2HQXA

Crystal structure of human p100 tudor domain conserved region
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
b'TQFQKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFSTRVLPAQAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P100 CO-ACTIVATOR TUDOR DOMAIN
publication title Crystal Structure of Human P100 Tudor Domain Conserved Region
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
A PF00567 TUDOR Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2hqxA01
1WJQA 4E7KA 2RHIA 2K3YA 3L2QA 4LD6A 2R58A 2M16A 2GFUA 3OYIA 2EQMA 3PMIA 3BDLA 2X4YA 2RJDA 4B9WA 2MWOA 4BE2A 2BIVA 3EAEA 5CIUA 4IUTA 3OYBA 3E9FA 4A4FA 4BACA 2XDPA 4FU6A 4C5GA 1WGSA 2FHDA 4N4HA 4B9XA 3DLMA 3OS2A 2RHYA 4N4IA 3SD4A 4Z02A 3KUFA 3PFSA 3OMGA 5D6XA 4C5HA 2EQUA 2F5KA 3OYGA 3OY9A 3H6ZA 4PLIA 4A4EA 2CKKA 3MEWA 4BD3A 3FC3A 2E6NA 2RO0A 3OMCA 3ZEHA 4L59A 1G5VA 2IG0A 3LGLA 4E7IA 2RI5A 5C6SA 2XK0A 4IUUA 3CEYA 3MEUA 4ZTFA 4ZTJA 2DIQA 3QIIA 4HCZA 3OB9A 2LDMA 2RHZA 2RJEA 2LRQA 3ME9A 4RG2A 2GFAA 3PNWC 5FRNA 3UWNA 2HQEA 2PQWA 3LYIA 5KE2A 2EQJA 2QQSA 2P0KA 4BDYA 1H3ZA 4C5IA 2DAQA 3MP1A 3OYLA 3OYEA 4IUPA 3OYKA 3P8HA 2R5MA 2E5QA 2EKOA 3S3OA 3DB3A 2LVMA 3NTKA 3S6WA 3P8DA 3OYMA 1WJRA 5D6WA 4A4HA 3MO8A 3OYFA 4IUVA 4QQGA 2O4XB 3UT1A 1SSFA 2EFIA 4OVAA 2R57A 5FROA 2QQRA 5M9OA 3S3NA 3OS1A 3L2WA 3S3MA 2L89A 2HQXA 5C0MA 5IN1A 1OZ3A 3OS0A 1OZ2A 4IKFA 2MWPA 3H8ZA 3DB4A 3M9QA 3NTHA 4GY5A 3C4SA 3QKJA 5KE3A 2VYTA 4BDZA 1N27A 3F70A 1OI1A 2NLUA 3QBYA 2BKDN 4QW2A 2EQKA 3GOXA 2RI3A 3E9GA 4BE0A 2WACA 3MP8A 5FRMA 3MEVA 2M1HA 5J39A 1MHNA 5D6YA 2DIGA 4II1A 3FEOA 4E7LA 3O8VA 2L8DA 3Q1JA 4IUQA 3LLRA 4QQDA 2X4WA 2M0OA 4A4GA 3LGFA 2RI2A 3MP6A 3NTIA 4QVZA 4X34A 2RJFA 2X35A 2L3RA 4CRIA 4PL6A 4C5EA 3OYCA 4E7HA 3OYJA 3LH0A 3META 4EDUA 3MEAA 2K3XA 3OYDA 2R5AA 3L42A 3FDRA 2RHUA 5J26A 4NS5A 5KH6A 4QQ6A 2YRVA 2RHXA 3ASKA 2D9TA 1KHCA 3OYAA 5KCOA 2LTOA 3OQ5A 1WJSA 5KCHA 4UC4A 2JTFA 4FL6A 4PLLA 3LX7A 3L2VA 1XNIA 3OYHA 2RJCA 2BUDA 2B8AA 3FLGA 2LCCA 4N4GA 4Q5WA 3OYNA 4BE1A 3PMTA 4E7JA 3L2UA 5IAYA 3OA6A 2X4XA 1OYXA 3QJ6A 3L2RA 2GF7A 2O4XA 2JZ2A 4IURA 2G3RA 1RI0A
chains in the Genus database with same CATH superfamily
4XTWA 3G71Q 3VS5A 1M8MA 3QO3A 2K5LA 4CI0C 2ENMA 2ZPGB 3SDZA 3JB9D 4X9CA 3EAEA 1T0HA 4LDYA 5LJ3e 4DA4A 3UA7A 3VRYA 1W2BP 1WGSA 1Y57A 3D7SB 1D0XA 3R6OA 1AZGB 4M7DG 3VUBA 5I21A 2DBMA 1QVPA 2QK0A 2YRDA 3ZBDA 3EH1A 3OYYA 1BCOA 2L3SA 2VWFA 3FIFA 4LN2A 2RI5A 4M7AB 3CD6T 4EMHA 4ZGEB 2VGNA 2LRQA 4OMNA 3UATA 4FW1A 4HCBA 4IUPA 3QXEB 4X9DA 5GAN2 2EKOA 4M78A 2CP0A 2DLPA 2KQWA 2P0QA 2HZYA 1BU1A 2MYSA 4RCBA 3OW2A 2QGFB 1SSFA 4LNPA 1YCSB 4PJOB 5GANg 4FSSA 2O88A 2A36A 4IIOA 1ABOA 3X20B 1W6XA 1OQKA 3NGPA 3QBYA 5FWBA 1RAGB 1MHNA 3A5ZB 2DE0X 2C06A 4QQDA 2F2WA 2XD0A 3NTIA 2K2VA 4EMKC 2DILA 1BIBA 1GBRA 4HA8A 3REBB 1OULA 4J9CA 4HXJA 1VQMT 1VQ4T 4MMLA 3BE3A 3OYAA 4DBFA 4M78G 5KCHA 2AK5A 2ZPHB 4OMOA 4C0DB 4PJLA 2OTJA 2F5TX 1WHHA 2OI3A 4J7FA 4K11A 4JZ4A 2MMPA 1QWFA 3OYBA 4MMKA 4R0KA 4BACA 1B34A 4OMLA 2NYSA 5EC7A 2FZKB 5L8RE 3VRZA 3CCVQ 3BW1A 1VQNA 1IXDA 3PFSA 1GFDA 3UDCA 2OTJT 2D6FA 3OW2S 5FWCA 2DF6A 3EGXA 4F7UG 4C92D 3EGDB 4AG1C 2X4JA 2P4RA 3JCMQ 3LW5E 1W1FA 3H41A 1GFCA 1UHFA 1Y7XA 3G7ZA 2HEQA 2XIDA 1YI2A 1IHVA 3JV3A 1KSWA 3VS3A 4AFUC 3L2ZA 1UGRB 2RJEA 1TG0A 1Q95G 2PQWA 2RQTA 2EYWA 1VQOQ 3OYKA 5DY9A 4C92G 2DMOA 2I2LA 4JZ3A 4OB1B 3MO8A 2LQNA 1PSFA 3JCMh 2XMFA 1VQLT 1R8OB 1YI2T 5A0LA 2ESWA 4QT7A 3IQLA 2RNAA 4BDZA 4XTZA 3A8OB 2NLUA 1QCOA 3V7RA 2EQKA 1LPLA 2L3QA 1KQ2A 4E7LA 4RTWA 1X27A 2LNHB 4PK4A 2MK5A 2IIMA 4M75D 1M90R 4J9IA 1Q81R 4J9BA 1K1ZA 2LZ6B 2ED0A 3KFVA 2KR3A 1NJIU 5A0GA 2KSSA 3FDRA 3PVLA 4WTOB 4M4ZA 1C6VX 3QHSA 4QKUA 2D9TA 2KDSA 2LTOA 1TWBA 4UC4A 3CCEA 1UTIA 1X01A 3OYNA 1YJNQ 1N8RC 1JU5C 2PU9B 3OA6A 2QA4T 1RI0A 3O5ZA 4D6WA 2VKNA 2DK3A 1M3CA 4D8DA 2GTOA 2E70A 3OYIA 2EQMA 4F16A 3JAME 4IUTA 3G4SQ 3I56A 2AKKA 5GANd 1Q7YU 1E6HA 1IB8A 3M57A 5A2QE 1GCQC 1R77A 1Z9ZA 3OS2A 4C0GA 2YUNA 2DBKA 4C0FA 1SRMA 2DJZA 5IH2A 2YXYA 3PTAA 1GCPA 1M1KR 2MPXC 2C0TA 4J9GA 2QQ9A 2VXFA 4M7DF 3C0CA 4ANJA 1K9MC 1QVGA 2HL5C 4M7DC 4HCCA 3I56T 2LQ8A 2V1RA 5DLOA 1EX4A 2RD1A 2CP6A 4DBQA 1RAEB 3LWHA 2KMTA 3JCMg 1OPKA 1UJ0A 3P8HA 1ZQ1A 2E5QA 1FMVA 1YITQ 4RG8A 2O4XB 3CD6Q 2VC8A 2F69A 5M9OA 2K3BA 1VQ7A 1G3WA 1HXDA 2WSFE 2MWPA 1PD1A 4J83A 3DB4A 4LXCA 3F70A 3I35A 4A53A 2BKDN 2LCLA 2DL5A 3N5BB 4MZMA 3FEOA 5LJ5e 2XI9A 3LGFA 3MP6A 1N9SA 1YJ9T 4E7HA 2JMCA 3PGGA 1SF9A 4KT0E 1YIJA 2BZYA 1HK9A 2RQUA 1U06A 4M78E 1VQ7T 1R0BG 4BUGA 4FT4A 2JNGA 2XDBA 1U1TA 1BI0A 2QXFA 1YFNA 1BB9A 4LUDA 1DJ7B 1G83A 2X4XA 1QVGS 1X6OA 4M78F 5D7UA 1I0CA 2NUPB 2G3RA 2CS7A 1BI3A 1VQMQ 1YIJT 1Q81U 1VQ4Q 3HRTA 3PMIA 1ZBXA 2DL4A 4BE2A 3H0IA 3QPHA 4PJJA 3HFOA 2D1XA 3C95A 2VB6A 4J9DA 2Z0WA 1V29B 3EG2A 2ECZA 2E65A 4ORZA 3JCMX 4C5HA 2JTMA 2DRKA 3VJPA 2RK1A 1I5OB 2YT6A 3MEWA 4M77A 2VUBA 2ZPBB 1CSKA 5GMKh 2D0NA 4IUUA 3EG3A 1X6GA 1NG2A 4LD9K 1YP5A 2F2VA 4C0ZA 2EQJA 2EVRA 2KXDA 3CBOA 1YWPA 2YUQA 1O75A 3HHTB 1VUBA 4JJNK 4A4KA 4TVRA 5LJ3h 2CUBA 4M75B 2B86A 3OS1A 3PT9A 4C92C 1S72T 1UECA 3M53A 4BI8B 3CMAA 4ELYC 3HTRA 2RH2A 1X2QA 2KT1A 1X75C 2H3EB 1V1CA 2HCKA 2CP2A 1ZLMA 3EFSA 4FYYB 2OAWA 2DETA 4M7AA 2OX7A 3LH0A 1VQLQ 4JS5A 4XK8E 2P84A 1AVZC 4JJCA 2DXCA 4EMGA 2MOXA 4NS5A 4C8QB 2LJ0A 1VIEA 5FLXE 4KUDK 4N0AA 1WJSA 2PVGB 3HL8A 1Q82R 3LX7A 4FCYA 4FYWB 3A1PA 5GAN8 3JCMP 3NHNA 4XTUA 2XDDA 1S1NA 2LNVA 3C94A 4O5VA 1Q86C 4PJOA 2FPEA 1PKTA 1BBZA 2CDTA 2D8HA 3WVDB 3CCJA 1GRIA 4ELZC 2JW4A 2KRNA 1B7TA 1B3QA 3VU3C 5IT9E 4N4IA 4HCKA 2QA4Q 1UGSB 2F5KA 2DL3A 1LJOA 3M0QA 3A98A 2K2MA 2E41A 1AWJA 1MNDA 1NYFA 1TUGB 2NUTB 1KC8U 2IG0A 2MAMA 5I22A 2JS0A 1E6GA 1WPYA 1TUCA 2GNCA 3VS6A 4CC4B 4HCZA 3CCJT 3TEEA 3ME9A 1SHGA 3PNWC 5LJ3g 4A63B 3UWNA 1TTHB 2QQSA 4X1VA 1CKBA 5HK3A 3AT1B 2QYZA 3LWIA 2JXBA 3I5SA 4BI3A 2JT4A 5GAMd 1OU8A 4NL2A 4ZN3A 4NOYA 2GQIA 2L89A 2X9HA 3OBYA 4JUVA 3WVEB 3GOXA 1OI1A 4HVWA 3X25B 1NBEB 2ROTA 1PKSA 2G6FX 3O8VA 3CCUT 4CC2A 3EGDA 1KQSA 4PKCC 2O9SA 1YHQA 1A0NB 1K73U 1VQ9A 3L42A 2K5IA 4QQ6A 2YRVA 2E64A 4XU3A 5J3BA 3KBGA 3G6EA 1WHJA 3L2VA 3OSVA 2RJCA 2SEMA 4N4GA 3CPFA 1YJ9Q 4DEYA 2E4HA 2GF7A 1YHQT 1MNEA 1M2VA 1VQPQ 2DNUA 2QEXA 2M16A 2CUDA 2BZXA 1YN8A 5CIUA 2AIRB 4HT9A 1PG5B 3CQTA 2LX9A 2L5QA 1X43A 3CCLT 2QG9B 2V1QA 1K4US 1Q82U 3OMGA 1ZA1B 2KT8A 1VYUA 2O9VA 2K57A 3OYGA 1J3TA 4BD3A 1TSFA 4XTXA 1VOMA 2FZCB 5HKCA 4M7DD 2KNBB 1U8RA 2V8KA 2XHCA 3OMCA 5CCAA 2ZCFB 2FPDA 5C6SA 2NUZA 1WXBA 2XK0A 3QYHB 2FO0A 1TUDA 2DIQA 2KXCA 5GAOp 2JM8A 2GFAA 1KQSS 3VS4A 3CPWA 2MCNA 2AHJB 1KHIA 3CMEA 1NLPC 3OYEA 1NLOC 2OTLT 5GAN6 4EMKB 3UPUA 2DERA 4GLKA 4OMQA 1RAFB 4RTXA 1VYTA 1M1GA 1BI2A 3VUZA 2FRYA 4M77E 2HQXA 3OS0A 3J81E 3CC7A 2EAYA 3BDUA 4GY5A 2EWNA 3H9NA 4JRPA 3E9GA 1ARKA 3MEVA 2BTTA 1K8AC 2QTXA 5KYXA 4IUQA 1W2BA 1D3BB 3JB9H 3SWNC 1VQ5A 1RLQC 1FX7A 3EH2A 4CRIA 3OYCA 1S72Q 1NJIR 2CZ1B 1Y96A 5GAOm 2H8HA 3RUXA 4FSXA 5LJ5f 1H8KA 1XJWB 1GXIE 2JMAA 3NMZC 4D8KA 3RIRA 2KBTA 2QTVA 1UGQB 4M78D 3RERA 5CO7A 1TU0B 1IRXA 3L2RA 1AWXA 1TXQA 2O4XA 2JZ2A 4JJBA 2DFUA 2YWWA 2R58A 3CCRA 2HBPA 4R55A 2RA2A 1RL2A 2MWOA 3CPWS 1Q7YR 4OB0B 3CC4A 4M7AE 1ZUYA 3V8LA 1PWTA 3RDVA 2FB7A 2DZCA 2LX7A 3V7SA 3M0TA 1QKXA 2FG0A 2E1HA 7AT1B 1HD3A 2AZSA 4RKUE 3QG1A 3VS2A 2QQAA 2RO0A 1KQ1A 3CCRT 5CKDA 2K6DA 2LJ1A 1QCFA 3MKDA 5GAN7 4M7AF 1UE9A 3TVTA 2LQKA 1MGQA 4OGEA 1VQKA 3MEUA 1WQWA 1VQ6A 4DQ2A 2RQVA 1BI1A 2DKGA 2DTOA 4PJOE 1H3HA 2GTJA 4PJMA 4RG2A 1BCMA 3SB2A 1W2BS 5KE2A 4N0AC 5AYFA 1F1BB 2D8JA 5KYUB 2RQWA 5GAOn 3I55A 5CKFA 1WHMA 1K0SA 2A3LA 4ATOA 3KXTA 2OJ2A 5HCKA 1AEYA 3CCJQ 2PTKA 1VQ6T 4IKFA 2E10A 3QKJA 5LJ5j 5CKBA 4RTUA 4RTZA 2KI7A 3A8HB 3H0HA 2GQVA 4BY6C 2CZ7B 1VQNT 2ED1A 5D6YA 2DIGA 2L3PA 2COWA 4PFZA 3CCMA 2E5KA 4A4GA 2K5FA 1AZEA 4FW2A 2P0PA 4J9HA 2DA9A 3T9NA 3M0RA 1MMNA 2RHXA 1JQQA 5KCOA 5CR2A 4J6XA 1WYXA 2EYQA 1JXMA 4PLLA 1WXUA 3CCUQ 1XNIA 4E47A 2A28A 1OU9A 4MDWA 3QJ6A 1GL5A 4F17A 2XKOC 4MZPA 1OEBA 2PVOB 4M7DB 1ZA2B 2DXTA 2M51A 3M4GA 3VS1A 4L5GA 2CP3A 1X2KA 2MI6A 3E9FA 3ZFJA 3CCSA 2HSPA 5CKEA 3V8JA 2EW3A 4KUIA 2J05A 1YHQQ 3MPUB 3PVQA 2QAZA 2LQWA 2E6ZA 3EG9B 1OV3A 2MIOA 1ZSZA 4ESRA 4C8QA 3HSBA 3PIPA 3G1JA 5GAMf 4LE9A 3CCLQ 4JS4A 1D1AA 4Y28E 1K0XA 1LNXA 4DBHA 2HNIA 3QDFA 2HQEA 3GPLA 2CZ0B 4IIMA 2KEAA 3CCET 2O2OA 2R5MA 4VUBA 1VIFA 2PUOB 2DVEA 5GMKl 3QDRB 4RTYA 2CT4A 2K7AA 5FU7C 3MJXA 1I1JA 5EG2A 1SPKA 2FRWA 1OZ2A 1R0CB 5DLQE 2EYZA 3HFNA 3NTHA 1WQ7A 5FU6C 2OTLQ 4ZNXA 4BE0A 4LDXA 4PJNA 3CC2A 1QMCA 5FRMA 1MMAA 2L8DA 2DYIA 2M0OA 1NEGA 1UGVA 2NUTA 2J6FA 1BYMA 1K9MU 2KY9A 2NWMA 4EDUA 2QDLA 5IHKA 2DPPB 3GLXA 2R5AA 1VQ8A 3RKXA 4FT2A 2LT4A 2EGAA 3CC2T 4LDVA 2CREA 2SRCA 4Q5WA 3M0SA 5IAYA 2F1LA 2RF0A 1QP3A 3M56A 5GMKi 1AT1B 2GFUA 2M0YA 2DJQA 3BDLA 2XG8D 4HVVA 3EFOA 5HY6A 4EIKA 3CCQA 4F7UB 5GAOq 4DOWA 4J7IA 1ZUKA 5GAMj 1VQ8T 4FU6A 4OB3B 2DM1A 1U1SA 3JSCA 2KK4A 1W70A 3CXCP 5A0DA 1PC0A 3QYGB 4HVUA 1CKAA 3OBWA 4PLIA 1KD1C 3PIOA 2HD0A 1KC8R 1M90C 2E12A 4M78C 1C0MA 4CC7A 3G71A 4C92B 1LCKA 3CCQT 4ZTJA 4AG2C 2RHZA 2C0OA 1B34B 3BY7A 2VVKA 3CXCA 3CCRQ 3EGXB 3TSZA 3ER0A 2DEQA 2W10A 8AT1B 3UT1A 1QP2A 3A8GB 1G3SA 3G71T 2R57A 1ABQA 3L2WA 3S3MA 1OZ3A 3FB9A 5KYWA 4BB7A 2DTHA 5KE3A 5GJWB 5GAOl 2MF2A 2WSEE 1PM3A 4J9EA 2LCSA 5DM7R 1SEMA 2OTJQ 1IO6A 1M30A 5J39A 2EGCA 1M9SA 1QKWA 4M77D 2HDAA 2RQRA 2X35A 1PCXA 1K73R 1ZBJA 1HSQA 1KK7A 1VQ6Q 1M1KC 4R56A 2D0QB 1QVFP 5J26A 5CQYA 2X51A 1BK2A 3OQ5A 1VQNQ 4FL6A 1WXTA 2DXUA 3RMSA 2XU8A 4EMKA 4M77G 4E7JA 1WHLA 5IHIA 3TU4K 3FRNA 3OY9A 3X26B 3V8KA 2EBPA 3HKSA 3VS7A 2Y4YA 3ZL7C 1YI2Q 4GLMA 2QASA 1WX6A 3HPWA 2QDYB 2CGHA 4JDSA 1OOTA 3P8BB 3J7AF 3CXCS 4PNOA 4FIBA 4JRKA 3CMAT 1QVFA 1D3BA 4BI4A 3E2UA 3JCMd 4M7AD 3M4YA 3JB9I 2DD4A 4L59A 4E7IA 4M75E 4NL3A 3OB9A 1ZX6A 1WDXA 3MP1A 5GAMe 2JOYA 3GIBA 3CCVA 3M0UA 1YNZA 4M7AG 1P92A 1Q86U 1I07A 1YJWA 4PJOD 1EZZB 4DEXA 5FROA 2QQRA 2V8IA 1IZ6A 3S3NA 2F2XA 3JCMb 2ZPIB 4XU2A 3CCEQ 1UUEA 4C8QE 2DXBA 3TREA 3DKMA 3A8MB 3MCAB 2YLBA 1JXOA 2EKHA 2AZVA 3CCVT 4PJOG 1QW1A 2KYMA 4X34A 2CH4A 1YJWT 2CSIA 1IHWA 4PL6A 4C5EA 1M5Q1 2EQIA 1I81A 1WLPB 2K3XA 3I56Q 4C8QF 3V7CA 1ZSZC 1QVFS 3QZ9B 3M59A 2KE9A 1D0ZA 1M2OA 5GMKm 5AT1B 1YCYA 1T0JA 2WSCE 1RLPC 4IURA 2BE9B 4E7KA 4ZGJB 1B07A 2EYXA 1IREB 1AWOA 1QQJA 1HJDA 2RJDA 2ROLA 4KGVB 1H641 4RCCA 1UGPB 4N4HA 2LP5A 2YUOA 3M55A 4E6RA 4DOVA 5GANf 4E7ZA 1Y0MA 3RMQA 3EG1A 2A37A 4XAXB 5D6XA 1M27C 1FWZA 4AFQC 5CQXA 1NM7A 1YJNA 4OMPA 1OX8A 3VYGA 2COZA 1VQ7Q 1G5VA 1VQ9T 1VQ8Q 2AT1B 2ZGWA 3G4SA 1XTDA 1KIKA 3G6ET 5CK9A 3M54A 3SWNB 3S3OA 3S6WA 1H92A 1WJRA 5D6WA 1YIJQ 2DZ9A 4QQGA 2A7YA 4LUEA 2QEXT 3CCQQ 4OVAA 1M8VA 4J8OA 2X3WD 3RBBB 4KH0B 2JTEA 4GBQA 5GMKe 3G4ST 4MDXA 3H8ZA 3WXMB 4PFPA 1UJYA 3C4SA 4EPCA 4F14A 4LDUA 3SEMA 1RACB 4PFOA 2M1HA 3QJYA 1ZHIA 1UHCA 3EG9A 2ZPEB 4OF1A 2W0ZA 1YITA 1M3AA 4AT1B 2HMAA 3NPFA 4P5NA 4ZGDB 3OYDA 5I2SA 4JRQA 3CD6A 5CAIA 5KYYB 3U23A 1I5LA 5GANj 1LVKA 1QLYA 3OW2P 5GAN5 3CMET 3FLGA 1JO8A 2HBWA 4KGXB 2K9GA 4Z88A 2KGTA 3FJ5A 3JB9G 1YITT 3L2QA 4M77F 2RPNA 4LD6A 5CKHA 2C0IA 2YLCA 4M77C 1IGUA 1UFFA 4C5GA 1RUWA 3CC7T 2YUPA 2Y90A 2V26A 2DRMA 1K8AU 3SD4A 1QWEA 1EFNA 3GBQA 4Z02A 4E7SA 2ZAEA 5LJ3d 1AWWA 1D09B 1O9SA 3H6ZA 3I5RA 1WFWA 1VQ5T 1D1BA 2EPDA 1U3OA 1VYVA 1VQMA 1VQ4A 3CEYA 1NZ9A 2LC4A 1WNLA 4Y92A 1QCNA 2LDMA 3VKIA 3CMAQ 2CSQA 4FYXB 4BY6B 1H3ZA 2VV5A 5LJ5h 1ZSGA 1N8RR 3E1SA 2FPFA 2OAUA 2H3JA 3NTKA 3OYMA 2ABLA 4A4HA 2HL3A 2JVVA 2K79A 2EFIA 4KBMB 4F7UA 1FYNA 1WZOA 1GBQA 8ATCB 4M7AC 2M02A 2COYA 2BE7D 1Z9QA 3X24B 3CC4T 2GBQA 3R6NA 3X28B 4QVCA 2NUPA 5CVIA 4FYVB 1K9MR 3OYJA 4C92A 4PJOF 3CBMA 3GNFB 1G2BA 2P4TA 4PJOC 1VQKT 3DLLA 1C1AA 2YDLA 1KHCA 1NE8A 2E3HA 1G8XA 1AD5A 2GGRA 2PVDB 1YJWQ 3TSWA 4L6V5 3JCMf 3I55T 3GP8A 3ULRB 3ASKA 2RHIA 1PD0A 1NPPA 4Y91A 2X4YA 3RESA 1VQLA 1X6BA 2EGEA 4XTYA 2J6KA 2RB6A 4B9XA 4KGZB 4KH1B 4C0DC 2CKKA 3CCMT 1XQHA 3FC3A 5GANe 2J7IA 4M75A 5FU7B 1M2VB 5LJ5g 1SG5A 4OMFB 4A54A 1W4SA 3LGLA 4ZTFA 1NJIC 4RTVA 5FU6B 2LMJA 1TS9A 4Z8AA 3LYIA 1FXXA 1KD1R 4AMCA 4WF2A 2Y4XA 3OYLA 2O01E 4ZN1A 1G3YA 2LVMA 2QA4A 1M1FA 1V76A 4WCIA 1VQ9Q 1UG1A 2QGGA 2KRSA 2QI2A 1MUZA 4OB2B 1IGQA 3G6EQ 3CCST 1RAAB 1UEBA 5FW9A 1I8FA 1Q7YC 2ZPFB 2WACA 2VASA 4M75G 1N8RU 1QVGP 2DD5A 4J9FA 2X4WA 2O31A 2A0FB 2RI2A 3QSUA 1RADB 2QEXQ 2L3RA 3CBPA 3M0PA 5I11A 1KG1A 1FMWA 3HRSA 4C8QD 1KJWA 2FL7A 2DX1A 1UDLA 4M7DE 5GAMh 4OGCA 3J80E 2BUDA 2X3XD 4BE1A 3PMTA 2KRMA 5KYXB 2PZ1A 4F04B 4C8QG 2KVQG 1TH7A 4M78B 1JEGA 1MMGA 2L0AA 4OP0A 2JS2A 4LDWA 5GAN4 3JB9F 4AFZC 1Y96B 2EYYA 3EHRA 4RUGA 3CMEQ 2RMOA 6AT1B 3EFRA 2EQUA 4KULA 5GAOr 1D1CA 4A4EA 1T3SA 2KAFA 1YJ9A 1UB4A 1VQPA 2QQBA 1OPLA 3RKYA 4FM4B 3INZA 1N6AA 3CC7Q 2YSQA 2J06A 2HKQB 5LL6S 2DTIA 1SKUB 3NFCA 2FEIA 2P0KA 2AKLA 2DEUA 3GF5A 3H0FA 1VQ5Q 1KFZA 1WIEA 2I0NA 1Q86R 3P8DA 3RNJA 2DL8A 3QUIA 3TCJA 4CC3A 1K9AA 1VQPT 5L23A 2JM9A 2CP7A 1Q81C 3REAB 9ATCB 5C0MA 5IN1A 1K76A 4JRIA 5IXBA 3A8LB 3VS0A 2J6OA 4QW2A 3MP8A 1KD1U 5FRNA 3Q1JA 4RTTA 2RJFA 3JCMJ 1M90U 5GAMg 3E19A 4B6MA 1ACMB 1RABB 2EIFA 4OMMA 5LJ5d 2HKNA 1JBMA 3CC4Q 3RR6A 1BIAA 1RAHB 1T3LA 2V8JA 4AFSC 2CP5A 4F7UE 3FJPA 1PSEA 3SWNA 3JCMc 3EHQA 2A08A 2LCCA 1WI7A 5GAN3 5LJ3f 3UA6A 3HRUA 4RMOA 1PNJA 2KYBA 1HYOA 2FVUA 1VQKQ 1N9RA 3VV0A 4F7UF 2BIVA 1S72A 1WHKA 1RAIB 2GCXA 4A4FA 2JN0A 2XDPA 4C92E 5IXFA 1LOJA 3JCMe 4XU0A 2PNIA 3DLMA 3I9QA 3LH5A 4HT8A 1VA7A 1U5SA 3KUFA 2EJ9A 3I55Q 1EIFA 2EJFA 1MV3A 3C12A 2YHTA 4XTVA 3SHWA 1M1KU 4V2SA 5IHNA 4C92F 5KYYA 3TQ7P 1AHJB 3PE0A 2YRCA 2FZGB 1SRLA 4J5YA 5GJVB 4C5IA 2DAQA 2IPOB 3UF4A 3CCMQ 1NPRA 1RI9A 3URGA 3QWYA 2IVWA 3DB3A 1PRMC 3OYFA 3HP9A 5GMKj 1BKBA 3OS5A 4E2FB 3EG0A 2DL7A 2LJ3A 1ZSZB 4JLIA 1WA7A 1YWOA 4JJDA 2K4YA 3QWXX 3RKWA 4DBRA 2ATCB 2CYZB 1N27A 1M3BA 3BFMA 1JJ2P 4II1A 2DVJA 4QVZA 2XICA 5LJ3j 3JB9J 4M75F 1D0YA 4J6YA 2PUKB 3MEAA 3CCSQ 1KC8C 4M75C 1Y71A 2HQHA 5KH6A 2JTFA 4QVDA 3OYHA 4O6JA 2B8AA 2RK2A 4MZTA 2EJGA 1XOVA 1OYXA 1VQOA 2VGMA 3JCMV 1WJQA 1N5ZA 2K3YA 1PHTA 1JJ2A 1MV0B 2VXEA 3QZ5B 5KYNA 4B9WA 3THKA 1X69A 2JUFA 2RN8A 1SHFA 1MMDA 4C8QC 1KQSP 2FHDA 4XU1A 1AOJA 1K8AR 2RHYA 3JRZA 5KYUA 2RM4A 2L2PA 1ZUUA 3CCUA 2CZ6B 5ECAA 1VQOT 2E6NA 3ZEHA 2FYKA 2DYBA 2KROA 1K73C 3EFOB 4XQ3A 3QIIA 3CC2Q 2ZZDA 4JLGA 4BDYA 3L1AA 2DO3A 2M9UA 1TOVA 1JRIA 2CT3A 2HAXA 2HSEB 4IUVA 3M5AA 4ME7A 3VYHB 1E7OA 1GCQA 1FMKA 1Y07A 3CCLA 3M9QA 3EGUA 4KRTA 2VYTA 1G3TA 1NEBA 1PRLC 4J6WA 2RI3A 4HKEA 1JB0E 1WHGA 3AHUA 5GANh 1M4ZA 1OX9A 1Q82C 1JJ2S 3LLRA 1I4K1 2E3IA 1YJNT 4JPBW 4Z89A 4YTLA 4M7DA 3META 4M77B 3CPWP 2JJ9A 3JCMW 1SSHA 2RHUA 3OSSC 5I2MA 5KYWB 5HK0A 3GNGA 1YBYA 2BZ8A 2OTLA 3M58A 3SFMA 3L2UA 3MHXA 1NYGA 2CH4W 2LT1A
chains in the Genus database with same CATH topology
4XTWA 2RHIA 5GMKi 4PJOA 4Y91A 1NPPA 2GFUA 3QO3A 2K5LA 3BDLA 4CI0C 2XG8D 2X4YA 2ZPGB 3RESA 3SDZA 3JB9D 1VQLA 5HY6A 4X9CA 3EAEA 3CCQA 4F7UB 4LDYA 5LJ3e 4DA4A 3WVDB 4XTYA 4DOWA 5GAOq 4J7IA 5GAMj 1VQ8T 2RB6A 4FU6A 4OB3B 3CCJA 1WGSA 1U1SA 3JSCA 4ELZC 2KK4A 4B9XA 5A0DA 3VU3C 3R6OA 5IT9E 4N4IA 3QYGB 4M7DG 1UGSB 2F5KA 3OBWA 4PLIA 3VUBA 4C0DC 5I21A 1KD1C 2CKKA 3CCMT 1QVPA 3PIOA 2HD0A 1LJOA 1XQHA 3ZBDA 3FC3A 3OYYA 5GANe 4M75A 5FU7B 2E41A 1M90C 5LJ5g 1KC8U 2E12A 4M78C 4OMFB 4A54A 3FIFA 3G71A 1W4SA 2IG0A 2MAMA 3LGLA 2RI5A 4M7AB 4C92B 1H3ZA 3CCQT 4ZTFA 3CD6T 1NJIC 1WPYA 4EMHA 4ZGEB 4ZTJA 5FU6B 4HCZA 3CCJT 3TEEA 2RHZA 2VGNA 3ME9A 2LRQA 1B34B 3PNWC 5LJ3g 3UWNA 3LYIA 3BY7A 2QQSA 1FXXA 4WF2A 2Y4XA 4HCBA 3OYLA 4IUPA 4C92E 2O01E 3QXEB 5HK3A 4X9DA 5GAN2 2EKOA 4ZN1A 4M78A 1G3YA 2LVMA 2QA4A 3CXCA 2KQWA 1M1FA 2P0QA 3LWIA 3ER0A 4RCBA 2DEQA 4BI3A 3OW2A 3UT1A 1QP2A 1SSFA 2QI2A 3A8GB 1G3SA 3G71T 4PJOB 2R57A 5GAMd 5GANg 4NL2A 4ZN3A 4NOYA 3L2WA 3S3MA 2L89A 1OZ3A 3FB9A 4OB2B 3CCST 4BB7A 1UEBA 2DTHA 1I8FA 3OBYA 3X20B 5KE3A 4JUVA 3WVEB 5GAOl 1Q7YC 2MF2A 2WSEE 3GOXA 1OI1A 3QBYA 5DM7R 2ZPFB 2WACA 3X25B 4M75G 5J39A 1MHNA 3A5ZB 1N8RU 2DD5A 3O8VA 4QQDA 1M9SA 3CCUT 2C06A 2XD0A 2X4WA 1KQSA 3NTIA 2RI2A 4M77D 4PKCC 2K2VA 4EMKC 1YHQA 3QSUA 1BIBA 2L3RA 2X35A 3CBPA 4HA8A 1KG1A 3HRSA 4C8QD 1K73U 1M1KC 1VQ9A 4R56A 2FL7A 3L42A 2D0QB 1VQMT 5J26A 1VQ4T 5CQYA 2K5IA 4M7DE 4QQ6A 2YRVA 2E64A 4MMLA 4XU3A 5J3BA 3KBGA 5GAMh 3G6EA 3OYAA 3OQ5A 4M78G 5KCHA 4OGCA 4FL6A 3L2VA 2DXUA 2ZPHB 3OSVA 2RJCA 3RMSA 2XU8A 4EMKA 2BUDA 4M77G 3J80E 4C0DB 4N4GA 4BE1A 4E7JA 2OTJA 3PMTA 3TU4K 3CPFA 3FRNA 2F5TX 2GF7A 4C8QG 1YHQT 3OY9A 2KVQG 1TH7A 3X26B 4M78B 3V8KA 3HKSA 2Y4YA 2QEXA 4OP0A 2M16A 4LDWA 4J7FA 2MMPA 3OYBA 5CIUA 4HT9A 5GAN4 4MMKA 3JB9F 2LX9A 1Y96B 3HPWA 4BACA 2L5QA 2QDYB 3CCLT 1B34A 2CGHA 4JDSA 5L8RE 3P8BB 3J7AF 3CXCS 4PNOA 1VQNA 3BW1A 4FIBA 4JRKA 1Q82U 3CMAT 3PFSA 1D3BA 3OMGA 1QVFA 3EFRA 3UDCA 4BI4A 2OTJT 2D6FA 2EQUA 4KULA 3OW2S 5GAOr 2K57A 3OYGA 4A4EA 3JCMd 4F7UG 2KAFA 4BD3A 1YJ9A 4XTXA 4C92D 5HKCA 4M7AD 4M7DD 1UB4A 3M4YA 3JB9I 1U8RA 2DD4A 2V8KA 2X4JA 2XHCA 3OMCA 5CCAA 3JCMQ 2ZCFB 3LW5E 4L59A 1VQPA 2QQBA 3RKYA 4FM4B 4E7IA 3INZA 5C6SA 2XK0A 3QYHB 1N6AA 1Y7XA 4M75E 3G7ZA 2XIDA 2DIQA 4NL3A 1YI2A 3OB9A 5LL6S 3L2ZA 1UGRB 2DTIA 2RJEA 5GAOp 2GFAA 1KQSS 2PQWA 3CPWA 3NFCA 2P0KA 2AHJB 1KHIA 3CMEA 3MP1A 3OYEA 3OYKA 5GAMe 2JOYA 5DY9A 2OTLT 3GF5A 3CCVA 5GAN6 4C92G 3GIBA 4M7AG 4EMKB 1P92A 2I2LA 3UPUA 1Q86U 4GLKA 3P8DA 4OB1B 3QUIA 1YJWA 3TCJA 4PJOD 3MO8A 1PSFA 1VQPT 3JCMh 1M1GA 1BI2A 5FROA 2QQRA 2V8IA 1IZ6A 3S3NA 3VUZA 1Q81C 1VQLT 1R8OB 4M77E 2HQXA 5C0MA 5IN1A 3JCMb 3OS0A 1YI2T 5A0LA 1Q7YU 3J81E 4JRIA 3CC7A 2EAYA 2ZPIB 3BDUA 2EWNA 4GY5A 3A8LB 4XU2A 4C8QE 2DXBA 4BDZA 4XTZA 3A8OB 2NLUA 3V7RA 4JRPA 4QW2A 2EQKA 3TREA 3E9GA 3DKMA 3A8MB 3MP8A 3MCAB 2YLBA 3MEVA 1KD1U 1K8AC 1KQ2A 2QTXA 5FRNA 3CCVT 4PJOG 4E7LA 3Q1JA 4IUQA 1W2BA 1D3BB 1QW1A 3JB9H 4X34A 3SWNC 1VQ5A 1YJWT 2RJFA 4M75D 3JCMJ 1M90U 1FX7A 5GAMg 3E19A 4CRIA 4PL6A 4C5EA 1M5Q1 3OYCA 2EIFA 1I81A 1NJIU 2K3XA 2CZ1B 5A0GA 4C8QF 5LJ5d 2KSSA 1JBMA 1Y96A 3FDRA 3V7CA 1BIAA 5GAOm 3RUXA 1QVFS 4FSXA 5LJ5f 2V8JA 3QHSA 2D9TA 4F7UE 3QZ9B 2KDSA 2LTOA 1GXIE 4UC4A 3M59A 3FJPA 1PSEA 3CCEA 3RIRA 3SWNA 1X01A 3JCMc 2LCCA 3OYNA 5GMKm 1UGQB 4M78D 3RERA 5CO7A 1N8RC 5GAN3 5LJ3f 2PU9B 1YCYA 3OA6A 3HRUA 3L2RA 2WSCE 4RMOA 2O4XA 2JZ2A 4IURA 2QA4T 1RI0A 4E7KA 4ZGJB 4D6WA 2DK3A 2FVUA 2HBPA 2R58A 2E70A 3OYIA 3CCRA 4R55A 1IREB 2EQMA 2RA2A 1N9RA 1RL2A 2RJDA 3VV0A 4F7UF 2MWOA 1H641 2BIVA 3JAME 3CPWS 4IUTA 1S72A 3I56A 3JCMe 2GCXA 4A4FA 2JN0A 2XDPA 1UGPB 4OB0B 1LOJA 4RCCA 3M57A 3V8LA 4XU0A 4N4HA 2FB7A 5A2QE 2DZCA 3M55A 5GANf 3DLMA 4DOVA 3OS2A 4C0GA 4HT8A 3RMQA 3V7SA 4XAXB 3KUFA 2EJ9A 5D6XA 4C0FA 2DJZA 1FWZA 1EIFA 2EJFA 2E1HA 5CQXA 3PTAA 3C12A 2YHTA 3QG1A 4RKUE 4XTVA 1YJNA 3VYGA 2QQAA 1M1KU 4V2SA 2RO0A 1KQ1A 3CCRT 2QQ9A 2VXFA 4C92F 5CKDA 4M7AF 4M7DF 5GAN7 1K9MC 1G5VA 1VQ9T 2LQKA 1QVGA 1MGQA 1AHJB 4OGEA 1VQKA 4M7DC 3MEUA 1WQWA 4HCCA 4DQ2A 3I56T 2LQ8A 2ZGWA 1VQ6A 1BI1A 2DKGA 2DTOA 4PJOE 5DLOA 3G4SA 4J5YA 1XTDA 2RD1A 4RG2A 3SB2A 1W2BS 3G6ET 3LWHA 5KE2A 2KMTA 3JCMg 4C5IA 5CK9A 2DAQA 1NPRA 4N0AC 3URGA 3P8HA 5AYFA 1ZQ1A 3M54A 2E5QA 3SWNB 5GAOn 2IVWA 3S3OA 3DB3A 3I55A 3S6WA 5CKFA 1WJRA 5D6WA 2A3LA 3OYFA 3HP9A 4ATOA 2DZ9A 4QQGA 2O4XB 4RG8A 5GMKj 2A7YA 1BKBA 3KXTA 2QEXT 3OS5A 4OVAA 2VC8A 1M8VA 2F69A 4J8OA 5M9OA 4JLIA 1VQ7A 1VQ6T 1G3WA 1HXDA 2K4YA 5GANd 2WSFE 4IKFA 2E10A 3RKWA 2MWPA 5GMKe 3G4ST 4J83A 4MDXA 3H8ZA 3DB4A 3WXMB 3C4SA 3QKJA 4EPCA 2CYZB 5CKBA 5LJ5j 1N27A 3F70A 4A53A 2BKDN 2LCLA 3A8HB 4LDUA 2GQVA 4BY6C 2CZ7B 1VQNT 3BFMA 2M1HA 3N5BB 5D6YA 2DIGA 3QJYA 3FEOA 1ZHIA 4II1A 4MZMA 5LJ5e 2XI9A 3CCMA 4A4GA 3LGFA 4QVZA 3MP6A 2K5FA 1N9SA 2XICA 2ZPEB 5LJ3j 4OF1A 1YJ9T 1YITA 3JB9J 4E7HA 3PGGA 4KT0E 4M75F 2P0PA 1YIJA 4J6YA 1HK9A 2PUKB 4M78E 3MEAA 3T9NA 4P5NA 1KC8C 4M75C 4ZGDB 3OYDA 5I2SA 4JRQA 1VQ7T 5CAIA 3CD6A 1Y71A 4BUGA 5KH6A 4FT4A 2RHXA 2JNGA 2XDBA 1I5LA 5KCOA 5CR2A 1U1TA 1BI0A 2QXFA 4J6XA 2JTFA 2EYQA 4PLLA 4QVDA 1XNIA 3OYHA 5GANj 4O6JA 1DJ7B 4E47A 5GAN5 2B8AA 3CMET 3FLGA 2RK2A 4MZTA 2EJGA 1XOVA 4MDWA 2X4XA 1OYXA 3QJ6A 1VQOA 1X6OA 1QVGS 4M78F 2XKOC 2VGMA 3JCMV 4MZPA 2G3RA 3JB9G 1WJQA 1YITT 2K3YA 3L2QA 4M77F 2CS7A 4LD6A 1BI3A 5CKHA 2YLCA 1YIJT 1JJ2A 1Q81U 2PVOB 2VXEA 3HRTA 3PMIA 3QZ5B 1ZBXA 4B9WA 4M77C 2DXTA 4M7DB 3M4GA 4BE2A 2JUFA 2MI6A 3E9FA 4L5GA 3ZFJA 3CCSA 3QPHA 1Q86C 3HFOA 4C8QC 4C5GA 2FHDA 3C95A 5CKEA 3CC7T 4XU1A 2Y90A 1V29B 2RHYA 2E65A 1K8AU 3V8JA 3SD4A 4Z02A 4KUIA 3JRZA 3JCMX 4C5HA 2RM4A 2JTMA 5LJ3d 3CCUA 1O9SA 3CC4A 2CZ6B 3H6ZA 3VJPA 1VQOT 2RK1A 3MEWA 1VQ5T 4M77A 2E6NA 2VUBA 2ZPBB 2E6ZA 3ZEHA 2FYKA 4C8QA 3HSBA 5GMKh 1K73C 3PIPA 1VQMA 5GAMf 4IUUA 3CEYA 1VQ4A 4JS4A 1NZ9A 4XQ3A 4Y28E 2LC4A 1WNLA 3QIIA 4LD9K 1LNXA 2LDMA 3VKIA 2HNIA 4C0ZA 4BY6B 2HQEA 2ZZDA 4JLGA 2CZ0B 2EQJA 2VV5A 5LJ5h 3GPLA 4BDYA 3L1AA 3CCET 3E1SA 2DO3A 2M9UA 3CBOA 2R5MA 4VUBA 1O75A 1VIFA 2OAUA 1JRIA 3HHTB 2PUOB 1VUBA 2H3JA 3NTKA 2DVEA 3OYMA 4JJNK 4A4KA 5GMKl 4A4HA 3QDRB 4TVRA 2HAXA 4IUVA 5LJ3h 2JVVA 4M75B 3M5AA 2EFIA 4KBMB 5FU7C 4F7UA 4ME7A 5EG2A 3VYHB 3OS1A 3PT9A 4C92C 1S72T 4M7AC 1OZ2A 5DLQE 1Y07A 3CCLA 3HFNA 3M9QA 3X24B 3NTHA 3CC4T 1WQ7A 5FU6C 2VYTA 3M53A 1G3TA 4BI8B 3CMAA 4J6WA 4ELYC 2RI3A 4HKEA 4BE0A 1JB0E 3X28B 3CC2A 4LDXA 5FRMA 2RH2A 3AHUA 4QVCA 5GANh 1X75C 1M4ZA 2L8DA 1Q82C 1JJ2S 3LLRA 4M7AE 1I4K1 2M0OA 5CVIA 3EFSA 1YJNT 1BYMA 4YTLA 1K9MU 3OYJA 4C92A 4M7AA 2KY9A 3LH0A 3META 4M77B 4M7DA 4PJOF 4EDUA 4JS5A 3CBMA 4XK8E 3JCMW 2DPPB 3GLXA 2DXCA 2R5AA 3GNFB 2P4TA 4EMGA 2RHUA 1VQKT 3OSSC 4NS5A 4C8QB 4PJOC 3DLLA 5I2MA 1VQ8A 3ASKA 1VIEA 1KHCA 1NE8A 3RKXA 5FLXE 5HK0A 4N0AA 1WJSA 4FT2A 2LT4A 3GNGA 2PVGB 4KUDK 3HL8A 3LX7A 1YBYA 3CC2T 4LDVA 5GAN8 2PVDB 2OTLA 4Q5WA 3M58A 3SFMA 3L2UA 3JCMP 4XTUA 5IAYA 3MHXA 2XDDA 2LNVA 4L6V5 3JCMf 3C94A 4O5VA 3I55T 3GP8A 1QP3A 3M56A 2LT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJQ A;  4E7K A;  2RHI A;  2K3Y A;  3L2Q A;  4LD6 A;  2R58 A;  2M16 A;  2GFU A;  3OYI A;  2EQM A;  3PMI A;  3BDL A;  2X4Y A;  2RJD A;  4B9W A;  2MWO A;  4BE2 A;  2BIV A;  3EAE A;  5CIU A;  4IUT A;  3OYB A;  3E9F A;  4A4F A;  4BAC A;  2XDP A;  4FU6 A;  4C5G A;  1WGS A;  2FHD A;  4N4H A;  4B9X A;  3DLM A;  3OS2 A;  2RHY A;  4N4I A;  3SD4 A;  4Z02 A;  3KUF A;  3PFS A;  3OMG A;  5D6X A;  4C5H A;  2EQU A;  2F5K A;  3OYG A;  3OY9 A;  3H6Z A;  4PLI A;  4A4E A;  2CKK A;  3MEW A;  4BD3 A;  3FC3 A;  2E6N A;  2RO0 A;  3OMC A;  3ZEH A;  4L59 A;  1G5V A;  2IG0 A;  3LGL A;  4E7I A;  2RI5 A;  5C6S A;  2XK0 A;  4IUU A;  3CEY A;  3MEU A;  4ZTF A;  4ZTJ A;  2DIQ A;  3QII A;  4HCZ A;  3OB9 A;  2LDM A;  2RHZ A;  2RJE A;  2LRQ A;  3ME9 A;  4RG2 A;  2GFA A;  3PNW C;  5FRN A;  3UWN A;  2HQE A;  2PQW A;  3LYI A;  5KE2 A;  2EQJ A;  2QQS A;  2P0K A;  4BDY A;  1H3Z A;  4C5I A;  2DAQ A;  3MP1 A;  3OYL A;  3OYE A;  4IUP A;  3OYK A;  3P8H A;  2R5M A;  2E5Q A;  2EKO A;  3S3O A;  3DB3 A;  2LVM A;  3NTK A;  3S6W A;  3P8D A;  3OYM A;  1WJR A;  5D6W A;  4A4H A;  3MO8 A;  3OYF A;  4IUV A;  4QQG A;  2O4X B;  3UT1 A;  1SSF A;  2EFI A;  4OVA A;  2R57 A;  5FRO A;  2QQR A;  5M9O A;  3S3N A;  3OS1 A;  3L2W A;  3S3M A;  2L89 A;  2HQX A;  5C0M A;  5IN1 A;  1OZ3 A;  3OS0 A;  1OZ2 A;  4IKF A;  2MWP A;  3H8Z A;  3DB4 A;  3M9Q A;  3NTH A;  4GY5 A;  3C4S A;  3QKJ A;  5KE3 A;  2VYT A;  4BDZ A;  1N27 A;  3F70 A;  1OI1 A;  2NLU A;  3QBY A;  2BKD N;  4QW2 A;  2EQK A;  3GOX A;  2RI3 A;  3E9G A;  4BE0 A;  2WAC A;  3MP8 A;  5FRM A;  3MEV A;  2M1H A;  5J39 A;  1MHN A;  5D6Y A;  2DIG A;  4II1 A;  3FEO A;  4E7L A;  3O8V A;  2L8D A;  3Q1J A;  4IUQ A;  3LLR A;  4QQD A;  2X4W A;  2M0O A;  4A4G A;  3LGF A;  2RI2 A;  3MP6 A;  3NTI A;  4QVZ A;  4X34 A;  2RJF A;  2X35 A;  2L3R A;  4CRI A;  4PL6 A;  4C5E A;  3OYC A;  4E7H A;  3OYJ A;  3LH0 A;  3MET A;  4EDU A;  3MEA A;  2K3X A;  3OYD A;  2R5A A;  3L42 A;  3FDR A;  2RHU A;  5J26 A;  4NS5 A;  5KH6 A;  4QQ6 A;  2YRV A;  2RHX A;  3ASK A;  2D9T A;  1KHC A;  3OYA A;  5KCO A;  2LTO A;  3OQ5 A;  1WJS A;  5KCH A;  4UC4 A;  2JTF A;  4FL6 A;  4PLL A;  3LX7 A;  3L2V A;  1XNI A;  3OYH A;  2RJC A;  2BUD A;  2B8A A;  3FLG A;  2LCC A;  4N4G A;  4Q5W A;  3OYN A;  4BE1 A;  3PMT A;  4E7J A;  3L2U A;  5IAY A;  3OA6 A;  2X4X A;  1OYX A;  3QJ6 A;  3L2R A;  2GF7 A;  2O4X A;  2JZ2 A;  4IUR A;  2G3R A;  1RI0 A; 
#chains in the Genus database with same CATH topology
 4XTW A;  3G71 Q;  3VS5 A;  1M8M A;  3QO3 A;  2K5L A;  4CI0 C;  2ENM A;  2ZPG B;  3SDZ A;  3JB9 D;  4X9C A;  3EAE A;  1T0H A;  4LDY A;  5LJ3 e;  4DA4 A;  3UA7 A;  3VRY A;  1W2B P;  1WGS A;  1Y57 A;  3D7S B;  1D0X A;  3R6O A;  1AZG B;  4M7D G;  3VUB A;  5I21 A;  2DBM A;  1QVP A;  2QK0 A;  2YRD A;  3ZBD A;  3EH1 A;  3OYY A;  1BCO A;  2L3S A;  2VWF A;  3FIF A;  4LN2 A;  2RI5 A;  4M7A B;  3CD6 T;  4EMH A;  4ZGE B;  2VGN A;  2LRQ A;  4OMN A;  3UAT A;  4FW1 A;  4HCB A;  4IUP A;  3QXE B;  4X9D A;  5GAN 2;  2EKO A;  4M78 A;  2CP0 A;  2DLP A;  2KQW A;  2P0Q A;  2HZY A;  1BU1 A;  2MYS A;  4RCB A;  3OW2 A;  2QGF B;  1SSF A;  4LNP A;  1YCS B;  4PJO B;  5GAN g;  4FSS A;  2O88 A;  2A36 A;  4IIO A;  1ABO A;  3X20 B;  1W6X A;  1OQK A;  3NGP A;  3QBY A;  5FWB A;  1RAG B;  1MHN A;  3A5Z B;  2DE0 X;  2C06 A;  4QQD A;  2F2W A;  2XD0 A;  3NTI A;  2K2V A;  4EMK C;  2DIL A;  1BIB A;  1GBR A;  4HA8 A;  3REB B;  1OUL A;  4J9C A;  4HXJ A;  1VQM T;  1VQ4 T;  4MML A;  3BE3 A;  3OYA A;  4DBF A;  4M78 G;  5KCH A;  2AK5 A;  2ZPH B;  4OMO A;  4C0D B;  4PJL A;  2OTJ A;  2F5T X;  1WHH A;  2OI3 A;  4J7F A;  4K11 A;  4JZ4 A;  2MMP A;  1QWF A;  3OYB A;  4MMK A;  4R0K A;  4BAC A;  1B34 A;  4OML A;  2NYS A;  5EC7 A;  2FZK B;  5L8R E;  3VRZ A;  3CCV Q;  3BW1 A;  1VQN A;  1IXD A;  3PFS A;  1GFD A;  3UDC A;  2OTJ T;  2D6F A;  3OW2 S;  5FWC A;  2DF6 A;  3EGX A;  4F7U G;  4C92 D;  3EGD B;  4AG1 C;  2X4J A;  2P4R A;  3JCM Q;  3LW5 E;  1W1F A;  3H41 A;  1GFC A;  1UHF A;  1Y7X A;  3G7Z A;  2HEQ A;  2XID A;  1YI2 A;  1IHV A;  3JV3 A;  1KSW A;  3VS3 A;  4AFU C;  3L2Z A;  1UGR B;  2RJE A;  1TG0 A;  1Q95 G;  2PQW A;  2RQT A;  2EYW A;  1VQO Q;  3OYK A;  5DY9 A;  4C92 G;  2DMO A;  2I2L A;  4JZ3 A;  4OB1 B;  3MO8 A;  2LQN A;  1PSF A;  3JCM h;  2XMF A;  1VQL T;  1R8O B;  1YI2 T;  5A0L A;  2ESW A;  4QT7 A;  3IQL A;  2RNA A;  4BDZ A;  4XTZ A;  3A8O B;  2NLU A;  1QCO A;  3V7R A;  2EQK A;  1LPL A;  2L3Q A;  1KQ2 A;  4E7L A;  4RTW A;  1X27 A;  2LNH B;  4PK4 A;  2MK5 A;  2IIM A;  4M75 D;  1M90 R;  4J9I A;  1Q81 R;  4J9B A;  1K1Z A;  2LZ6 B;  2ED0 A;  3KFV A;  2KR3 A;  1NJI U;  5A0G A;  2KSS A;  3FDR A;  3PVL A;  4WTO B;  4M4Z A;  1C6V X;  3QHS A;  4QKU A;  2D9T A;  2KDS A;  2LTO A;  1TWB A;  4UC4 A;  3CCE A;  1UTI A;  1X01 A;  3OYN A;  1YJN Q;  1N8R C;  1JU5 C;  2PU9 B;  3OA6 A;  2QA4 T;  1RI0 A;  3O5Z A;  4D6W A;  2VKN A;  2DK3 A;  1M3C A;  4D8D A;  2GTO A;  2E70 A;  3OYI A;  2EQM A;  4F16 A;  3JAM E;  4IUT A;  3G4S Q;  3I56 A;  2AKK A;  5GAN d;  1Q7Y U;  1E6H A;  1IB8 A;  3M57 A;  5A2Q E;  1GCQ C;  1R77 A;  1Z9Z A;  3OS2 A;  4C0G A;  2YUN A;  2DBK A;  4C0F A;  1SRM A;  2DJZ A;  5IH2 A;  2YXY A;  3PTA A;  1GCP A;  1M1K R;  2MPX C;  2C0T A;  4J9G A;  2QQ9 A;  2VXF A;  4M7D F;  3C0C A;  4ANJ A;  1K9M C;  1QVG A;  2HL5 C;  4M7D C;  4HCC A;  3I56 T;  2LQ8 A;  2V1R A;  5DLO A;  1EX4 A;  2RD1 A;  2CP6 A;  4DBQ A;  1RAE B;  3LWH A;  2KMT A;  3JCM g;  1OPK A;  1UJ0 A;  3P8H A;  1ZQ1 A;  2E5Q A;  1FMV A;  1YIT Q;  4RG8 A;  2O4X B;  3CD6 Q;  2VC8 A;  2F69 A;  5M9O A;  2K3B A;  1VQ7 A;  1G3W A;  1HXD A;  2WSF E;  2MWP A;  1PD1 A;  4J83 A;  3DB4 A;  4LXC A;  3F70 A;  3I35 A;  4A53 A;  2BKD N;  2LCL A;  2DL5 A;  3N5B B;  4MZM A;  3FEO A;  5LJ5 e;  2XI9 A;  3LGF A;  3MP6 A;  1N9S A;  1YJ9 T;  4E7H A;  2JMC A;  3PGG A;  1SF9 A;  4KT0 E;  1YIJ A;  2BZY A;  1HK9 A;  2RQU A;  1U06 A;  4M78 E;  1VQ7 T;  1R0B G;  4BUG A;  4FT4 A;  2JNG A;  2XDB A;  1U1T A;  1BI0 A;  2QXF A;  1YFN A;  1BB9 A;  4LUD A;  1DJ7 B;  1G83 A;  2X4X A;  1QVG S;  1X6O A;  4M78 F;  5D7U A;  1I0C A;  2NUP B;  2G3R A;  2CS7 A;  1BI3 A;  1VQM Q;  1YIJ T;  1Q81 U;  1VQ4 Q;  3HRT A;  3PMI A;  1ZBX A;  2DL4 A;  4BE2 A;  3H0I A;  3QPH A;  4PJJ A;  3HFO A;  2D1X A;  3C95 A;  2VB6 A;  4J9D A;  2Z0W A;  1V29 B;  3EG2 A;  2ECZ A;  2E65 A;  4ORZ A;  3JCM X;  4C5H A;  2JTM A;  2DRK A;  3VJP A;  2RK1 A;  1I5O B;  2YT6 A;  3MEW A;  4M77 A;  2VUB A;  2ZPB B;  1CSK A;  5GMK h;  2D0N A;  4IUU A;  3EG3 A;  1X6G A;  1NG2 A;  4LD9 K;  1YP5 A;  2F2V A;  4C0Z A;  2EQJ A;  2EVR A;  2KXD A;  3CBO A;  1YWP A;  2YUQ A;  1O75 A;  3HHT B;  1VUB A;  4JJN K;  4A4K A;  4TVR A;  5LJ3 h;  2CUB A;  4M75 B;  2B86 A;  3OS1 A;  3PT9 A;  4C92 C;  1S72 T;  1UEC A;  3M53 A;  4BI8 B;  3CMA A;  4ELY C;  3HTR A;  2RH2 A;  1X2Q A;  2KT1 A;  1X75 C;  2H3E B;  1V1C A;  2HCK A;  2CP2 A;  1ZLM A;  3EFS A;  4FYY B;  2OAW A;  2DET A;  4M7A A;  2OX7 A;  3LH0 A;  1VQL Q;  4JS5 A;  4XK8 E;  2P84 A;  1AVZ C;  4JJC A;  2DXC A;  4EMG A;  2MOX A;  4NS5 A;  4C8Q B;  2LJ0 A;  1VIE A;  5FLX E;  4KUD K;  4N0A A;  1WJS A;  2PVG B;  3HL8 A;  1Q82 R;  3LX7 A;  4FCY A;  4FYW B;  3A1P A;  5GAN 8;  3JCM P;  3NHN A;  4XTU A;  2XDD A;  1S1N A;  2LNV A;  3C94 A;  4O5V A;  1Q86 C;  4PJO A;  2FPE A;  1PKT A;  1BBZ A;  2CDT A;  2D8H A;  3WVD B;  3CCJ A;  1GRI A;  4ELZ C;  2JW4 A;  2KRN A;  1B7T A;  1B3Q A;  3VU3 C;  5IT9 E;  4N4I A;  4HCK A;  2QA4 Q;  1UGS B;  2F5K A;  2DL3 A;  1LJO A;  3M0Q A;  3A98 A;  2K2M A;  2E41 A;  1AWJ A;  1MND A;  1NYF A;  1TUG B;  2NUT B;  1KC8 U;  2IG0 A;  2MAM A;  5I22 A;  2JS0 A;  1E6G A;  1WPY A;  1TUC A;  2GNC A;  3VS6 A;  4CC4 B;  4HCZ A;  3CCJ T;  3TEE A;  3ME9 A;  1SHG A;  3PNW C;  5LJ3 g;  4A63 B;  3UWN A;  1TTH B;  2QQS A;  4X1V A;  1CKB A;  5HK3 A;  3AT1 B;  2QYZ A;  3LWI A;  2JXB A;  3I5S A;  4BI3 A;  2JT4 A;  5GAM d;  1OU8 A;  4NL2 A;  4ZN3 A;  4NOY A;  2GQI A;  2L89 A;  2X9H A;  3OBY A;  4JUV A;  3WVE B;  3GOX A;  1OI1 A;  4HVW A;  3X25 B;  1NBE B;  2ROT A;  1PKS A;  2G6F X;  3O8V A;  3CCU T;  4CC2 A;  3EGD A;  1KQS A;  4PKC C;  2O9S A;  1YHQ A;  1A0N B;  1K73 U;  1VQ9 A;  3L42 A;  2K5I A;  4QQ6 A;  2YRV A;  2E64 A;  4XU3 A;  5J3B A;  3KBG A;  3G6E A;  1WHJ A;  3L2V A;  3OSV A;  2RJC A;  2SEM A;  4N4G A;  3CPF A;  1YJ9 Q;  4DEY A;  2E4H A;  2GF7 A;  1YHQ T;  1MNE A;  1M2V A;  1VQP Q;  2DNU A;  2QEX A;  2M16 A;  2CUD A;  2BZX A;  1YN8 A;  5CIU A;  2AIR B;  4HT9 A;  1PG5 B;  3CQT A;  2LX9 A;  2L5Q A;  1X43 A;  3CCL T;  2QG9 B;  2V1Q A;  1K4U S;  1Q82 U;  3OMG A;  1ZA1 B;  2KT8 A;  1VYU A;  2O9V A;  2K57 A;  3OYG A;  1J3T A;  4BD3 A;  1TSF A;  4XTX A;  1VOM A;  2FZC B;  5HKC A;  4M7D D;  2KNB B;  1U8R A;  2V8K A;  2XHC A;  3OMC A;  5CCA A;  2ZCF B;  2FPD A;  5C6S A;  2NUZ A;  1WXB A;  2XK0 A;  3QYH B;  2FO0 A;  1TUD A;  2DIQ A;  2KXC A;  5GAO p;  2JM8 A;  2GFA A;  1KQS S;  3VS4 A;  3CPW A;  2MCN A;  2AHJ B;  1KHI A;  3CME A;  1NLP C;  3OYE A;  1NLO C;  2OTL T;  5GAN 6;  4EMK B;  3UPU A;  2DER A;  4GLK A;  4OMQ A;  1RAF B;  4RTX A;  1VYT A;  1M1G A;  1BI2 A;  3VUZ A;  2FRY A;  4M77 E;  2HQX A;  3OS0 A;  3J81 E;  3CC7 A;  2EAY A;  3BDU A;  4GY5 A;  2EWN A;  3H9N A;  4JRP A;  3E9G A;  1ARK A;  3MEV A;  2BTT A;  1K8A C;  2QTX A;  5KYX A;  4IUQ A;  1W2B A;  1D3B B;  3JB9 H;  3SWN C;  1VQ5 A;  1RLQ C;  1FX7 A;  3EH2 A;  4CRI A;  3OYC A;  1S72 Q;  1NJI R;  2CZ1 B;  1Y96 A;  5GAO m;  2H8H A;  3RUX A;  4FSX A;  5LJ5 f;  1H8K A;  1XJW B;  1GXI E;  2JMA A;  3NMZ C;  4D8K A;  3RIR A;  2KBT A;  2QTV A;  1UGQ B;  4M78 D;  3RER A;  5CO7 A;  1TU0 B;  1IRX A;  3L2R A;  1AWX A;  1TXQ A;  2O4X A;  2JZ2 A;  4JJB A;  2DFU A;  2YWW A;  2R58 A;  3CCR A;  2HBP A;  4R55 A;  2RA2 A;  1RL2 A;  2MWO A;  3CPW S;  1Q7Y R;  4OB0 B;  3CC4 A;  4M7A E;  1ZUY A;  3V8L A;  1PWT A;  3RDV A;  2FB7 A;  2DZC A;  2LX7 A;  3V7S A;  3M0T A;  1QKX A;  2FG0 A;  2E1H A;  7AT1 B;  1HD3 A;  2AZS A;  4RKU E;  3QG1 A;  3VS2 A;  2QQA A;  2RO0 A;  1KQ1 A;  3CCR T;  5CKD A;  2K6D A;  2LJ1 A;  1QCF A;  3MKD A;  5GAN 7;  4M7A F;  1UE9 A;  3TVT A;  2LQK A;  1MGQ A;  4OGE A;  1VQK A;  3MEU A;  1WQW A;  1VQ6 A;  4DQ2 A;  2RQV A;  1BI1 A;  2DKG A;  2DTO A;  4PJO E;  1H3H A;  2GTJ A;  4PJM A;  4RG2 A;  1BCM A;  3SB2 A;  1W2B S;  5KE2 A;  4N0A C;  5AYF A;  1F1B B;  2D8J A;  5KYU B;  2RQW A;  5GAO n;  3I55 A;  5CKF A;  1WHM A;  1K0S A;  2A3L A;  4ATO A;  3KXT A;  2OJ2 A;  5HCK A;  1AEY A;  3CCJ Q;  2PTK A;  1VQ6 T;  4IKF A;  2E10 A;  3QKJ A;  5LJ5 j;  5CKB A;  4RTU A;  4RTZ A;  2KI7 A;  3A8H B;  3H0H A;  2GQV A;  4BY6 C;  2CZ7 B;  1VQN T;  2ED1 A;  5D6Y A;  2DIG A;  2L3P A;  2COW A;  4PFZ A;  3CCM A;  2E5K A;  4A4G A;  2K5F A;  1AZE A;  4FW2 A;  2P0P A;  4J9H A;  2DA9 A;  3T9N A;  3M0R A;  1MMN A;  2RHX A;  1JQQ A;  5KCO A;  5CR2 A;  4J6X A;  1WYX A;  2EYQ A;  1JXM A;  4PLL A;  1WXU A;  3CCU Q;  1XNI A;  4E47 A;  2A28 A;  1OU9 A;  4MDW A;  3QJ6 A;  1GL5 A;  4F17 A;  2XKO C;  4MZP A;  1OEB A;  2PVO B;  4M7D B;  1ZA2 B;  2DXT A;  2M51 A;  3M4G A;  3VS1 A;  4L5G A;  2CP3 A;  1X2K A;  2MI6 A;  3E9F A;  3ZFJ A;  3CCS A;  2HSP A;  5CKE A;  3V8J A;  2EW3 A;  4KUI A;  2J05 A;  1YHQ Q;  3MPU B;  3PVQ A;  2QAZ A;  2LQW A;  2E6Z A;  3EG9 B;  1OV3 A;  2MIO A;  1ZSZ A;  4ESR A;  4C8Q A;  3HSB A;  3PIP A;  3G1J A;  5GAM f;  4LE9 A;  3CCL Q;  4JS4 A;  1D1A A;  4Y28 E;  1K0X A;  1LNX A;  4DBH A;  2HNI A;  3QDF A;  2HQE A;  3GPL A;  2CZ0 B;  4IIM A;  2KEA A;  3CCE T;  2O2O A;  2R5M A;  4VUB A;  1VIF A;  2PUO B;  2DVE A;  5GMK l;  3QDR B;  4RTY A;  2CT4 A;  2K7A A;  5FU7 C;  3MJX A;  1I1J A;  5EG2 A;  1SPK A;  2FRW A;  1OZ2 A;  1R0C B;  5DLQ E;  2EYZ A;  3HFN A;  3NTH A;  1WQ7 A;  5FU6 C;  2OTL Q;  4ZNX A;  4BE0 A;  4LDX A;  4PJN A;  3CC2 A;  1QMC A;  5FRM A;  1MMA A;  2L8D A;  2DYI A;  2M0O A;  1NEG A;  1UGV A;  2NUT A;  2J6F A;  1BYM A;  1K9M U;  2KY9 A;  2NWM A;  4EDU A;  2QDL A;  5IHK A;  2DPP B;  3GLX A;  2R5A A;  1VQ8 A;  3RKX A;  4FT2 A;  2LT4 A;  2EGA A;  3CC2 T;  4LDV A;  2CRE A;  2SRC A;  4Q5W A;  3M0S A;  5IAY A;  2F1L A;  2RF0 A;  1QP3 A;  3M56 A;  5GMK i;  1AT1 B;  2GFU A;  2M0Y A;  2DJQ A;  3BDL A;  2XG8 D;  4HVV A;  3EFO A;  5HY6 A;  4EIK A;  3CCQ A;  4F7U B;  5GAO q;  4DOW A;  4J7I A;  1ZUK A;  5GAM j;  1VQ8 T;  4FU6 A;  4OB3 B;  2DM1 A;  1U1S A;  3JSC A;  2KK4 A;  1W70 A;  3CXC P;  5A0D A;  1PC0 A;  3QYG B;  4HVU A;  1CKA A;  3OBW A;  4PLI A;  1KD1 C;  3PIO A;  2HD0 A;  1KC8 R;  1M90 C;  2E12 A;  4M78 C;  1C0M A;  4CC7 A;  3G71 A;  4C92 B;  1LCK A;  3CCQ T;  4ZTJ A;  4AG2 C;  2RHZ A;  2C0O A;  1B34 B;  3BY7 A;  2VVK A;  3CXC A;  3CCR Q;  3EGX B;  3TSZ A;  3ER0 A;  2DEQ A;  2W10 A;  8AT1 B;  3UT1 A;  1QP2 A;  3A8G B;  1G3S A;  3G71 T;  2R57 A;  1ABQ A;  3L2W A;  3S3M A;  1OZ3 A;  3FB9 A;  5KYW A;  4BB7 A;  2DTH A;  5KE3 A;  5GJW B;  5GAO l;  2MF2 A;  2WSE E;  1PM3 A;  4J9E A;  2LCS A;  5DM7 R;  1SEM A;  2OTJ Q;  1IO6 A;  1M30 A;  5J39 A;  2EGC A;  1M9S A;  1QKW A;  4M77 D;  2HDA A;  2RQR A;  2X35 A;  1PCX A;  1K73 R;  1ZBJ A;  1HSQ A;  1KK7 A;  1VQ6 Q;  1M1K C;  4R56 A;  2D0Q B;  1QVF P;  5J26 A;  5CQY A;  2X51 A;  1BK2 A;  3OQ5 A;  1VQN Q;  4FL6 A;  1WXT A;  2DXU A;  3RMS A;  2XU8 A;  4EMK A;  4M77 G;  4E7J A;  1WHL A;  5IHI A;  3TU4 K;  3FRN A;  3OY9 A;  3X26 B;  3V8K A;  2EBP A;  3HKS A;  3VS7 A;  2Y4Y A;  3ZL7 C;  1YI2 Q;  4GLM A;  2QAS A;  1WX6 A;  3HPW A;  2QDY B;  2CGH A;  4JDS A;  1OOT A;  3P8B B;  3J7A F;  3CXC S;  4PNO A;  4FIB A;  4JRK A;  3CMA T;  1QVF A;  1D3B A;  4BI4 A;  3E2U A;  3JCM d;  4M7A D;  3M4Y A;  3JB9 I;  2DD4 A;  4L59 A;  4E7I A;  4M75 E;  4NL3 A;  3OB9 A;  1ZX6 A;  1WDX A;  3MP1 A;  5GAM e;  2JOY A;  3GIB A;  3CCV A;  3M0U A;  1YNZ A;  4M7A G;  1P92 A;  1Q86 U;  1I07 A;  1YJW A;  4PJO D;  1EZZ B;  4DEX A;  5FRO A;  2QQR A;  2V8I A;  1IZ6 A;  3S3N A;  2F2X A;  3JCM b;  2ZPI B;  4XU2 A;  3CCE Q;  1UUE A;  4C8Q E;  2DXB A;  3TRE A;  3DKM A;  3A8M B;  3MCA B;  2YLB A;  1JXO A;  2EKH A;  2AZV A;  3CCV T;  4PJO G;  1QW1 A;  2KYM A;  4X34 A;  2CH4 A;  1YJW T;  2CSI A;  1IHW A;  4PL6 A;  4C5E A;  1M5Q 1;  2EQI A;  1I81 A;  1WLP B;  2K3X A;  3I56 Q;  4C8Q F;  3V7C A;  1ZSZ C;  1QVF S;  3QZ9 B;  3M59 A;  2KE9 A;  1D0Z A;  1M2O A;  5GMK m;  5AT1 B;  1YCY A;  1T0J A;  2WSC E;  1RLP C;  4IUR A;  2BE9 B;  4E7K A;  4ZGJ B;  1B07 A;  2EYX A;  1IRE B;  1AWO A;  1QQJ A;  1HJD A;  2RJD A;  2ROL A;  4KGV B;  1H64 1;  4RCC A;  1UGP B;  4N4H A;  2LP5 A;  2YUO A;  3M55 A;  4E6R A;  4DOV A;  5GAN f;  4E7Z A;  1Y0M A;  3RMQ A;  3EG1 A;  2A37 A;  4XAX B;  5D6X A;  1M27 C;  1FWZ A;  4AFQ C;  5CQX A;  1NM7 A;  1YJN A;  4OMP A;  1OX8 A;  3VYG A;  2COZ A;  1VQ7 Q;  1G5V A;  1VQ9 T;  1VQ8 Q;  2AT1 B;  2ZGW A;  3G4S A;  1XTD A;  1KIK A;  3G6E T;  5CK9 A;  3M54 A;  3SWN B;  3S3O A;  3S6W A;  1H92 A;  1WJR A;  5D6W A;  1YIJ Q;  2DZ9 A;  4QQG A;  2A7Y A;  4LUE A;  2QEX T;  3CCQ Q;  4OVA A;  1M8V A;  4J8O A;  2X3W D;  3RBB B;  4KH0 B;  2JTE A;  4GBQ A;  5GMK e;  3G4S T;  4MDX A;  3H8Z A;  3WXM B;  4PFP A;  1UJY A;  3C4S A;  4EPC A;  4F14 A;  4LDU A;  3SEM A;  1RAC B;  4PFO A;  2M1H A;  3QJY A;  1ZHI A;  1UHC A;  3EG9 A;  2ZPE B;  4OF1 A;  2W0Z A;  1YIT A;  1M3A A;  4AT1 B;  2HMA A;  3NPF A;  4P5N A;  4ZGD B;  3OYD A;  5I2S A;  4JRQ A;  3CD6 A;  5CAI A;  5KYY B;  3U23 A;  1I5L A;  5GAN j;  1LVK A;  1QLY A;  3OW2 P;  5GAN 5;  3CME T;  3FLG A;  1JO8 A;  2HBW A;  4KGX B;  2K9G A;  4Z88 A;  2KGT A;  3FJ5 A;  3JB9 G;  1YIT T;  3L2Q A;  4M77 F;  2RPN A;  4LD6 A;  5CKH A;  2C0I A;  2YLC A;  4M77 C;  1IGU A;  1UFF A;  4C5G A;  1RUW A;  3CC7 T;  2YUP A;  2Y90 A;  2V26 A;  2DRM A;  1K8A U;  3SD4 A;  1QWE A;  1EFN A;  3GBQ A;  4Z02 A;  4E7S A;  2ZAE A;  5LJ3 d;  1AWW A;  1D09 B;  1O9S A;  3H6Z A;  3I5R A;  1WFW A;  1VQ5 T;  1D1B A;  2EPD A;  1U3O A;  1VYV A;  1VQM A;  1VQ4 A;  3CEY A;  1NZ9 A;  2LC4 A;  1WNL A;  4Y92 A;  1QCN A;  2LDM A;  3VKI A;  3CMA Q;  2CSQ A;  4FYX B;  4BY6 B;  1H3Z A;  2VV5 A;  5LJ5 h;  1ZSG A;  1N8R R;  3E1S A;  2FPF A;  2OAU A;  2H3J A;  3NTK A;  3OYM A;  2ABL A;  4A4H A;  2HL3 A;  2JVV A;  2K79 A;  2EFI A;  4KBM B;  4F7U A;  1FYN A;  1WZO A;  1GBQ A;  8ATC B;  4M7A C;  2M02 A;  2COY A;  2BE7 D;  1Z9Q A;  3X24 B;  3CC4 T;  2GBQ A;  3R6N A;  3X28 B;  4QVC A;  2NUP A;  5CVI A;  4FYV B;  1K9M R;  3OYJ A;  4C92 A;  4PJO F;  3CBM A;  3GNF B;  1G2B A;  2P4T A;  4PJO C;  1VQK T;  3DLL A;  1C1A A;  2YDL A;  1KHC A;  1NE8 A;  2E3H A;  1G8X A;  1AD5 A;  2GGR A;  2PVD B;  1YJW Q;  3TSW A;  4L6V 5;  3JCM f;  3I55 T;  3GP8 A;  3ULR B;  3ASK A;  2RHI A;  1PD0 A;  1NPP A;  4Y91 A;  2X4Y A;  3RES A;  1VQL A;  1X6B A;  2EGE A;  4XTY A;  2J6K A;  2RB6 A;  4B9X A;  4KGZ B;  4KH1 B;  4C0D C;  2CKK A;  3CCM T;  1XQH A;  3FC3 A;  5GAN e;  2J7I A;  4M75 A;  5FU7 B;  1M2V B;  5LJ5 g;  1SG5 A;  4OMF B;  4A54 A;  1W4S A;  3LGL A;  4ZTF A;  1NJI C;  4RTV A;  5FU6 B;  2LMJ A;  1TS9 A;  4Z8A A;  3LYI A;  1FXX A;  1KD1 R;  4AMC A;  4WF2 A;  2Y4X A;  3OYL A;  2O01 E;  4ZN1 A;  1G3Y A;  2LVM A;  2QA4 A;  1M1F A;  1V76 A;  4WCI A;  1VQ9 Q;  1UG1 A;  2QGG A;  2KRS A;  2QI2 A;  1MUZ A;  4OB2 B;  1IGQ A;  3G6E Q;  3CCS T;  1RAA B;  1UEB A;  5FW9 A;  1I8F A;  1Q7Y C;  2ZPF B;  2WAC A;  2VAS A;  4M75 G;  1N8R U;  1QVG P;  2DD5 A;  4J9F A;  2X4W A;  2O31 A;  2A0F B;  2RI2 A;  3QSU A;  1RAD B;  2QEX Q;  2L3R A;  3CBP A;  3M0P A;  5I11 A;  1KG1 A;  1FMW A;  3HRS A;  4C8Q D;  1KJW A;  2FL7 A;  2DX1 A;  1UDL A;  4M7D E;  5GAM h;  4OGC A;  3J80 E;  2BUD A;  2X3X D;  4BE1 A;  3PMT A;  2KRM A;  5KYX B;  2PZ1 A;  4F04 B;  4C8Q G;  2KVQ G;  1TH7 A;  4M78 B;  1JEG A;  1MMG A;  2L0A A;  4OP0 A;  2JS2 A;  4LDW A;  5GAN 4;  3JB9 F;  4AFZ C;  1Y96 B;  2EYY A;  3EHR A;  4RUG A;  3CME Q;  2RMO A;  6AT1 B;  3EFR A;  2EQU A;  4KUL A;  5GAO r;  1D1C A;  4A4E A;  1T3S A;  2KAF A;  1YJ9 A;  1UB4 A;  1VQP A;  2QQB A;  1OPL A;  3RKY A;  4FM4 B;  3INZ A;  1N6A A;  3CC7 Q;  2YSQ A;  2J06 A;  2HKQ B;  5LL6 S;  2DTI A;  1SKU B;  3NFC A;  2FEI A;  2P0K A;  2AKL A;  2DEU A;  3GF5 A;  3H0F A;  1VQ5 Q;  1KFZ A;  1WIE A;  2I0N A;  1Q86 R;  3P8D A;  3RNJ A;  2DL8 A;  3QUI A;  3TCJ A;  4CC3 A;  1K9A A;  1VQP T;  5L23 A;  2JM9 A;  2CP7 A;  1Q81 C;  3REA B;  9ATC B;  5C0M A;  5IN1 A;  1K76 A;  4JRI A;  5IXB A;  3A8L B;  3VS0 A;  2J6O A;  4QW2 A;  3MP8 A;  1KD1 U;  5FRN A;  3Q1J A;  4RTT A;  2RJF A;  3JCM J;  1M90 U;  5GAM g;  3E19 A;  4B6M A;  1ACM B;  1RAB B;  2EIF A;  4OMM A;  5LJ5 d;  2HKN A;  1JBM A;  3CC4 Q;  3RR6 A;  1BIA A;  1RAH B;  1T3L A;  2V8J A;  4AFS C;  2CP5 A;  4F7U E;  3FJP A;  1PSE A;  3SWN A;  3JCM c;  3EHQ A;  2A08 A;  2LCC A;  1WI7 A;  5GAN 3;  5LJ3 f;  3UA6 A;  3HRU A;  4RMO A;  1PNJ A;  2KYB A;  1HYO A;  2FVU A;  1VQK Q;  1N9R A;  3VV0 A;  4F7U F;  2BIV A;  1S72 A;  1WHK A;  1RAI B;  2GCX A;  4A4F A;  2JN0 A;  2XDP A;  4C92 E;  5IXF A;  1LOJ A;  3JCM e;  4XU0 A;  2PNI A;  3DLM A;  3I9Q A;  3LH5 A;  4HT8 A;  1VA7 A;  1U5S A;  3KUF A;  2EJ9 A;  3I55 Q;  1EIF A;  2EJF A;  1MV3 A;  3C12 A;  2YHT A;  4XTV A;  3SHW A;  1M1K U;  4V2S A;  5IHN A;  4C92 F;  5KYY A;  3TQ7 P;  1AHJ B;  3PE0 A;  2YRC A;  2FZG B;  1SRL A;  4J5Y A;  5GJV B;  4C5I A;  2DAQ A;  2IPO B;  3UF4 A;  3CCM Q;  1NPR A;  1RI9 A;  3URG A;  3QWY A;  2IVW A;  3DB3 A;  1PRM C;  3OYF A;  3HP9 A;  5GMK j;  1BKB A;  3OS5 A;  4E2F B;  3EG0 A;  2DL7 A;  2LJ3 A;  1ZSZ B;  4JLI A;  1WA7 A;  1YWO A;  4JJD A;  2K4Y A;  3QWX X;  3RKW A;  4DBR A;  2ATC B;  2CYZ B;  1N27 A;  1M3B A;  3BFM A;  1JJ2 P;  4II1 A;  2DVJ A;  4QVZ A;  2XIC A;  5LJ3 j;  3JB9 J;  4M75 F;  1D0Y A;  4J6Y A;  2PUK B;  3MEA A;  3CCS Q;  1KC8 C;  4M75 C;  1Y71 A;  2HQH A;  5KH6 A;  2JTF A;  4QVD A;  3OYH A;  4O6J A;  2B8A A;  2RK2 A;  4MZT A;  2EJG A;  1XOV A;  1OYX A;  1VQO A;  2VGM A;  3JCM V;  1WJQ A;  1N5Z A;  2K3Y A;  1PHT A;  1JJ2 A;  1MV0 B;  2VXE A;  3QZ5 B;  5KYN A;  4B9W A;  3THK A;  1X69 A;  2JUF A;  2RN8 A;  1SHF A;  1MMD A;  4C8Q C;  1KQS P;  2FHD A;  4XU1 A;  1AOJ A;  1K8A R;  2RHY A;  3JRZ A;  5KYU A;  2RM4 A;  2L2P A;  1ZUU A;  3CCU A;  2CZ6 B;  5ECA A;  1VQO T;  2E6N A;  3ZEH A;  2FYK A;  2DYB A;  2KRO A;  1K73 C;  3EFO B;  4XQ3 A;  3QII A;  3CC2 Q;  2ZZD A;  4JLG A;  4BDY A;  3L1A A;  2DO3 A;  2M9U A;  1TOV A;  1JRI A;  2CT3 A;  2HAX A;  2HSE B;  4IUV A;  3M5A A;  4ME7 A;  3VYH B;  1E7O A;  1GCQ A;  1FMK A;  1Y07 A;  3CCL A;  3M9Q A;  3EGU A;  4KRT A;  2VYT A;  1G3T A;  1NEB A;  1PRL C;  4J6W A;  2RI3 A;  4HKE A;  1JB0 E;  1WHG A;  3AHU A;  5GAN h;  1M4Z A;  1OX9 A;  1Q82 C;  1JJ2 S;  3LLR A;  1I4K 1;  2E3I A;  1YJN T;  4JPB W;  4Z89 A;  4YTL A;  4M7D A;  3MET A;  4M77 B;  3CPW P;  2JJ9 A;  3JCM W;  1SSH A;  2RHU A;  3OSS C;  5I2M A;  5KYW B;  5HK0 A;  3GNG A;  1YBY A;  2BZ8 A;  2OTL A;  3M58 A;  3SFM A;  3L2U A;  3MHX A;  1NYG A;  2CH4 W;  2LT1 A; 
#chains in the Genus database with same CATH homology
 4XTW A;  2RHI A;  5GMK i;  4PJO A;  4Y91 A;  1NPP A;  2GFU A;  3QO3 A;  2K5L A;  3BDL A;  4CI0 C;  2XG8 D;  2X4Y A;  2ZPG B;  3RES A;  3SDZ A;  3JB9 D;  1VQL A;  5HY6 A;  4X9C A;  3EAE A;  3CCQ A;  4F7U B;  4LDY A;  5LJ3 e;  4DA4 A;  3WVD B;  4XTY A;  4DOW A;  5GAO q;  4J7I A;  5GAM j;  1VQ8 T;  2RB6 A;  4FU6 A;  4OB3 B;  3CCJ A;  1WGS A;  1U1S A;  3JSC A;  4ELZ C;  2KK4 A;  4B9X A;  5A0D A;  3VU3 C;  3R6O A;  5IT9 E;  4N4I A;  3QYG B;  4M7D G;  1UGS B;  2F5K A;  3OBW A;  4PLI A;  3VUB A;  4C0D C;  5I21 A;  1KD1 C;  2CKK A;  3CCM T;  1QVP A;  3PIO A;  2HD0 A;  1LJO A;  1XQH A;  3ZBD A;  3FC3 A;  3OYY A;  5GAN e;  4M75 A;  5FU7 B;  2E41 A;  1M90 C;  5LJ5 g;  1KC8 U;  2E12 A;  4M78 C;  4OMF B;  4A54 A;  3FIF A;  3G71 A;  1W4S A;  2IG0 A;  2MAM A;  3LGL A;  2RI5 A;  4M7A B;  4C92 B;  1H3Z A;  3CCQ T;  4ZTF A;  3CD6 T;  1NJI C;  1WPY A;  4EMH A;  4ZGE B;  4ZTJ A;  5FU6 B;  4HCZ A;  3CCJ T;  3TEE A;  2RHZ A;  2VGN A;  3ME9 A;  2LRQ A;  1B34 B;  3PNW C;  5LJ3 g;  3UWN A;  3LYI A;  3BY7 A;  2QQS A;  1FXX A;  4WF2 A;  2Y4X A;  4HCB A;  3OYL A;  4IUP A;  4C92 E;  2O01 E;  3QXE B;  5HK3 A;  4X9D A;  5GAN 2;  2EKO A;  4ZN1 A;  4M78 A;  1G3Y A;  2LVM A;  2QA4 A;  3CXC A;  2KQW A;  1M1F A;  2P0Q A;  3LWI A;  3ER0 A;  4RCB A;  2DEQ A;  4BI3 A;  3OW2 A;  3UT1 A;  1QP2 A;  1SSF A;  2QI2 A;  3A8G B;  1G3S A;  3G71 T;  4PJO B;  2R57 A;  5GAM d;  5GAN g;  4NL2 A;  4ZN3 A;  4NOY A;  3L2W A;  3S3M A;  2L89 A;  1OZ3 A;  3FB9 A;  4OB2 B;  3CCS T;  4BB7 A;  1UEB A;  2DTH A;  1I8F A;  3OBY A;  3X20 B;  5KE3 A;  4JUV A;  3WVE B;  5GAO l;  1Q7Y C;  2MF2 A;  2WSE E;  3GOX A;  1OI1 A;  3QBY A;  5DM7 R;  2ZPF B;  2WAC A;  3X25 B;  4M75 G;  5J39 A;  1MHN A;  3A5Z B;  1N8R U;  2DD5 A;  3O8V A;  4QQD A;  1M9S A;  3CCU T;  2C06 A;  2XD0 A;  2X4W A;  1KQS A;  3NTI A;  2RI2 A;  4M77 D;  4PKC C;  2K2V A;  4EMK C;  1YHQ A;  3QSU A;  1BIB A;  2L3R A;  2X35 A;  3CBP A;  4HA8 A;  1KG1 A;  3HRS A;  4C8Q D;  1K73 U;  1M1K C;  1VQ9 A;  4R56 A;  2FL7 A;  3L42 A;  2D0Q B;  1VQM T;  5J26 A;  1VQ4 T;  5CQY A;  2K5I A;  4M7D E;  4QQ6 A;  2YRV A;  2E64 A;  4MML A;  4XU3 A;  5J3B A;  3KBG A;  5GAM h;  3G6E A;  3OYA A;  3OQ5 A;  4M78 G;  5KCH A;  4OGC A;  4FL6 A;  3L2V A;  2DXU A;  2ZPH B;  3OSV A;  2RJC A;  3RMS A;  2XU8 A;  4EMK A;  2BUD A;  4M77 G;  3J80 E;  4C0D B;  4N4G A;  4BE1 A;  4E7J A;  2OTJ A;  3PMT A;  3TU4 K;  3CPF A;  3FRN A;  2F5T X;  2GF7 A;  4C8Q G;  1YHQ T;  3OY9 A;  2KVQ G;  1TH7 A;  3X26 B;  4M78 B;  3V8K A;  3HKS A;  2Y4Y A;  2QEX A;  4OP0 A;  2M16 A;  4LDW A;  4J7F A;  2MMP A;  3OYB A;  5CIU A;  4HT9 A;  5GAN 4;  4MMK A;  3JB9 F;  2LX9 A;  1Y96 B;  3HPW A;  4BAC A;  2L5Q A;  2QDY B;  3CCL T;  1B34 A;  2CGH A;  4JDS A;  5L8R E;  3P8B B;  3J7A F;  3CXC S;  4PNO A;  1VQN A;  3BW1 A;  4FIB A;  4JRK A;  1Q82 U;  3CMA T;  3PFS A;  1D3B A;  3OMG A;  1QVF A;  3EFR A;  3UDC A;  4BI4 A;  2OTJ T;  2D6F A;  2EQU A;  4KUL A;  3OW2 S;  5GAO r;  2K57 A;  3OYG A;  4A4E A;  3JCM d;  4F7U G;  2KAF A;  4BD3 A;  1YJ9 A;  4XTX A;  4C92 D;  5HKC A;  4M7A D;  4M7D D;  1UB4 A;  3M4Y A;  3JB9 I;  1U8R A;  2DD4 A;  2V8K A;  2X4J A;  2XHC A;  3OMC A;  5CCA A;  3JCM Q;  2ZCF B;  3LW5 E;  4L59 A;  1VQP A;  2QQB A;  3RKY A;  4FM4 B;  4E7I A;  3INZ A;  5C6S A;  2XK0 A;  3QYH B;  1N6A A;  1Y7X A;  4M75 E;  3G7Z A;  2XID A;  2DIQ A;  4NL3 A;  1YI2 A;  3OB9 A;  5LL6 S;  3L2Z A;  1UGR B;  2DTI A;  2RJE A;  5GAO p;  2GFA A;  1KQS S;  2PQW A;  3CPW A;  3NFC A;  2P0K A;  2AHJ B;  1KHI A;  3CME A;  3MP1 A;  3OYE A;  3OYK A;  5GAM e;  2JOY A;  5DY9 A;  2OTL T;  3GF5 A;  3CCV A;  5GAN 6;  4C92 G;  3GIB A;  4M7A G;  4EMK B;  1P92 A;  2I2L A;  3UPU A;  1Q86 U;  4GLK A;  3P8D A;  4OB1 B;  3QUI A;  1YJW A;  3TCJ A;  4PJO D;  3MO8 A;  1PSF A;  1VQP T;  3JCM h;  1M1G A;  1BI2 A;  5FRO A;  2QQR A;  2V8I A;  1IZ6 A;  3S3N A;  3VUZ A;  1Q81 C;  1VQL T;  1R8O B;  4M77 E;  2HQX A;  5C0M A;  5IN1 A;  3JCM b;  3OS0 A;  1YI2 T;  5A0L A;  1Q7Y U;  3J81 E;  4JRI A;  3CC7 A;  2EAY A;  2ZPI B;  3BDU A;  2EWN A;  4GY5 A;  3A8L B;  4XU2 A;  4C8Q E;  2DXB A;  4BDZ A;  4XTZ A;  3A8O B;  2NLU A;  3V7R A;  4JRP A;  4QW2 A;  2EQK A;  3TRE A;  3E9G A;  3DKM A;  3A8M B;  3MP8 A;  3MCA B;  2YLB A;  3MEV A;  1KD1 U;  1K8A C;  1KQ2 A;  2QTX A;  5FRN A;  3CCV T;  4PJO G;  4E7L A;  3Q1J A;  4IUQ A;  1W2B A;  1D3B B;  1QW1 A;  3JB9 H;  4X34 A;  3SWN C;  1VQ5 A;  1YJW T;  2RJF A;  4M75 D;  3JCM J;  1M90 U;  1FX7 A;  5GAM g;  3E19 A;  4CRI A;  4PL6 A;  4C5E A;  1M5Q 1;  3OYC A;  2EIF A;  1I81 A;  1NJI U;  2K3X A;  2CZ1 B;  5A0G A;  4C8Q F;  5LJ5 d;  2KSS A;  1JBM A;  1Y96 A;  3FDR A;  3V7C A;  1BIA A;  5GAO m;  3RUX A;  1QVF S;  4FSX A;  5LJ5 f;  2V8J A;  3QHS A;  2D9T A;  4F7U E;  3QZ9 B;  2KDS A;  2LTO A;  1GXI E;  4UC4 A;  3M59 A;  3FJP A;  1PSE A;  3CCE A;  3RIR A;  3SWN A;  1X01 A;  3JCM c;  2LCC A;  3OYN A;  5GMK m;  1UGQ B;  4M78 D;  3RER A;  5CO7 A;  1N8R C;  5GAN 3;  5LJ3 f;  2PU9 B;  1YCY A;  3OA6 A;  3HRU A;  3L2R A;  2WSC E;  4RMO A;  2O4X A;  2JZ2 A;  4IUR A;  2QA4 T;  1RI0 A;  4E7K A;  4ZGJ B;  4D6W A;  2DK3 A;  2FVU A;  2HBP A;  2R58 A;  2E70 A;  3OYI A;  3CCR A;  4R55 A;  1IRE B;  2EQM A;  2RA2 A;  1N9R A;  1RL2 A;  2RJD A;  3VV0 A;  4F7U F;  2MWO A;  1H64 1;  2BIV A;  3JAM E;  3CPW S;  4IUT A;  1S72 A;  3I56 A;  3JCM e;  2GCX A;  4A4F A;  2JN0 A;  2XDP A;  1UGP B;  4OB0 B;  1LOJ A;  4RCC A;  3M57 A;  3V8L A;  4XU0 A;  4N4H A;  2FB7 A;  5A2Q E;  2DZC A;  3M55 A;  5GAN f;  3DLM A;  4DOV A;  3OS2 A;  4C0G A;  4HT8 A;  3RMQ A;  3V7S A;  4XAX B;  3KUF A;  2EJ9 A;  5D6X A;  4C0F A;  2DJZ A;  1FWZ A;  1EIF A;  2EJF A;  2E1H A;  5CQX A;  3PTA A;  3C12 A;  2YHT A;  3QG1 A;  4RKU E;  4XTV A;  1YJN A;  3VYG A;  2QQA A;  1M1K U;  4V2S A;  2RO0 A;  1KQ1 A;  3CCR T;  2QQ9 A;  2VXF A;  4C92 F;  5CKD A;  4M7A F;  4M7D F;  5GAN 7;  1K9M C;  1G5V A;  1VQ9 T;  2LQK A;  1QVG A;  1MGQ A;  1AHJ B;  4OGE A;  1VQK A;  4M7D C;  3MEU A;  1WQW A;  4HCC A;  4DQ2 A;  3I56 T;  2LQ8 A;  2ZGW A;  1VQ6 A;  1BI1 A;  2DKG A;  2DTO A;  4PJO E;  5DLO A;  3G4S A;  4J5Y A;  1XTD A;  2RD1 A;  4RG2 A;  3SB2 A;  1W2B S;  3G6E T;  3LWH A;  5KE2 A;  2KMT A;  3JCM g;  4C5I A;  5CK9 A;  2DAQ A;  1NPR A;  4N0A C;  3URG A;  3P8H A;  5AYF A;  1ZQ1 A;  3M54 A;  2E5Q A;  3SWN B;  5GAO n;  2IVW A;  3S3O A;  3DB3 A;  3I55 A;  3S6W A;  5CKF A;  1WJR A;  5D6W A;  2A3L A;  3OYF A;  3HP9 A;  4ATO A;  2DZ9 A;  4QQG A;  2O4X B;  4RG8 A;  5GMK j;  2A7Y A;  1BKB A;  3KXT A;  2QEX T;  3OS5 A;  4OVA A;  2VC8 A;  1M8V A;  2F69 A;  4J8O A;  5M9O A;  4JLI A;  1VQ7 A;  1VQ6 T;  1G3W A;  1HXD A;  2K4Y A;  5GAN d;  2WSF E;  4IKF A;  2E10 A;  3RKW A;  2MWP A;  5GMK e;  3G4S T;  4J83 A;  4MDX A;  3H8Z A;  3DB4 A;  3WXM B;  3C4S A;  3QKJ A;  4EPC A;  2CYZ B;  5CKB A;  5LJ5 j;  1N27 A;  3F70 A;  4A53 A;  2BKD N;  2LCL A;  3A8H B;  4LDU A;  2GQV A;  4BY6 C;  2CZ7 B;  1VQN T;  3BFM A;  2M1H A;  3N5B B;  5D6Y A;  2DIG A;  3QJY A;  3FEO A;  1ZHI A;  4II1 A;  4MZM A;  5LJ5 e;  2XI9 A;  3CCM A;  4A4G A;  3LGF A;  4QVZ A;  3MP6 A;  2K5F A;  1N9S A;  2XIC A;  2ZPE B;  5LJ3 j;  4OF1 A;  1YJ9 T;  1YIT A;  3JB9 J;  4E7H A;  3PGG A;  4KT0 E;  4M75 F;  2P0P A;  1YIJ A;  4J6Y A;  1HK9 A;  2PUK B;  4M78 E;  3MEA A;  3T9N A;  4P5N A;  1KC8 C;  4M75 C;  4ZGD B;  3OYD A;  5I2S A;  4JRQ A;  1VQ7 T;  5CAI A;  3CD6 A;  1Y71 A;  4BUG A;  5KH6 A;  4FT4 A;  2RHX A;  2JNG A;  2XDB A;  1I5L A;  5KCO A;  5CR2 A;  1U1T A;  1BI0 A;  2QXF A;  4J6X A;  2JTF A;  2EYQ A;  4PLL A;  4QVD A;  1XNI A;  3OYH A;  5GAN j;  4O6J A;  1DJ7 B;  4E47 A;  5GAN 5;  2B8A A;  3CME T;  3FLG A;  2RK2 A;  4MZT A;  2EJG A;  1XOV A;  4MDW A;  2X4X A;  1OYX A;  3QJ6 A;  1VQO A;  1X6O A;  1QVG S;  4M78 F;  2XKO C;  2VGM A;  3JCM V;  4MZP A;  2G3R A;  3JB9 G;  1WJQ A;  1YIT T;  2K3Y A;  3L2Q A;  4M77 F;  2CS7 A;  4LD6 A;  1BI3 A;  5CKH A;  2YLC A;  1YIJ T;  1JJ2 A;  1Q81 U;  2PVO B;  2VXE A;  3HRT A;  3PMI A;  3QZ5 B;  1ZBX A;  4B9W A;  4M77 C;  2DXT A;  4M7D B;  3M4G A;  4BE2 A;  2JUF A;  2MI6 A;  3E9F A;  4L5G A;  3ZFJ A;  3CCS A;  3QPH A;  1Q86 C;  3HFO A;  4C8Q C;  4C5G A;  2FHD A;  3C95 A;  5CKE A;  3CC7 T;  4XU1 A;  2Y90 A;  1V29 B;  2RHY A;  2E65 A;  1K8A U;  3V8J A;  3SD4 A;  4Z02 A;  4KUI A;  3JRZ A;  3JCM X;  4C5H A;  2RM4 A;  2JTM A;  5LJ3 d;  3CCU A;  1O9S A;  3CC4 A;  2CZ6 B;  3H6Z A;  3VJP A;  1VQO T;  2RK1 A;  3MEW A;  1VQ5 T;  4M77 A;  2E6N A;  2VUB A;  2ZPB B;  2E6Z A;  3ZEH A;  2FYK A;  4C8Q A;  3HSB A;  5GMK h;  1K73 C;  3PIP A;  1VQM A;  5GAM f;  4IUU A;  3CEY A;  1VQ4 A;  4JS4 A;  1NZ9 A;  4XQ3 A;  4Y28 E;  2LC4 A;  1WNL A;  3QII A;  4LD9 K;  1LNX A;  2LDM A;  3VKI A;  2HNI A;  4C0Z A;  4BY6 B;  2HQE A;  2ZZD A;  4JLG A;  2CZ0 B;  2EQJ A;  2VV5 A;  5LJ5 h;  3GPL A;  4BDY A;  3L1A A;  3CCE T;  3E1S A;  2DO3 A;  2M9U A;  3CBO A;  2R5M A;  4VUB A;  1O75 A;  1VIF A;  2OAU A;  1JRI A;  3HHT B;  2PUO B;  1VUB A;  2H3J A;  3NTK A;  2DVE A;  3OYM A;  4JJN K;  4A4K A;  5GMK l;  4A4H A;  3QDR B;  4TVR A;  2HAX A;  4IUV A;  5LJ3 h;  2JVV A;  4M75 B;  3M5A A;  2EFI A;  4KBM B;  5FU7 C;  4F7U A;  4ME7 A;  5EG2 A;  3VYH B;  3OS1 A;  3PT9 A;  4C92 C;  1S72 T;  4M7A C;  1OZ2 A;  5DLQ E;  1Y07 A;  3CCL A;  3HFN A;  3M9Q A;  3X24 B;  3NTH A;  3CC4 T;  1WQ7 A;  5FU6 C;  2VYT A;  3M53 A;  1G3T A;  4BI8 B;  3CMA A;  4J6W A;  4ELY C;  2RI3 A;  4HKE A;  4BE0 A;  1JB0 E;  3X28 B;  3CC2 A;  4LDX A;  5FRM A;  2RH2 A;  3AHU A;  4QVC A;  5GAN h;  1X75 C;  1M4Z A;  2L8D A;  1Q82 C;  1JJ2 S;  3LLR A;  4M7A E;  1I4K 1;  2M0O A;  5CVI A;  3EFS A;  1YJN T;  1BYM A;  4YTL A;  1K9M U;  3OYJ A;  4C92 A;  4M7A A;  2KY9 A;  3LH0 A;  3MET A;  4M77 B;  4M7D A;  4PJO F;  4EDU A;  4JS5 A;  3CBM A;  4XK8 E;  3JCM W;  2DPP B;  3GLX A;  2DXC A;  2R5A A;  3GNF B;  2P4T A;  4EMG A;  2RHU A;  1VQK T;  3OSS C;  4NS5 A;  4C8Q B;  4PJO C;  3DLL A;  5I2M A;  1VQ8 A;  3ASK A;  1VIE A;  1KHC A;  1NE8 A;  3RKX A;  5FLX E;  5HK0 A;  4N0A A;  1WJS A;  4FT2 A;  2LT4 A;  3GNG A;  2PVG B;  4KUD K;  3HL8 A;  3LX7 A;  1YBY A;  3CC2 T;  4LDV A;  5GAN 8;  2PVD B;  2OTL A;  4Q5W A;  3M58 A;  3SFM A;  3L2U A;  3JCM P;  4XTU A;  5IAY A;  3MHX A;  2XDD A;  2LNV A;  4L6V 5;  3JCM f;  3C94 A;  4O5V A;  3I55 T;  3GP8 A;  1QP3 A;  3M56 A;  2LT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...