1W5AA 3MTBA 3O31A 4X0EA 5LKAA 3U6KA 1KWKA 1OF1A 5B2FA 3DF7A 5CLLA 4Q4JA 4BO0A 1RM5A 2QQ0A 1PT6A 5ALRA 1VFPA 2WFLA 3VZDA 1R8XA 1HDXA 2PHZA 3IS3A 4E15A 3OY2A 3KDAA 3WSWA 4EHJA 3U7QB 1NW3A 4RTMA 1G6KA 3BXOA 1PVDA 4RHXA 3DL4A 4ZYVA 5AW7A 4PZZA 2Z4TA 3R3JA 1SQFA 4KNVA 3GP3A 2AN3A 5I5GA 3W3AD 4EB3A 1N4DA 2M6KA 5IM4A 4B6GA 3B1ZA 3QH4A 2ZRJA 2BFDA 3R41A 4ZU3A 2I7XA 2H0QA 2H2DA 2YUIA 1TLFA 2C9OA 2V58A 1II8A 2IJGX 3QWFA 4HJXA 3TN7A 5LZ2A 4BAGA 2A78A 5IG2A 3DZIA 3FNGA 3WADA 1FPQA 1NF3A 3P52A 4OB8A 5FKJA 5DXJA 4D4KA 1E7MA 4YUYA 1MHTA 4HDSA 4K2AA 2JG3A 2PWZA 1JPUA 4C9BA 4JX8A 2XE4A 3E0XA 2JVKA 4OUDA 1H2ZA 3PF8A 1DIMA 1JR3A 3COSA 3REOA 2G4CA 4MR7A 1JRLA 2VSXA 3RIEA 5JAMA 1E63A 1G17A 2VDOB 4M8IA 2ZYTX 5AHXA 2DQKA 3WLQA 3FWNA 1JECA 5IZ4A 2BFFB 1SC9A 3LP8A 2HO5A 3X1XA 1OKKA 3NM4A 1V8OA 4GO1A 3ZWAA 1YBMA 3NGLA 4EKDA 3Q5GA 1RI5A 1BMFD 1J33A 1LA2A 3OMXA 4GMFA 4QJIA 4ZPXA 1SUBA 5F73A 2DF8A 2F3UA 3OZAA 2PS3A 3ULKA 4C4YA 1KYTA 4RTLA 1Y1SA 4JZKA 5F1OA 3TSYA 2ODTX 5LU9A 4LJAA 4WUTA 2PH7A 5B5SA 2TYSB 2C7OA 3NCHA 4RF4A 1IPEA 3RC8A 1RCFA 1W2WB 1W47A 3QOFA 3TMKA 4EY6A 4RYLA 5HUMA 2Z8YM 3LVBA 4Q3BA 1CUSA 3LVFO 4JLOA 2YASA 4LZJA 2QZPA 5ALQA 5K1ZA 4CG2A 2XI4A 4B3XA 4KW7A 3PXGA 2W2PA 4BRWA 1VJGA 2ZFUA 1NE7A 4FX5A 3I62A 2WP0A 2FLWA 3IDSA 1VKJA 4LSWA 3THYA 4EX7A 2Q3FA 1T3LA 1T15A 3TTUA 1RWNA 2RBKA 1FDIA 3F5MA 4YGYA 1V0EA 3V7WA 5EVCA 4Q6WA 1QTRA 2HHCA 4U7JA 2H1LA 5F52A 4IFBA 3PUWA 4L0CA 1T1GA 1ZH8A 3ZDRA 1PZGA 1E7SA 3M6AA 2FKAA 3TRDA 4NC5A 3AU8A 1CDEA 3N59A 1EFCA 3UMCA 1SQSA 1VLMA 3ESDA 1UEXC 3WLAA 4ZJZA 5KMGB 3W9BA 2BGLA 3CRRA 2I8LA 3JR3A 3KR1A 2GXSA 2XWPA 1BE1A 4AO8A 1HNZB 4MJXA 4CMJA 4FNMA 3C97A 3TCNA 4HGOA 1AA6A 5FLXA 2CHUA 2DFLA 1AGYA 1NVTA 2BONA 3TECE 4MO2A 3OPYI 3T5CA 1U31A 5G0TA 1PTKA 4ZAYA 4ZLRA 4ZHQA 4NXNB 2J85A 4ZAFA 3CYFA 3MUNA 2HBQA 4ZGGA 5L3VA 3O7WA 1PR2A 3WWEA 5AVZA 2DR2A 3G0CA 3G0DA 2WHRA 2HJGA 1V2GA 1UKYA 1MXHA 4M4VA 1LDYA 3UZUA 3QTLA 3ZDDA 1U4NA 4NNPA 4QE3A 1W76A 2WMOB 4AWBA 1JPNA 1QO0A 4JUFA 3ZWOA 1OIXA 2IPMA 3NP9A 1Z22A 1KKLA 1XP8A 5B1DA 4MWCA 3SXPA 5EO7A 2NT4A 3HA7A 4HH0A 1YASA 3EG5A 2AOUA 5L3RA 7REQB 3AKZA 2AH2A 4K5QA 2O7NA 4B48A 3C43A 1IBSA 3L4SO 4Y8VA 5DRYA 3KZCA 2I4RA 1MC8A 1VE5A 1ZOPA 1I01A 5F7OA 3JQEA 3EDQA 4B32A 4OI0A 3OIFA 2SNIE 2PY6A 2Q3HA 4MUKA 5L40A 1I7QB 5C5DA 3K1ZA 4RJJA 4Q7QA 2C4TA 4WZBA 4AROA 3E53A 3LD9A 3PPYA 2GNOA 2OTCA 3QPWA 1QGUB 4XAQA 1XLWA 3JD0A 1O9BA 1IVDA 4R05A 4CKBB 1HDCA 4YJGA 3CPHA 3PD1A 4MUYA 3A1EA 4KXXA 2CFTA 1NG9A 5IVDA 3V8PA 4BO5A 2JAUA 3FWZA 2RGEA 1Z5PA 4WXHA 4LG1A 4XIJA 1UBNA 1SBNE 1YRHA 1I4WA 1G8PA 4XUCA 3UGJA 3KL2A 3C7TA 1Y34E 4QELA 4ZAZA 3O8OB 5C46F 4O4HF 4FN5A 1PD1A 1M75A 2HJRA 1FMLA 2P69A 2Z04A 4E5SA 3UM9A 1IM2A 1V8BA 4CKCA 4FBLA 1ZN9A 3ZGCA 1WKBA 3CUUA 3WC4A 2HZBA 3UWPA 4DR5B 3MGCA 1T2CA 2ANBA 1KEPA 2QXTA 3F49S 4H6XA 4WOCA 5TEVA 1E89A 1NMEA 4EHLA 1P5RA 5C8YF 2ZANA 1ICEA 4XE5A 2CL6X 5LP6A 2A1TS 4X3CA 1VYTA 1RKQA 4L3OA 3FCUB 1R1DA 5BUZA 2QW1A 4TN1A 5EZYB 4BO4A 1FLNA 3I39X 2NUAB 1MABB 1A8QA 3STHA 1W75A 2PV0A 4XLLA 2J9FB 1FTQA 2E89A 3VPGA 2R8OA 1NAIA 2RJNA 3HU3A 4H1HA 1PLKA 4MV5A 3QKSB 4GOND 4Z4HA 3NH9A 3R0IA 2C82A 4L8YA 4QUIA 4FMPA 4X6UA 1QHGA 5KNCA 1CQJB 1EGHA 2V7BA 3FNHA 4U39A 1NXSA 1KO8A 3KXKA 1RLOA 4ZYXA 2G1PA 5FL7A 2UDPA 3TQIA 5LB2A 4WEGA 3L02A 2C57A 2QQGA 4N5NA 5EE5B 2G80A 4X00A 1QGDA 3GRAA 1XTSA 2FPCA 2W4IA 2O8DB 3HL0A 2QD3A 4J2OA 4WWHA 5J9FA 1MC1A 1PJ8A 1KORA 4MVJP 3CSSA 4MCJA 4PANA 1MA0A 2DT8A 2QLJA 2VT3A 4MUNA 4TMFA 5DLEA 2HMUA 2ZUCA 3OQ6A 3WKBA 1T9KA 3OKFA 1DC5A 1L7DA 1SKUA 2CBZA 3QK7A 3ZS8A 1DARA 4K26A 4F06A 4YS6A 3FLMA 2X23A 4CYMA 2Q6KA 1C0PA 1D0VA 1P17A 2WIKA 2ZI5A 3IP9A 4MARA 4O59O 1K97A 4HQFA 3AYZB 5CB0A 3WWCA 3RYFA 1Q2XA 1T1JA 1I3LA 2GA8A 1NSTA 4NS4A 3T3MB 1E1RA 1F8CA 1ZK3A 2G9RA 2K87A 3HUUA 3TIAA 1OI3A 1V5WA 2XKAA 3EVDA 3PE3A 3Q8XB 1Y0BA 3D1VA 3FJOA 4I36A 4DLWA 1G3QA 2Q6VA 4RQUA 3QMVA 3AF5A 1MIOB 2G0NA 1SHLA 2PZGA 2BLLA 2IHJA 4RTQA 1Y9JA 1LBIA 4NY1A 4R83A 1GZHB 3MB5A 3LM8A 3RS8A 2DAPA 2OFWA 1X86B 1GILA 3RPEA 1LQ2A 4QFDA 1VIDA 1Z4KA 1KK3A 4M3NA 4ZI3A 2NXWA 4LYFA 5DWVA 3USES 3VSDA 4D8SA 1OLXB 4HADA 1VI2A 1FSFA 5A1JA 1NQTA 4I4IA 4KFSA 4F85A 2HRQA 4O4JF 4XR4A 3VV2A 2CCKA 3IB6A 1OWNA 3GLSA 4KWHA 2HF2A 4B4KA 1W0JA 3H1FA 5FTNA 4JKYA 1XQWA 5HFAA 1DDIA 2BMEA 2QWXA 2YJGA 3WXMA 2PLAA 4A2CA 2JAXA 2WM8A 1GADO 4N03A 2C61A 2QU7A 4D42A 3FOEC 1K7FB 4IVRA 2CV1A 4CQJA 3TQFA 1Z2CA 4Y2QA 1F5NA 4Q7KA 1D9ZA 2WZQA 3DXXA 4ZVSA 3VR2A 3D4OA 2DSTA 1R5NA 2BEUA 3N2IA 4QGHA 5H3CA 1M34B 1O95A 2WNSA 3LPLA 3WLRA 3N8NA 2LVBA 5EXTA 4ZOCA 1KHHA 2E49A 4I4TF 3PXEA 2PANA 4QOHA 3TLYA 3W0LB 1RC0A 4DUGD 1XMIA 3C1OA 5ECDA 3T3HA 1J0EA 5K03A 5FAXA 3IDFA 1UBFA 2VDUE 3JXEA 3KLPX 3DR2A 4HDKA 1DX4A 1KJ9A 3IUEA 3M1LA 5BSRA 1A5BB 1HOTA 5CTAA 3RUEA 1MO2A 4KV9A 1I6WA 2JKVA 2Q1YA 2YQZA 3OVMA 4W6QA 2HCFA 4C7VA 1RQPA 4D0RA 3AH8A 3GEPA 4CQMA 4EHFA 4OYRA 4IDEA 3BJMA 2VNIA 3J7AC 1IVSA 2HR1A 5IHPA 4Q1FA 3C3EA 5SY9A 4XGRA 4BRZA 1NNUA 3U1BA 3VSBA 3NIFB 5L3ZA 1H0SA 1LWOA 3FW1A 3L1VA 3PVZA 1K7XB 1UPAA 4U6QA 2PZAA 4WNAA 1WAMA 4GEKA 4PZUA 3FUWA 1ULBA 3PHHA 3PXUA 4IMJB 1OXBB 4Q4JB 1AQYA 1ZIXA 2Q46A 2VHCA 2ZXEA 3UV7A 2WFLB 3ZWNA 4IJWA 4LW8A 1QX4A 2PVCA 2QL9A 2PLFA 3GJTA 2XCSB 3WYAA 2VAMA 1NWCA 3HPRA 2QN7A 1E5XA 2W6PA 1S8FA 1TYBE 1MAAA 4MH0R 4XIFA 5I8WA 2IZ1A 3IFSA 2BFDB 3NHBA 1YJCA 1FQOA 4UZEA 1Q3KA 4J4TA 3V7NA 1QE3A 3I73A 3IDZA 1E3WA 1II8B 4X8LA 1EUQA 2GVXA 1RFLA 5GX1A 1Z0FA 2WJVA 3MFQA 5A6SA 1NX9A 3H7AA 3KTAA 3ROMA 4FPYA 3WGMA 4HG2A 3TNDA 4YAKA 1P2SA 3PD0A 1JAIA 4HDSB 4AJLA 1ZDMA 3P26A 3SEFA 5CG2A 3P2YA 2BCJQ 4OUDB 3D1LA 3PR3A 1JH8A 2XDQB 4MR7B 4YC7A 2XGSA 3QEKA 5IW8A 4CT0A 3ZTWA 4C0BA 3EVBA 4C7OA 1CIPA 4EB0A 1UDAA 2JJ2A 3WK6A 4U5XA 4CNQA 1SIBE 1GA4A 4TGLA 3SR3A 4FUTA 4EQ6A 3QWIA 5AVVA 2OXEA 2X5KO 1FRVA 5EHXA 1NY6A 3GN2A 2P1ZA 3RRFA 1G3RA 1AT1A 1EM8A 3I9V6 2ZSBA 4JITA 2R6DA 1BE8A 2HT7A 4HIZA 1B0UA 1G0NA 3DD5A 2BJVA 3OPVA 4XVHA 3T7SA 3WJ1A 4ENTA 4MMXB 3TF5A 4RV9A 3LBFA 2BFEA 2I7TA 3NLLA 3B6JA 4BVKA 1WEKA 2IGTA 2CY0A 3ZGDA 2SILA 4XWAA 4LY0A 1VSTA 1ZXBA 3PGMA 2YA6A 2R8XA 3LDHA 4EITA 3IUQA 3KT0A 3ZHQA 4CE6A 3LPCA 1D4AA 4ZT7A 2IYXA 4LJ6A 3THYB 2XGJA 2EP8A 2TMDA 4C4ZA 2Z8XA 1AO3A 2HQOA 3QXXA 1BMTA 4GC5A 1O94C 5KYUA 2GBIA 1FXWA 4KGZA 1GFIA 1H42A 4UEWA 2Q8NA 3X1WA 1UBLS 1RP7A 4HVTA 1MU0A 1YI0A 3FG9A 4M9RA 2X9GA 3HI4A 4M21A 1P0MA 2O1SA 1VG8A 4WLFA 4OI1A 3VR4A 1QIFA 4O2AF 2FQQA 2NGRA 4DV4B 1NU6A 2VL7A 3EVGA 3RV4A 3KR0A 1OXUA 4B7CA 5IDYA 3B1JA 1BWPA 1T9BA 3OCXA 2BPOA 1QQBA 1MX9A 1H6AA 2ENUA 4CVNA 2C20A 1NN2A 4ZHQB 4NFYA 1DGQA 2H4FA 3KU4A 1F9EA 1JXQA 2DJIA 3HU5A 1ZRMA 2VPIA 3EIUA 1U5AA 5ALGA 3K5IA 2PSFA 1AUQA 2R4QA 1CY4A 3L4BC 2WE8A 2ZRKA 1QS0A 4RL6A 4BVGA 3GFOA 3DNFA 4JA2A 721PA 3KC2A 5DSTA 2B92A 2QG6A 3NBAA 1QLGA 5BQXA 1MIHA 2EBHX 1TZ2A 1GAEO 3ENWA 2AR0A 3IHWA 3LBAA 3MTEA 4MUHA 3GLGE 1VHLA 3CS3A 5DYIA 4A1FA 3B69A 2YMQA 1D6MA 3K9NA 2PL5A 3MGBA 1SD2A 4MQBA 1TAGA 3FSJX 3UXHA 1KY3A 3NU1A 4IWYA 4OFXA 4PRLA 4BLWA 2FSUA 4PHTA 3I01M 4AS2A 3K20A 4EECA 4FPGA 3GARA 4J6EA 4F86A 7MDHA 4N5DA 2VF2A 4PFSA 4RHEA 4Q16A 4M46A 1SC1A 3RWBA 4DMLA 2B7BA 1DOZA 1GCUA 4NBNA 3ZH2A 4Y2JA 3TAUA 3TZ6A 2O2HA 4GSKA 1DPGA 5KWIA 2WHEA 3H6HA 3ED1A 2O3JA 4M8LA 3H1GA 3ZE9A 3D8TA 2WWYA 2PR7A 5B7NA 1XT6A 4LXXA 1N75A 3RW9A 3OIDA 1J25A 2JF0A 4EKYA 4WZBB 4PCAA 4QPZA 4A8HA 1NCDN 1ODIA 4JY7A 3FCYA 1KZYC 1NIJA 2GGSA 5DN6A 1CKEA 4EF5A 4ZZ1A 5CEEA 1DTEA 3OPZA 3A6HA 2Y66A 3C16C 3HCBA 3PYXA 4EEZA 1EPUA 4YJGB 3L6CA 3QVSA 4ZVQA 3ZDFA 3ABSB 2C94A 5CITA 2PX6A 3EARA 4J0QA 5K4HA 3DO5A 4Y0AA 2PTHA 5FWNA 4OK3A 2H5JA 3LKDA 5FZJA 5JDCC 1N1YA 4FZHA 7GPBA 1R5OA 3DZCA 2WHYA 4BVJA 5KNDD 1BIFA 3GGPA 4DG6A 2VHVA 4AJKA 1NBEA 1CETA 4L28A 2MR5A 3NJRA 4TMWA 1U7TA 3GJZA 1PU2A 1EDDA 4CKCB 1LFDB 4ZT3A 3OEHA 4EJSC 5B2ZA 2P68A 4DLPA 1XEXB 3ZDBA 3OECA 2QWDA 4P81A 1V95A 2VDNB 1RWQA 5SY4A 6AT1A 4WCVA 2BFOA 1E5VA 2L42A 4D52B 5LP6B 1P39A 1CBUA 3C4JA 1JZQA 3Q6PA 4W9NA 1E8UA 2XA1A 4EI2A 3G7NA 3ILXA 3L0CA 4KXNA 1M0SA 4DBLC 2ZAYA 5A3QA 2W8ZA 1UBSB 2RC5A 3O92A 1KH2A 2PX0A 2XCRB 2HWXA 1PFKA 1EZ1A 1YJXA 2V6JA 1KQNA 3KPUA 3I1FA 4UQLA 4XFDA 4KOEC 4JI4B 2BV3A 4G1EB 4Q4AA 3FHCB 4JGBA 4REQB 2I4LA 2OO5C 5EUQB 4CIBA 3ONFA 3USZA 1XMPA 4B71A 4R0MA 1WUHS 3FDXA 4RPLA 2VJPA 4QPDA 4Z3KA 3X2FA 2W5OA 2Q9CA 2VIIA 1F8BA 3EIXA 4L8WB 2QAJA 5ALSA 5H02A 3BBLA 2XJ9A 3EC7A 1MQ9A 1N0WA 2DUMA 2B4YA 2QF7A 5EP1A 2QRNA 4D82A 3UMFA 2ETVA 1S6YA 2GF9A 3AM4A 5GVSA 4X66B 2CN1A 1Q1GA 3UYKA 4QN6A 3BGVA 4FVTA 4HZWA 2HMSA 4TX1A 5T3YA 3GJ7A 1RYEA 4IIGA 1V47A 1R6DA 2GCNA 3FKSD 1U80A 2XWJI 2HAEA 3AR8A 4JENA 5K6TA 2QVZX 5JV5A 5J2TA 1RJEA 3BA6A 3MT0A 4Q6KA 1E9SA 1WVMA 3RYFB 3MWDA 1FFBA 1XHEA 4RADA 3V6LA 4PS0A 1APBA 3B5IA 1Z39A 2BT4A 2XQJA 1KMHB 2YTZA 1TJNA 4PYIA 5KVAA 2ZB6A 2X1VA 3CNHA 1C9JA 2ZTSA 1YVDA 3RD5A 2KE5A 3AJ9A 2V65A 1JAXA 3MMNA 3VYVA 421PA 2F13A 2XD9A 4JD5A 2ODPA 4WLOA 2IKSA 1L5ZA 4FGLA 3LQFA 3ZD9A 2WKQA 3D5TA 1WMSA 2VCHA 4FDLA 3TAXA 1OXSC 2M1ZA 1DBSA 1OXVA 3RNLA 2VSQA 2QV0A 1MFPA 4NEQA 4B31A 2VYCA 1S0IA 4EARA 3T3EA 2F1OA 2H2AA 1QBIA 4YUZA 3UCXA 4WRRA 1Y8RA 4ZICA 2E82A 4ZN6A 5KTSA 1BTOA 1I80A 2YY7A 3JQ9A 3SJCA 1LLCA 2WJGA 1Q1BA 3IAS6 4TOIA 3DASA 4NLLA 3LYHA 4DA6A 1R0KA 2ORWA 3HR4A 2MYUA 1C9UA 3PJDA 1B8UA 4FPEA 4JCOA 1PZHA 3MMZA 2BEUB 3GCXA 3UN1A 5JYCA 1ZC4A 1EBFA 2JIZD 2ZRLA 4L76A 4BEVA 1MJ5A 1C7FA 4FOWA 4N6OA 4A6PA 4BC1A 4EY8A 5KQGA 2DERA 3QF7A 3ZYCA 1UJMA 1QQ6A 3V4ZA 3MXOA 3V42A 3CLSD 4GUAA 5LMNB 3EVTA 1FFDA 2XNKA 1A8HA 2RHCA 1B00A 3IESA 4EYSA 1GZUA 1KY4A 221PA 5CT9A 5B1HA 3ECSA 5AW8A 4PG5A 5PGMA 4OVKA 2R66A 1Z5WA 4WQMA 2PV7A 4FILA 1AUXA 3ZNQA 1WXGA 3WDZA 4C1YB 1N92A 1OREA 2P9ZA 3B3JA 3K9QO 4KIFA 2DJ5A 2DY0A 4QJ4A 1EGVB 1JXMA 4CQMB 4E88A 1IBCA 4RM3A 1VSVA 4D5GA 1Z0KA 4Q3AA 4JC5A 6CHYA 3AF4A 4GE0A 3OBBA 2ATXA 4NMLA 4WEFA 2IEAA 4ARBA 4MRNA 1FL9A 4LV6A 5H4HA 4WNAB 1DOAA 1ORDA 3HGMA 4UE6A 1MAWA 4BASA 4ESHA 2FR1A 2FN9A 4X3OA 4RVGA 3FW0A 1GTG1 1ZJJA 2KYRA 2V97A 3LFHA 4Y2SA 1M6NA 4HXYA 5T6MA 3CNLA 3RU7A 4I8IA 3CLRD 1N5DA 3GVCA 1N5IA 1ARZA 1EZ4A 1QCZA 3KJZA 3QWAA 1BFKA 2AGVA 5GIPE 1H94A 4Q3LA 2CLMB 1P7ZA 2FEXA 4PG6A 3ZGXA 1BX0A 3UJAA 4PHFA 2YFKA 3DNMA 4IG4A 2BBOA 4BGEA 2VSOA 3P5SA 4RKWA 2Z43A 2V54A 3EEIA 1H4SA 4XQGA 3V55A 1P1BA 4RORA 2W2OA 3GCZA 3C0KA 3MQ2A 1QTIA 5AJVB 5C4IA 3OQPA 2AG8A 1V9CA 2OO3A 4FZ5A 5LYYA 4CCSA 5A6SB 2VPTA 3KTAB 3GEGA 5KJFA 4BLRA 2F29A 4WY5A 3H13A 4JELA 4ABYA 4PZ0A 5DXAA 5TPZD 3P9PA 3T61A 2PUGA 4JYMA 2I4MA 2WU1A 4UBNA 5IAGA 1MWEA 3HK2A 1VRWA 2VNAA 1RQRA 3KAPA 5L8VA 1JQ3A 2B6HA 2BM0A 3DEHA 3FNFA 5E0OA 2P9HA 5G4KA 2XCUA 2PA3A 2VR1A 1L4YA 3BTVA 4E12A 3GBSA 3K2EA 5AK5A 2CFRA 5DJ5A 4HWGA 2QK4A 1WZ2A 1XWFA 1Y1QA 2C7RA 4C7OB 1KI9A 2NZUG 1ZNZA 1VLHA 1C4KA 1W85A 3R0JA 4LYGA 4Q4LA 1G1AA 3VH1A 3MOGA 2YNMA 4H3HB 1UP6A 4ID3A 2H4XA 3UH1A 4CMGA 2AW5A 1EM8B 4JR0A 2GWHA 3PA6A 4CIAA 3M6IA 1Z5OA 4X45A 4G5GA 2XQVA 4J4HA 4ALJA 4RZ3A 2FFBA 3WFIA 1XMQB 2WM2A 2BFEB 4P34A 2VK8A 4QJ5A 4YGXB 1QKJA 1JXOA 1S8AA 1SBQA 1YGYA 2VP5A 1Z15A 4EMTA 4P92A 1T2DA 1OFTA 3ROZA 4A0PA 1HZZC 2XDYA 3EXG1 4MJ3A 2X42A 4FMDB 2HW8A 4NZZA 5HK8A 2Q4BA 1AS3A 2BCGY 2IV3A 3UJHA 3JQ8B 4F9FA 2IZOA 2YN4A 3LU1A 2B1JA 4QBFA 4TLEA 1QRSA 1W94A 5KYUB 1LH0A 2DU8A 4ZA2A 2ZYUX 4IDFA 4C78A 4NI5A 2CLSA 2HMVA 3ML1A 3HLHA 3PPVA 4HZGA 5G1PA 1F8YA 5JNRA 4UD2A 4XDHA 2DTXA 4ZTZB 2C4KA 4AMGA 4DGRA 2G77B 3OF3A 4JJ4A 2Z9CA 2GPWA 1KF0A 3T38A 1GPMA 2O06A 1SCQA 4C7KA 5T4BA 1SU7A 2Z2ZA 4EAAA 4BBJA 3HWRA 2H16A 2W6CX 4B2IA 4KGXA 1SXHA 3H5LA 1FBNA 2WY2D 2J6IA 3F8TA 4FYVA 4C0WA 1IBLB 4R8VA 4JROA 1PJSA 2G04A 4B85A 1VKHA 4FYYA 4XGIA 3WA6A 4RX1A 3W5IA 4DSNA 1UKAA 1ZCJA 3MVEA 3JYPA 1F1JA 3RIXA 2HHJA 3NIBA 3NQ41 2AT1A 5DXFA 1IB0A 1HDGO 4U8HA 1XC7A 3CM0A 3JQAB 5H59A 3SJUA 2HTFA 4W4TA 2YYZA 4IZ6A 4LTDA 4DDHA 3LIIA 5C1IA 3BGOS 1C29B 5IT5A 3M6XA 3ZVKA 3VR3A 3IEIA 1T0BA 4YT8A 4I19A 1YD7A 3CVYA 1QG6A 4PE5B 3GJYA 3Q9UA 3O1LA 1P31A 4NYIQ 1Q77A 1W4LA 3PK0A 4OCZA 2HU0A 2ZB8A 2XMCA 5CLIA 1QV7A 5E9AA 2D59A 3KPJA 1I4TD 3SZGA 3INGA 4UNIA 5LM3A 2D00A 3LZCA 1ABEA 2DKNA 3IAHA 3PUIA 3G68A 3PGLA 1T35A 4IIJF 1U2QA 4RMHA 5IKMA 4Q1BA 1YJ5A 4FOTA 4HWRA 4J1QA 1NHGA 4UUNA 3D59A 3AWIA 4KV7A 4DT1A 5CB6A 1BGVA 2P2SA 3IAXA 2EJVA 3BQNB 5C7YA 2CHEA 2QW0X 4G6ZA 3IAS1 5HBGA 4AF6A 1E1QA 5K45A 4M1ZA 1E2MA 1GRNA 1C4XA 3IOCA 3B8HA 3OEYA 2YHIA 5EGNA 5EKUA 3IEKA 3HJUA 3VFDA 1M2EA 5CNMA 2IAXA 1KEZA 2IEYA 3I0NA 3QF4A 3G82C 3K8QA 1ZMTA 4G0MA 4QKQA 4OH7A 1MMFB 2F43A 4J0HA 5HILA 3ZDZB 3EY4A 3TZCA 3W7AA 4BB0A 4ED9A 3N70A 2O8FA 1WO8A 3MUFA 1XQVA 3FDZB 1T8PA 4HFMA 1KERA 3O4PA 2CMDA 3NM5A 1G9XA 4IUCS 3RHFA 4KSYA 3ZDCA 2XCOA 1V4NA 1OXMA 4INPA 4GBMA 4EW6A 3BE4A 4UARA 5DHSA 3DZDA 3SQMA 1RTTA 3BJIC 3VKVA 2JJQA 1ZZGA 3OD1A 3KQNA 4R1PA 4ZKEA 4Z9FA 1N2OA 3N2EA 4DJ5X 4P83A 4CFSA 1W0PA 4GPTA 3IIMA 4QM7A 4BU0A 1USRA 1ULZA 4UNQA 1EUSA 1R6AA 3FNEA 4YIKA 2AYYA 3QXGA 4O2BA 2YMLA 1FY2A 2H9IA 1OJ7A 3LI4A 5KDOA 5TEWA 5CPFA 1US8A 3LWBA 2OP0A 1RXIA 4PYKA 2HO4A 4FHEA 3H9CA 1PK7A 4DIKA 1N2HA 2V5AA 4Q4AB 2N46A 2B7CA 2AEQA 1Q83A 1SCAA 3HP1A 3I9FA 4U7TB 4RTSA 4HB3A 3M4NA 3Q7TA 2SBTA 2JC3A 2PX2A 1ZD3A 4C30A 3DPUA 1LLFA 2HKIA 2BVNA 2WTBA 1X2EA 4RM2A 1KZHA 4AP6A 1CZOA 4HZZA 1TD9A 3UT0A 1VIYA 1BZYA 3KAQA 3QX8A 5EQJB 2R6JA 4J0IA 5F72C 3KYDB 4X95A 1CRWG 3MD0A 1IK6A 1DXYA 4B7MA 2GVZC 2QENA 3I6MA 2R7LA 4G4JA 1KDVA 2PRZA 1M2HA 2H51A 3JZMA 4R2LA 4R16A 3TIGA 4IN4A 3ETDA 1S3FA 2MMGA 3EGXA 3SS9X 2ZSAA 3PCXA 3W9UA 3FUXA 3DMDA 3VHXA 1RLUA 3ANMA 4DDUA 3PJGA 4D3ZA 3LE8A 4DHEA 1YR7A 4ZALA 5J4LA 4JJFA 3A32A 2UZ1A 4NBSA 3B7WA 3PEEA 3MWDB 4JUAA 4F3TA 2H9AA 4PBSA 5L4NA 2ADOA 3TOCA 4E1VA 1XYGA 5ADVA 2J3LA 3DAYA 1VRCA 2AJBA 2QMUA 4R5MA 2WFZA 1DHRA 1UQRA 5HA5A 3BIWA 3X1MA 1EX6A 4KDFA 3DZHA 3WW9A 4U00A 1WUTA 2P75A 3S44A 4EFLA 1DBIA 2PMWB 3SGLA 2WSYB 2AI1A 5JS1A 4Q24A 1YKSA 1L5GB 2VZ8A 3ESAA 2WTUA 4AK9A 2O3SA 4D9GA 3RC7A 1VJ1A 1ULTA 3O4IA 3T9AA 4YYEA 4KQFA 5CLHA 3HV2A 3CLTC 3WJ7A 4XMBA 1NOKA 3O38A 5MN6A 5NULA 4DMKA 4JLMA 1Y8RB 2ID7A 1RJDA 2ZU0C 1WHTA 4KXQA 1U0TA 4URHA 4BVEA 1NOJA 1U9IA 1YQGA 2HRBA 3GZ4A 4PVDA 2OFPA 3FNRA 4ESEA 1WULS 3H72A 1INVA 2QRLA 1D03A 3MUOA 3E1KA 2QU8A 5AM4A 2ZE8A 3JZDA 1NXPA 2AEJA 3AJEA 2BAGA 3ETEA 2WWRA 3ABZA 2VXBA 3IP5A 4IJUA 1VBKA 3HEMA 2JBWA 2JGDA 3I92A 3K09C 2QYHA 1B6SA 1TM2A 3OZWA 4D57A 2ZRAA 2UKDA 4LHZA 3RT1A 4G0PA 3AFIA 2HT5A 4DOMA 5ECGC 4PLYA 2E37A 5JS7A 1WSAA 2EYQA 1N8NA 4L9RA 4WN3A 5JO0A 1R0RE 1RRFA 3BIXA 5LLSA 3V8RA 3JX9A 3IL2A 3DOIA 2WD9A 4ND8A 5EJAA 4E6PA 4HFRA 3D0RA 4DJDC 2H2NA 3SI7A 3SN6A 2OLKA 3FMPB 3L7NA 5ABPA 4MC7A 1KO4A 2FZCA 3T5BA 4X6KA 3U13A 1X2BA 4J75A 4ISBA 1VSUA 4KTVE 2EP7A 3TLZA 4IQKA 3TSZA 4LF7B 2HTQA 4B0PA 4Z7QB 2ZCJA 1IZYA 3PRKE 5MFZA 4JI2B 4QULA 3TXXA 3UHPA 8GPBA 4L72A 4A16A 5CK4A 4FKBA 4RZUA 3V7FA 1L7QA 1S2IA 1ZK4A 3QBTA 4PSVA 3I72A 2JK1A 2I91A 1XPRA 4QYMA 1O5TA 3CWQA 2DLNA 1OZ0A 3JQDA 2QGFA 2A0FA 3AV0B 2E6KA 2IXAA 1YHYA 4YT2A 1SXJC 2QMYA 4G5RA 4IRXA 3BK1A 3QVMA 4UBLA 4CDNA 1GG5A 3VI3B 4RC9A 5KYKA 1JHRA 2O8EA 4IZHA 5L4SA 1ENZA 2JI6A 1ECBA 4HEA6 3GRUA 5DDIP 5DM70 2C3UA 2F55A 4LC1A 1M3SA 3V7YA 1N3YA 2H92A 4P22A 3ZXXA 3NHAA 4KGDA 1DIBA 3PFFA 3S2ZA 4F0JA 2OK8A 3PGVA 5EWMA 2R7MA 3VOAA 4S0XA 4NFHA 1Q0UA 3CNQS 5FI3A 1CWUA 3DYVA 1HSOA 1GA1A 2WLTA 4UHBA 3JAKA 2ZIGA 4FS8A 1XTVA 1RAAA 1P8AA 1QHIA 3SEQA 5D5HA 2R3SA 2XNCA 3CVWA 1X2RA 3NWOA 1GKYA 4YDRA 4ZOEA 1UQTA 3CRMA 4OSOA 4WNCA 2X3YA 4N9WA 5G4KB 3S2YA 1XKXA 3V2GA 3TPZA 4RVCA 3VR4H 1ND5A 2QUHA 2ZYVX 3O91A 2ZWAA 5CU7A 3SLKA 2XKKA 1G59A 4KFCA 1EDEA 1RE1A 1B15A 3AVPA 1UWKA 1W34A 3GWGA 4YV1A 1FCJA 1W85B 3G2JA 1TEXA 3I2JA 4PHHA 3K8OE 5CJ2A 4F5ZA 3N2GA 2OHOA 3DP7A 4I55B 4DB2A 1QM5A 1GYPA 1P80A 1AXEA 5DHFA 1O0SA 1YJ8A 4PF1A 1TA0A 1BOFA 2GFQA 3CX4A 1XNJA 3HBAA 3A8TA 1E1DA 2BBWA 3EH2A 4XWTA 5I7WA 4BNMA 5INTA 3DL7A 2WM3A 4YT5A 2EC5A 1H8ED 3Q3HA 2W11A 3B5JA 4HLNA 4KO2S 2X0RA 5DU2A 5K0LA 3I23A 4QTXA 1U0RA 3R7SA 3LWDA 3R9IA 4CM7A 5HKLA 2M6RA 3NHKA 4JQCA 2PZLA 4CZ2A 3F6BX 4ZC1A 1H2EA 1J7KA 3PWSA 4H6PA 3C1AA 1I30A 3ORSA 3ZY5A 5FPHA 4KYIB 2BD0A 2XGGA 3ZH9B 1PRYA 1CJBA 4CKEB 1TPYA 4IRMA 1DTSA 1OLSA 4AJHA 4YRJA 4RZIA 3EPHA 1GZ3A 4MVJG 1GD1O 3LJKA 5E9QA 5HTOA 2DHDA 2XW6A 3VUEA 4AWAA 4C5AA 2PKEA 1YZFA 2Y1DA 1DUVG 4BTVA 5AT1A 4DMMA 2GVUA 3M5PA 1P5JA 2X76A 3IQWA 2IHBA 3UMBA 3X44A 3SLGA 4BV2A 3I6YA 1SCNE 1XDBA 3NHRA 4MP3A 1ZR2A 1SZCA 2ZIVB 1NR7A 1Z68A 3HHPA 1Z4OA 1HNWB 1CJTC 1QAQA 2Y1XA 1WCWA 1KI8A 1JU9A 2O6HA 4URWR 4FDTA 5AJHA 2D2FA 2D74A 4R1UA 5TGDA 4YPVA 1DDGA 5BSKA 3QE9Y 1PV4A 1QONA 3C3BA 3K0CA 2F1KA 2Y0PA 4KLNA 2YWJA 2G1KA 4X6YA 1KVSA 4A5OA 3FHTA 1KP3A 2ZBUA 4Y30A 4NE9A 1OBHA 5D86A 4JLVA 3DMRA 2OCPA 3OIUA 2X1LA 2HYIC 3IPXA 3JV7A 1DWPA 4YTEA 3S2FA 3UJDA 2ZJOA 5ICEA 1R12A 1QHFA 5A7GA 2WWGA 5KEIA 1GZ6A 1E62A 1N1EA 2R8BA 4B81A 4U2FA 4CLHA 4TXJA 3TOVA 1E4YA 3SFZA 3PUJA 2G6TA 1FQKA 3NO4A 5CXSA 5J4KA 1FX0A 3H1EA 5AVYA 2OFOA 3KVOA 1B8OA 2NLOA 2IS6A 4KIJA 4RAOA 5FTMA 4FR2A 2O2CA 4US2R 4YAEA 4A82A 4U9UA 4C4SA 1GNPA 4NAHA 5ILOA 1X8LA 3BXGA 4ZT5A 3DE1X 1RHRA 5BUQA 1VM6A 3EHDA 4PIPA 2FW6A 1TRKA 2CKMA 2DHQA 3TH5A 5KWVA 3ET4A 1DU4A 3ZWDA 1L9XA 2E4WA 4CLXA 2XN4A 1TU4A 3E15A 3GMIA 3LFUA 4IOMA 1R8YA 2AL7A 4Y1EA 4ZEXA 2Y3IA 4Y6PA 7MHTA 2JBAB 1L5RA 5HGJA 2V7TA 4P35A 1DV1A 2V96A 4K9KA 4JSTA 4BNXA 2OG1A 3EIEA 4DT1B 3N3BC 4HY3A 1G16A 2Z58A 2Z95A 4GR4A 5ENZA 1QG0A 4I50A 3TTTA 1E66A 3P2OA 1MFZA 1J6UA 2E7ZA 2A5DA 3AVQA 1J4AA 2H6EA 2IY9A 4KVFA 5HKOA 3CCCA 1AMNA 3BXHA 1EFHA 4D9KA 4EPRA 3K73O 6REQB 5JLAA 3RB8A 3FRJA 1G5TA 1MP0A 5BWNA 3KD2A 1VCOA 3OUTA 4GM1A 4FQ8A 1RPZA 2F43B 3FGPA 5B58T 3MRVA 3RS0A 3D6UA 2O8FB 3I05A 4XQEA 1EUCA 1KAHA 3W34A 3WGIA 1K3TA 1DLIA 3A6JA 3BXFA 3NTQA 4HL6A 4LRWA 1E6EA 4V02A 4WOJA 2F67A 4RDXA 2PJZA 3T7JA 1JZTA 4Y98A 3TQQA 1A72A 3QGMA 5LQKA 3RYTC 3UGTA 4RFSA 1CT9A 3H1BA 4MUBA 3SF0A 4KFRA 3WFZA 4CPDA 2KQUA 2VP3A 4EA6A 5FOWA 5TF0A 3NONA 1H6DA 2VF7A 3GFPA 3TQRA 5HJ7A 2OORC 2D1SA 3A6ZA 2GZ3A 1IJKA 3OHPA 3SILA 4EH1A 2C3PA 1BFDA 2Z3WA 3JYNA 3N2ZB 4YN3A 4R5HA 4AKIA 1QCYA 1NKSA 4O2BB 4XYXA 1INGA 1JFVA 1EAMA 1IB6A 1L4GA 1YR2A 1XTKA 2XLBA 3E3MA 1NQAO 4FIDA 1US8B 2MSEB 4NESA 4Q3KA 5JCJD 2J41A 3CX8A 1YRYE 1JEQA 2XGMA 3LKVA 1M33A 4DUYB 5B7PA 1NVEA 1SO8A 3HPQA 1MC5A 4L8LA 2FPIA 3IDAA 4R9RA 4RVNA 1ECJA 2HU5A 1AQLA 4HWSA 1VL2A 2DPMA 3VR5D 3S8VA 4HRXA 2YWEA 2HIGA 4MGYR 1Q12A 1ZNYA 4LQ4A 3V9PA 2I3AA 4FNGA 5BORA 2QJWA 3A9UA 1V8PA 2FQWA 4FN4A 2QI9C 2KBFA 2YIMA 1TMGE 2WD7A 4IGFA 4JJKA 4TTQA 5BWBA 1MD9A 3M6VA 5IT9A 3R4CA 5EMNA 1TKRA 1KYZA 1E1NA 3EGXB 4LQCA 4O5TA 4GWKA 4X1OA 1BA3A 4Y0VA 3Q7RA 2QLNA 2EZ9A 3PIDA 4KNWA 4P5PA 4QNPA 3FCOA 4GM4A 4MCHA 5E1DA 3F1KA 1GUZA 3UWDA 1G291 1PW5A 5HFNA 4EKEA 2UZ1B 1SC6A 5D3KA 2VTVA 3OBIA 3WRVA 3QKRB 4DN6A 2XUFA 4ZI7F 3AOEA 1O6GA 5E7QA 5KYVA 2QORA 4P31A 1NVBA 3OCVA 4QDZA 3ZHUA 2H9YA 1J20A 3E6AA 1XZAA 4KKXB 2XWBF 3RVPA 3WP1B 4EKNB 1ZHOA 5BWMA 1Q0HA 3FD8A 3UAXA 4IWXA 1IK4A 4NFLA 3E1GA 3W2GA 1ORTA 2I65A 1OR8A 4I81A 3ADCA 3OQOA 1BA2A 1OI4A 2PQ6A 5A4DA 1EIZA 3W8RA 4MDEA 3NOOA 2BMAA 4YRDA 2V1UA 5JMTA 5FB3A 3RARA 3ADBA 4KL8S 5IKEA 4WE3A 3O4VA 2FR8C 1D1QA 3U3KA 2C5GA 3U19A 1G7RA 3OF5A 1EXDA 2JGRA 3LF1A 2AR7A 4HB4A 1D2CA 3PLNA 2EOAA 1LPAB 5E9WA 4X71A 1QIGA 2PBFA 2KM1A 2GN4A 3AHDA 3GELA 4MMYB 2AJDA 1HEIA 3LZDA 2NUPA 3PQ5A 3DOOA 3P0HA 4PHGA 2A35A 4AY5A 3OJFA 1INLA 2Z6UA 1FNSA 1U0EA 3Q7SA 2PX3A 2Y2VA 1P29A 4MVJI 4PRKA 4YJHB 1I7DA 2ZZNA 3A1DA 4UQPA 3RSZA 2H17A 2JGDB 1S2GA 2NV6A 5FWYB 4CMIA 4I5EA 3E7XA 4ACBA 4KYVA 4XJ9A 2WZCA 1WQ4A 3OTQA 4J1TA 4K46A 1VECA 2E4AA 1NBME 1VJTA 4MQMA 5J3JA 1XTZA 4G1MB 5A9SB 2E48A 1KOGA 1TQDA 2Q5FA 3MJHA 4F4FA 3GUVA 3RS5A 1UOPA 3M3PA 1ZKDA 4AS3A 5CYOA 1PCXA 3KTDA 1THZA 2HXYA 2QE8A 2H06A 4DCJA 3SANA 4ND8B 3HFGA 2WFAA 4IV5A 3T5MA 5F5NA 1W4BA 3PDJA 2PBLA 3W3AA 4HX9A 4KN9S 3W6OA 1KE1A 2J5RA 2PUBA 4X6LA 1U2RA 4RVSA 3IHTA 1NF2A 3TO5A 1LF0A 3VHLB 2FX2A 4I99A 3BRQA 3WS7A 3HFRA 3EBOA 1KDOA 4O3FA 2QWIA 2JGKA 3ND7A 3CKZA 1TMOA 2GZ1A 2FDXA 3VDMA 2BKEA 2ZREA 3P9XA 4JBWA 5BRAA 2H2IA 2CZCA 3U39A 4RENA 2X7JA 3WDMA 1INYA 2X1HA 2EZUA 4TMYA 5FPTA 1UBRS 3D6NB 4BBAA 4DSUA 4EJ6A 2I78A 1TK2A 1N6OA 4OFBA 3GW8A 2A92A 3W2FA 4F11A 5JZ9A 4C0QC 1PKEA 1VRVA 4OKNA 2RHLA 4RE6A 4B6SA 1KMIY 1WF6A 1P1IA 1K6JA 3Q15C 3Q7PA 4JP1A 4IUYA 1F2VA 3O1IC 5EQFA 2O8EB 3TLKA 5THKA 4ZU1X 1BMFA 1H65A 4RBNA 3BJZA 2IU3A 1IRXA 2XTAA 3EIQA 3FTDA 4U2CA 4YMIA 2FRXA 2XMPA 3QVJA 4JQOA 3GJ4A 4IW3B 2YOFA 4UASA 5FV4A 1T26A 3CRNA 2G7ZA 2WAXA 1R0WA 3FWKA 4UDNA 4V2IA 4DLBA 4NOKA 3ZWPA 3GDOA 3LH5A 4LSZA 1AOXA 1U3WA 1IG0A 4QNRA 4JVSB 5L7TA 1B6GA 4UTXA 1QC5A 1FMCA 1MO5A 1A98A 1ZLYA 5FWAA 5B1IA 1XZPA 1Q3TA 4IILA 4HWTA 2BZ1A 1XZGA 5ALEA 5CA1B 2OENG 2ECPA 2PLRA 5AVWA 1TQ8A 2IZZA 4GSLA 3AUYA 2RGDA 2B30A 3SZMA 3Q6MA 1TYEB 1ADYA 2QWEA 1J0AA 2PE5A 2H1CA 3K4QA 3ORFA 2QYSA 3Q7QA 3JVEA 1E4EB 3RUHA 1TJ4A 4C0KA 3N2GB 1XNHA 1FRNA 4B73A 3NFRA 3T06B 3JALA 1R9MA 2QDKA 3DE7X 4BEBA 3RASA 4QPJC 1Z25A 5JD5A 1AGNA 2G9QA 5K8UA 1PR0A 3PDWA 3NGMA 3C24A 3QHQA 1CUXA 4GSYA 4ZXFA 4LYEA 1QCCA 4H7DA 4BVAA 3ZHCA 1GZ4A 4G1VA 1DEXA 4OTZA 2DPXA 1CLUA 3FLEA 4UREA 2FE4A 2R2AA 3K15A 2X19A 3H2JA 3L84A 3FPEA 2FK7A 5E4JA 2XT6A 3P0FA 4TQAA 4LF8B 2GLXA 3MWYW 3Q87B 2WQ7A 2AMFA 2VF5X 3R9WA 3VU8A 1NW6A 3FB4A 1KA9H 5EWJB 1QHEA 2FDCA 1YZUA 4F4CA 1JVNA 5KC8A 3KUXA 3VC2A 1OLSB 3LG2A 1D6SA 1AZLA 4KXVA 4RGVA 1PP4A 4XASA 3QEAZ 4GZ5A 3VPCA 3IUPA 4UAUA 5DEIA 5LYJF 2GUGA 4B4UA 2Q5QA 1JPVA 4F3CA 1FS4A 4HLCA 4JJ7A 2NNLD 3G0GA 2J87A 2Z8ZA 3DDOA 4RVFA 4KUHA 1OIVA 1U7ZA 2H1WA 2IDZA 4XOGA 3IB3A 4NTZA 1FQWA 2F28A 1JHXA 5EXXA 4GI5A 3FSEA 4Q9JA 1XTQA 3VR6H 5BN4A 3M3HA 4MKHA 3NDRA 4WT7A 1TCAA 1R66A 2JFQA 1FDRA 3Q6TA 1A2QA 1GTZA 4GZXA 2NVOA 4PZAA 4ZC8A 1A7KA 4JI3B 5BMVB 1CRZA 3A0UA 4IUBS 1JTVA 1YA4A 3RRNA 3TSWA 4RPKA 2OHFA 5FH9A 3DC2A 3HKBA 16PKA 4TV8B 4Z4EA 4JUCA 4BDTA 2Y1LA 3C6XA 4IRUB 4LXUA 3S94A 3AMVA 5GZ3A 2NYVA 1QAMA 2Y0CA 4DNOA 3MOSA 1T3HA 1LRJA 2FQYA 4XCVA 3RTAA 3TB4A 3E2MA 3OIVA 4NOLA 3ZTTA 5J47A 4HGNA 5C35A 4JR1A 2VCEA 5C34B 2ID9A 4O1HA 1SU8A 4S0ZA 4JC8A 4JT9A 4YQZA 5DBFA 3U1TA 3U7HB 1U7DA 4AY4A 1C1XA 3R2JA 3O4RA 4JC4A 2VRNA 3SAJA 2POCA 3B36A 2O0HA 3LX8A 2ZJ2A 3QVLA 1U8CB 2XRYA 1DBQA 4R9UC 4ZHSA 5KUTA 1EGMB 3DLIA 4LZZA 4MW9A 4EDHA 3LC0A 3DT8A 3V4SA 2EGGA 5JBQA 4F1WA 1WCXA 4Q82A 4DR4B 3R5SA 1A9YA 2OFXA 2FLUX 1GQOA 1SJ9A 1XQXA 2C59A 2FGKA 3VNQA 1N7DA 3CLKA 1LLDA 2NSJA 3NORA 3OQ1A 5ESXA 1A76A 3T7AA 3IR6A 4I50B 4O25A 2GWRA 1AUOA 3PV0A 1EFDN 4QN3A 4DY4A 2F8LA 2GCPA 3JQ7B 3TD6A 2IUUA 4M1YA 5E3HA 5K6RA 3H5AA 4OQLA 1DO8A 1NYTA 2CXTA 2J5BA 5CIYA 2E6UX 4OREX 3F2IA 3UK0A 5LZ4A 2F10A 1R0ZA 2ZJ6A 3D12A 5K8TA 5J5CA 1GU7A 1H5QA 2XCLA 1YOVA 3S70A 5F98A 3LLSA 1KNQA 3E81A 4HQOA 3D7RA 1NLYA 2R5FA 2J0EA 1VMIA 2HRCA 2J0UA 2L69A 2QRPA 1EU1A 3COWA 4TKUA 4V0NA 3RBAA 5THQA 5BPFA 3FR7A 1DXHA 2O4CA 5EC8A 4GMKA 4MCIA 2CD7A 4K6KA 4LBWA 1C7JA 3G1WA 2P27A 3G17A 4DSTA 2EJCA 5CFMA 5FTWA 1PTJA 3PR2B 4FYIA 3OLVA 5JFTA 3MXTA 1X77A 1KVTA 1TF5A 1XB2A 3VA7A 2G1UA 1W8OA 4LY6A 1XRJA 2PS1A 4K7JA 5JQGF 4TL7A 4M7PA 1RWKA 2H4HA 1XOGA 5AW5A 1U7HA 4B7ZA 1ZESA 4XVCA 1VE1A 2C07A 3W6PA 1KWGA 3D5QA 4CM9D 1GEEA 3O4FA 1JEQB 1RPJA 2HYDA 3WWDA 3K1JA 4EYQA 1M67A 1K08A 4ACAA 2CF5A 4WXEA 3Q2IA 3EVZA 2FKNA 3EGIA 3L05A 1O9HA 1ZRNA 3RRYA 3RVRA 3M6FA 2CFIA 2FOLA 3K0EA 2WWHA 3EFHA 4MUEA 1IAQA 4CU2A 3NNNA 3EGWA 2QWJA 1HWYA 3ZVMA 1U9CA 10MHA 2WF8A 3MF4A 1DT3A 2BFPA 4Y1GA 4FPKA 4YAUA 3KOXA 1OWLA 2I6FA 3MJSA 3PQCA 4MQ6A 5D3MB 1FVXA 4COOA 1M0EA 2IHUA 4BZPA 3A1NA 5B30A 2XCYA 1CFZA 2HCRA 4Q1AA 2WD7B 4UU7A 5ALMA 4F7WA 3FPJA 1FTSA 2F25A 1YZKA 3P9YA 3E9YA 1ATZA 4YMGA 3U7EB 1EK0A 1Z4MA 3ZD6A 5DNWA 2FMHA 4A91A 3O2QB 4OP3A 2G9UA 1H3EA 2X0FA 5K0ZA 3FBWA 3PICA 4C6SA 1HT0A 4MWJA 2AZXA 4D8TA 2AKAB 2BGRA 4TSKA 5D5QA 3HWWA 3ZY6A 2ZS7A 4M22A 1VE7A 2HQ1A 2MSLA 4MLDA 3WVNA 1M2VA 1WWKA 3FPCA 4H2DA 4LE2A 1SQ5A 2ZRHA 1SXPA 5ALKA 1YTLA 1G8JA 2MR6A 2WDPA 2I8CA 2IF0A 3QE0A 3AI1A 2J6CA 5TIIA 1DAOA 5K20A 3CCFA 1AKMA 3PWKA 1L7NA 3A26A 2PMEA 2BW0A 3LLCA 2JNWA 3FB1A 4IPTA 1KDYA 1T4CA 3H5OA 2ADMA 3ZOKA 5DMXA 4B17A 4EMSA 1U1EA 4BNTA 4N76A 3UJ6A 2JGMA 2V3WA 4DUGA 3VU9B 1L7HA 2WSBA 1BYUA 1GNSA 2I99A 3QU4A 1Z4YA 3GDHA 5D51S 2OCBA 5HQTA 1E2GA 3QY0A 1Z4XA 3Q88A 4UHFA 3SZUA 4JLKA 1BDBA 4IHJF 3SOBB 3QVUA 1O8CA 4OAQA 5BVHA 3QIVA 4HYEA 2QAGC 2H2WA 2ONZA 2WABA 2P2DA 2DH6A 3V4FA 1ZZEA 2QTLA 3WWAA 1J8YF 4Z2AA 2NUPB 1ZM3A 2WZDA 2ZE7A 3FUCA 3SC4A 8MHTA 1QHHB 4Y0NA 3BULA 4P3PA 1HTWA 4KIGA 4ADSG 4AMBA 1Z4WA 3A6KA 2Q9BA 4OHWA 3TTXA 3CBQA 1XA3A 3IQGX 2KHZA 1A7UA 1HFKA 1QCDA 1CJCA 2J1LA 3B89A 3K6KA 4K2HA 4N49A 1CJKC 2BMVA 2FN3A 1CQWA 3FWYA 3N7UA 5HKAA 3RKUA 2QX9A 3KPYA 1L6IA 1NJ8A 1NXQA 4JASB 1E0DA 5DE3A 1G4UR 1L5OA 1X8JA 3LKBA 3V1UA 3TLAA 4F2WA 5CB4F 1N8SA 3CL0A 4M1SA 3TLJA 5L6LB 2YWHA 4JUDX 2YV5A 4W99A 5K3BA 1M1UA 1CR6A 3DOFA 1K7SN 1NBIA 2QN1A 4XR9A 3QI2A 4DYHA 2OZLA 4D4IA 3TNJA 5JMWA 2VSFA 4UTOA 1N6KA 1AX9A 4D74A 3FTFA 4NF2A 7YASA 2JEZA 5T57A 4LQLA 3OF2A 4TVKA 3U4MA 5CT8A 1UFRA 2HA5A 3BX1A 1I8TA 2QN2A 4G5YA 3ZHXA 1GFSA 3CQ9A 3ZX4A 4BP3A 4EABA 3L7YA 4IDAA 3PX7A 4PCVA 1HLFA 2VJQA 3LCJA 3NIDB 3H3FA 3SVZA 3UC9A 5LL6P 4FDVA 3STUA 3SOQA 1L4EA 2A5LA 3RK1A 2H11A 3T3PB 4V38A 4F7DA 5KVQA 1HKHA 3VPDA 821PA 5MGNA 2HHAA 5IHXA 1A95A 3NT4A 3DMTC 4CGYA 3H99A 4QU0A 1GNTA 4ZO4A 4F1KA 4N0MA 4EA9A 1DKQA 2QIOA 3ZXSA 5KKCA 2G17A 5C0OE 4GHWA 2JZCA 3UCEA 3NIWA 4EYOA 1Q7GA 3WWZA 4H1UA 2XMZA 1XNRB 2P8SA 3TI5A 2GZDA 3K3AA 1V1MB 5DNCA 5KS2A 3IILA 4JX9A 1TT5A 2G7MC 2M32A 3ANLA 3DPIA 4MB2A 4XB1A 1AA9A 2OGSA 1U8YA 1QC5B 1JMKC 3UAOA 3WQBA 1U7XA 3MJTA 1V5IA 4AZWA 3UB4A 1J9ZA 1VPDA 5B53A 1JQBA 3RSQA 3TVYA 4BWGA 3H9GA 4DLLA 4PGGA 4K88A 3C15C 1Z8HA 3NEPX 4R54A 5AXCA 4YCCA 1T3ZA 5JOQA 1U6DX 4FZ3A 1QP8A 4C05A 2WKRA 2CBXA 3QU7A 2FPKA 4MRRA 1V9SA 1L1RA 1DJMA 5AVOA 2WTEA 3W4KA 2G06A 4RESA 2XSZD 2FX5A 1U2PA 2QJFA 4J3JA 4CTNA 4JJ6A 3AHHA 5DSXA 2C00A 3FNBA 4IG9A 4EEKA 1KSFX 3JALB 5TMPA 1CIJA 1Z37A 3UK1A 3GROA 5CRIA 5AUOB 1NUAA 3SJZA 5IF3A 2QN9A 1F2TA 2B5WA 4C22A 4GZQA 1ZNXA 3GJ8A 3VTAA 3RVQA 3H11A 2ZLBA 1ML3A 2GCOA 3N8HA 2WYVA 3H2HA 1V4BA 5DULA 3RCBA 3O8QA 4BWVA 3P27A 4B4OA 3ZHTA 1DC8A 4AN4A 3LK7A 5IXSA 3VDXA 4PCUA 1SBHA 3PBKA 4UMEA 1VJ5A 1K2VN 1UJ6A 3ENVA 3CW9A 3RT7A 5AVSA 3W2TA 2VP6A 5EHGA 5JXJA 4MZDA 4OHMA 3K71B 1NW7A 3IVGA 1XAGA 3DL2A 5JNTA 4RJTA 3SHQA 4D79A 2VA9A 5ALFA 5KWSA 5KSPA 3KZNA 4LF9B 1A1VA 4MVCA 1FEZA 5L95A 3CVUA 1JKIA 1X7YA 3M4ZA 3PP8A 3STXA 4MWOA 1HE8B 5ESDA 2BH2A 5HDQA 1WZIA 2WYHA 4R1NA 5I4CA 3MWGA 4M9SA 1UM8A 5KVSA 2LPMA 1GTL1 3ZQ4A 4ES6A 2DCUA 3TNYA 1ZX1A 4PLTA 3A2NA 2ILVA 4B47A 2QN3A 3SFVA 1TOAA 4CCAA 2O6LA 3KLNA 3HKBB 4DJTA 1UBKS 1P9RA 4MS1A 4FONA 2YJZA 3F47A 3AV3A 3CEJA 5E6UA 4AWXA 1GRVA 2D7DA 2C0CA 4TS3A 4E7PA 3SSOA 3B1YA 4EW2A 2FSIA 3ONEA 4LPKA 3WMFA 1KQPA 3DEFA 3H8VA 3WK7A 4AF8A 1RZRD 1YVUA 4JQYA 4KRFA 2HGSA 3TM4A 3A14A 5CFOA 2XUAA 4CDGA 1H66A 3IXQA 1O6ZA 4ZKDA 2YMMA 2WT4A 4I46A 4TWIA 2IPOA 1RJWA 2JD2A 2OHXA 4PLGA 3Q8LA 2ZIZA 4GG1A 5DVZA 1G8MA 3FXAA 2HD4A 5B4VA 5LLTA 4KKVA 4DR6B 3BRCA 5KNDA 4GZLA 1Y7PA 1D0IA 4KLRA 4TMZA 2A5FA 4XYMA 1DT5A 5HUNA 3GJ5A 1SUWA 5KOJA 5FBVB 1YKFA 1IXYA 1YO6A 3HXOA 1KYVA 1QPGA 2WSIA 4O2RA 2AF3C 3AIOA 2IE0A 2HIHA 3AUTA 5A4JA 4DLUA 3OOHA 3WKAA 4G26A 3UW3A 1XOIA 4G0NA 1G5RA 2XRFA 4P6VF 2ZT7A 4UUAA 1SVUA 1GN9A 1TK9A 4F4HA 1RJ9A 3BK2A 4TTAA 3WNCA 4JHXA 1ZVKA 2NTJA 4RQAA 2OCDA 4ZCSA 1P44A 4FIZA 5E1OA 5A5EA 2JAPA 2Z08A 2CXHA 2FN7A 4KAFA 1JTFA 5JI3E 1TLLA 3G2NA 4IXNA 1DZIA 1FDWA 1P2BA 2F00A 2JFPA 1G8AA 3TIIA 4ZGWA 1NV8A 1NL3A 3SIWA 3SHVA 1YOVB 3C14C 2IWRA 1Z0DA 4E4RA 2ONJA 5AVQA 2J0UB 5IBPA 2XZLA 3Q7IA 2PL1A 1OAAA 3NHUA 4TKUB 4LYJA 2CB0A 3H6GA 4BZXA 3OIWA 3CEHA 2GF0A 2Y99A 1M0TA 3OICA 3I0MA 1T2AA 4AKTA 2GEBA 2JASA 4H17A 1DMSA 1Q74A 3NPMA 1Z2NX 5EMKA 2C31A 4QVKA 3JZIA 4LQDA 1JSXA 4W63A 2C5LA 5A4AA 3MK31 4OUKX 1JQ5A 2F24A 1G42A 1W5SA 1X7WA 1XELA 2PU5A 1DAMA 3BZWA 1U9IC 3EGCA 4GQAA 4MZAA 2VZEA 2ZWOA 2ZI4A 5FOSA 4BJ5A 5AKLA 4CXMA 3BCRA 4W5QA 2C54A 2EXXA 1L7MA 2CFCA 3B52X 4ZFNA 1P2GA 3LT4A 3LUDA 3OE7D 3NPAA 4WOBA 3L7LA 7AT1A 2RARA 4KQ2A 5I4KA 4BFXA 3SEAA 3W1EA 5AW3A 1ZR4A 1HEUA 1YB5A 2YFQA 2BUCA 2AF4C 3NVDA 3OJOA 4IJKA 1C3JA 3PGA1 4XLTA 4WKOA 4KVZA 1YAHA 2P9YA 4KHZA 3KVYA 3IMGA 4K6OA 1TK3A 1M66A 3GAFA 3KAKA 4LK3A 4ENWA 1QP0A 3QPCA 4MYRA 4OD0A 2NUTA 1RAFA 2YXBA 5TY0A 4EMUA 3PU6A 1V1JA 1E6LA 1WM1A 2B2XA 4TUYF 4GP9A 2V6BA 3N0RA 5FUXA 1PJBA 3KLBA 1O0BA 2D4HA 2ZUEA 1VB3A 2C8KA 2C7GA 2NXCA 2V0NA 2QRJA 1J07A 2R1UA 2ZS8A 2C2HA 3U7JA 2CXPA 2PYDA 1OILA 4KBGA 1FVOA 4II2A 3UXEA 1NXVA 2PNJA 2G67A 3W4JA 1SKMA 5HIJA 5EJ5A 3D4PA 1TYDE 4MAAA 1W46A 1KMQA 2MIIA 2ZVJA 1P1FA 2FSSA 2GFHA 2PRIA 2WE7A 4UJ5A 4YEDA 5KDLA 2GZHA 4FD2A 4XJTA 3KO8A 1RC8A 1G38A 1RSZA 2EFDB 1ORWA 2I2BA 3QEOA 3WV4A 4DG5A 5DX0A 1M2VB 3P7MA 1R0CA 4JIGA 4JJIA 3S68A 1WCSA 1UDXA 2VDJA 1HMYA 4J6FA 4B2PA 3QSYA 1FUUA 3FPKA 4NCHA 1JBKA 3D2CA 2JIZA 1CRQA 4HZVA 1GZ5A 3HYNA 4MGEA 4X24A 3A25A 3VTKA 4B7UA 4DBLE 3T4PA 3TGWA 2IZ5A 5ENDA 1UMDA 1DBVO 3U0SA 4RTKA 1MX3A 3GH3A 3PEYA 1BHSA 2EJTA 3U3JA 2GHIA 4M0UA 3DCJA 5H4GA 1U81A 4CDRA 2VW1A 4QDKA 1LB1B 4AIRA 4ND6A 5CFLA 4Z0PA 1DZ3A 4KX3A 1XL0A 4ZANA 1IY8A 3TRKA 4EZBA 2FOXA 2R6HA 5FA5A 5EESA 4ZEVA 5BVHB 3HLYA 1T5HX 2B1RA 1XCBA 1LC0A 1LZKA 3BH7A 3NUZA 5JY6A 2LKCA 3SY8A 2WUGA 1PK8A 2LTAA 4GZMA 5EPEA 4D4LA 1OLOA 3ORQA 1Y48E 1XFAA 2Q6TA 3IEMA 1ONBA 3TRJA 5FYQA 3SLIA 2Q49A 3AEUB 3ENNA 3EZ6A 1QRTA 4LRSB 3WK5A 1CSEE 1XTRA 3PQ7A 4HZUA 4A73A 4ENRA 3A31A 4MWZA 3HWX1 1NZJA 4R7GA 4OHZA 2E5LB 1X0XA 1Q1NA 3H04A 3ESZA 4IV0A 1J0DA 4N8DA 2QI9F 4V2UA 3SHOA 1HYGA 3RIHA 3R9XA 1Y9EA 2FG7C 4ARIA 1R4NA 3OJXA 3QV2A 4DPLA 1ZH6A 3A3YA 4CL0A 3A9GA 4QC2A 3CLUC 3F3YA 3PI6A 3UK7A 5C18A 1PR1A 4GMXA 1E3MA 5GAJA 4XOIA 3CN9A 3Q2KA 1G21E 2IRWA 4K3UA 4Y6GB 5BR8B 4GPIB 1ADGA 2WV9A 3ELDA 2UYQA 3NTOA 3S2SA 4Z4CA 3ODPA 2C4WA 2IEBA 3QVWA 3WMGA 3RU3A 3MELA 1BAPA 2QRZA 4JMPA 5I3ZA 2UYYA 5HF9A 5KBYA 3WXBA 1L2TA 4ILKA 1U7WA 2NZVG 3RHZA 5M5BA 3ENQA 2E85A 1JN0A 3K92A 3R74A 3BTUA 3HJAA 4RH0A 1SC3A 5DX8A 2F12A 3BRSA 4ZVRA 4W5NA 4ZI2A 1MPXA 1QHSA 1SOWA 2FMKA 3T1OA 4LWOA 1NPEA 3EG9A 3GMTA 4KVGA 2QL7A 3LXRA 1EYZA 3IX7A 4N3BA 1KO1A 3A28A 3S2KA 2FLKA 4CM6A 4JSYA 1IN7A 1PHPA 2WW8A 2Q4EA 2ZTUA 1YJAA 3F7OA 2ORIA 4LV5B 1X1QA 1RYBA 3WB9A 1OBOA 1RHQA 2DULA 1XKLA 5GP1A 1N1TA 1JHZA 4NG5A 4G8JA 3DM9B 3L0ZA 1HE4A 4YI3A 4BX9A 5AW2A 4A27A 3PSHA 1JVSA 3KEOA 4Z7NB 2PD3A 2V7EA 1YC5A 2W5UA 3PCRB 3TQTA 1Y3DE 4L7VA 2WJWA 1XZLA 1YWGO 3ZTYA 3KS9A 3N87A 3EAGA 3ZQKA 1PEKE 1QDEA 1CX9B 1TT5B 4Z1MA 5K8IA 4IKOA 4BN5A 1Q1EA 5EUBA 1J24A 1JP7A 1CERA 1O2DA 1TLTA 2WBLC 4MA0A 1L5HA 4E22A 5EJ8A 1GCO