2HQSA

Crystal structure of tolb/pal complex
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
412
Chain Sequence
b'VRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYLHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein tolB
molecule tags Transport protein/lipoprotein
source organism Escherichia coli
publication title Molecular mimicry enables competitive recruitment by a natively disordered protein.
pubmed doi rcsb
total genus 109
structure length 412
sequence length 414
chains with identical sequence B, D, F
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04052 TolB_N TolB amino-terminal domain
A PF07676 PD40 WD40-like Beta Propeller Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 2hqsA02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 2hqsA01
3Q6PA 2FP9A 1NPEA 3SREA 3DASA 2V91A 2IASA 3Q6TA 5GX1A 3KYAA 3SOBB 3SOVA 1C9UA 1C5KA 2DG0A 5FWWA 3G4HA 2IARA 5EX7A 3HRPA 1POOA 4IMBA 2IAPA 4HHOA 1H6LA 4A0PA 3S2KA 2DSOA 4PWZA 4GN7A 3S8VA 1V04A 2GVUA 4ZLRA 2QE8A 3P5BL 3KGGA 2GHSA 3HLHA 4HHQA 3A9GA 5GX4A 4GNCA 4GN8A 3SOQA 4GNBA 3A9HA 4R40A 4DG6A 1Q7FA 3BYCA 2POOA 1E1AA 4O5TA 3AMSA 2OJHA 2W8BB 1CRUA 3WW9A 1CRZA 3AMRA 4HW6A 3SRGA 2HQSA 5GX3A 2W8BA 2FPCA 1QBIA 2P4OA 2IVZA 3Q6KA 3LI3A 2GVXA 3V65B 1CVMA 3FW0A 3LI5A 3TC9A 3IAXA 2G8SA 4JMLA 5D9BA 3I1CA 1QLGA 5D9DA 2GVWA 1CQ1A 3V64C 1RWLA 4IYGA 4O5SA 2IAQA 2VAQA 3G4EA 3LI4A 5GX2A 5D9CA 5GTQA 2IAUA 2ISMA 3WWAA 4Q1UA 3S94A 3S8ZA 3E5ZA 5GX5A 3FVZA 1RWIA 4GN9A 2IAVA 2IAWA 3U0SA 2IAXA 1PJXA 2IAOA 2FP8A 2FPBA 1IJQA 3V1SA 2DG1A 2GVVA 4GNAA 3DR2A 3O4PA 3HLIA 2IATA 1N7DA
chains in the Genus database with same CATH superfamily
4W4TA 2ORIA 4FS8A 4IVRA 5LYJA 4OBEA 3ESCA 1C7EA 1PNRA 2KBEA 1QTNA 4FZHA 1S9HA 2DUUA 5ETJA 2V03A 3BTUA 3CKLA 5DHQA 2HJGA 2IZOA 5JIBA 5LZ4A 1OT5A 4JXKA 3WWEA 2B99A 3KV3O 4GLOA 3A06A 4MCIA 1L4LA 1YHZA 1M8GA 1EJ2A 4D4GA 4UEKA 2GN6A 2C61A 4BMNA 2C29D 5F9FA 3GRKA 1J09A 3H0EA 3L84A 1G59A 5FUQA 1GUYA 4KFTA 2PD3A 3PZBA 1BJTA 3HCNA 3V3TA 1IONA 1BE6A 4MS1A 3A05A 1N6FA 4C1YA 2ZM5A 1P9LA 3O38A 3T5MA 3UB4A 4JITA 1UBEA 3B6KA 4YJ2B 5TT0A 1EPUA 4Q7KA 4DLRA 3IJRA 4RZIA 2CDCA 2VQDA 4O2BB 4WK4B 1NX6A 1K86A 4OHBA 3LGXA 5DGXA 3TLXA 1V4BA 1WHSA 2OP0A 3ET4A 5EYPB 1WW3A 4C22A 1P6QA 1RWQA 1VMEA 2MU1A 3IE1A 5BNFA 3PWSA 3SSOA 3ZHYA 2BSAA 2H92A 4DFDA 4F45A 1BGVA 4L0MA 4P38A 1PDOA 1JR3D 3BWMA 5HVNA 1AXGA 4IKEA 2VK1A 2ZSJA 4QQNA 1OSNA 4YUYA 4AJIA 1H2BA 5BN1A 2CNBA 3PR2B 3DEYX 3MN1A 1NVAA 3T9AA 2HK7A 1K9SA 1JZSA 1WSBA 2BUAA 4Z0NA 3EDYA 1USIA 3QVOA 4UOUA 1Z4LA 2YR0A 3MCZA 2GN4A 3HKEA 3HSKA 4L7QA 1QRAA 3FFXA 3SBXA 1Y8RB 3WGUA 3HR4A 4R8MA 2J0QA 4HLUA 3ADKA 1E8VA 2VDVE 4ZZ1A 1SUIA 2ZUBA 3BFKA 3QPDA 5FWDA 2ZIWB 3ICVA 3UJ7A 2CFCA 1Z4WA 2J85A 2YMLA 2Z2YA 3FG9A 4URYR 5THQA 3QU4A 1MZ5A 4BU0A 1JG7A 3HB0A 4UD6A 2G83A 5IDXA 1WKCA 4AJHA 1H69A 3VSDA 1DJPA 1GRCA 4KE8A 4AJ4A 4F60A 4ZIRA 2OC4A 4LCEA 1JHYA 4L8FA 1RM3A 1VPLA 1D03A 3DWFA 1U6IA 3E03A 3ETEA 4I4LA 5B7NA 2I7XA 2AN5A 2QZPA 1Z37A 1J2TA 3DFKA 3D5TA 4BE7B 1VBKA 3NHBA 4D57A 2BJVA 3AX6A 5IW8A 1GPH1 3MLAA 5KHOC 1UEJA 5J4HA 2QX4A 4XGIA 2AXNA 2JIQA 1XPUA 3CR8A 1KKUA 1GSIA 1VHJA 4KXYA 4ZCSA 2CXHA 4YBRA 2ODAA 4DDTA 2GEJA 3WYFA 2I6TA 4UXHA 4DJTA 7REQA 3IOBA 4JLKA 3R0ZA 4PHHA 4Q3NA 4V0RA 3TM4A 4HSEA 4EYKA 1ZFNA 3BICA 1ZESA 4RHUA 1GVNB 3EBPA 4JP8A 3EVTA 4WNAB 2Y1XA 4GEGA 4EKDA 5DE3A 4Q16A 2C2WA 4GW3A 1Z4MA 3RCBA 3RFFA 3RRBA 4AJPA 5D8DA 3RHTA 4LZNA 5CT9A 1DKOA 4CMHA 1N33B 4CQJA 4L7BA 2LRHA 1T2DA 3LDUA 2FN4A 4YIHA 1F8EA 3IV7A 3A4MA 5HYVA 2QMHA 3SLRA 2G28A 4MWEA 5EI5A 1FYXA 3X2FA 1M6YA 1BHJA 2BLLA 4M4UA 3ZJUA 1NHGA 1ATZA 3WLTA 1BCRA 3AYXB 2B21A 3I76A 1AKTA 2FW1A 3AY0A 3SICE 2CXOA 4V0NA 3KYAA 4EA9A 3FOWA 4N6OA 4DM7A 5A4IS 3H72A 2H8GA 4V1CA 4GHWA 1OWNA 3G4HA 3H5IA 3I9JA 3SIXA 4AY5A 4XVQA 3L4KA 2MYTA 2QQEA 4UNSA 4L22A 4WHMA 5AJHA 4DL9A 4LNHA 4YJ3A 2BMJA 3I3OA 1PR5A 4MKHA 1GADO 2QLFA 1UP7A 1EG2A 4DQDA 5F12A 3TDKA 1IJFA 3KD2A 4LGMA 1IVGA 5A0VA 5DBGA 3DOUA 2DPGA 4PWZA 4QARA 1Y8AA 1Z28A 2C2BA 3MFYA 4K87A 2EJBA 2H7VA 3H8VA 1WM1A 1VFNA 3IIKA 2EC5A 4IF4A 4DNPA 4ZYXA 4IJ5A 2O8DA 5CH8A 4ZMSA 3UGQA 3E5NA 1Z6PA 4F4CA 2VIIA 5AHKA 4D5GA 2GA8A 1P0QA 3OQVA 1QYIA 5TS2A 3PJRA 2CJPA 2HJWA 2O7QA 4LBWA 3ICEA 3UKOA 5I4KA 3ZI4A 3C24A 1J7KA 1LSJA 2B1RA 1XZAA 1UBNA 3HBAA 4GNBA 1SUCA 2YWDA 3I92A 4UE6A 1AO3A 2PV0A 2FZGA 1ODCA 1VXOA 5E8JA 2XD4A 3R1IA 3R5TA 4HX2A 5L4NA 1ACLA 4CR6A 1FDRA 3C8HA 5AK6A 5AVOA 4ZEVA 3LUHA 3PFKA 1PUXA 3IB6A 3EZFA 5EEHA 4WXRA 1IN7A 3CW9A 2WM8A 4KS2A 5DOZA 3WIBA 4E03A 1FRFS 1QO0D 2OA0A 1TQ6A 5F33A 1CETA 3GAFA 2AEFA 1NQTA 3BWDD 2R44A 5CK4A 2AZ4A 1E0KA 1M0EA 5FXMA 2FPSA 3YASA 4DOMA 4E4TA 3LOPA 1H4TA 3IESA 1OZAA 4NU8X 4CIVA 1LD3A 2NMVA 5ECGC 2QRQA 4Q6BA 4MRAA 1LFAA 1JEAA 5ALIA 2IIBA 4PLYA 3WWPA 1WHTB 3WMGA 4N8DA 5JS6A 4P4NA 3IHKA 3S81A 4A1OA 4W8OA 3PNLA 3SEQA 2QAGC 1GYRA 1EJBA 2IZ7A 3WOVA 2JCBA 3U5ZB 4BV8A 1CUEA 5CVCA 3FGNA 2Q5OA 1J8QA 4LHEA 4WCDA 1QF7A 4GP7A 1KMCA 1E9FA 1OV6A 1Q17A 3MD9A 2LZ0A 1YJ8A 3DZHA 1EFRA 2WWWA 2NTYC 4TL6A 4PFKA 4ZOCA 1KDYA 3TEMA 1X92A 1DHRA 2ZE6A 3D43A 3QI7A 4RL6A 5FI5A 3KK0A 5JBNA 4WZZA 2VDLB 3OVMA 4AWAA 1AB6A 4OGLA 5K3OA 1CNMA 1MABA 3LWNA 3STTA 4CTMA 4DDWA 1US8A 5EZQA 1NJFA 3QLVC 1OBVA 1AKQA 1GKYA 2OCPA 3NHZA 1ZVKA 1R12A 3LWZA 3C70A 4QOIA 5K1ZA 4GN9A 1C7QA 4RY2A 4ESEA 1KDOA 3K6RA 2NPFA 4JXXA 2AYZA 4QUAA 4RE6A 1EFPA 1Y4SA 3ZWQA 1KHTA 4FKZA 2X8AA 3QA9A 1Y63A 1EHIA 1AA6A 4Z4IA 1INYA 1V1MB 3SQDA 3UGKA 4YHBA 1HURA 3B6MA 4DG8A 1U99A 5GVRA 4BQNA 1AG9A 4V0MA 3FYDA 5TQ0B 1UKCA 2CE7A 2Z98A 2OORC 3VYVA 2K7FA 4RF3A 2RG1A 4KAFA 2G80A 5KSZA 3DDHA 1EFRD 2QR3A 1V3DA 2Y6VA 2CT8A 3GGSA 2ZI5A 2FMUA 4HVLA 3DFZA 2WNIA 2A7XA 1UK7A 4H59A 2ZRCA 1NVFA 2BCJQ 5DHTA 3TW0A 2HT1A 3G1UA 3O74A 2PUJA 3FIUA 2ODBA 4MGZR 1DAKA 1DC5A 4DEXA 3QUSA 3S8YA 4IFTA 4X6KA 2OL4A 1JHZA 5ALNA 4BVBA 4EWLA 3I34X 2VPPA 4DV3B 2HA5A 4J4BA 2F7SA 1Y3IA 4WZBB 3TH5A 3PS9A 3VUFA 1R5OA 4MDFA 1L4NA 3GJ7A 3KUXA 1VIVA 1P1CA 2JCSA 4NCSA 1YRLA 4I5FA 4IHQA 1P4HA 4MYSA 3FYSA 1XHLA 1TA0A 4ZOAA 5H4GA 2LGJA 1JEDA 4MGEA 4LV8B 1VIYA 1PNTA 1PSDA 1ESDA 3LUAA 3I52A 4YDQA 2NZYA 4CPMA 2FDRA 4J07A 1T2EA 3W4IA 2YYYA 4ID9A 4HO1X 4YV1A 5KWIA 2QD5A 5JLAA 2Z32A 1WXEA 3FZQA 3IH5A 2H08A 3D6VA 1JHXA 4GXTA 1DKUA 1KYWA 3KHUA 2Q3DA 2QWXA 3EIFA 4BC0A 5LMCA 3SVTA 5AWFC 1JEQB 1Q7GA 2ORWA 5HMLA 4D44A 1V11A 3V55A 4K3VA 2AX3A 4OB7A 1VG8A 2ZPAA 4AG6A 1XZBA 1JG4A 3GLKA 4FBLA 2ZIAA 5AYVA 3V7FA 2GK3A 1LQUA 3F0TA 4QWMA 5EL0A 1RPTA 5D5PA 5HGXA 5FO0A 3D9QX 1ZS9A 3JQBC 3PVZA 4P7FA 4Y8VA 3K0AB 3R6LA 3L46A 4XPZA 1M67A 1QHHA 3QKSB 3H13A 1XLTC 2WYVA 2HT8A 3K53A 2WTAA 1Z8NA 3R2JA 4BU1A 3C6QA 3TSYA 5B4VA 3O9JA 2XRFA 3GDFA 3HB4X 3I2HA 4B33A 4R1OA 1YMUA 1J5XA 2XA9A 4JBWA 1SKUA 3ZVKA 3FTPA 1W8NA 3R7WA 1ND5A 3K9BA 5EQJB 4F6CA 4ZVVA 3G5LA 4QNNA 4BB9A 3F7OA 3BCHA 2IV7A 3SIPA 2QU8A 1HSZA 2VP0A 4FI3C 3R0IA 4KYTA 1GPDG 1AKNA 2RHBA 3PQ3A 4UHFA 2J87A 3WTBA 3OCXA 3WDKA 2BYTA 2YW2A 1R4MA 3OFND 5ALMA 2F3RA 1CFJA 4EY4A 2FMHA 1XQXA 4EW6A 1JMKC 3PJQA 3SX2A 1E8UA 2WVHA 5JMTA 1EFUA 2QZZA 1QBGA 2VF5X 5KQLA 2YINC 3AOEC 1ONPA 1TT5B 2BD0A 4MOWA 4J6FA 2VSFA 3CH5A 5TPWB 4IDNA 1IZ8A 4UCWA 3C5VA 4I3FA 1X9GA 5JDCA 1SOUA 3R8CA 2F43B 2FG7C 2FR8A 4H6PA 3N5CA 2XIJA 3U61B 1DIBA 2QTTA 3FCXA 4PAGA 4CGYA 4FUTA 1FNNA 1H1TA 4KI7A 2P62A 2AFIB 3QSYA 1T9ZA 1K1EA 3HFSA 3R3YA 5TNXA 3FXAA 5TS3A 3KKPA 1HFWA 1HPLA 5FA6A 5H5JA 1LNQA 1SELA 2VZLA 1DCTA 2HYIC 1VC2A 4A36A 4IFJA 1DMRA 3AYZB 2YV2A 3JWEA 4QBIA 1KY3A 2O2JA 1NLZA 2MR6A 1VL2A 3MYRA 2H2WA 4US1R 2XZPA 6NN9A 4CCWA 3UJHA 3I28A 4MV3A 2IDKA 1R4ZA 3HBJA 4HTAA 3SZGA 2JLYA 1GGKA 3HUUA 2KE5A 3TG2A 5BUQA 1OC2A 1YONA 1XNGA 1GARA 3DBVO 3WAJA 4O1IA 3TQQA 3SP1A 2FFRA 2QUAA 3GFTA 3AERA 4LHVA 2DT8A 5DTMA 2OV1A 3VNSA 2ATCA 4XOUA 1X80B 5ALVA 5LN1A 1YRYE 2A58A 2JJQA 4G4IA 2JAOA 2BFFA 2CWDA 1KI2A 1COWD 1W44A 2YJ6A 2ONZA 4M1OA 4AB1A 2YTZA 1PEKE 3TIVA 4G9EA 1J25A 2V7QA 4DIKA 5AVZA 2BAGA 3M4NA 5H3LA 1E96A 3EEBA 4KJZA 4PYOA 3UICA 4ZAFA 1NNI1 4PTYA 1SBIA 3BJEA 1M2HA 1CJCA 1P9WA 3NUQA 2XTZA 1THGA 3QH4A 4UATA 2GHSA 1YULA 2Z5FA 4YJ2A 3ZBUA 4TRRA 3E7XA 4MRSA 1PR3A 3ZI0A 3O82A 5BQ5A 2NV6A 5C8DA 3LPAA 1RJGA 3OPYI 3R9IA 3REGA 2WOJA 3LX4A 1IXSB 3F3MA 4RDIA 2DKNA 2OCBA 2PGIA 2IWRA 5DRTA 4B3XA 3T7KA 4E30A 5IKMA 5KQMA 3VHLB 5M5BA 3E82A 2D5AA 4P4TA 4EGCB 4FGKA 1F0KA 1OLOA 4FS3A 2WT9A 2NXEA 2YV1A 1P2BA 2Q3HA 4M0MA 2NZXA 2W8BB 4BVAA 1ZGBA 4I1YA 2VYQA 3IDSA 1CPYA 4HW6A 2OK8A 2Q4TA 3DGFC 5AHWA 1LVHA 1HNWB 4YRGA 4LZLA 1QO7A 1VLQA 5JS7A 4F3TA 2NTNA 1Y3FE 4P7GA 1Z34A 3USCS 1GTL1 1W581 2C2HA 1NQAO 1VGRA 1SVMA 1YDEA 1AZSC 1N25A 2QORA 1H42A 4H16A 1NWHA 4JJ4A 1YWGO 4JP1A 4MR8B 3VI4B 2Z9CA 4DMMA 3PGXA 1KU0A 5J2UF 2CHEA 3UHAA 4OQEA 2F6RA 4DDHA 5E7QA 2PL3A 4BC1A 4R1TA 3WYEA 3FMOB 1Q20A 1SXJB 2J3LA 3LO8A 3U80A 4ARZB 3N2YA 3JZDA 4LECA 3N2EA 1ES9A 3D3JA 3GNQA 3PYMA 3H2KA 1ETHA 4QRHA 2ORVA 2W2VA 1RJFA 3RYCB 4NJEA 1BJKA 4S1NA 2REQB 1X7ZB 2ZJ3A 3ZE0B 2DFTA 1DILA 2EBHX 2FW6A 3IUYA 1H9AA 2YH2A 2FEKA 3NHSA 2HIMA 1NW9B 3SQWA 4E12A 1S5PA 2OMEA 1FQWA 1SU8A 3EBOA 5HKAA 1COZA 2PXXA 4BO1A 2UUAB 3FFTA 4PVCA 4BB0A 1KMQA 3QWBA 2VRCD 2BGJA 4QXQA 1F8UA 1JKJA 4E5VA 5GONF 1DJNA 3ZJYA 1Y9JA 4L8LA 3PI6A 3K05A 3SR0A 2I1QA 4I1UA 5FRDA 3GWZA 3FWHA 1JBQA 5JD5A 1WVGA 1G3IA 4HWTA 1ADGA 2P27A 2G9VA 2V6BA 3FHOA 3EUWA 4X20B 5D3MB 5DMXA 4ZICA 1OAAA 2H1RA 5FH9A 5JCXA 2O3SA 4RS4A 4B2IA 3C6KA 3I9LA 3ETJA 2DG1A 1ZA1A 4I99A 2GTIA 4FOQA 2BISA 1G66A 1QP8A 4FPKA 2INGX 2J46A 3A58B 1QDLB 4EGJA 1T2CA 5JZ9A 2G1PA 3W2FA 1B8NA 2IASA 1UQTA 3A3PA 4AW9A 4CT5A 4KYUA 4DY4A 1DHTA 1KVRA 3R8FA 3DEKA 5E0OA 1Q57A 2ZIXA 2H59A 3IQEA 2X86A 1N6KA 3QMPA 1T13A 3ZY6A 4XQ9A 5KYYA 4QM7A 1HQKA 3N2GA 1V11B 3CGGA 1OXUA 3IAS1 4KXMA 1DFGA 1NDHA 3CCBA 1O54A 3CNBA 3BK7A 4KQMA 1C7JA 3NO4A 2XMRA 5EJ7A 4N0DA 4AY3A 3H6JA 5LYJB 2DHCA 2HF2A 3WWYA 1O4VA 4NZOA 4JI3B 2EJCA 4JI0B 4I5GA 3RW9A 1O95D 3E5MA 3WSWA 4RVDA 1DX6A 1J56A 4AMZA 5H9WA 3A6EA 1DFIA 4MIYA 1EX1A 2CD9A 2PRIA 1YE8A 2W6CX 2V58A 3MTJA 1UEXC 3W8DA 4P4SB 1U94A 3CGWA 1I1NA 3KZNA 3N8IA 2O52A 2VF4X 3IVMA 4O0LA 3SCZA 1H93A 1ZJJA 3JR3A 4TXJA 5HMMA 4H4DA 3N8HA 4BFWA 4M1EA 3TEFA 3OD1A 4AF6A 3QBDA 5DN6A 3D7SA 2QMOA 1GL9B 2BEUB 3S2ZA 5K8IA 2DH5A 2XNCA 4O4IF 3RO7A 2F4VB 1O96A 3RHSA 4MWLA 2Z5LA 3CUKA 2WB2A 4RAOA 1EQ2A 4MUBA 3R77A 4PX9A 3VRHA 2QTHA 5H3CA 2J3DA 4HWOA 4N03A 2RHRA 1M34A 1TT5A 3MQFA 1Q1AA 4WEGA 3P0FA 4YAIA 2PS3A 2XDYA 5DP2A 4XUCA 10MHA 2V9ZA 4YMHA 5LOVA 4N3CA 1A9PA 5AW0A 2C3YA 2IU0A 1C8LA 1AB5A 4BN0A 4CM7A 2NOAA 5JASA 2PBRA 1GYQA 3RAPR 1ESMA 2JIPA 5D86A 3VKGA 4GP6A 4XSHA 2ZCVA 2QUZA 3JQ8B 4MR7B 2H7XA 2AYXA 2FW9A 4R1MA 3U1TA 3K8OE 4A4DA 4H27A 3AF3A 4P53A 5KMGB 2QA5A 3ZXIA 2FZKA 1DAHA 3P4UA 5DTEA 5DGTA 2D5IA 2F48A 4TSFD 1GVHA 2JDIA 3UQYS 1XNQB 1R18A 2P5SA 1OB5A 3UUEA 4MVJP 1KAGA 3EXHB 2VYVA 3RQIA 5KDDA 1Q91A 1M75A 1YQEA 2PJUA 2W6QA 3OA2A 4A9AA 4C0KA 1LBSA 2E6UX 2WV7A 4BKRA 4ZC1A 3RYFB 1R0KA 4IIBA 1IN1A 3OX2A 4EX6A 1E98A 1P7PA 1L2TA 1TO2E 2CFOA 3GPBA 3KPVA 4RFSB 1H6DA 1JYSA 1JIUA 1E8DA 1SN7A 1NN5A 1ZHFA 3GDWA 1BA3A 1XJQA 1XWFA 1EE9A 3Q7RA 3H75A 4G1UC 4LJ9A 4W6QA 4CG0A 2RDMA 3HB5X 2XQJA 3DP7A 1GZ7A 3ES9A 3I61A 1EZ4A 1XELA 1XMQB 1H2RS 1NJ8A 1QOPB 5FUXA 1RXYA 2DFPA 2V9PA 1WTCA 1TCVA 2XHEA 1RWIA 3K32A 3MRXA 4XH9B 5JNSA 1JPNA 1I51A 1V43A 2FTKE 2J4FA 2Q9CA 4JUFA 3N70A 1KSFX 1RABA 5KQRA 4Q12A 5DK4A 2EWMA 3SY8A 4R9UC 1B41A 5JQWA 1OFUA 4EMUA 4KQIA 3HKBB 1R0RE 2J3MA 2X4GA 3C3EA 2YZNA 2UYOA 4LHSA 3ROZA 3NGXA 2OKCA 4YRFA 5FTKA 2VDWA 5FTNA 4JASB 3VTZA 4P34A 4R16A 1YR6A 4JEHA 3A9UA 3CNNA 2LVBA 5DRYA 1V3CA 4UPVA 1WP4A 2ZWOA 5FWWA 4CMAA 4YB8A 3WK9A 1KJQA 2VSYA 1GQQA 4D97A 3A26A 1SIUA 2H63A 2W2MA 4MRVA 5FWYB 1XCGB 1D0VA 1DBVO 3AEQA 2DYHA 2V7TA 1J2JA 1DG1G 3A9SA 3ESXA 2F11A 3PEWA 5KSPA 2VNAA 1MORA 1LK0A 4ZPXA 4A0RA 3A3NA 3GUVA 4W1SA 4N54A 4LRTB 3AUXA 3ZWWA 3ZHVA 3KT0A 2RAUA 5AKKA 1PDVA 3LD9A 2D0PB 1OFUX 1UXJA 2YBEA 3HACA 2V6IA 1AF4A 4J3NA 3EZ6A 4LJ7A 1X2RA 5HR5A 3CYFA 2R96A 1QK4A 1MO5A 4X8OA 4TSFA 2XE4A 5EMHA 4QDJA 2A1UA 1Y48E 3G2KA 1UC4B 5ALUA 3MOSA 5CURA 5EXTA 2VJAA 4HQ6A 1DQSA 1JEYB 2ZETA 4L02A 4L51A 2X1VA 2VYVD 1VP9A 4GI7A 4GX0A 5A3JA 1GAWA 3JQ6A 5BYJA 2XR1A 4TTIA 5ECWA 2O06A 2B1QA 5AJVB 3HKBA 2Q8PA 4PIPA 3QE3A 5HWSA 3OQNA 1MHTA 4JAVC 2JS7A 3QU9A 5GJBA 3O7WA 5GONB 3A4LA 3QE0A 3UM9A 3RVMA 3CZRA 1N9GA 1WY5A 5JE8A 4B35A 3M6MD 2JL1A 2CW5A 5LA6B 1RM5A 2GETA 2VL7A 4RDHA 1GOTA 1QGED 1K2VN 2R1TA 4FIZA 4YAJA 3ZDDA 3ICQB 1RYDA 3ETHA 3P1JA 2AN4A 3GHYA 5AI8A 4YP0A 5AK4A 2FQWA 4ZVKA 1R6TA 3WGQA 1AS3A 1RP1A 2A1TS 2B1GA 3HG7A 1V1RA 5C4GB 3BXOA 3RUPA 3FWYA 2X8JA 3I62A 3JR7A 2HX1A 5LBUA 4M0FA 1JJBA 1HV8A 1XHFA 4LPSA 1MG5A 1XLTA 3MT9A 3PT9A 2Q2WA 5ER9A 4HFNA 1TMYA 3HVUA 4U5QA 2VW0A 5E6RA 1H1DA 2LW7A 1T1IA 1WB6A 4B17A 9GPBA 5F23A 4XMIA 3UJ8A 2DBYA 3RU3A 3WLOA 3CR7A 2KB0A 5D87A 1N2CE 2RC5A 2WD7B 4AJ1A 2C7OA 4AY2A 2C2XA 2XE6A 1CYEA 1J1UA 1N2JA 4X3CA 2EJTA 4QN6A 3IB3A 3HBLA 4JF7A 3K0FB 3RBZA 4ARBA 4XCVA 1Y4AE 2V3CC 4C6RA 4BLRA 1ZA2A 5C8YF 2QP4A 4TMTA 3VR5H 2W93A 1CEYA 2DR0A 2XADA 4MVJE 4F8YA 4ND8B 3T41A 1K98A 1PN3A 3O73A 5EYPA 3TW8A 3GOQA 1TOAA 1HO3A 4M0KA 3VZRA 4CLOA 1J0AA 4CU2A 3PQCA 3FWPA 1A96A 5EN4A 3AI2A 3BN3A 3V8PA 4RTKA 5JYDA 4OIMA 3VNVA 2CHUA 2JJMA 3AHFA 1NC3A 2TECE 4GPD1 1SUFA 3L0PA 1GGNA 2XT0A 2P69A 2R6HA 2FFBA 1V48A 4JEUA 3H2GA 5C9ZA 3P9QA 1AA9A 1C3VA 4TXHA 1V1RB 5JSYA 2WFLB 2F00A 1OASA 2CLLB 2O2YA 3ABZA 4YMSA 1UPCA 5EXXA 4D4KA 3H8WA 3F6RA 5CVUA 3TI9A 2IS4A 4IO0A 3EN0A 2JGMA 5MF6A 4FP9A 3NJ8A 3VDRA 1RSZA 1NQUA 3DZJA 1KDVA 3JD4A 2HF9A 2YBDA 4NEQA 3V1LA 5CA0B 1IN8A 3EASA 4LOHA 4MV1A 1XVAA 1ZZEA 2C2OA 5BQPA 4WZAE 1VTKA 4MUGA 3GXBA 4BFYA 5KC8A 1ZDMA 2WFMA 4EHLA 1U3GA 1VG9B 1MU0A 3HJGA 1V45E 1E2IA 1GSHA 4Z86A 3UHPA 3LMKA 1E2MA 4WXYB 4IGAA 2GAFA 1M1YE 1D6MA 2P9CA 5SYAA 3V8VA 4MMZB 3OUUA 5CT6A 3OX4A 2O7RA 4R51A 3DOEA 4QQ8A 3D7KA 4I3HA 1JR2A 2QMQA 4I2VA 3L06A 5HDBB 2BBSA 3EVGA 4J0DA 3B9QA 5KWEA 1JSRA 3MINA 4UE3S 3E22B 2AN3A 2ARKA 5FR1A 3RAEC 3TIAA 1A7UA 1HDCA 1NBAA 3N07A 1NSFA 2Q7XA 5TT1A 1U6JA 1LLFA 2E5WA 4PSVA 2LDXA 5DIZA 2J45A 2G25A 1ZK0A 3MB8A 4HEQA 4HEHA 3IMEA 4IRUB 1BHQ1 1U2QA 5CCXA 1J9ZA 4O4HA 5KYXA 1G4HA 3H71A 3OLWA 3FKJA 2R7MA 3KTDA 2WYUA 1YZVA 2CXTA 2WT4A 5CYGA 3UHJA 3HYSA 4KO1S 3UAVA 5JAOA 3SKXA 5B58T 3TTVA 4GRIA 4PO8A 2EQAA 4R54A 4Q48A 2PLRA 3EARA 2VSKA 1ZMTA 2ZI6A 2II6A 4XDYA 3ZCPA 1D6NA 3SDBA 4Q93A 3F49S 3FZYA 4JJFA 4MWTA 4OHKA 4TRJA 4C1BA 4JWTA 4HB0A 5ADUS 2YA5A 4TYMA 4AVYA 4UNIA 4NJEB 4HZYA 2HD4A 3W6UA 5ELXA 3R3XA 2VTEA 3CONA 3B13B 2GHTA 4B0PA 2VRWA 1EDDA 4DLKA 2P2GA 2AR0A 4XWGA 4RTLA 2EX4A 1F17A 5EXSA 2FY8A 3ZY2A 1E3JA 4CUZA 3MTIA 5DWDA 4J8PA 4WBXC 5INTA 1H1LA 3C74A 2JARA 3HPQA 4YJGA 4ZHQB 1FFSA 2R66A 1QZ3A 1RAFA 5FKJA 4R81A 1AUQA 3Q0TA 5SY9A 2XRZA 4UJ5A 4EHNA 3OJWA 3IXLA 1AMNA 3DM9B 1J8MF 5AVSA 2Q21A 4AL4A 3UT5B 1YKGA 2BF7A 4OQXA 2F10A 4E1VA 4YMIA 4G5GA 2XQGA 1IUBA 2GAJA 3G79A 1TTQB 3HS3A 9LDTA 4CM4A 4KO2S 1TZJA 4NPHA 3FM9A 3OWXA 1B76A 3V8BA 1ODJA 2FSFA 3L8FA 4JB0A 3CS3A 1Z0DA 4MEJA 2I3GA 3D3QA 3DL0A 3ETLA 3HCEA 4WZ6A 2GF0A 5BW6B 4CFYA 1CSEE 2XYRA 1IWPB 4DV0B 1WUHS 3NRCA 3UAXA 3WBBA 1CZHA 3Q6PA 1SNTA 2DR3A 3X1ZA 1TF7A 1Y1SA 4PPFA 4KR7A 1B42A 3W34A 2HWUA 5IVPA 4MYDA 1K7CA 2VBIA 1V35A 1SXPA 3KC2A 1X7WB 5HOQA 3DMPA 3MGAA 5CNMA 3NDJA 5ALDA 5EIEA 1OYWA 1G8HA 1CVLA 2CV2A 4LTNA 2IHTA 1S1DA 1QMGA 2Q6IA 1COWA 1VDMA 3DBHB 4TWAA 4TVOA 1KO8A 3QKUA 1CERA 3O9VA 1AF7A 3CXUA 1JHUA 4KXLA 1BEUB 3V48A 4KNWA 3MS7A 4KO4S 5DYYA 1GG5A 2WJYA 3GP5A 1OH6A 1CG6A 5ALZA 4JSTA 9ATCA 1T2NA 3HK2A 2YN0A 3NBFA 4UHBA 3IT3A 2RBEA 1JHAA 3HGMA 2OVFA 3JWIA 4IJKA 4EG0A 2B8EA 5JOQA 1LK5A 1IFXA 1N4DA 1W35A 3J7AC 4PX3A 2CMKA 4UHEA 1TZCA 4ASUA 1ECLA 1I2CA 3A6DA 3AVVA 3F8WA 3O95A 4LQ4A 4RVFA 3WS7A 2B83A 2PEZA 1E4YA 2MWMA 3ZU6A 1DAMA 1U8ZA 3RQSA 1AJEA 2WUFA 5IM5A 5AHXA 1A0OA 3LY9A 1TPZA 3RH0A 4J4HA 1X87A 3EZ7A 4L7VA 2YYZA 3TLGA 2QE7D 3RSCA 3QOYA 4BE4A 3ZWNA 3CRW1 2ZG6A 5L6LB 2HWXA 2J5KA 2VTBB 4U6QA 2HU0A 1N36B 2N0SA 1HTWA 4EKIA 2ODWA 1XVLA 4YMLA 2Q5FA 1CIPA 1J7JA 5FNRA 1VCOA 5HKKA 4AQYB 4CMIA 5ITZB 2BDUA 3O9MA 4X71A 3I1IA 4MEBA 2PT7A 2XQFA 4E7PA 1HORA 5G1NA 4ADSG 3DD1A 2WUWE 3K1AB 2X7HA 3GRCA 3T38A 3ASVA 3DXFA 5I45A 3GCZA 5BNIA 3K0HA 3ZWVA 1SHLA 2PUDA 1EVYA 4ZI7B 4HDNA 2QTWB 1NXPA 5ALRA 1YVRA 5HCUA 1WY7A 3DKKA 1XT6A 3DCYA 1FYVA 4DGSA 1Z0ZA 2QZ4A 2ZXFA 3QVXA 4ETMA 1CUBA 2XCUA 4U63A 1Z18A 4JV5B 1UL1X 1X8KA 4L2IA 2GVDC 3ENNA 4ZRMA 3DBRB 4IS2A 4KXXA 5M29A 4PHGA 4ZTBA 1KO5A 5CBPB 3S8MA 3T06B 1EK1A 5IAEA 4Y1EA 1JIIA 2YJ4A 2WYIA 5JNWA 3EGOA 2GKSA 3G85A 4BHTA 2C03A 1SIWA 1BJIA 1V2GA 1FFAA 5F72C 1DIHA 2PXHA 3TRHA 3AINA 3NATA 2H1FA 3IXQA 4LF6B 4KPGA 1T9HA 3LAWA 3NHUA 4BO4A 3NXKA 1FTNA 4ABTA 2HTQA 5CITA 2PKCA 1RXVA 3TNDA 1Z0KA 1GPUA 2IXGA 1L6IA 2CNLA 1NVXQ 4HDSA 4ALLA 1X7ZA 3T1OA 4AWBA 4S05A 5K0BA 1O0BA 1GG8A 1YB2A 2E6KA 3QTBA 1EK0A 1V3EA 3L1IA 2ID7A 1IG3A 5CAEB 1AVTA 1YS4A 4JGGA 5H7XA 3HO1A 4QPZA 3GVCA 3O6VA 1T4CA 2VRNA 2WDZA 3T61A 3HFGA 1JQ5A 1X2BA 1ZISA 3A4IA 3LQQA 4CN8A 1DC7A 4E31A 3IOMA 2XA1A 4UDOA 4CSDA 2C7GA 5K01A 4AIIA 5JCZA 2OLKA 1ZOLA 1MIOB 4MQ6A 1YE3A 5JG7A 1AU9A 3B2NA 4IDFA 1G3RA 5MHTA 4C5BA 2FSGA 2IQIA 1T1EA 1KMMA 1O97C 3K3PA 3OJFA 4HBZA 1C5KA 3LECA 3F6BX 1W25A 3ND7A 3GUUA 2PFGA 1FTWA 1VIMA 3FPBA 4FOSA 5KQPA 2OYRA 4N41A 2O5EA 3L7AA 1JXAA 1Q92A 4MQEA 4KWTA 5EJAA 2XB6A 5G0SA 4TL8A 4MC7A 3BXXA 1G9SA 2BKAA 3ZCSA 4DLPA 1KYZA 3NB0A 3INGA 4JL5A 2FMXA 1R1DA 2XD9A 3BS4A 4IR7A 4LTMA 3CLRD 2VNIA 1A76A 4ZVMA 1GNLA 4P0TA 3T12A 3T7JA 3V5NA 5I3ZA 5H70A 2BFNA 4HMPA 1CNFA 3HXKA 4LE1A 4QC2A 4B34A 5FUBA 4F2GA 3GT0A 3BJRA 3R5XA 3T4PA 5DGDA 4UJ3A 5FBVB 1BFDA 1E0JA 2G5PA 3EDRA 3ZJ5A 4OXKA 1VIDA 3PFFA 4HEA6 4I0WB 4U3JA 4RZXA 3RIEA 1XXHE 3BTVA 4MWUA 3IP1A 2QW8A 4FX5A 2WTUA 4QODA 2I4OA 2C84A 4MWRA 1MOSA 2QVCA 3AQ4A 5C53B 1M2OA 2I6GA 4I6JA 4OI0A 1Q7FA 2PNFA 2VXBA 1ZJ5A 2O2CA 4LISA 2IZ0A 3ZXSA 1YR7A 3ZIAA 4D9FA 4OQNA 3RS2A 3TNLA 3E5RA 1GCGA 5TGZA 4O3MA 1Y5IA 4FGUA 2VJLA 1VL5A 3WDSA 1TA9A 3FAZA 3Q0IA 5HQ3B 1RLTA 3AL0C 1Y1TA 3IO3A 1YMQA 4EM6A 3MWFA 4PY2A 3O9ZA 1TF5A 4X54A 2YOGA 3TZHA 4D5EA 4MV4A 2H7YA 1QO9A 1A9XB 2Z09A 4XR9A 2QMUA 5PNTA 4UPEA 3JRXA 4DCVA 3ILHA 2CE2X 1PEAA 6AT1A 4KYIB 2WI8A 3WB0A 1W8DA 2Y9MB 1UPTA 3DKRA 2F25A 2IFTA 1JV2B 3OH8A 1JILA 1PJ3A 1M1XB 1YZUA 3ELWA 4WADA 4WZAA 1Q0RA 5ALKA 2Q5QA 3IVXA 2DWUA 2YVAA 3NX4A 4JBLA 4JUAA 2B4YA 4UVGA 5T6BA 5THKA 4GRDA 1G20B 3L1VA 1RRPA 3A37A 4KXUA 1NHWA 1AIPA 3RYIB 3PNMA 5HJ7A 1O97D 1G291 1P81A 3ORSA 3RK1A 2NNWB 2PH7A 3CX7A 1B0PA 4L15A 3H3XA 4OCZA 4EB6A 5HRAA 2QOEA 4G1MB 2VH2A 3PRJA 1CUSA 1OXTA 3LBFA 1FSSA 5EFZA 2CXNA 3QYAA 1CR0A 2UZ0A 3DD5A 2IP2A 2P6OA 3RT1A 4YO8A 4EKYA 3GQVA 1L5WA 5EWMB 1SUSA 1GDDA 4GD3Q 2KLHA 1GNQA 1V5IA 4ARUA 5KMGA 2ONCA 1X0XA 1FYDA 3P2MA 1AUXA 1F2TB 1HT0A 2OM6A 4KH0A 1E3DA 4YWJA 1D1QA 3H3FA 4E7OA 1IXRC 5THXA 1SA0B 3WG9A 1D1SA 5LDGA 1HG0A 4E4RA 5HX7A 3E9QA 3SM9A 2BL4A 3DCIA 4OLHA 1XEXB 3GGPA 2JDID 1W20A 2JBAB 2CLEB 2PSSA 3JARB 2HMSA 2OV6A 2VAXA 4H0CA 1QV9A 3I32A 3U3RA 4SLIA 3H5VA 5EE9A 1K0FA 1AS0A 4TUYA 2EATA 1LLQA 2NU7A 4WAUA 1C9DB 1GNSA 1T3ZA 2VPTA 5LA6F 3TKLA 4QUGA 2CCGA 4FFLA 2C9ZA 1SXQA 1REQB 3A70A 3U9SA 1B2RA 1JHRA 4KGZA 3W78A 1DRKA 2QZSA 2WW8A 1G20A 1O2DA 3RR2A 3O5AA 3X1KA 4A5SA 1UJMA 4Z2YA 1YZTA 1ZEMA 3DTVD 2Z2IA 3N0VA 4WLVA 2GZSA 1Y81A 1IPEA 1J0BA 1DJLA 1OFVA 2QEQA 2XUAA 3KDAA 3VJLA 3WY9A 4A8HA 1CW2B 1JT9A 4DILA 3IBFA 2FZ5A 3K2BA 3ROPA 1SUAA 3QEAZ 1UAGA 2OOSA 1XEWY 2OWDA 1QQAA 1H6BA 5KYTA 2JCGA 4Y1RB 3CLUD 3WP0A 3KUDA 4IHAA 3SJBA 4RK7A 4N6NA 4EDFA 4WKCA 1H8HA 1HETA 3F8SA 4RELA 1XPRA 3GZJA 5K0ZA 5ARBA 1DNPA 1F2VA 3ANNA 5IKXA 3AHHA 1JDNA 3E3NA 1RNLA 1TJNA 1XGKA 2DZDA 4QJ4A 1K97A 1ZM9A 2QQGA 2V59A 3WL6A 2P2SA 4DAEA 2O3QA 4NK5A 5EJIA 3NYRA 5K51A 1HX7A 1NZDA 1SG6A 3ELUA 1R9MA 3PA8A 4TV9A 4EF4A 1ZVVA 4NECA 5EGNA 2QXTA 3F46A 2O1WA 5CU7A 1KFJB 5KTKA 1WRBA 3IT2A 3F47A 3OCYA 4ZGGA 5B2CA 3OIWA 1KVUA 6REQB 3Q12A 2BIFA 5AJYA 2I4TA 1NI4A 4YAUA 3N6XA 2PR7A 3RWMB 1PD1A 2OZEA 1U2RA 3WLSA 3UGJA 2WOZA 3ID6C 3UAOA 5IJZA 2GZAA 3LGSA 2GK4A 1ZR4A 1ID8A 4OBXA 3L7NA 1A98A 4EUSA 3FNRA 2HT7A 3HY4A 4EG4A 3PGMA 4I3GA 3LY7A 1FFCA 4HNQA 5JI3E 3NVMB 3N2KA 4DCCA 2GRJA 2JLUA 1C7RA 3PF9A 1RIFA 4PQRA 4L50A 1VPVA 3KTAA 2PGDA 1SH7A 2PZMA 4YP1A 1NXWA 3V00A 5A6VA 3F2VA 4FXPA 4Z9BA 3S27A 4IG9A 1QDUA 1EFPB 4D6XA 3GZ4A 1GQ2A 3DZFA 4OJNA 3VYTB 2WUEA 1P0FA 2HWYA 3IV6A 4ZCTA 4YI5A 4W82A 1K5PA 1NVUQ 2YA4A 1GFZA 5JQGA 3IODA 3OJ0A 4KGXA 1G8AA 1VBFA 4UQLA 2CBGA 1L7AA 4M0LA 2BW0A 2D0DA 2EWWA 3JD2A 5CJPA 4EH1A 2ERYA 3CISA 2X0IA 5HIMA 3TPFA 1VCHA 2IAQA 2XB2A 2MOKA 3AUKA 3HA2A 5T4HA 3IMKA 3DZBA 4KE6A 2HGZA 4CL0A 3PTZA 5GADl 2I7TA 1PJBA 1E77A 1TD9A 4PZ9A 3ZXXA 4RUKA 2CLHB 5LQMA 4D02A 1BYUA 1UT5A 3MWJA 4B74A 3L0DA 2CMLA 2QUHA 1Z62A 2JAUA 3JQ7B 2HIHA 3K0CC 1UT8A 2N1BA 1M6WA 4ND5A 4OA8A 1OKKA 3DO6A 4FD3A 3GRAA 4P22A 4R4JA 4RGYA 1JLLB 3SZMA 4XM1A 3M8KA 4E11A 3NWJA 2UYGA 3E58A 1QFJA 2QR5A 2WF6A 1EZZA 2YS7A 4LXIA 3M6XA 4INPA 4ESOA 3LU1A 2GVVA 1DRJA 2HU8A 4W9NA 3WNQA 2EU8A 1KYIA 2ESRA 1JTEA 3ECCA 3L8GA 1LPBB 4ZTZB 4C0XA 1UFKA 3RU7A 1PVVA 2VUTA 4QEDA 3PE4A 3JQQA 5HM8A 4GZXA 3CX3A 5E6SA 1D2HA 2P11A 4MWCA 1QZZA 1HRKA 1WHSB 2BH9A 4GLFA 1CRWG 5TV2A 1RRKA 2ZITA 3L5OA 3M5DA 3TKYA 4PZUA 4KUGA 5KWVA 3BILA 4JA0A 2Q3LA 4EABA 4FGJA 4OO3A 2ZU6A 2P90A 1MB2A 2VA8A 3JAKA 4NLLA 4QNRA 4BJHB 4MVJG 1EFHA 4QSHA 3VR5D 2IZ1A 3CVOA 4WN9A 4CETA 3AEKA 3S55A 5AW4A 3EXAA 3FBGA 4NIMA 1Z4PX 1DZ3A 2QSYA 4MI1A 1VI6A 2V7XA 3I12A 1IBRA 3L0YA 2O1EA 1W8IA 5J1SB 4ZLRA 5AW1A 1LB1B 1QVWA 4KUEA 4YREA 3O84A 1ADYA 2D1TA 4IH1A 4JLVA 2HW8A 1U9ZA 3PK0A 5C1IA 3A71A 2C07A 4JI5B 2FHPA 2KWIA 4MZAA 3OG9A 4QUEA 2H85A 1L4FA 2HKIA 3T3HA 4OGWA 4S0XA 5E4FA 4A92A 2Z08A 3P9PA 1UCFA 1ISFA 3PQEA 4J76A 5E7JA 1FQKA 4QTYA 2WAMA 2F3SA 2J4DA 3L01A 4BEVA 3OQMA 3JVUA 2H4ZA 3W5HA 3ZDBA 1CRPA 3KT6A 1AK1A 4Q1FA 3LVFO 1OBCA 4XJTA 1P2VA 3VU9B 1W1WA 4G65A 4CM6A 4DIMA 1R0CA 3K94A 1GZUA 5HNKA 3ZHUA 4Z3KA 2C4WA 1G3MA 4MDYA 4FYHA 1F9AA 4LFBB 2W2KB 1NVGA 3TR0A 5EHGA 5LFAA 3V6MA 4AI6A 2YWCA 3FR7A 3VC7A 4HL6A 2ALJA 2H29A 3R44A 3ROXA 2O5RA 1A1SA 2ON6A 2XNDD 3TRIA 3V2UA 4FCVA 2GBLA 2PJDA 2IUEA 1KJ8A 1CJUC 2ZSFA 4QGFA 3SN6A 1X3SA 1AUOA 1SVNA 3TL6A 4ZT7A 3HJTA 1YDWA 1Z25A 3KXPA 4WN9B 2GBIA 2RBGA 3JCZA 4B3DA 3UW1A 4IHJF 3SF0A 4EVSA 4EPTA 3V4LA 3C0KA 1JSLA 2XDWA 3KDSE 3LV8A 5A1TA 3T7AA 4O4IA 1NT4A 2BMDA 3ASYA 5JAZA 4TMVA 3UWOA 2DBZA 3N7UA 4DADA 2PYZA 1U1IA 1USRA 3B3AA 3M3HA 2MYUA 5EMMA 4YN3A 1NJ5A 3I8SA 2IOQA 4EHIA 1YR1A 4B48A 5A5DA 1LI7A 1BWSA 3K30A 5ILOA 3SZRA 2GJKA 2GH1A 4YP9A 4AP6A 4INZA 3R3SA 4TLLB 4Z4QA 1XXHA 3IUJA 3QVMA 4I7EA 2CNOA 4R3WA 1HNNA 1XLWA 2PKWA 3DKVA 5A3SA 3RODA 4A0SA 5JQGF 2I29A 2ZWMA 4PCAA 4D3YA 1ZM3A 3N87A 6Q21A 1XA0A 4A2QA 1T6NA 4FYJA 5A7FA 2JIDA 4YY8A 4MV0A 1NCBN 4A6EA 4Z6KA 4YIKA 2W4IA 3C3KA 3QXCA 2HV8A 3DEHA 3OHSX 4DCNA 2DR2A 2ZUCA 3A3YA 2HLHA 4KQ1A 1WF6A 2HL6A 3FVQA 5DLQC 2IXAA 1DE0A 5EQTA 2FLKA 5EHQA 2O8BB 1HQDA 5FUWA 2BV3A 3H1GA 3QENA 4KKVA 2XKBA 1H1LB 4MV5A 4YJGB 5KI6A 1VJGA 5KNCA 3SHFA 3WJAA 3OICA 4P3OA 1N1TA 4QE3A 2G04A 3GX1A 1W8OA 1E7RA 5DBIA 2KPOA 3KXIA 1QCDA 3I9NA 2PT9A 2E4ZA 5A4DA 1J2YA 2AVDA 4FD2A 1FFYA 3F7MA 3GVJA 4BAGA 2XNSA 1A69A 2GM3A 4Y6OA 3I5YA 4HUQA 2F13A 1TYAE 2P30A 4NWIA 1FNSA 2AKYA 3B82A 2VDPB 1MQAA 1QKKA 1QOQB 4MWXA 4AM8A 1ODKA 4MWYA 2QUKA 4ASUD 2WK1A 4DDUA 3BGSA 1AHNA 1ZRHA 3PPXA 3W2TA 3QVWA 3UAYA 4EI2A 4WOCA 5IDQA 3P45A 1QHNA 2JZNA 2QU7A 3GF4A 1LH0A 1UJ6A 1RYZA 3ZCVA 5F73A 3ND5A 1I2DA 4YGXB 2G9NA 1M6HA 4MSUA 4MITA 3O3CA 4F1KA 2SIMA 2NV0A 5FB3A 4GI1A 5G53C 1J8YF 5ICEA 4N82A 3I01M 4DG6A 1KIFA 3AHDA 4CUKA 2C1EA 1E3EA 3A9VA 3ZXUB 4BBJA 2FZVA 4C4TA 4E3WA 1E9AA 3T7RA 4QU9A 2O2XA 2OBBA 1WPGA 4DRYA 1YOVA 3QNUA 3WXMA 4LOLA 1B9VA 1JYEA 2YWHA 1XO1A 1SD2A 4G1CA 1DG9A 4RPLA 5ALLA 3RIYA 4FPYA 3TR5A 3IIIA 4RXMA 1L3CA 5DM4A 2XYQA 4LSZA 1JG3A 1NMYA 1J4AA 1VMKA 2I34A 2OAP1 2X15A 2CXXA 3BWCA 4LI3X 3T0IA 4EHBA 1CZRA 3M1LA 5I4CA 1XD2B 1G20E 2AGVA 3LLCA 5H80A 2C9CA 4LSMA 5FLXA 2W6OA 3BXEA 1IHPA 3WRYC 1UEIA 4TLAA 4IJQA 5LDHA 1U2DC 3R9XB 2VTVA 1MV8A 3N3AC 4LIPD 4M1QA 3ZHCA 3WA6A 2IYRA 1NRJB 1SVSA 1UZAA 3DMYA 4TN5A 1DWPA 4P4GA 2QTVB 4P3PA 4MZDA 4UXIA 3FHCB 1PWHA 1XMPA 3MPOA 2VSNA 3IPXA 4NY1A 2Y92A 2XUJA 1MKYA 2AIRA 3W4KA 1SUPA 5TDHA 2D7JA 2OUKA 1LLDA 4Q4HA 2WTMA 3JPWA 4RFLA 5AFSA 2ZZMA 4OVKA 1DXHA 2G5GX 1P4JA 1ZJ4A 1SCAA 2IHKA 2ZQZA 3ISJA 5KYVA 4DYHA 4HZGA 2ZOSA 1K6MA 2X1HA 1PZMA 1XU7A 5LLSA 4RJLA 4WDRA 4NXMB 1LW6E 1ZITA 2F67A 4XIOA 3B3QA 3OCCA 4CFZA 2IT1A 3TAUA 3FMGA 4FLFA 1ZJ6A 4FZJA 3AEKB 3T4UA 2Y0CA 1GZ3A 4IO1A 4JJEA 4MAAA 3AZPA 3LKZA 3RE1A 2AC2A 4NBWA 3MAAC 3OOSA 3RROA 4EHHA 4HXGA 3U17A 4HNUA 5IX8A 1P5ZB 5I48A 3TR6A 4R83A 2BY4A 2OKGA 3TSWA 4UE2A 3EY9A 5LDDC 3LDFA 4HZVA 4EJMA 1EXNA 4GZ3A 3QVKA 1LTQA 3LHKA 4M9XA 5ENDA 3VAAA 4KRXA 4CDNA 3A7EA 1QXSA 4MV8A 4RA6B 5J59A 4B32A 2A0WA 2BEWA 1A8IA 1T3SA 2IZZA 4FMDB 1J22A 4PYNA 2ZE8A 1WL8A 1BVHA 1PJ8A 4XIGS 4WL0A 2VHVA 1USUA 5EJ4A 2C2MA 5A9SB 1T91A 2PSFA 3IPYA 2FX2A 2EFYA 4PG8A 4N7MA 4O2BF 4LZZA 4U0JA 1QORA 2ZYRA 5HUQA 5IFLA 4HIZA 3T5PA 4KMSA 5ICMA 3PXXA 3I1JA 2YZ7A 4HNSA 4D4HA 4LMPA 4N01A 4ZOBA 1B3RA 4LYJA 3WJ1A 1UK8A 2F27A 1CFZA 2IIPA 2OD7A 3MG9A 5P21A 5TEWA 1WAMA 2EP7A 4CPLA 4QDZA 4FYIA 5HQJA 4QWWA 5TJ9A 4D0NA 3C5HA 4PFJA 3K9NA 5CVEA 1ODTC 1NLMA 3DL2A 3L7JA 3ZNQA 4F92B 2QTCA 3RV4A 3O1LA 1HE4A 3NTRA 2H3EA 2LKDA 2MYNA 2C7RA 1U7WA 3OZEA 4B7JA 3L7BA 2R87A 2QW0X 3JQAA 1YZNA 3VH4A 5K3FA 3MRSA 1UZUA 3JYHA 5D6NA 3A6FA 3GHHA 4BQRA 3RF7A 3KJXA 4NE2A 2B2NA 4Q0MA 5D85A 5ALSA 2ZSIA 3MF4A 1U3TA 2E4AA 4XTRA 3HWX1 2BKVA 4W1RA 3M3DA 1QU2A 4FONA 3T0GA 2YS6A 4FILA 2B8WA 1GD1O 2R7KA 3F9IA 4RSMA 1KI4A 2NTJA 3U3JA 4WK6A 1QIDA 4ZT5A 2Y1DA 3T5DA 1JGTA 1VCUA 4HP8A 4LMRA 2UVDA 3ZNNA 3OPVA 1C2TA 3U4GA 3ZZNA 4L07A 3TZCA 2XLCA 4MB6A 1W0KD 3PC2A 4OQLA 4EEZA 1VSUA 2Q3MA 2GM5A 4AG3A 2I2CA 1PJQA 3E1KA 3KKLA 4ZU3A 5A4MS 3TXYA 4EZBA 2PQ2A 3C8UA 2E7ZA 3C8MA 3E7DA 2NO4A 2WU8A 3KEFA 4WEOA 4TRMA 2QTFA 3D1JA 1C7IA 2QY6A 2XGMA 4HUTA 3EY4A 4B7ZA 4W5NA 1J0EA 2B3TA 4OM7A 2XQKA 3PGKA 4HGRA 4U02A 1GQSA 3JWHA 3LGAA 1OREA 2OLJA 5G0VA 1XZEA 3BGOS 3MWLA 3UT0A 2YWJA 4XD2A 3CVUA 2X6QA 3HJBA 4XEUA 1L1RA 4RIGA 5B1SA 3ML1A 2AJLI 4DCPA 2HPVA 3MGGA 1ZOSA 2E4UA 4YLYA 3DONA 4WK0B 1DT5A 3K36A 3S68A 2JGLA 4YCBA 3T34A 1OWMA 3KKEA 1L5SA 2V7VA 4W7IA 4XQ0A 2PZEA 5E2IA 1PYGA 1KZ1A 3RYTC 2XKKA 1VLHA 1CXZA 3BDIA 1YUMA 4UQOA 5ICGA 5TGTA 3CINA 1IY0A 2HI0A 4XDZA 1LNSA 3RYIA 1G21B 1QS0B 2JEYA 4PSKA 1W1IA 1K2WA 1NDUA 3LUJA 3PDWA 4OU4A 2C98A 4R5MA 4EVIA 4DXAA 3FETA 4EBFA 4PRZA 1Z5VA 3STWA 2FAXA 2PCLA 3OJXA 2WWIA 3IX7A 4EECA 1LRJA 1PFGA 1PJ2A 2XCRB 4RWZA 4P3KA 4BFXA 1OA0A 2OV4A 4J7CA 4UTZA 2WWRA 2P8SA 1UOPA 2Z8YA 4OKSA 4PGHA 4F38A 5BQFA 1D9ZA 3ICOA 1H8EA 1QGDA 1J90A 1MVLA 4X24A 2WLTA 2VCHA 4DC1A 4KE9A 3IE2A 3OUZA 2K5UA 1BTOA 4CLDA 4XWWA 4RMGA 1A8HA 1O94D 3D7RA 4BGVA 5KNDA 4QDUA 4HGYA 4LX8A 2BF6A 5HFNA 4F12A 5TPWA 2J48A 2C31A 3PDIB 3LCRA 3GLGE 2FP4B 2QRKA 1I6WA 3UV6A 4HWRA 3PEYA 1Q95A 4NBLA 1ZNXA 4MWDA 3RVDA 2FFQA 5F3WB 3FH0A 3GJ8A 2FPLA 1NKTA 2BMAA 1V71A 1A9ZA 4BDTA 4DR4B 1FU4A 3N8KA 1E0DA 5E6UB 3E2IA 3S44A 1I0LA 5DW3A 1XTZA 1NJSA 2AXPA 5JH7B 2VJMB 5EJ9A 3ZW7A 4R7GA 3CVXA 3GEPA 3JYQA 3HKCA 4JL8A 4HYEA 1QTQA 2O6LA 5BSUA 1IB6A 1KL7A 4XPIB 1LEHA 3R7NA 5BORA 5I7RA 5E8RA 5JDIC 2RD2A 4UZEA 4PLHA 4BGUA 4D8WA 1N1MA 2HK6A 2GNAA 4C0SA 4CLRA 3ESQA 1SEPA 4KOAA 3AEZA 1OXSC 4AF8A 4UVIA 3VU9A 4ZI7F 3KSDO 2PMEA 4OPMA 1YRAA 4G0XA 2W98A 5COBA 1P5HA 1DOAA 2GLTA 3FR8A 4KQWA 5FZJA 4PZEA 2VK6A 3EUEA 4D46A 1XOEA 1J21A 4Z0TA 4K6HA 4AZ0A 5BMOA 4MAFA 3PLRA 3TZQA 1YVUA 3FHLA 2GOYA 1G5TA 3OLQA 3RYCA 5FAKA 5HJ2A 2Q5HA 3UJ6A 3CVVA 2ONYA 1ZD9A 4IGIA 1YRWA 2YVKA 1W96A 1RLUA 3IKTA 2C95A 2YHIB 3LY8A 2ONKA 4FZ5A 4OY3A 5AUPB 3E27A 4ZV4A 1PZGA 1RCTE 4PXAA 3MQ2A 4UTPA 5KOHA 3DF7A 2NYAA 2W48A 2OXCA 1V16B 1QYRA 5L3QB 5IDWA 4DSAA 2Y1CA 3CF2A 2G6TA 3M7IA 3OLZA 5DJ5A 2Z58A 2DFLA 3F6CA 4L4SA 1RPNA 3EZLA 4TS3A 521PA 5K3AA 5JS2A 1OBHA 2PY6A 1NTRA 3WB2A 2VQSA 2WF5A 4BTLA 1Y7LA 1KMHB 2FN9A 2UV8A 3DT9A 3PTAA 5JCJA 1I80A 1IAQA 3FVRA 2IUSA 3U7QB 1E3WB 1KFKB 2MTBA 1N7JA 2EHDA 3AJAA 4IW3B 1JEEA 2C4UA 1MRSA 1SKQA 2N1MA 1TFRA 2PD4A 3M5PA 2X4DA 4KRGA 3V1NA 4AD8A 4DWVA 4ZZ0A 3FUXA 5I7SA 4Q9HA 3IR7A 1SG0A 2CDRA 4GMGA 4ZVLA 4L9AA 5JCOC 2ABWA 3TIGA 3U6KA 4C2TA 2A5YB 1R6DA 5IKPA 1WEHA 2FVYA 1W85A 2B37A 4QO8A 3QKTA 1L7OA 1EXDA 1E1NA 2NWQA 4U2CA 2CHGA 4KTVE 4PBSA 2HTYA 4ZXFA 4CV3A 2XCTB 4MQ5A 5C8XA 3WRXA 1ZR2A 3M2TA 3WLLA 4FPXA 3VOSA 1VG1A 4NZNA 3K31A 3GROA 5EXDA 1GG9A 1JN0A 3QE9Y 3KT3A 2WWXA 3JS5A 3R5KA 3IEUA 4FMCF 3DO8A 3AW9A 4YT8A 2IXFA 5JBQA 4BX2A 4IZIA 5HA5A 1GN8A 1DQNA 4W5RA 1V8BA 4F5ZA 4YV0A 4YV7A 1L3IA 1G6KA 3L0BA 4XMAA 1E2HA 4ES6A 5IJ9B 2ZROA 3W5VA 4DVGA 4ZWNA 4DWWA 1H05A 3WKBA 5H0IA 1A9XA 3L9XA 3DFIA 3OUTA 3OOHA 1Y7IA 3LP8A 2CCKA 2E0IA 2P0EA 3UW3A 2RJ3A 2J9YB 3WFJA 4BXOA 4CODB 1E1RD 5FNVA 4RTRA 3CSUA 5FPKA 1IUCA 2SHKA 3MS4A 3VOAA 5BRAA 5LP6A 2O57A 4KR2A 3DVQX 2UZ1B 1Q21A 4X95A 4NZ9A 4EKGA 4KSCA 1KYXA 4DSZA 4PN7A 1MS9A 4MR9A 1U0NA 3ZWAA 3ZU3A 2VKQA 4L7CA 3T9BA 3KGGA 2WHRA 5FQNA 4I8IA 2BGTA 1Q0PA 4QLBA 3MUEA 3UKJA 2Q7DA 4RULA 3LXXA 3J81k 2V7GA 2X6RA 3HE3A 3D1VA 1QHEA 3LPMA 4YP5A 2BP7A 3GRPA 3BL5A 3G7SA 2M98A 3DOJA 3D0QA 3FYCA 4YFYA 5EWMA 3HCRA 3TVDA 4AKGA 1BXGA 5AO9A 3UN1A 2X3FA 3GZNB 1C9YA 2C59A 1ITZA 3JD0A 3SNKA 3FDFA 3EGEA 1ZGAA 1MTOA 3SRGA 2H6EA 2WSSA 2YA8A 4L6IA 4U6NA 4QGBA 1I4LD 2JI4A 4M4VA 4YZ3A 1EX6A 5I47A 1MB3A 4KIGA 1N2CB 1EFLA 1RJWA 1M72A 2D0OB 2K6GA 2QP9X 5LB2A 3UH0A 2YJNA 2XUGA 4YHHB 1EEXB 2C82A 3IGFA 4ACBA 2PDAA 3O8OA 3HVRA 1L9XA 3S1AB 1LUAA 1VPWA 4X49A 2KBFA 4G24A 1SBNE 2NO9A 1NKVA 5FYDA 5E6RB 5BRJA 3ALXA 3VZPA 1W2HA 4LWZA 3SD7A 3PL1A 1SCKA 3EIHA 3VKUA 1O0SA 1FUUA 5EZSA 5ALGA 1HYQA 4ZU6X 3SXPA 4RTQA 1G2IA 1MN6A 1W4RA 1N5KA 3HY6A 1OZGA 2AJBA 1SBCA 3RYHB 3EPLA 2YWBA 2LTAA 1VCIA 1RRCA 3EG5A 4YY3B 4ZGCA 1T8WA 1EGQA 3TDNA 4G23A 3WBJA 1CQJB 1L1FA 1SC6A 2H1IA 3BMNB 3OESA 3CKMA 5A6SA 4D81A 3RU9A 1RP7A 2V8BA 4O63O 1YA8A 1XKTA 2WWTA 3QVUA 2WD8A 4TUYF 4GKBA 2WUDA 5BW5A 5FL3A 2DG2A 4CHGA 1P4RA 2W0MA 5JROA 1Y8ZA 3PTLA 4S2UA 3TM5A 3I9V1 3EC2A 4DGQA 3IVRA 1ZN9A 5AKXA 3DEFA 3NIDB 3G0OA 4FJ1A 2R6R1 3R75A 3X2EA 3RVBA 3LNCA 2PFKA 4DG9A 5B3AA 2UVPB 3QU5A 2O48X 1JNYA 4JFRA 4LY6A 1CB7A 4RMHA 2M6KA 4LF7B 3O8RA 1NVVQ 2HWWA 2BZDA 3HN2A 3IOEA 4O2AB 5HM6A 1THTA 3FE2A 5LMNB 1WCIB 2QDKA 3S40A 5AQEA 2PN1A 3PEEA 4LF5B 1IJBA 2OVBA 4RADA 1QUEA 4MJ3A 1TYCA 3OMWA 1BC5A 1FU7A 4WUTA 5C1PA 5E2AA 1B23P 3GEIA 4HTFB 1SJ9A 1KMIY 1VB3A 2I0FA 4IVPA 3QXXA 2GPSA 2VPWA 1DB3A 3F96A 4CNQA 2OBLA 3K6SB 5GVSA 1SVIA 4YUXA 3ZCRA 4KZKA 1F12A 2AH2A 2DY0A 2Z3ZA 4BNVA 4D7AA 4R8KA 4M9SA 1YCDA 3CIFA 3D6UA 3DMTC 4EQ6A 1LKZA 1HOTA 1QAQA 2GESA 5GOTA 1S3IA 1TL7C 4C0AC 5SZIA 3FW1A 5K4HA 4WI1A 1VE9A 4IDHA 4IDDA 3WDLA 3KQTA 1ISRA 4AJJA 2VDWB 3KAPA 5H8WA 1D04A 4I19A 4JZYA 2YMPA 4E5YA 3FBTA 2XXAA 4HN2A 3I6YA 5JFGA 5JJ5A 2C1ZA 2QE8A 4J29A 2PGAA 1CP3A 3A3KA 2R8XA 1B8UA 3F8TA 2MSNA 1JFRA 1CHNA 2PXAA 2EKZA 3INTA 1XWWA 3W3ZB 5LA6A 5J4VA 5J58A 1F51E 2OEPA 4YAKA 1SCBA 3SOPA 4A6PA 2EV9A 1KNQA 4R0MA 4PR3A 3A9HA 1PQPA 2ZK7A 4FIDA 1F3LA 2FWAA 3R5FA 3R23A 3DTVB 4NBTA 4U9IS 3OT1B 2YL2A 3EBLA 5BUCA 3IBCA 3RJZA 2GCEA 3UK6A 1PTJC 2OT3B 5HUHA 3CMMA 1LI4A 3VOTA 4TV9F 5AOAA 2GJ9A 1X2EA 3DAHA 2QRVB 2IUFA 3EC7A 1SWWA 3EPJA 4Q21A 3IELA 4RS3A 2CD7A 3CJTA 4L8VA 5ICCA 2B8JA 1Q0ZA 4L74A 3RF6A 4DUYB 2GYUA 2JEOA 2TMYA 1MR5A 2A1UB 3BWEA 3WGIA 1YBMA 5DN6D 1JXOA 1RLIA 1JSCA 2IVZA 1NU8A 3Q6KA 1L5MA 3UJ9A 4JI7B 1ODIA 5T3YA 1MA0A 2D2VA 3AF2A 5CX1B 4Y67A 3KQHA 1S2NA 3OJOA 2OZLA 1CVMA 2V65A 4KL8S 3O7MA 4M9QA 4PZ0A 5ALOA 3KLPX 2F8LA 4ZDKA 4UUPA 4L4UA 2HMTA 2O2GA 2XF8A 1OQAA 3HHEA 4ZKDA 1MAVA 4RU1A 4BNXA 3MMNA 1FDOA 2DJIA 2GJ4A 2GD0A 3LOQA 4PLPA 1XVUA 3UXEA 2IE0A 4UOEA 2QJFA 3F3SA 4QYTA 1MH9A 4RH1A 1ORTA 1FFHA 1XDUA 5DNVA 2XRYA 3OU6A 2CFTA 1G8GA 3E18A 3U48A 1D09A 1HTTA 1QAOA 1NUPA 5JVDB 5JEDA 4YRBA 3DTNA 5BNTA 1KERA 2R79A 3R6WA 3UT5A 4C07A 3V7YA 1B73A 1DAGA 3O4IA 2Q1WA 1UQRA 2A5FA 1T8TA 1CJKC 1HF3A 2UZIR 5EKUA 5JJCA 3G0GA 1UDRA 4B1FA 2DTXA 4EYOA 3WA7A 3RVSA 5HS4A 3AIKA 3H87A 1ZUWA 1CY4A 2P3OA 5NULA 3FUCA 3PSHA 5DK6A 1H22A 1XIVA 4OQQA 3IDQA 4M60A 1M8JA 4UCXA 2IAWA 1E3SA 3NBXX 4KH1A 5JZVA 4J03A 4B6OA 3UWMA 2YMQA 4EG8A 4K1XA 5DM1A 3GJXC 4PHTA 3IULA 3LT0A 1Z39A 2I2AA 1ODFA 4WDQA 1N3IA 2DLNA 4RWEA 5CX4A 1KK1A 2GPNA 3MFQA 1FDIA 4HNGA 4AICA 5IXSA 1RXUA 1PGNA 2FW7A 3GD5A 1PG2A 3OFNA 4DLBA 5CFZA 4HD8A 4PTLA 1OZHA 5K8UA 3K1ZA 5IC6A 4AIRA 1FP4B 1D2NA 2FQYA 1GV1A 4B81A 3IFSA 1G4AE 4LYHA 3C3PA 2HLDA 4OOFA 5M2QA 1NLYA 1NVMB 1GTRA 1PGOA 3GBPA 4OI2A 5AXAA 1NKSA 1UFVA 1ZVJA 1T9GS 2A94A 2I6SA 2PBLA 1QH9A 2I2XB 2MSWA 1C4XA 2QDXA 2VVTA 3EQ2A 3IQZA 3G7NA 3PNQA 1B6TA 4GQBA 3KEGA 1RHMA 3ND9A 3WMFA 5HQ3A 3R7AA 1YFJA 3LRPA 2HRQA 3QBTA 2BONA 3QITA 4NCBA 4TVBA 3FVVA 3HM2A 1M8FA 1A7AA 2A86A 2B0CA 2QS9A 3S8VA 1E6UA 2QNBA 5AXBA 1GL7A 2CLIB 2HJHA 2IU6A 4KLNA 2HWKA 2IYEA 2JLRA 2BATA 2AQ8A 4O4IB 4ABYA 4Q3OA 3DAPA 1HQCA 1L8LA 2D74A 4E2XA 5I9IA 1Z17A 3FDXA 4O4LA 4Q9JA 5JXWA 1ONOA 4QO7A 4YJHA 4CKEB 2H2IA 4AUKA 3ADDA 1E94E 4L0CA 2QN1A 2YVUA 4BO2A 1BEZA 1RXCA 2COUA 1PBTA 4OP3A 5FBQB 3D0OA 4LXQA 5FV7A 3S7TA 4JQZA 4EO9A 2ZB5A 1RI1A 5CA1F 5EMJA 2A0FA 4ZI2A 2QY9A 1YU9A 1I2MA 1J49A 4WBNF 2QGNA 3WJ2A 3W5JA 3JVVA 5CFOA 3AFMA 3TB6A 4PNEA 5JAMA 2H4YA 4HDRA 4CQMA 3OZIA 4QGAA 1EEHA 2Y1OA 2IC5A 2FR0A 4ETNA 5KCMA 2Z8ZA 1AXRA 4XDHA 3SQXA 4GECA 5CDFA 2HBYA 3IPRA 3L6UA 3TPZA 2ZXEA 5DM60 3AEXA 2RKOA 2P4OA 1RPAA 2NSJA 2ZIGA 3DOIA 3EIWA 4EGSA 1U28C 2O8BA 4PPQA 3I0ZA 2GVXA 1ZMRA 2AEJA 2WG2A 2AOVA 2ZVPX 3DZKA 3NS7A 1C0IA 4ZANA 1ZONA 3NTOA 4NMXB 1AKRA 4V02A 4UBNA 1L4MA 1IY2A 2NTEA 4FFBB 4C6HA 1EGHA 2SLIA 2VK5A 1ZI0A 1A7KA 1XMIA 4G84A 4X91A 4AQDA 2EZTA 1PW5A 2FKAA 1KIAA 4L75A 1I4WA 2DQKA 1XROA 2UDPA 1QH8B 1W87A 3I0NA 5KSOA 2C3PA 4AS2A 6GPBA 5A03A 3NTVA 4S2EA 4UFOA 3ER6A 5G41A 1TZ2A 3DDCA 2CY0A 5KNBD 1BE0A 3VC1A 2GHIA 1RWPA 2I7VA 5KVSA 1R66A 1Y7PA 4PYLA 1G8MA 4IEIA 4RK1A 3M6IA 2GARA 4JCOA 4BQIA 2UU9B 1L6RA 4HQRA 2BMVA 2GCOB 4UW9A 4BFCA 2CVFA 1MZPA 2O19A 3L4JA 3DWGA 3QLEA 4X5OA 4Y2QA 3VHXB 1SIOA 4XARA 5JNLA 2E49A 4WXPA 1UZLA 3L7IA 1HQYE 2I76A 2PX6A 4ZVSA 3LPNA 4GKKB 1K4YA 1GIAA 2JI8A 2HXGA 4NQZA 2E5LB 3HRIA 3GB9A 1RLOA 4FHZA 1P4SA 3M6LA 4NMLA 2IF2A 4OMDA 4QFCA 3S2SA 1N57A 1PHRA 1S96A 3ZBPA 1CEQA 3A4YA 1NF8A 2DFNA 1MB4A 1UADA 3HP1A 1D4ZA 1DIGA 4H0FA 1YTLA 3RU2A 3WIDA 5F2NA 2DM6A 4ZQHA 1YJCA 2Q6VA 2GMWA 3CG4A 3QX8A 3X1YA 1QYWA 1TKAA 1T0HB 2V5VA 3PKIA 2ZIEA 4O4JF 5FNVB 4DQKA 5KHLB 1UJ5A 1Z4IA 3JYLA 3S2IA 4PNHA 3VR1A 4DJDC 3TUIC 3ER8A 1DAOA 4ILKA 2DETA 1NZJA 3SVLA 2PUAA 3QMWA 4LHYA 3QELA 3CNEA 4M1YA 3H16A 1TVKB 1QLJA 4ZVPA 3WADA 4BP8A 4ZAGA 4OX9Y 3NOQA 3SMQA 3DOFA 3W1WA 1J1ZA 2C77A 4K1IA 2OXEA 2H9AA 2QE7A 1QO0A 1OLXB 2G06A 2ODPA 3EHDA 3GLHA 4IIJA 4O1MA 2IYNA 4M1MA 3R6GA 3RLFA 4ZJZA 4I1PA 2CKMA 5KX5F 1Z4ZA 1LDYA 2ATXA 3U3OA 3WAKA 1KKMA 2QN2A 3A14A 1MJFA 3I6MA 3NBYC 1RD4A 3BEQA 3P2KA 5DH9A 5F64A 3UGTA 1OTXA 1V0EA 4GXNA 4AZSA 1Z8DA 3R74A 1NVWQ 2B69A 4BNGA 2BFPA 4JC0A 4E4YA 8MHTA 2PWPA 4JVSB 1G5IA 1Y89A 3FMIA 1SNYA 1NVEA 4FR0A 4QHTA 1AT1A 4EA7A 3E3LA 3H19A 1GU0A 2HRCA 2CGEA 2P9GA 5LLDA 4ND8A 4CLOB 4DMUB 2H17A 2QTLA 1JA1A 2ZI3A 1F2DA 4ZYZA 4C7OA 1K8RA 1BOOA 1BN7A 3A1NA 3BD8A 2GZ3A 4E09A 4ZOLF 4V1CI 1FMTA 3HCCA 4G8DA 5IC5A 2GFHA 3LBHA 2QW1A 3FGPA 4HWPA 1HI9A 4KTTE 1FTQA 4YNBA 4OQYA 4CM8B 3DFFA 4J1TC 2PGOA 3UBMA 2FQ1A 3H2YA 2P68A 3KBOA 4WA8A 1N1SA 4J9UE 1DADA 1WBJB 2W6ID 4LXYA 2J6BA 3WBFA 4M7PA 4NOLA 4Q7QA 1CY2A 3C2QA 3BXGA 3FFWA 3WYCA 5I5EA 3CT4A 3F6YA 3OETA 2JCXA 3C8ZA 4XYEA 5IJ0A 4IHKA 1ZHOA 2XV1A 4G25A 4PW0A 2A9QA 1TC2A 2QTGA 3M1AA 3P0HA 3I8OA 4YYZA 5C8YB 1JP7A 2WF8A 6LDHA 3D7NA 3Q3GE 1UMKA 4M76B 1FP4A 2X58A 1WKBA 1RZRA 2WM3A 2JFXA 2XB4A 4Y9DA 3DLPX 1BVYF 2D2IA 5EE3A 2JAHA 4L8WB 3QU7A 4Q39A 3W5UA 4O25A 4XUDA 1YCFA 4PGMA 4PS0A 2YRXA 3CLRC 4JU8A 1C3EA 1V16A 4I5EA 3ZVRA 1VHQA 3OT4A 4IEEA 4MUYA 5BT9A 4RJJA 1E5LA 4ZDIA 3ED1A 5A6SB 4HHEA 1W5EA 2PUBA 1YC2A 2O0MA 3DNMA 3OQHA 1JFTA 1CLEA 1DBPA 3T7IA 2W9XA 4EKNB 1PG0A 4CKYA 5BSFA 4WACA 1EXVA 4WA3A 1QVAA 3MJVA 5IBCA 4GPTA 2OHXA 4PV7A 3V8RA 2W38A 4L72A 2HEIA 1TTTA 2MINA 5ES4B 1GPBA 4JJGA 4I8XA 1P7WA 1YZGA 4I1SA 5ILGA 4AP9A 3AKYA 4CKWB 2IPMA 1H4VB 4H15A 3RVNA 4IYRA 1PL8A 3U7GA 2I99A 1CRQA 2ZRIA 4WCFC 1GTSA 1S2MA 2D1QA 5HX0A 3D81A 3MA0A 4ER3A 5C1DA 2OCIA 2YFKA 4XUEA 4N40A 5CLIA 5HW0A 1K5HA 4HDKA 4EJFA 1WIWA 2BUBA 1KAMA 3C3YA 1R6XA 2XWBF 3GN1A 1UPXA 4ND6A 2R2GA 3DUFA 2AE2A 1SUEA 2J31A 1KDTA 2WE8A 4EB8A 1YDFA 2FN3A 2UZ4A 3X1WA 5EO7A 2DMRA 2WVGA 5FPPA 5I7EA 1FSGA 2PSEA 4DLSA 1BXZA 1P9OA 3B52X 5KU7A 3CZ4A 2PGNA 1DP4A 1PT6A 4R68A 3INRA 5EHIA 3RSGA 1ZW6A 1JFVA 3VZQA 2QQ0A 3FPKA 2O8EA 4WUVA 1JR3A 1BIFA 2Q2VA 2BDTA 3EZYA 3ECSA 1IN6A 1KYVA 3NV7A 4XI9A 3A6PC 4F7WA 4FM9A 1GFWA 4NCIA 2XITA 3ONEA 4Z9FA 4C08A 3OZDA 4V24A 1XQ9A 4M53A 4OHMA 1SFRA 3P2IA 4DM4A 1OD6A 1ZH4A 4UU0A 3BTSA 3LYLA 2O8DB 3MGBA 2HAEA 4F91B 5ANRB 3CTMA 1S0UA 3R40A 3C98A 4RCVA 3RFTA 1DS6A 5SY6A 2WFAA 2QJWA 2QRVA 1W93A 3LKVA 4BZWA 2E55A 3ZY3A 5JALA 2VF2A 1K0UA 2C4NA 1OJ7A 1Z56C 2ZBDA 3DE0X 4WQMA 3REFA 1J9EA 3B3GA 4QT0A 4OJQA 3WRYA 4YCCA 4I4IA 1WTAA 5LOVF 5EUQB 4EI9A 5AJXA 4WTOA 4ZYWA 3PV0A 2RGEA 1JXQA 2TMKA 3W5BA 3K70D 1B1CA 4GI3A 1N2BA 2OXTA 5JCPA 4EJ6A 3H0CA 1FYFA 1XTKA 1KQGA 2VPJA 3EIUA 1O5OA 2NQ8A 3WO0A 1UODA 4XQCA 2YXNA 2WTEA 4FNOA 2IZ5A 4Y2UA 1U1CA 2C8KA 1UH5A 3VDMA 1O3YA 2D5BA 4J9TA 1F38A 2WWHA 3BBLA 4JK3A 3TWOA 5LNK1 3NHFA 3OZUA 2G09A 1XK7A 3I1CA 4B82A 3IJ5A 4U3JB 4BNNA 2FDCA 1LLCA 4ZAZA 4M8KA 2OV8A 3WK8A 4KX3A 2UVQA 1C7FA 2GVWA 1SOWA 1I5RA 4ARSA 2Q2OA 4LWQA 4JLJA 4TVKA 4G07A 2OTCA 1QJCA 3GZNA 3OT5A 1INHA 1N7HA 3Q8XB 4BB5A 2HTUA 2I22A 4L4YA 5LZ9A 3EIXA 1EK6A 3GBSA 4B8YA 4KNYA 2BMFA 4I9GA 2PMCA 4TGLA 4X94A 2IH5A 3VDNB 1N1GA 3GOHA 3II6X 4N1AA 4CKCB 2GVNA 2VSXA 1CY1A 2GBGA 3DYVA 5JJLA 3W5AA 1JLHA 4L76A 1RYFA 3WGJA 1Z83A 4QLOA 4B79A 3I1FA 1O96B 3BZBA 1YZHA 5A02A 5AW8A 1GXSA 5L6MB 1CZNA 2OSVA 2WYOA 2Q4OA 3I04A 5JDCC 1ULTA 3H8SA 1X86B 2HCFA 4NS1A 5HF9A 2IAXA 3CLHA 2Z56A 4LXXA 3GLHB 3K96A 2EZ9A 4IIJB 4OREX 5FBWB 4DA4A 2NX2A 1Z13A 1IJQA 4RFVA 4G8CA 4F5YA 1DQRA 1NIJA 4IXTA 2BGUA 3FYUA 4MYTA 4OSEA 4FOTA 5FOUA 5TB5A 4DLZA 2IEZA 1Z6GA 1HDEA 2IDZA 2HFJA 1DC8A 2IYFA 4AZ0B 4ZEOA 3TPCA 3MBIA 1NXVA 1XFAA 2P5UA 2Q27A 5ADVA 3WZ2A 4IHJA 1ZAYA 1MAWA 3CF0A 3GGGA 5EIWA 2WKSA 1L7NA 2H2DA 1L9KA 5JYYA 1EFAA 5L3SB 3STYA 3ZQJA 4TUYB 1NUUA 3TOXA 5JPDA 1DOZA 1ZK2A 2ZW9A 2SILA 2V4UA 4FEAA 3S0JA 1CZKA 5G02A 2A4MA 2PKYX 3PHHA 5H83A 4HDAA 4FPLA 4D52C 1REQA 5DYTA 1DBSA 2R1ZA 3IO5A 2XCYA 1RFGE 3R3WA 4G63A 4K81B 4RJTA 5BVGB 4B3MB 3L4EA 1I30A 4EW1A 5CBPA 3HU1A 1QR6A 3HLKA 1YC5A 2FZLA 2CB9A 2IXDA 2I3DA 4B6SA 3OOWA 1PZEA 5KNDH 4B75A 1C0EA 1U98A 2GYVA 2WIJA 1YQDA 4O6VA 1KZ9A 3CHYA 1O5IA 1Q1NA 2BWJA 2B8HA 1E4EB 4E5PA 2VQEB 1M1UA 1BDJA 1FNDA 5DX1A 4YV2A 2C54A 1B4DA 3K9GA 1ZOPA 2O0JA 1Y6ZA 2C9BA 2RJNA 1LJ8A 5FNZA 3KKNA 4BJ3A 1DFHA 4ZTUB 5ESXA 4PN3A 1UANA 1WUKS 1JFLA 1TB4A 7GPBA 1E63A 2QTNA 3GG2A 3MIZA 2IU4A 4L5AA 4KS1A 1NC1A 4TL7A 1GDTA 2WMNB 1JECA 2BM8A 1XNHA 1YB6A 1B9SA 2H00A 7AT1A 1W21A 1JEQA 2OP1A 1AGNA 1CUJA 3K5WA 2FUCA 4QQKA 3SK0A 2CVZA 5CXQA 1HUQA 4XAQA 2Z1MA 2WQ7A 4NCHA 5TGDA 2YDPA 1YFKA 3AVTA 5LB4A 4R8RA 4QGGA 3SSAA 1OLUA 2PX2A 1W0OA 1X1RA 2OCGA 3LKBA 3PUWA 3ZZTA 1NOKA 4IZ6A 4F5DA 1IB0A 4XE5A 4CJXA 4KVFA 5C7IO 2J08A 5B5SA 3SF8A 5KUTA 2WM9B 4MRRA 2M2IA 2VQ3A 1F14A 1JQ3A 2G1AA 1KWGA 4RL4A 1RWLA 1ZY2A 3SSNA 2QKYA 4OJKA 1UAYA 5CVJA 1XRJA 3NBQA 3GI1A 2FLUX 3GLHE 3DAOA 2SBTA 5GOZA 3JAMA 1I32A 4YFVA 3TRJA 4O5SA 1NMAN 4UXJA 1R0YA 2GN1A 1Z4VA 3D3KA 3ABRB 1LNZA 4LYDA 2VAQA 3T1NA 3NIBA 4GP9A 1E6EA 2ZBQA 2OUIA 2R85A 5FBHA 6ADHA 2DFKB 2HLNA 3PHLA 2C9OA 2O2HA 3X43A 2VSOA 2YJZA 3G8YA 5IVIA 5DKFA 1KETA 2VCYA 3E5HA 2X9VA 4XB1A 1Z8FA 3OTHA 4RM3A 2EZ8A 3KTAB 5AUQA 5G1OA 3WL7A 3AUTA 4MJLA 2A5JA 4Q4AB 4MMXB 4YRRA 1U1DA 1KI3A 2A30A 4BLPA 2ZAOA 2OCAA 2REBA 5JPIA 1P31A 4OLJA 3VR2D 3IRUA 5K8TA 2NPIA 4CV0A 4ZOQI 2OORA 4BBWA 3FF4A 3UB2A 3NMUF 3O3OB 2IEYA 1GEGA 2BFEA 3GO4A 4OSOA 4OU5A 3W3AD 1YL5A 2ZULA 2NACA 4GZ5A 1TM2A 5FWYA 3PFWO 3VDXA 3JXEA 3VSBA 3BX1A 1SU6A 3DVLA 5GV7A 4B6GA 4UTNA 1EFCA 3RS7A 1FPMA 1XE3A 5KNDD 4EMBA 3U7RA 5CW1A 3FTDA 4NXNB 2GAIA 4CF7A 2NSDA 1TQ8A 3VVLA 5FL7D 3ZXYA 1FEZA 2AMVA 1E9RA 2J41A 2J0EA 1X80A 2XYGA 5IEBA 2PRZA 2GRAA 2FSIA 3QWFA 1U65A 4N5HX 1IVNA 1BROA 1F6DA 4R2IA 5KSYA 4A10A 1Z5GA 2XVAA 1T6ZA 2PQ6A 1CCWA 2WD9A 4P3XA 2NVUB 3LX5A 4DQXA 1Z47A 2FPOA 3M2PA 3DFUA 1G21E 3PCXA 1FSPA 1EK5A 4OKIA 2JFOA 4RH0A 3V8NA 4DAOA 1BAPA 4US2R 1E79A 3TSCA 4D4UA 1R4AA 1QHXA 5EWLB 1TEVA 1H6AA 1L7BA 3ZC3A 3KUKA 2H0AA 3ABSB 4UASA 4AKEA 1FDVA 5EPUA 4B3JA 3KO8A 9ABPA 4JB8A 2ZS9A 4I2NA 4PIVA 3HDVA 4EBBA 5AJUA 5I7AA 3Q9LA 1FMJA 1QFYA 2FA9A 5JAHA 4X1OA 5C18A 3N39C 2RHCA 1IVEA 2OGTA 1UKYA 4MVCA 2IHBA 2GEFA 4XVHA 2JD0A 1MLDA 2F43A 5JSUA 3NO0A 2VFAA 4LXUA 5BSMA 1PGJA 2GXSA 1ML3A 421PA 3WBKA 5JI2E 3AOEA 2W8BA 1FE8A 3JW8A 4ZODA 3AIIA 3CJRA 4J9VA 3JARA 1BS9A 1KVQA 3F1LA 4LV5B 4Y30A 2C00A 2WKRA 4JQOA 1NOJA 5K3DA 4EUKA