2HQXA

Crystal structure of human p100 tudor domain conserved region
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
TQFQKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFSTRVLPAQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human P100 Tudor Domain Conserved Region
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords P100 CO-ACTIVATOR TUDOR DOMAIN
total genus 21
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
A PF00567 TUDOR Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2hqxA01
4HCZA 3OYAA 5KE3A 4IURA 3S3OA 2YRVA 4N4HA 1KHCA 2EKOA 2RJDA 3OYFA 4BDYA 2QQSA 3OYKA 3P8DA 2DAQA 4E7IA 4E7JA 1OI1A 2M0OA 4C5GA 3FEOA 2K3XA 4BE1A 2IG0A 2CKKA 4BD3A 3OS2A 1OZ3A 2P0KA 3OYHA 3UT1A 4EDUA 3S6WA 2FHDA 4A4HA 2MWOA 1XNIA 1RI0A 2BKDN 2RI2A 3OY9A 3O8VA 4NS5A 3L2WA 5CIUA 1H3ZA 3PFSA 2JTFA 3S3NA 2EQMA 3Q1JA 5IN1A 3MEUA 4C5HA 3OA6A 3MEWA 4E7LA 3OB9A 3OYCA 2VYTA 3L2QA 4C5EA 2X4XA 2L8DA 2B8AA 2K3YA 4RG2A 5D6XA 3MEAA 1MHNA 3LLRA 5KCHA 3OYEA 3QJ6A 2RHIA 3PNWC 4A4EA 3OS0A 3OYDA 1N27A 5J26A 3OMGA 1WJQA 4E7HA 3QKJA 1OZ2A 3CEYA 4L59A 4N4IA 3P8HA 5C6SA 4PLLA 3OYIA 2RHUA 2L3RA 4Q5WA 3MO8A 3MP6A 5FRNA 3OYBA 3L2UA 3M9QA 3FLGA 3PMTA 3OYMA 5KH6A 3OYLA 4FU6A 3NTIA 4A4FA 2EQJA 1WJSA 4ZTFA 3DB3A 3NTKA 2RO0A 2EQKA 3LYIA 2M16A 2X35A 3LGFA 1WJRA 3E9FA 2HQXA 2RHZA 2WACA 3UWNA 2R5AA 5D6YA 5J39A 3MP8A 3ME9A 4B9XA 3L2RA 4BACA 2LDMA 2D9TA 2LRQA 2R57A 4QQDA 2JZ2A 2HQEA 4QW2A 3EAEA 1G5VA 3MP1A 2O4XA 2R58A 1OYXA 2RHYA 3H8ZA 2DIQA 2RHXA 4QQ6A 4PLIA 4BDZA 5KCOA 3BDLA 3ASKA 2X4WA 3LGLA 4IUVA 4IKFA 4PL6A 5D6WA 4II1A 4X34A 2LVMA 3F70A 2DIGA 2BUDA 2GFAA 2X4YA 2XDPA 2L89A 3LX7A 4IUTA 3E9GA 3L2VA 4BE0A 2EQUA 3QBYA 3OYJA 3FC3A 3FDRA 2E5QA 2G3RA 4GY5A 4CRIA 2RJCA 3SD4A 4LD6A 1SSFA 2F5KA 3LH0A 5FROA 3OMCA 2PQWA 4C5IA 2MWPA 3QIIA 2BIVA 4A4GA 4Z02A 5IAYA 4BE2A 3OYGA 4UC4A 4IUUA 3H6ZA 4OVAA 4QVZA 4N4GA 4FL6A 2RI3A 3OS1A 2RJFA 3OYNA 2E6NA 2NLUA 3S3MA 4B9WA 3DB4A 4IUPA 2O4XB 2LCCA 3C4SA 3PMIA 4QQGA 3GOXA 1WGSA 2RI5A 2M1HA 3NTHA 3DLMA 3KUFA 2R5MA 2XK0A 3L42A 3META 3MEVA 5C0MA 5KE2A 5FRMA 2EFIA 4IUQA 2GF7A 2QQRA 5M9OA 2LTOA 3ZEHA 4E7KA 2GFUA 2RJEA 3OQ5A 4ZTJA
chains in the Genus database with same CATH superfamily
5KE3A 1R0BG 2FZCB 3EHRA 3VS0A 3P8DA 3CCET 5CK9A 2IVWA 3M59A 3VUBA 2PTKA 4C0DC 3G6ET 2KMTA 4F04B 5GANe 1FX7A 5I22A 1SRLA 4F17A 1RI9A 2KQWA 2RD1A 2JJ9A 5LJ5d 2YWWA 1VQ5Q 3ZL7C 1R77A 2RMOA 4PLLA 4F7UB 1UGRB 3V7SA 1Y96B 3OYMA 3OYLA 3EG9B 1KD1C 2HSPA 4MZTA 2ED0A 3PVLA 3GBQA 1W1FA 2R5AA 2LQWA 4M7DE 4F7UG 4EMKA 3J81E 1M8VA 1VQ4T 3HRSA 1G5VA 1HXDA 2RHYA 1ABOA 1X2QA 1S72T 2LJ1A 1DJ7B 3SDZA 5CCAA 1BBZA 2QGFB 2QEXA 2LVMA 2CZ6B 1VQOT 1WQ7A 3OBYA 3I56Q 5LL6S 2JM8A 3SFMA 2RQVA 5CKBA 1HSQA 2QGGA 4PJOF 1A0NB 2CDTA 3S3MA 3DB4A 1TWBA 2O9SA 2HCKA 1KG1A 2E3HA 4DBRA 4J9IA 1TUDA 3TEEA 2DXCA 3CMAT 1B34A 1Y07A 1X69A 3KFVA 2RJEA 1N8RU 4EMKC 4AFUC 2EKOA 3TU4K 1M1KC 2QG9B 1K0SA 4E7IA 2KAFA 4XTWA 4E7JA 3FEOA 3ULRB 1I4K1 3HFNA 5GAOr 3E19A 1Q86R 4M75F 1W2BA 2KYMA 2HNIA 1CKBA 3FJPA 4OMQA 1LPLA 1BB9A 3CMAA 5IN1A 2HEQA 8AT1B 3OA6A 5ECAA 3VYGA 1M2VB 2L8DA 4PJLA 1QKXA 2M51A 3BE3A 3EFOB 1Q7YU 2OAUA 3QYHB 1YITQ 2XG8D 1QWEA 2DXTA 3H0FA 1OU9A 2M9UA 2JS2A 3QKJA 3FB9A 1UE9A 1VQ4A 2QI2A 2DD5A 1AHJB 1AOJA 3OYIA 1VQ8T 2LJ0A 3CPWP 3PT9A 4C0FA 2K5IA 4JZ4A 1JJ2A 3ZBDA 5AYFA 2EQJA 3CCQA 2EGEA 1TS9A 2E5KA 1UJYA 2YUQA 4GLMA 1YNZA 1ZQ1A 3M4GA 4LUDA 2RHZA 3L1AA 3JB9F 4M7AA 3MPUB 2EIFA 2EYWA 4M77G 5GAOp 3AT1B 3HKSA 1K1ZA 4FYXB 4PFOA 2ZPHB 4Y91A 3CCST 2X9HA 4PL6A 1MNEA 2CZ7B 4F16A 1VQLT 4L5GA 1QW1A 1IGQA 1SEMA 2OI3A 1WHKA 1Y0MA 4HKEA 2XMFA 5I2MA 1YWOA 2F69A 2E1HA 2BIVA 5KYXB 4C0ZA 3GNGA 2J6OA 3I56T 2DL8A 3CD6A 3EG0A 2NLUA 1K9MU 3C4SA 4FYYB 2CP3A 4QVDA 2J6KA 2M1HA 4M7DB 2QA4T 2XK0A 2BZ8A 4IIMA 4M78E 1N8RC 3RMSA 1I0CA 2PUKB 3RR6A 1PRLC 2GGRA 5IXFA 1JXMA 1KSWA 5CVIA 3X26B 2K79A 3CPWA 4EDUA 2FHDA 3IQLA 3VS3A 2VV5A 2BE9B 2DO3A 2RI2A 2A36A 4XU1A 3EFOA 1Q81C 2EQMA 3Q1JA 4HCCA 3JCMQ 2KBTA 1QQJA 2VXEA 1G3WA 2B8AA 3JCMV 2L3SA 1MHNA 1TU0B 3RESA 3HP9A 3OYDA 1IXDA 3CEYA 1V29B 1PCXA 3SWNA 2RK1A 2HZYA 1X43A 4N0AC 3FLGA 4F14A 2RH2A 3RBBB 1QVFA 3VJPA 1LCKA 4JJBA 4JRKA 2LJ3A 1Q82C 4HXJA 5FU6B 1YIJT 3CPWS 2D8JA 1WJRA 5L23A 3CC2T 5J39A 1VQ5A 2YRCA 1AWOA 1C6VX 1VQ9T 1GL5A 2QQAA 2VXFA 2HQEA 3UF4A 3RUXA 2LX9A 4PLIA 5A2QE 4MDXA 1HJDA 4II1A 4M7AB 1IGUA 3G6EQ 2C0TA 4HT9A 3REBB 5I2SA 1UTIA 3RDVA 2XICA 2KNBB 4IUUA 2RI3A 3JCMX 4BI4A 3WVEB 1M4ZA 1VQ4Q 3URGA 3HL8A 4XTYA 1M5Q1 2DRMA 2OTLA 1VQ5T 1WGSA 4QVCA 1H92A 3NFCA 4FT2A 3A8MB 5C0MA 2FG0A 1K8AR 4EMHA 4XTUA 1X01A 2EGCA 4N0AA 4HCKA 2LMJA 1KHIA 4D8DA 3SWNC 2ZZDA 2BTTA 1KHCA 4KBMB 4X9CA 1SHFA 2M0OA 3RKXA 2IG0A 3OS2A 5GMKh 1ZBXA 4RCBA 1E7OA 4NS5A 3L2WA 1NJIC 1KC8U 4A63B 1WNLA 2RK2A 3JCMb 1I8FA 3JAME 3KBGA 1YJWQ 3LW5E 3CC4A 5GAOl 1ZUUA 2CYZB 3M56A 3JCMJ 2NUTA 2VB6A 1WHLA 4JLGA 1WHJA 1OPLA 4ZGEB 3V8KA 1PWTA 1JU5C 3CCUA 2EW3A 4A4FA 1KQSP 4ZTFA 2LNVA 4BUGA 4M77B 2MYSA 1UHCA 2HQXA 3J80E 5GAMg 3TQ7P 2AIRB 4FSXA 4ATOA 2FEIA 1KIKA 2CH4W 2DVEA 2MAMA 3EH2A 5EC7A 4M77E 3U23A 3I5SA 5LJ5h 4FT4A 1IRXA 4JUVA 1VYTA 1VQ8Q 5FWCA 2DEQA 4M77D 5DLOA 4LXCA 7AT1B 2CGHA 2DIGA 2BUDA 4E7SA 1JEGA 2EJGA 3LX7A 4IUTA 5IXBA 1YCYA 4MDWA 3HRTA 4C8QC 3VRYA 4KUDK 1MV3A 3G1JA 1VA7A 3CCVT 1JRIA 2PU9B 4FL6A 5GAOm 1I1JA 4M7AC 5GMKm 3CC2A 5LJ3e 2VC8A 4C92B 5KYWA 3NGPA 3RKWA 3M57A 1OX9A 4XU0A 2EBPA 2VVKA 4ZGJB 6AT1B 1NEBA 1UUEA 1WZOA 1QMCA 1SPKA 1ZUKA 4PJOA 4IURA 4KRTA 3CMEQ 2QQSA 5GANj 5IHNA 1K9AA 2FB7A 3OYHA 1K9MC 4A4HA 1XNIA 1RADB 4DEXA 4Y28E 2L0AA 4X1VA 1W6XA 2V1RA 4XTZA 4PJMA 2B86A 4FM4B 1ZSZA 2K3YA 1VQ6A 3MEAA 3TCJA 3BFMA 4JS4A 1WFWA 1WJQA 3A98A 1SHGA 1RL2A 1BI0A 3TVTA 2OTLQ 2YUOA 2LT1A 2DEUA 3JCMg 4M7AD 3VS2A 5GMKl 3JCMW 1EZZB 3UWNA 1Y7XA 2CS7A 1KQSS 3QG1A 5HKCA 1OV3A 4M78C 2HL5C 5GAN4 3NPFA 2JZ2A 4D6WA 1UJ0A 3MCAB 3JB9G 2CT3A 1U3OA 1RACB 2DIQA 2DF6A 3M55A 1R0CB 4RUGA 4F7UA 1B34B 1ZBJA 3F70A 1R8OB 1FXXA 2KRNA 5L8RE 4RCCA 4DBQA 2RQRA 1VQKA 1Q7YC 4NOYA 2EQUA 3VS4A 2O9VA 3FDRA 3SD4A 3EH1A 1TH7A 2V8IA 2LNHB 1VQPT 3RKYA 2LQKA 4FYVB 1WX6A 3GOXA 2QA4Q 1X2KA 2EYXA 5GAN5 1N9RA 2DZ9A 2VASA 1VQKT 2QTXA 2GF7A 4PJNA 3VU3C 1NPRA 2E3IA 1ZHIA 1QVGS 2QEXT 3GPLA 2DAQA 3C0CA 1QP3A 5CKHA 1UGVA 1VQOA 2A3LA 3CPFA 3ER0A 3QJYA 1M90U 1O75A 5GAN8 3SWNB 1D3BB 1OX8A 5GANf 3UPUA 1M30A 3CCSQ 4E2FB 2BKDN 1M2VA 1RUWA 1M3CA 2MOXA 3CCQT 4RTWA 4M7DD 1WDXA 1OPKA 2VYTA 1C0MA 4C5EA 3ZFJA 2FRWA 1NJIU 3N5BB 1OQKA 3VUZA 2LZ6B 3PNWC 1AD5A 2QA4A 4M75B 1TSFA 3X20B 5IT9E 2CP2A 5FRNA 2VGNA 2KY9A 1KQ2A 1IHWA 2EQIA 3T9NA 3EGUA 2ZAEA 1VQ9Q 3JB9I 3CCLT 3VV0A 5D6YA 2JMAA 3L2RA 4M78A 1PKSA 3CCJA 2QTVA 4JS5A 1WPYA 2O4XA 2DILA 2AKKA 2K9GA 1GBRA 5GMKe 1AEYA 3V8LA 4CC4B 5KCOA 2XDBA 2P4RA 2JTMA 2MPXC 3PTAA 4WTOB 1YIJA 4M7AG 1GBQA 5DM7R 3QO3A 4DOVA 4C0GA 1Y57A 3MJXA 4BE2A 5I11A 3H6ZA 4JRIA 3CD6T 2JM9A 2E6NA 2MK5A 1PSEA 2K2MA 3OSSC 1X6GA 1SG5A 2AK5A 4WCIA 1G8XA 3KUFA 3I55Q 2RA2A 2KK4A 5FWBA 4JJDA 1N9SA 1K73C 2DA9A 4E7KA 1PC0A 1RAEB 3H41A 1YI2A 1TG0A 4HVVA 2YRDA 2MMPA 2QQBA 2JUFA 4Z89A 1KC8R 4N4HA 4K11A 4KGXB 2PVOB 3OYKA 1P92A 1YJNA 4LE9A 2DTOA 1M90R 2P0KA 1QVGP 3S6WA 1GCQC 4J9EA 4CC2A 1N6AA 3CC7T 4BY6B 3JB9J 2Y4XA 2LP5A 1KFZA 2ROLA 3MEUA 1RAHB 3L2QA 3CCLA 5CO7A 3HRUA 2D8HA 2FVUA 2W10A 2EKHA 3OYEA 4A4EA 3UA6A 1QWFA 4E7HA 5J26A 3SEMA 4C8QA 2LQNA 2DE0X 2KE9A 3UA7A 4OB2B 3CBPA 4HA8A 2EGAA 3CXCP 2AT1B 2RO0A 2CUBA 4J7IA 5HCKA 2ED1A 3C12A 5CAIA 4BACA 4FYWB 2FL7A 1Q86U 3M4YA 4QW2A 2DL7A 4XU2A 2V26A 3CCUT 2E4HA 1WHMA 2OTLT 2BZXA 2DK3A 1VYUA 3G4SQ 1RAAB 2OTJQ 2V1QA 1YI2T 1JJ2P 4YTLA 3OMCA 1K76A 1VQPQ 4OVAA 1HK9A 3V7CA 3REAB 5A0GA 3OW2P 5GAOq 1BKBA 3CBMA 1CSKA 2ESWA 2COZA 3CC4Q 2R5MA 3INZA 2P0PA 2EJ9A 3QZ5B 5FRMA 1QVPA 2ABLA 3JCMf 3WVDB 3ZEHA 1WIEA 5LJ5f 4DBFA 4XU3A 2H3EB 2RN8A 1K0XA 4CC3A 5FU7C 1GXIE 2A28A 1VQNQ 3CCJQ 1V1CA 1UGSB 1NEGA 2ZPBB 2DTIA 3PGGA 1W2BP 3PFSA 3L2ZA 4FCYA 2E41A 1X6BA 2HDAA 2LCSA 5GANh 3OS0A 4AT1B 4JRPA 1ZSZC 2DJQA 2D0QB 4N4IA 1BIBA 2QXFA 4PJOC 2X3XD 3MO8A 1M1FA 1M1KU 1FMKA 3L2UA 2XKOC 3CCMA 1NYFA 1FMVA 2YUNA 2HAXA 2OJ2A 1RAIB 2FZGB 1TOVA 1NZ9A 4AMCA 1M3BA 1VQNT 2G6FX 3CMET 3CMAQ 1X6OA 3O5ZA 1MMDA 5FW9A 4QQ6A 1U1TA 3A8OB 5GANd 1VQ6T 2YUPA 3G71Q 3JCMP 1KK7A 3BY7A 2JMCA 1MV0B 3E9GA 9ATCB 4M7AE 4KULA 1HYOA 2EAYA 3FC3A 4CRIA 3VS7A 5FROA 1FWZA 2DZCA 3QIIA 2L3PA 1QVGA 1W70A 2KT1A 3EFSA 4B9WA 2E64A 3J7AF 2YT6A 4OGEA 3E2UA 3OBWA 1VQKQ 5CKFA 4MZMA 2IIMA 2EFIA 4A4KA 2JN0A 1EIFA 2LTOA 4MMKA 3P8BB 2GFUA 2O88A 2H3JA 2LCLA 1VIFA 2RJDA 4RMOA 1MMNA 5LJ5j 3M54A 1OI1A 1VYVA 5IHIA 2L2PA 4C8QB 5AT1B 3OY9A 3CCVA 2JW4A 1K8AC 2V8KA 5GAN6 3OB9A 3R6OA 2QDLA 4RG2A 1WXUA 1Z9QA 3EG2A 4LN2A 2D0NA 1OZ2A 4DOWA 1V76A 4J9DA 1BYMA 3M0TA 2L3RA 2DFUA 4PJOD 3M9QA 2GTJA 1TXQA 3NTIA 2NYSA 4OMFB 3JRZA 1K4US 2M16A 2X35A 1WXTA 2LX7A 4PKCC 3M0UA 2KDSA 2CP0A 4M77F 1B3QA 1BI1A 1SKUB 2R57A 1VQMT 2DBKA 2SEMA 1QLYA 2ZPFB 1OEBA 3CC4T 2X4WA 3HFOA 3H0IA 1MMGA 1ZUYA 1NYGA 4XTXA 1IO6A 2DKGA 3CCRT 1T0JA 4M77A 2P4TA 3CCMT 1SSFA 2DL4A 3JCMc 2F2XA 4ORZA 2XU8A 2DJZA 4A4GA 2V8JA 1D3BA 1MNDA 1O9SA 2RJFA 3OYNA 4E6RA 1I5LA 2K7AA 1IZ6A 3GP8A 2FPDA 4ZNXA 3DLMA 2OX7A 3L42A 2NUPB 3M5AA 1JBMA 2P84A 5DY9A 3AHUA 2KROA 1AWWA 4LDWA 1HD3A 2QQRA 5M9OA 3HTRA 3G71A 3PE0A 2K3BA 1E6GA 1UGQB 2JNGA 1M3AA 2RQUA 5GAMf 2OTJT 3CC7Q 4ME7A 4C5GA 4MMLA 5LJ5e 3CCEQ 1VQOQ 2OAWA 1UECA 3JCMh 1Y71A 2HMAA 2K5LA 3FJ5A 3JB9D 1M9SA 3D7SB 5GAMe 4KT0E 4C8QD 1WYXA 5J3BA 3MEWA 4E7LA 4LD9K 3OYCA 2CZ0B 3CCMQ 3CCUQ 1UGPB 5KCHA 1MGQA 4GBQA 5EG2A 2DL5A 3OYYA 3VRZA 1J3TA 3RIRA 2KI7A 2RHUA 4JDSA 1K9MR 4M78F 1G83A 4M4ZA 5KYXA 3CD6Q 3OSVA 4C92D 3OW2A 3M58A 3LGFA 5GJVB 1Q95G 2WSEE 3C95A 1VUBA 3ME9A 3RMQA 3QWYA 4NL3A 2D9TA 3CC7A 4QQDA 5GAMd 4M7DC 2JXBA 4HT8A 3H8ZA 1FMWA 3EGXA 3A8GB 2L3QA 1ZLMA 1NBEB 5GAN3 5D6WA 2DL3A 1I5OB 2COYA 1K73R 2XDPA 1ACMB 1VQ7A 5GMKi 3VS1A 3TSZA 4GY5A 2RJCA 5LJ3h 4J9CA 4OMOA 1F1BB 4CI0C 2PQWA 3QZ9B 1KC8C 2MWPA 3GNFB 5FLXE 2JTEA 1GRIA 3V7RA 3X28B 2CSQA 2RF0A 5GANg 1T3LA 2QDYB 4KGVB 1I81A 2RQWA 2XIDA 1GCQA 2ATCB 4OGCA 1WLPB 2QYZA 1VOMA 3G7ZA 4AFZC 4KH1B 3VS5A 2DBMA 3PVQA 2JS0A 1WHHA 1VQLA 2YRVA 5KYYA 2F1LA 4A54A 4JRQA 1NG2A 4OMMA 4M7DF 1YJNT 2H8HA 1U8RA 5HK3A 2FYKA 3TREA 3TSWA 1MUZA 1N5ZA 5CIUA 3QWXX 4L6V5 2I2LA 4C5HA 1UEBA 1N8RR 1YHQA 3C94A 3QJ6A 4CC7A 1YN8A 4A53A 4M7DA 1M1KR 2PZ1A 4C8QE 2DRKA 5KYYB 3GF5A 2YLBA 4ZN3A 2MCNA 3QPHA 3RERA 2GBQA 2CP7A 2DXUA 5HY6A 1YJ9A 1SRMA 2O2OA 4M7DG 4DQ2A 3QSUA 3CXCS 1Q82U 4DBHA 3EAEA 3DLLA 1WXBA 1H641 3EGDB 4ANJA 3I9QA 4XQ3A 1BCMA 1RLPC 1QKWA 2MIOA 1G3SA 1Q82R 2JVVA 2BZYA 2NUPA 4BE0A 4JZ3A 4RTUA 2A08A 4KGZB 4HCBA 1K8AU 1MMAA 1M8MA 3A8LB 5GAN2 5IAYA 1YFNA 4XAXB 1NLOC 4QKUA 2E6ZA 2LCCA 3PMIA 3CCJT 2HBWA 1ARKA 2HD0A 3META 2FPEA 1NJIR 3X25B 2DLPA 1KQSA 1XTDA 2NWMA 5IHKA 1YITT 2D6FA 1YHQQ 3A8HB 2GQIA 5CKEA 2KR3A 1D1AA 2K2VA 1H8KA 2P0QA 5GJWB 2CH4A 3OW2S 2KRSA 2MWOA 1RI0A 4OMNA 3MHXA 2HBPA 1LJOA 2E70A 3S3NA 2K57A 5GMKj 1YI2Q 5IH2A 3LLRA 1N27A 1AVZC 4AFSC 2QK0A 4P5NA 3P8HA 2D1XA 1C1AA 4OF1A 4XTVA 5CQXA 3OYBA 3A1PA 2A0FB 4RTXA 5GAOn 4FU6A 1WJSA 4J5YA 1PG5B 2DX1A 2F5TX 3NTKA 3QDFA 2C0OA 2SRCA 2XD0A 1GFDA 2ZPIB 4X9DA 4B9XA 4J7FA 2IPOB 2LDMA 2W0ZA 3EG3A 1UHFA 2LRQA 4LNPA 1VQNA 3HSBA 4DEYA 2R58A 4AG2C 1KJWA 5FU6C 3RNJA 1SF9A 4BDZA 3HPWA 3ASKA 2DMOA 2HSEB 2KXCA 4X34A 3CCEA 2GFAA 2EYYA 1D0YA 2NUTB 4JLIA 3OYJA 4PJOB 2E5QA 1JXOA 3EG1A 4C5IA 4OB3B 4C92G 1D1CA 4UC4A 2RM4A 4OB1B 4J6XA 4OB0B 2JT4A 4PJOE 3UATA 1G3YA 5KYNA 2XHCA 4B6MA 1Q86C 1Z9ZA 2DVJA 3QXEB 4OMLA 2FPFA 4J9GA 2M0YA 2KVQG 1VQMA 1QVFS 2KYBA 3PIPA 3QDRB 4AFQC 3M0PA 1NPPA 1RAGB 2AHJB 2DTHA 1OOTA 2M02A 2YLCA 3VYHB 4EPCA 1UG1A 3NHNA 2ZPEB 4BD3A 3LWIA 3HHTB 5A0LA 4LDXA 1AZGB 3SHWA 3DKMA 1RAFB 4ELZC 4RG8A 1H3ZA 2GNCA 2I0NA 1I07A 1S1NA 3JSCA 2X4XA 1OULA 2VKNA 1M2OA 4PFZA 5KYUA 4BY6C 3VKIA 2F2VA 4PFPA 2DETA 3OMGA 5GAMj 1X27A 2DD4A 1KQ1A 1XQHA 2ZGWA 1T0HA 5C6SA 1IB8A 3BW1A 2XI9A 4Q5WA 1D0XA 4LDYA 4M7AF 1LVKA 3LH5A 2LQ8A 2GCXA 4VUBA 4LDVA 1ZA1B 4EIKA 1G2BA 1RLQC 4RKUE 1K73U 2WACA 1WHGA 2E12A 1ABQA 4HVUA 4R56A 2O31A 2Z0WA 2CREA 4M77C 3H0HA 4J83A 3CCVQ 4LUEA 3BDLA 5LJ3g 1WI7A 2A37A 1KD1R 2CZ1B 1E6HA 2CSIA 3G4ST 4M78G 2J06A 3L2VA 2DYIA 4ZGDB 3QBYA 4C92E 2YDLA 2G3RA 4LD6A 3QYGB 4F7UF 1YJ9Q 1U1SA 4QVZA 2KGTA 3EFRA 4N4GA 4BI8B 3OS1A 4F7UE 2BE7D 1BCOA 5A0DA 3CBOA 2CT4A 2RI5A 2DXBA 5GAMh 4M75A 3NTHA 3CCRQ 4Z88A 1X75C 5FU7B 4RTVA 4IUQA 4BI3A 2VGMA 5LJ3j 1VQ8A 5DLQE 2HKNA 1BI3A 4J8OA 4V2SA 4HCZA 2E65A 3OYAA 1JQQA 4JJNK 1QVFP 2YHTA 4JJCA 3S3OA 2YXYA 4BDYA 3UDCA 2VUBA 4NL2A 2FO0A 5D7UA 1VQ7T 4BE1A 4ZN1A 2K3XA 2CKKA 2QQ9A 3MKDA 1NLPC 1VQ9A 3O8VA 3R6NA 4OP0A 1Q81U 4DA4A 3JCMd 1ZSGA 1PM3A 3V8JA 1G3TA 1Y96A 2CUDA 1PD1A 5CKDA 1WQWA 1XJWB 3EGDA 4R55A 1QP2A 2RQTA 3G71T 4BB7A 5HK0A 3CC2Q 3PMTA 2FRYA 3EGXB 1PSFA 3E1SA 2OTJA 3I56A 2CP5A 2C0IA 2PVDB 2QASA 3NMZC 3G4SA 3LYIA 1QCOA 1U06A 1D09B 2K6DA 2HQHA 1QCNA 2CP6A 3I55T 2QEXQ 1TTHB 2AKLA 4C92F 2E10A 2DPPB 3I35A 3GIBA 2RHXA 3THKA 4PNOA 1YHQT 1CKAA 3CCSA 3LWHA 2X3WD 2XDDA 1BI2A 1LNXA 3JV3A 2L89A 1NM7A 4QT7A 2AZVA 1IHVA 1XOVA 2O01E 1UDLA 1PD0A 1AT1B 4C92C 3LH0A 2F5KA 4C92A 4Z02A 4FW2A 1YBYA 1M90C 2O4XB 4QQGA 1IREB 2NUZA 1VIEA 1M1GA 3JB9H 3GLXA 1GFCA 4RTYA 3MEVA 4PJJA 1TUCA 3CCLQ 4M75E 2KSSA 4IIOA 1Q7YR 4Y92A 2MF2A 2PUOB 1YJWA 4J9FA 2ENMA 1BIAA 2YSQA 1QCFA 2K4YA 1D1BA 4C0DB 8ATCB 2GQVA 4KUIA 1JJ2S 4RTTA 2K5FA 2RNAA 2RPNA 3BDUA 3EHQA 4EMGA 4HVWA 4Z8AA 1AZEA 3M0SA 5CR2A 2EJFA 3QUIA 1B07A 2KEAA 1H3HA 1PHTA 1VQMQ 3I55A 2LC4A 3FRNA 2RHIA 2C06A 1W2BS 1PKTA 2J6FA 4L59A 1UB4A 4O6JA 4OMPA 4D8KA 5LJ3f 2LT4A 3MP6A 3SB2A 4ESRA 1SSHA 2KRMA 5KH6A 3I5RA 4M78B 4C8QF 1Q81R 4JPBW 4M75C 4XK8E 3VS6A 2DM1A 2EYQA 2DYBA 2F2WA 1VQ6Q 1D0ZA 1NE8A 2ZPGB 3QHSA 2HL3A 1M27C 3PIOA 3CMEA 2J05A 3MP1A 1OYXA 3EG9A 3A5ZB 1YCSB 3M53A 3M0RA 2FZKB 4IUVA 4PK4A 4IKFA 2DNUA 4GLKA 1W4SA 2J7IA 4RTZA 1BK2A 2ECZA 5KYUB 1EX4A 1VQLQ 1YJWT 1BU1A 5CQYA 4M75D 1YJ9T 2Y90A 1EFNA 4ELYC 3FIFA 1ZX6A 5LJ3d 4TVRA 2EWNA 1S72Q 5KE2A 4M75G 1ZSZB 4E7ZA 2MI6A 1U5SA 2JOYA 2X51A 4E47A 2EVRA 3H9NA 3OQ5A 2PNIA 2RB6A 2Y4YA 4FIBA 1KD1U 3OYFA 4FW1A 1VQ7Q 3KXTA 1OZ3A 4J9BA 2A7YA 3UT1A 2WSCE 1WA7A 1YJNQ 1YWPA 3CXCA 2JTFA 2EPDA 1GCPA 4J6YA 5D6XA 4PJOG 4FSSA 4WF2A 1B7TA 2KXDA 3CQTA 2X4JA 4LDUA 1FYNA 4MZPA 5LJ5g 5I21A 3DB3A 2KT8A 2EQKA 1AWXA 2PVGB 1T3SA 1JO8A 3E9FA 3WXMB 4R0KA 2COWA 4KH0B 2AZSA 2HKQB 3MP8A 1PRMC 1YIJQ 2GTOA 1RABB 1TUGB 5KYWB 1PNJA 4O5VA 3JCMe 3LGLA 2EYZA 3X24B 4C8QG 1UFFA 1ZA2B 1AWJA 2X4YA 4J9HA 4AG1C 3CCRA 3OS5A 1OU8A 2DERA 2ROTA 2L5QA 4J6WA 3OYGA 3CCQQ 1VQPA 2WSFE 2ZCFB 3M0QA 2QAZA 4EMKB 1S72A 4M78D 4IUPA 3G6EA 1LOJA 1YITA 1JB0E 5GAN7 1YP5A 4ZTJA 2VWFA
chains in the Genus database with same CATH topology
2DTHA 5KE3A 4PJOA 4IURA 2LCLA 1VIFA 2RJDA 4RMOA 2YLCA 2QQSA 3P8DA 5GANj 5LJ5j 5CK9A 2IVWA 3M59A 3VYHB 4EPCA 3CCET 3M54A 1OI1A 3VUBA 2ZPEB 4BD3A 4C8QB 2FB7A 3OYHA 1K9MC 3LWIA 3HHTB 5A0LA 4LDXA 4C0DC 4A4HA 3G6ET 3DKMA 2KMTA 1XNIA 4ELZC 3OY9A 3CCVA 4RG8A 1H3ZA 5GANe 4Y28E 1FX7A 1K8AC 2V8KA 2KQWA 2RD1A 3JSCA 3OB9A 3R6OA 4XTZA 5GAN6 4FM4B 2X4XA 2K3YA 4RG2A 1VQ8T 3MEAA 3TCJA 1VQ6A 3BFMA 5LJ5d 4BY6C 4JS4A 3VKIA 3OMGA 1WJQA 5GAMj 1RL2A 2DD4A 1OZ2A 1BI0A 1KQ1A 1XQHA 4DOWA 2ZGWA 1BYMA 5C6SA 4PLLA 3BW1A 4F7UB 1UGRB 2XI9A 2L3RA 2LT1A 4Q5WA 3V7SA 4LDYA 1Y96B 4M7AF 4PJOD 3M9QA 3JCMg 3OYMA 3OYLA 3NTIA 4OMFB 1KD1C 2LQ8A 4M7AD 5GMKl 2GCXA 4VUBA 4MZTA 4LDVA 3JCMW 3JRZA 2M16A 2X35A 4RKUE 1K73U 2WACA 3UWNA 2R5AA 1Y7XA 4PKCC 2CS7A 2KDSA 3QG1A 4M77F 5HKCA 1KQSS 2E12A 4M7DE 4M78C 4F7UG 4EMKA 1BI1A 2R57A 5GAN4 3J81E 1VQMT 1M8VA 2JZ2A 4D6WA 1VQ4T 3HRSA 2ZPFB 3MCAB 3JB9G 1G5VA 1HXDA 4R56A 2RHYA 2DIQA 4M77C 4J83A 1S72T 3BDLA 3CC4T 1DJ7B 2X4WA 3M55A 3HFOA 5LJ3g 3SDZA 5CCAA 4F7UA 1B34B 2QEXA 2LVMA 3F70A 1R8OB 2CZ6B 1FXXA 1VQOT 2CZ1B 4XTXA 5L8RE 3G4ST 4M78G 4RCCA 2DKGA 3CCRT 1Q7YC 1VQKA 3L2VA 4ZGDB 1WQ7A 3OBYA 4NOYA 2EQUA 3QBYA 4C92E 5LL6S 3FDRA 2G3RA 4M77A 2P4TA 3SFMA 3CCMT 5CKBA 4LD6A 3SD4A 1SSFA 3JCMc 3QYGB 1TH7A 2V8IA 2XU8A 4PJOF 2DJZA 4F7UF 4A4GA 1VQPT 1U1SA 2V8JA 1D3BA 4QVZA 3EFRA 4N4GA 1O9SA 3RKYA 4BI8B 2RJFA 3OS1A 4F7UE 2LQKA 3OYNA 1I5LA 5A0DA 1IZ6A 3GP8A 3S3MA 3CBOA 3DB4A 1KG1A 3GOXA 2RI5A 2DXBA 5GAMh 4M75A 3NTHA 3DLMA 5GAN5 3L42A 1N9RA 2DZ9A 3M5AA 1X75C 5FU7B 1JBMA 3TEEA 5DY9A 3AHUA 4IUQA 2DXCA 4BI3A 2QTXA 1VQKT 3CMAT 2VGMA 2GF7A 4ZTJA 4LDWA 2QQRA 3VU3C 5M9OA 5LJ3j 1NPRA 1B34A 1Y07A 3G71A 1VQ8A 5DLQE 1ZHIA 2RJEA 1BI3A 4J8OA 2JNGA 1UGQB 4EMKC 4HCZA 2E65A 3OYAA 1QVGS 1N8RU 4JJNK 4V2SA 2YHTA 2QEXT 3S3OA 5GAMf 2EKOA 4BDYA 2OTJT 3TU4K 3UDCA 3GPLA 1M1KC 2DAQA 1VQOA 1QP3A 2VUBA 4NL2A 5CKHA 2KAFA 4XTWA 4E7JA 4E7IA 1VQ7T 4BE1A 4ME7A 3FEOA 2K3XA 4MMLA 2A3LA 2CKKA 3CPFA 1I4K1 3ER0A 4C5GA 4ZN1A 3QJYA 3HFNA 5GAOr 1O75A 3E19A 3JCMh 1Y71A 1D3BB 2QQ9A 4M75F 3SWNB 5GANf 5GAN8 3UPUA 2K5LA 2BKDN 3JB9D 1VQ9A 3O8VA 1M9SA 1W2BA 5GAMe 2HNIA 3FJPA 4KT0E 3CCQT 4C8QD 4OP0A 3CMAA 4M7DD 5IN1A 3OA6A 5J3BA 3MEWA 4E7LA 1M90U 3OYCA 2VYTA 3VYGA 4LD9K 2CZ0B 4C5EA 4DA4A 1Q81U 3JCMd 2L8DA 1UGPB 3ZFJA 5KCHA 3N5BB 3VUZA 1NJIU 1Q7YU 1MGQA 2OAUA 3QYHB 2XG8D 1G3TA 1Y96A 3PNWC 2DXTA 3V8JA 2QA4A 5CKDA 1WQWA 3QKJA 2M9UA 4M75B 3OYYA 5EG2A 3FB9A 1VQ4A 4R55A 2QI2A 3X20B 1QP2A 2DD5A 3RIRA 1AHJB 3OYIA 2RHUA 4BB7A 4JDSA 5HK0A 3PT9A 3G71T 4C0FA 2K5IA 2VGNA 2KY9A 4M78F 5FRNA 1KQ2A 3PMTA 1JJ2A 3ZBDA 1PSFA 3E1SA 5AYFA 2EQJA 3OSVA 3T9NA 4C92D 3CCQA 2OTJA 3I56A 2PVDB 3G4SA 3OW2A 3LYIA 3M58A 3LGFA 3JB9I 3CCLT 1ZQ1A 3M4GA 3VV0A 2RHZA 2WSEE 3C95A 3L1AA 3I55T 3JB9F 5D6YA 1VUBA 3ME9A 3L2RA 4M78A 3RMQA 4M7AA 4NL3A 3CCJA 2D9TA 4C92F 3CC7A 4QQDA 5GAMd 4JS5A 4M7DC 2EIFA 4M77G 1WPYA 5GAOp 2E10A 4HT8A 2DPPB 2O4XA 3H8ZA 3HKSA 5GMKe 3GIBA 2RHXA 1YHQT 4PNOA 3V8LA 2ZPHB 3A8GB 5KCOA 4Y91A 3CCSA 3CCST 3LWHA 2XDBA 2XDDA 4PL6A 2JTMA 5GAN3 1BI2A 2CZ7B 5D6WA 1VQLT 1LNXA 3PTAA 5LJ5e 4L5GA 2XDPA 2L89A 1YIJA 1QW1A 1VQ7A 4M7AG 5GMKi 1XOVA 4HKEA 2O01E 5DM7R 5I2MA 3QO3A 4GY5A 2RJCA 5LJ3h 4DOVA 4C0GA 4C92C 3LH0A 2F5KA 4C92A 4CI0C 2PQWA 2F69A 3QZ9B 2MWPA 1KC8C 2E1HA 2BIVA 3GNFB 4Z02A 4BE2A 4C0ZA 3GNGA 5FLXE 3H6ZA 1YBYA 4JRIA 3I56T 3CD6A 3CD6T 2E6NA 3V7RA 3X28B 2NLUA 1M90C 1PSEA 5GANg 3OSSC 1K9MU 2QDYB 2O4XB 3C4SA 1I81A 1IREB 4QQGA 4QVDA 1VIEA 1M1GA 2M1HA 2XIDA 3JB9H 5IT9E 4M7DB 4OGCA 3GLXA 2QA4T 3KUFA 2XK0A 2RA2A 3MEVA 2KK4A 1N9SA 4M78E 4M75E 2KSSA 3G7ZA 1K73C 2MF2A 2PUOB 1N8RC 4E7KA 3RMSA 1YI2A 1YJWA 2PUKB 1BIAA 2MMPA 2K4YA 2QQBA 4C0DB 2JUFA 1VQLA 2YRVA 4N4HA 2GQVA 2PVOB 4KUIA 4A54A 2K5FA 1P92A 3OYKA 4JRQA 1JJ2S 1YJNA 4M7DF 1YJNT 5CVIA 3BDUA 2DTOA 3X26B 4EMGA 2P0KA 1U8RA 3CPWA 5HK3A 2FYKA 3S6WA 2FHDA 4EDUA 3TREA 2VV5A 1N6AA 2DO3A 5CR2A 2RI2A 3CC7T 4BY6B 2EJFA 3QUIA 5CIUA 2Y4XA 4L6V5 4XU1A 2I2LA 3JB9J 1Q81C 2EQMA 3Q1JA 4C5HA 3MEUA 3JCMQ 4HCCA 1UEBA 3L2QA 3CCLA 1YHQA 2VXEA 1G3WA 5CO7A 3HRUA 2B8AA 3JCMV 3I55A 1MHNA 3C94A 2FVUA 2LC4A 3OYEA 3QJ6A 3FRNA 2RHIA 3HP9A 3RESA 4A4EA 3OYDA 5J26A 4E7HA 1W2BS 2C06A 4C8QA 4A53A 4M7DA 3CEYA 1V29B 4L59A 1UB4A 4O6JA 3SWNA 4C8QE 2RK1A 4OB2B 3GF5A 2LT4A 3MP6A 2YLBA 3CBPA 4N0AC 5LJ3f 3SB2A 4HA8A 4ZN3A 3FLGA 3QPHA 2RH2A 1QVFA 3RERA 5KH6A 3VJPA 2DXUA 4JRKA 5HY6A 4M78B 1YJ9A 4C8QF 1Q82C 2RO0A 4M75C 5FU6B 4J7IA 3CPWS 1YIJT 4M7DG 4XK8E 1WJRA 3CC2T 4DQ2A 3C12A 5CAIA 5J39A 1VQ5A 3QSUA 2EYQA 4BACA 3CXCS 2FL7A 1Q82U 1VQ9T 1NE8A 1Q86U 2ZPGB 2QQAA 2VXFA 2HQEA 3M4YA 3QHSA 4QW2A 3EAEA 3PIOA 3CMEA 4XU2A 3MP1A 3RUXA 3DLLA 1OYXA 2LX9A 3A5ZB 4PLIA 3M53A 1H641 3CCUT 2OTLT 4IUVA 4IKFA 5A2QE 4MDXA 4XQ3A 4II1A 4GLKA 1G3SA 1W4SA 2DK3A 4M7AB 2JVVA 4BE0A 1YI2T 1YJWT 4HT9A 4YTLA 3OMCA 4HCBA 1K8AU 5CQYA 5I2SA 3A8LB 5GAN2 4M75D 2XICA 5IAYA 4IUUA 1YJ9T 2Y90A 1HK9A 4OVAA 3V7CA 5A0GA 4ELYC 2RI3A 3JCMX 5GAOq 4BI4A 3WVEB 1M4ZA 1BKBA 3CBMA 3FIFA 4XAXB 3URGA 3HL8A 2E6ZA 4XTYA 1M5Q1 5LJ3d 2LCCA 3PMIA 1VQ5T 2OTLA 4TVRA 1WGSA 3CCJT 4QVCA 2EWNA 3NFCA 4FT2A 2HD0A 2R5MA 3INZA 3META 2P0PA 3A8MB 2EJ9A 3QZ5B 5C0MA 5KE2A 3X25B 5FRMA 4M75G 1KQSA 1XTDA 2MI6A 1QVPA 2JOYA 4EMHA 4XTUA 1YITT 1X01A 2D6FA 4E47A 3JCMf 3WVDB 3ZEHA 4N0AA 3OQ5A 5LJ5f 4XU3A 1KHIA 2RB6A 2Y4YA 3A8HB 4FIBA 1KD1U 5CKEA 1GXIE 5FU7C 3SWNC 2ZZDA 2K2VA 1KHCA 3OYFA 4KBMB 4X9CA 2P0QA 3KXTA 2M0OA 3RKXA 2IG0A 3OS2A 1OZ3A 5GMKh 2A7YA 3UT1A 3OW2S 2WSCE 2MWOA 1UGSB 1ZBXA 1RI0A 4RCBA 4NS5A 3L2WA 2ZPBB 3MHXA 1NJIC 2HBPA 1LJOA 2DTIA 3PGGA 3CXCA 1KC8U 2E70A 3L2ZA 3PFSA 2JTFA 3S3NA 1WNLA 2K57A 2RK2A 4J6YA 3JCMb 1I8FA 5GMKj 3JAME 3KBGA 2E41A 3LW5E 5D6XA 3CC4A 3LLRA 5GAOl 5GANh 3OS0A 1N27A 4PJOG 2CYZB 3M56A 3JCMJ 4JRPA 4WF2A 2D0QB 4JLGA 4N4IA 1BIBA 2QXFA 3P8HA 4P5NA 4PJOC 4OF1A 4XTVA 4ZGEB 3MO8A 1M1FA 3V8KA 5CQXA 3OYBA 3L2UA 1M1KU 3CCUA 2X4JA 2XKOC 3CCMA 4LDUA 5GAOn 4FU6A 4MZPA 4A4FA 5LJ5g 1WJSA 4ZTFA 4J5YA 2LNVA 2F5TX 3DB3A 3NTKA 5I21A 4BUGA 2EQKA 2XD0A 4M77B 2PVGB 2ZPIB 3E9FA 4X9DA 3WXMB 2HQXA 3J80E 5GAMg 2HAXA 3MP8A 4B9XA 4J7FA 4FSXA 2LDMA 4ATOA 1NZ9A 2LRQA 2MAMA 2DVEA 1VQNT 1VQNA 4M77E 3CMET 3HSBA 1X6OA 2R58A 5FU6C 5LJ5h 4O5VA 4QQ6A 1U1TA 4FT4A 4JUVA 3A8OB 3JCMe 3HPWA 5GANd 4BDZA 3ASKA 1VQ6T 3LGLA 3X24B 4C8QG 2DEQA 4M77D 3JCMP 5DLOA 4X34A 3BY7A 2CGHA 2DIGA 2BUDA 3CCEA 2GFAA 2X4YA 2EJGA 3LX7A 4IUTA 3E9GA 4JLIA 3CCRA 4KULA 3OS5A 4M7AE 1YCYA 3OYJA 4MDWA 2EAYA 4PJOB 3HRTA 3FC3A 2E5QA 4C8QC 4CRIA 4KUDK 5FROA 4C5IA 1FWZA 2DZCA 4OB3B 2L5QA 3QIIA 4C92G 4J6WA 3CCVT 3OYGA 4UC4A 1JRIA 1VQPA 1QVGA 2PU9B 2RM4A 2WSFE 4FL6A 4OB1B 5GAOm 2ZCFB 4J6XA 3EFSA 4OB0B 4PJOE 4M7AC 5GMKm 3CC2A 1G3YA 4B9WA 2VC8A 4EMKB 2E64A 2XHCA 4M78D 4IUPA 4C92B 5LJ3e 1S72A 3J7AF 1Q86C 3G6EA 4OGEA 3RKWA 3OBWA 3QXEB 3M57A 4MZMA 5CKFA 1VQMA 2KVQG 1LOJA 4XU0A 1QVFS 2EFIA 4ZGJB 4A4KA 2JN0A 1YITA 1JB0E 3PIPA 1EIFA 3QDRB 2LTOA 4MMKA 5GAN7 3P8BB 2GFUA 1NPPA 2AHJB 2H3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HCZ A;  3OYA A;  5KE3 A;  4IUR A;  3S3O A;  2YRV A;  4N4H A;  1KHC A;  2EKO A;  2RJD A;  3OYF A;  4BDY A;  2QQS A;  3OYK A;  3P8D A;  2DAQ A;  4E7I A;  4E7J A;  1OI1 A;  2M0O A;  4C5G A;  3FEO A;  2K3X A;  4BE1 A;  2IG0 A;  2CKK A;  4BD3 A;  3OS2 A;  1OZ3 A;  2P0K A;  3OYH A;  3UT1 A;  4EDU A;  3S6W A;  2FHD A;  4A4H A;  2MWO A;  1XNI A;  1RI0 A;  2BKD N;  2RI2 A;  3OY9 A;  3O8V A;  4NS5 A;  3L2W A;  5CIU A;  1H3Z A;  3PFS A;  2JTF A;  3S3N A;  2EQM A;  3Q1J A;  5IN1 A;  3MEU A;  4C5H A;  3OA6 A;  3MEW A;  4E7L A;  3OB9 A;  3OYC A;  2VYT A;  3L2Q A;  4C5E A;  2X4X A;  2L8D A;  2B8A A;  2K3Y A;  4RG2 A;  5D6X A;  3MEA A;  1MHN A;  3LLR A;  5KCH A;  3OYE A;  3QJ6 A;  2RHI A;  3PNW C;  4A4E A;  3OS0 A;  3OYD A;  1N27 A;  5J26 A;  3OMG A;  1WJQ A;  4E7H A;  3QKJ A;  1OZ2 A;  3CEY A;  4L59 A;  4N4I A;  3P8H A;  5C6S A;  4PLL A;  3OYI A;  2RHU A;  2L3R A;  4Q5W A;  3MO8 A;  3MP6 A;  5FRN A;  3OYB A;  3L2U A;  3M9Q A;  3FLG A;  3PMT A;  3OYM A;  5KH6 A;  3OYL A;  4FU6 A;  3NTI A;  4A4F A;  2EQJ A;  1WJS A;  4ZTF A;  3DB3 A;  3NTK A;  2RO0 A;  2EQK A;  3LYI A;  2M16 A;  2X35 A;  3LGF A;  1WJR A;  3E9F A;  2HQX A;  2RHZ A;  2WAC A;  3UWN A;  2R5A A;  5D6Y A;  5J39 A;  3MP8 A;  3ME9 A;  4B9X A;  3L2R A;  4BAC A;  2LDM A;  2D9T A;  2LRQ A;  2R57 A;  4QQD A;  2JZ2 A;  2HQE A;  4QW2 A;  3EAE A;  1G5V A;  3MP1 A;  2O4X A;  2R58 A;  1OYX A;  2RHY A;  3H8Z A;  2DIQ A;  2RHX A;  4QQ6 A;  4PLI A;  4BDZ A;  5KCO A;  3BDL A;  3ASK A;  2X4W A;  3LGL A;  4IUV A;  4IKF A;  4PL6 A;  5D6W A;  4II1 A;  4X34 A;  2LVM A;  3F70 A;  2DIG A;  2BUD A;  2GFA A;  2X4Y A;  2XDP A;  2L89 A;  3LX7 A;  4IUT A;  3E9G A;  3L2V A;  4BE0 A;  2EQU A;  3QBY A;  3OYJ A;  3FC3 A;  3FDR A;  2E5Q A;  2G3R A;  4GY5 A;  4CRI A;  2RJC A;  3SD4 A;  4LD6 A;  1SSF A;  2F5K A;  3LH0 A;  5FRO A;  3OMC A;  2PQW A;  4C5I A;  2MWP A;  3QII A;  2BIV A;  4A4G A;  4Z02 A;  5IAY A;  4BE2 A;  3OYG A;  4UC4 A;  4IUU A;  3H6Z A;  4OVA A;  4QVZ A;  4N4G A;  4FL6 A;  2RI3 A;  3OS1 A;  2RJF A;  3OYN A;  2E6N A;  2NLU A;  3S3M A;  4B9W A;  3DB4 A;  4IUP A;  2O4X B;  2LCC A;  3C4S A;  3PMI A;  4QQG A;  3GOX A;  1WGS A;  2RI5 A;  2M1H A;  3NTH A;  3DLM A;  3KUF A;  2R5M A;  2XK0 A;  3L42 A;  3MET A;  3MEV A;  5C0M A;  5KE2 A;  5FRM A;  2EFI A;  4IUQ A;  2GF7 A;  2QQR A;  5M9O A;  2LTO A;  3ZEH A;  4E7K A;  2GFU A;  2RJE A;  3OQ5 A;  4ZTJ A; 
#chains in the Genus database with same CATH topology
 5KE3 A;  1R0B G;  2FZC B;  3EHR A;  3VS0 A;  3P8D A;  3CCE T;  5CK9 A;  2IVW A;  3M59 A;  3VUB A;  2PTK A;  4C0D C;  3G6E T;  2KMT A;  4F04 B;  5GAN e;  1FX7 A;  5I22 A;  1SRL A;  4F17 A;  1RI9 A;  2KQW A;  2RD1 A;  2JJ9 A;  5LJ5 d;  2YWW A;  1VQ5 Q;  3ZL7 C;  1R77 A;  2RMO A;  4PLL A;  4F7U B;  1UGR B;  3V7S A;  1Y96 B;  3OYM A;  3OYL A;  3EG9 B;  1KD1 C;  2HSP A;  4MZT A;  2ED0 A;  3PVL A;  3GBQ A;  1W1F A;  2R5A A;  2LQW A;  4M7D E;  4F7U G;  4EMK A;  3J81 E;  1M8V A;  1VQ4 T;  3HRS A;  1G5V A;  1HXD A;  2RHY A;  1ABO A;  1X2Q A;  1S72 T;  2LJ1 A;  1DJ7 B;  3SDZ A;  5CCA A;  1BBZ A;  2QGF B;  2QEX A;  2LVM A;  2CZ6 B;  1VQO T;  1WQ7 A;  3OBY A;  3I56 Q;  5LL6 S;  2JM8 A;  3SFM A;  2RQV A;  5CKB A;  1HSQ A;  2QGG A;  4PJO F;  1A0N B;  2CDT A;  3S3M A;  3DB4 A;  1TWB A;  2O9S A;  2HCK A;  1KG1 A;  2E3H A;  4DBR A;  4J9I A;  1TUD A;  3TEE A;  2DXC A;  3CMA T;  1B34 A;  1Y07 A;  1X69 A;  3KFV A;  2RJE A;  1N8R U;  4EMK C;  4AFU C;  2EKO A;  3TU4 K;  1M1K C;  2QG9 B;  1K0S A;  4E7I A;  2KAF A;  4XTW A;  4E7J A;  3FEO A;  3ULR B;  1I4K 1;  3HFN A;  5GAO r;  3E19 A;  1Q86 R;  4M75 F;  1W2B A;  2KYM A;  2HNI A;  1CKB A;  3FJP A;  4OMQ A;  1LPL A;  1BB9 A;  3CMA A;  5IN1 A;  2HEQ A;  8AT1 B;  3OA6 A;  5ECA A;  3VYG A;  1M2V B;  2L8D A;  4PJL A;  1QKX A;  2M51 A;  3BE3 A;  3EFO B;  1Q7Y U;  2OAU A;  3QYH B;  1YIT Q;  2XG8 D;  1QWE A;  2DXT A;  3H0F A;  1OU9 A;  2M9U A;  2JS2 A;  3QKJ A;  3FB9 A;  1UE9 A;  1VQ4 A;  2QI2 A;  2DD5 A;  1AHJ B;  1AOJ A;  3OYI A;  1VQ8 T;  2LJ0 A;  3CPW P;  3PT9 A;  4C0F A;  2K5I A;  4JZ4 A;  1JJ2 A;  3ZBD A;  5AYF A;  2EQJ A;  3CCQ A;  2EGE A;  1TS9 A;  2E5K A;  1UJY A;  2YUQ A;  4GLM A;  1YNZ A;  1ZQ1 A;  3M4G A;  4LUD A;  2RHZ A;  3L1A A;  3JB9 F;  4M7A A;  3MPU B;  2EIF A;  2EYW A;  4M77 G;  5GAO p;  3AT1 B;  3HKS A;  1K1Z A;  4FYX B;  4PFO A;  2ZPH B;  4Y91 A;  3CCS T;  2X9H A;  4PL6 A;  1MNE A;  2CZ7 B;  4F16 A;  1VQL T;  4L5G A;  1QW1 A;  1IGQ A;  1SEM A;  2OI3 A;  1WHK A;  1Y0M A;  4HKE A;  2XMF A;  5I2M A;  1YWO A;  2F69 A;  2E1H A;  2BIV A;  5KYX B;  4C0Z A;  3GNG A;  2J6O A;  3I56 T;  2DL8 A;  3CD6 A;  3EG0 A;  2NLU A;  1K9M U;  3C4S A;  4FYY B;  2CP3 A;  4QVD A;  2J6K A;  2M1H A;  4M7D B;  2QA4 T;  2XK0 A;  2BZ8 A;  4IIM A;  4M78 E;  1N8R C;  3RMS A;  1I0C A;  2PUK B;  3RR6 A;  1PRL C;  2GGR A;  5IXF A;  1JXM A;  1KSW A;  5CVI A;  3X26 B;  2K79 A;  3CPW A;  4EDU A;  2FHD A;  3IQL A;  3VS3 A;  2VV5 A;  2BE9 B;  2DO3 A;  2RI2 A;  2A36 A;  4XU1 A;  3EFO A;  1Q81 C;  2EQM A;  3Q1J A;  4HCC A;  3JCM Q;  2KBT A;  1QQJ A;  2VXE A;  1G3W A;  2B8A A;  3JCM V;  2L3S A;  1MHN A;  1TU0 B;  3RES A;  3HP9 A;  3OYD A;  1IXD A;  3CEY A;  1V29 B;  1PCX A;  3SWN A;  2RK1 A;  2HZY A;  1X43 A;  4N0A C;  3FLG A;  4F14 A;  2RH2 A;  3RBB B;  1QVF A;  3VJP A;  1LCK A;  4JJB A;  4JRK A;  2LJ3 A;  1Q82 C;  4HXJ A;  5FU6 B;  1YIJ T;  3CPW S;  2D8J A;  1WJR A;  5L23 A;  3CC2 T;  5J39 A;  1VQ5 A;  2YRC A;  1AWO A;  1C6V X;  1VQ9 T;  1GL5 A;  2QQA A;  2VXF A;  2HQE A;  3UF4 A;  3RUX A;  2LX9 A;  4PLI A;  5A2Q E;  4MDX A;  1HJD A;  4II1 A;  4M7A B;  1IGU A;  3G6E Q;  2C0T A;  4HT9 A;  3REB B;  5I2S A;  1UTI A;  3RDV A;  2XIC A;  2KNB B;  4IUU A;  2RI3 A;  3JCM X;  4BI4 A;  3WVE B;  1M4Z A;  1VQ4 Q;  3URG A;  3HL8 A;  4XTY A;  1M5Q 1;  2DRM A;  2OTL A;  1VQ5 T;  1WGS A;  4QVC A;  1H92 A;  3NFC A;  4FT2 A;  3A8M B;  5C0M A;  2FG0 A;  1K8A R;  4EMH A;  4XTU A;  1X01 A;  2EGC A;  4N0A A;  4HCK A;  2LMJ A;  1KHI A;  4D8D A;  3SWN C;  2ZZD A;  2BTT A;  1KHC A;  4KBM B;  4X9C A;  1SHF A;  2M0O A;  3RKX A;  2IG0 A;  3OS2 A;  5GMK h;  1ZBX A;  4RCB A;  1E7O A;  4NS5 A;  3L2W A;  1NJI C;  1KC8 U;  4A63 B;  1WNL A;  2RK2 A;  3JCM b;  1I8F A;  3JAM E;  3KBG A;  1YJW Q;  3LW5 E;  3CC4 A;  5GAO l;  1ZUU A;  2CYZ B;  3M56 A;  3JCM J;  2NUT A;  2VB6 A;  1WHL A;  4JLG A;  1WHJ A;  1OPL A;  4ZGE B;  3V8K A;  1PWT A;  1JU5 C;  3CCU A;  2EW3 A;  4A4F A;  1KQS P;  4ZTF A;  2LNV A;  4BUG A;  4M77 B;  2MYS A;  1UHC A;  2HQX A;  3J80 E;  5GAM g;  3TQ7 P;  2AIR B;  4FSX A;  4ATO A;  2FEI A;  1KIK A;  2CH4 W;  2DVE A;  2MAM A;  3EH2 A;  5EC7 A;  4M77 E;  3U23 A;  3I5S A;  5LJ5 h;  4FT4 A;  1IRX A;  4JUV A;  1VYT A;  1VQ8 Q;  5FWC A;  2DEQ A;  4M77 D;  5DLO A;  4LXC A;  7AT1 B;  2CGH A;  2DIG A;  2BUD A;  4E7S A;  1JEG A;  2EJG A;  3LX7 A;  4IUT A;  5IXB A;  1YCY A;  4MDW A;  3HRT A;  4C8Q C;  3VRY A;  4KUD K;  1MV3 A;  3G1J A;  1VA7 A;  3CCV T;  1JRI A;  2PU9 B;  4FL6 A;  5GAO m;  1I1J A;  4M7A C;  5GMK m;  3CC2 A;  5LJ3 e;  2VC8 A;  4C92 B;  5KYW A;  3NGP A;  3RKW A;  3M57 A;  1OX9 A;  4XU0 A;  2EBP A;  2VVK A;  4ZGJ B;  6AT1 B;  1NEB A;  1UUE A;  1WZO A;  1QMC A;  1SPK A;  1ZUK A;  4PJO A;  4IUR A;  4KRT A;  3CME Q;  2QQS A;  5GAN j;  5IHN A;  1K9A A;  2FB7 A;  3OYH A;  1K9M C;  4A4H A;  1XNI A;  1RAD B;  4DEX A;  4Y28 E;  2L0A A;  4X1V A;  1W6X A;  2V1R A;  4XTZ A;  4PJM A;  2B86 A;  4FM4 B;  1ZSZ A;  2K3Y A;  1VQ6 A;  3MEA A;  3TCJ A;  3BFM A;  4JS4 A;  1WFW A;  1WJQ A;  3A98 A;  1SHG A;  1RL2 A;  1BI0 A;  3TVT A;  2OTL Q;  2YUO A;  2LT1 A;  2DEU A;  3JCM g;  4M7A D;  3VS2 A;  5GMK l;  3JCM W;  1EZZ B;  3UWN A;  1Y7X A;  2CS7 A;  1KQS S;  3QG1 A;  5HKC A;  1OV3 A;  4M78 C;  2HL5 C;  5GAN 4;  3NPF A;  2JZ2 A;  4D6W A;  1UJ0 A;  3MCA B;  3JB9 G;  2CT3 A;  1U3O A;  1RAC B;  2DIQ A;  2DF6 A;  3M55 A;  1R0C B;  4RUG A;  4F7U A;  1B34 B;  1ZBJ A;  3F70 A;  1R8O B;  1FXX A;  2KRN A;  5L8R E;  4RCC A;  4DBQ A;  2RQR A;  1VQK A;  1Q7Y C;  4NOY A;  2EQU A;  3VS4 A;  2O9V A;  3FDR A;  3SD4 A;  3EH1 A;  1TH7 A;  2V8I A;  2LNH B;  1VQP T;  3RKY A;  2LQK A;  4FYV B;  1WX6 A;  3GOX A;  2QA4 Q;  1X2K A;  2EYX A;  5GAN 5;  1N9R A;  2DZ9 A;  2VAS A;  1VQK T;  2QTX A;  2GF7 A;  4PJN A;  3VU3 C;  1NPR A;  2E3I A;  1ZHI A;  1QVG S;  2QEX T;  3GPL A;  2DAQ A;  3C0C A;  1QP3 A;  5CKH A;  1UGV A;  1VQO A;  2A3L A;  3CPF A;  3ER0 A;  3QJY A;  1M90 U;  1O75 A;  5GAN 8;  3SWN B;  1D3B B;  1OX8 A;  5GAN f;  3UPU A;  1M30 A;  3CCS Q;  4E2F B;  2BKD N;  1M2V A;  1RUW A;  1M3C A;  2MOX A;  3CCQ T;  4RTW A;  4M7D D;  1WDX A;  1OPK A;  2VYT A;  1C0M A;  4C5E A;  3ZFJ A;  2FRW A;  1NJI U;  3N5B B;  1OQK A;  3VUZ A;  2LZ6 B;  3PNW C;  1AD5 A;  2QA4 A;  4M75 B;  1TSF A;  3X20 B;  5IT9 E;  2CP2 A;  5FRN A;  2VGN A;  2KY9 A;  1KQ2 A;  1IHW A;  2EQI A;  3T9N A;  3EGU A;  2ZAE A;  1VQ9 Q;  3JB9 I;  3CCL T;  3VV0 A;  5D6Y A;  2JMA A;  3L2R A;  4M78 A;  1PKS A;  3CCJ A;  2QTV A;  4JS5 A;  1WPY A;  2O4X A;  2DIL A;  2AKK A;  2K9G A;  1GBR A;  5GMK e;  1AEY A;  3V8L A;  4CC4 B;  5KCO A;  2XDB A;  2P4R A;  2JTM A;  2MPX C;  3PTA A;  4WTO B;  1YIJ A;  4M7A G;  1GBQ A;  5DM7 R;  3QO3 A;  4DOV A;  4C0G A;  1Y57 A;  3MJX A;  4BE2 A;  5I11 A;  3H6Z A;  4JRI A;  3CD6 T;  2JM9 A;  2E6N A;  2MK5 A;  1PSE A;  2K2M A;  3OSS C;  1X6G A;  1SG5 A;  2AK5 A;  4WCI A;  1G8X A;  3KUF A;  3I55 Q;  2RA2 A;  2KK4 A;  5FWB A;  4JJD A;  1N9S A;  1K73 C;  2DA9 A;  4E7K A;  1PC0 A;  1RAE B;  3H41 A;  1YI2 A;  1TG0 A;  4HVV A;  2YRD A;  2MMP A;  2QQB A;  2JUF A;  4Z89 A;  1KC8 R;  4N4H A;  4K11 A;  4KGX B;  2PVO B;  3OYK A;  1P92 A;  1YJN A;  4LE9 A;  2DTO A;  1M90 R;  2P0K A;  1QVG P;  3S6W A;  1GCQ C;  4J9E A;  4CC2 A;  1N6A A;  3CC7 T;  4BY6 B;  3JB9 J;  2Y4X A;  2LP5 A;  1KFZ A;  2ROL A;  3MEU A;  1RAH B;  3L2Q A;  3CCL A;  5CO7 A;  3HRU A;  2D8H A;  2FVU A;  2W10 A;  2EKH A;  3OYE A;  4A4E A;  3UA6 A;  1QWF A;  4E7H A;  5J26 A;  3SEM A;  4C8Q A;  2LQN A;  2DE0 X;  2KE9 A;  3UA7 A;  4OB2 B;  3CBP A;  4HA8 A;  2EGA A;  3CXC P;  2AT1 B;  2RO0 A;  2CUB A;  4J7I A;  5HCK A;  2ED1 A;  3C12 A;  5CAI A;  4BAC A;  4FYW B;  2FL7 A;  1Q86 U;  3M4Y A;  4QW2 A;  2DL7 A;  4XU2 A;  2V26 A;  3CCU T;  2E4H A;  1WHM A;  2OTL T;  2BZX A;  2DK3 A;  1VYU A;  3G4S Q;  1RAA B;  2OTJ Q;  2V1Q A;  1YI2 T;  1JJ2 P;  4YTL A;  3OMC A;  1K76 A;  1VQP Q;  4OVA A;  1HK9 A;  3V7C A;  3REA B;  5A0G A;  3OW2 P;  5GAO q;  1BKB A;  3CBM A;  1CSK A;  2ESW A;  2COZ A;  3CC4 Q;  2R5M A;  3INZ A;  2P0P A;  2EJ9 A;  3QZ5 B;  5FRM A;  1QVP A;  2ABL A;  3JCM f;  3WVD B;  3ZEH A;  1WIE A;  5LJ5 f;  4DBF A;  4XU3 A;  2H3E B;  2RN8 A;  1K0X A;  4CC3 A;  5FU7 C;  1GXI E;  2A28 A;  1VQN Q;  3CCJ Q;  1V1C A;  1UGS B;  1NEG A;  2ZPB B;  2DTI A;  3PGG A;  1W2B P;  3PFS A;  3L2Z A;  4FCY A;  2E41 A;  1X6B A;  2HDA A;  2LCS A;  5GAN h;  3OS0 A;  4AT1 B;  4JRP A;  1ZSZ C;  2DJQ A;  2D0Q B;  4N4I A;  1BIB A;  2QXF A;  4PJO C;  2X3X D;  3MO8 A;  1M1F A;  1M1K U;  1FMK A;  3L2U A;  2XKO C;  3CCM A;  1NYF A;  1FMV A;  2YUN A;  2HAX A;  2OJ2 A;  1RAI B;  2FZG B;  1TOV A;  1NZ9 A;  4AMC A;  1M3B A;  1VQN T;  2G6F X;  3CME T;  3CMA Q;  1X6O A;  3O5Z A;  1MMD A;  5FW9 A;  4QQ6 A;  1U1T A;  3A8O B;  5GAN d;  1VQ6 T;  2YUP A;  3G71 Q;  3JCM P;  1KK7 A;  3BY7 A;  2JMC A;  1MV0 B;  3E9G A;  9ATC B;  4M7A E;  4KUL A;  1HYO A;  2EAY A;  3FC3 A;  4CRI A;  3VS7 A;  5FRO A;  1FWZ A;  2DZC A;  3QII A;  2L3P A;  1QVG A;  1W70 A;  2KT1 A;  3EFS A;  4B9W A;  2E64 A;  3J7A F;  2YT6 A;  4OGE A;  3E2U A;  3OBW A;  1VQK Q;  5CKF A;  4MZM A;  2IIM A;  2EFI A;  4A4K A;  2JN0 A;  1EIF A;  2LTO A;  4MMK A;  3P8B B;  2GFU A;  2O88 A;  2H3J A;  2LCL A;  1VIF A;  2RJD A;  4RMO A;  1MMN A;  5LJ5 j;  3M54 A;  1OI1 A;  1VYV A;  5IHI A;  2L2P A;  4C8Q B;  5AT1 B;  3OY9 A;  3CCV A;  2JW4 A;  1K8A C;  2V8K A;  5GAN 6;  3OB9 A;  3R6O A;  2QDL A;  4RG2 A;  1WXU A;  1Z9Q A;  3EG2 A;  4LN2 A;  2D0N A;  1OZ2 A;  4DOW A;  1V76 A;  4J9D A;  1BYM A;  3M0T A;  2L3R A;  2DFU A;  4PJO D;  3M9Q A;  2GTJ A;  1TXQ A;  3NTI A;  2NYS A;  4OMF B;  3JRZ A;  1K4U S;  2M16 A;  2X35 A;  1WXT A;  2LX7 A;  4PKC C;  3M0U A;  2KDS A;  2CP0 A;  4M77 F;  1B3Q A;  1BI1 A;  1SKU B;  2R57 A;  1VQM T;  2DBK A;  2SEM A;  1QLY A;  2ZPF B;  1OEB A;  3CC4 T;  2X4W A;  3HFO A;  3H0I A;  1MMG A;  1ZUY A;  1NYG A;  4XTX A;  1IO6 A;  2DKG A;  3CCR T;  1T0J A;  4M77 A;  2P4T A;  3CCM T;  1SSF A;  2DL4 A;  3JCM c;  2F2X A;  4ORZ A;  2XU8 A;  2DJZ A;  4A4G A;  2V8J A;  1D3B A;  1MND A;  1O9S A;  2RJF A;  3OYN A;  4E6R A;  1I5L A;  2K7A A;  1IZ6 A;  3GP8 A;  2FPD A;  4ZNX A;  3DLM A;  2OX7 A;  3L42 A;  2NUP B;  3M5A A;  1JBM A;  2P84 A;  5DY9 A;  3AHU A;  2KRO A;  1AWW A;  4LDW A;  1HD3 A;  2QQR A;  5M9O A;  3HTR A;  3G71 A;  3PE0 A;  2K3B A;  1E6G A;  1UGQ B;  2JNG A;  1M3A A;  2RQU A;  5GAM f;  2OTJ T;  3CC7 Q;  4ME7 A;  4C5G A;  4MML A;  5LJ5 e;  3CCE Q;  1VQO Q;  2OAW A;  1UEC A;  3JCM h;  1Y71 A;  2HMA A;  2K5L A;  3FJ5 A;  3JB9 D;  1M9S A;  3D7S B;  5GAM e;  4KT0 E;  4C8Q D;  1WYX A;  5J3B A;  3MEW A;  4E7L A;  4LD9 K;  3OYC A;  2CZ0 B;  3CCM Q;  3CCU Q;  1UGP B;  5KCH A;  1MGQ A;  4GBQ A;  5EG2 A;  2DL5 A;  3OYY A;  3VRZ A;  1J3T A;  3RIR A;  2KI7 A;  2RHU A;  4JDS A;  1K9M R;  4M78 F;  1G83 A;  4M4Z A;  5KYX A;  3CD6 Q;  3OSV A;  4C92 D;  3OW2 A;  3M58 A;  3LGF A;  5GJV B;  1Q95 G;  2WSE E;  3C95 A;  1VUB A;  3ME9 A;  3RMQ A;  3QWY A;  4NL3 A;  2D9T A;  3CC7 A;  4QQD A;  5GAM d;  4M7D C;  2JXB A;  4HT8 A;  3H8Z A;  1FMW A;  3EGX A;  3A8G B;  2L3Q A;  1ZLM A;  1NBE B;  5GAN 3;  5D6W A;  2DL3 A;  1I5O B;  2COY A;  1K73 R;  2XDP A;  1ACM B;  1VQ7 A;  5GMK i;  3VS1 A;  3TSZ A;  4GY5 A;  2RJC A;  5LJ3 h;  4J9C A;  4OMO A;  1F1B B;  4CI0 C;  2PQW A;  3QZ9 B;  1KC8 C;  2MWP A;  3GNF B;  5FLX E;  2JTE A;  1GRI A;  3V7R A;  3X28 B;  2CSQ A;  2RF0 A;  5GAN g;  1T3L A;  2QDY B;  4KGV B;  1I81 A;  2RQW A;  2XID A;  1GCQ A;  2ATC B;  4OGC A;  1WLP B;  2QYZ A;  1VOM A;  3G7Z A;  4AFZ C;  4KH1 B;  3VS5 A;  2DBM A;  3PVQ A;  2JS0 A;  1WHH A;  1VQL A;  2YRV A;  5KYY A;  2F1L A;  4A54 A;  4JRQ A;  1NG2 A;  4OMM A;  4M7D F;  1YJN T;  2H8H A;  1U8R A;  5HK3 A;  2FYK A;  3TRE A;  3TSW A;  1MUZ A;  1N5Z A;  5CIU A;  3QWX X;  4L6V 5;  2I2L A;  4C5H A;  1UEB A;  1N8R R;  1YHQ A;  3C94 A;  3QJ6 A;  4CC7 A;  1YN8 A;  4A53 A;  4M7D A;  1M1K R;  2PZ1 A;  4C8Q E;  2DRK A;  5KYY B;  3GF5 A;  2YLB A;  4ZN3 A;  2MCN A;  3QPH A;  3RER A;  2GBQ A;  2CP7 A;  2DXU A;  5HY6 A;  1YJ9 A;  1SRM A;  2O2O A;  4M7D G;  4DQ2 A;  3QSU A;  3CXC S;  1Q82 U;  4DBH A;  3EAE A;  3DLL A;  1WXB A;  1H64 1;  3EGD B;  4ANJ A;  3I9Q A;  4XQ3 A;  1BCM A;  1RLP C;  1QKW A;  2MIO A;  1G3S A;  1Q82 R;  2JVV A;  2BZY A;  2NUP A;  4BE0 A;  4JZ3 A;  4RTU A;  2A08 A;  4KGZ B;  4HCB A;  1K8A U;  1MMA A;  1M8M A;  3A8L B;  5GAN 2;  5IAY A;  1YFN A;  4XAX B;  1NLO C;  4QKU A;  2E6Z A;  2LCC A;  3PMI A;  3CCJ T;  2HBW A;  1ARK A;  2HD0 A;  3MET A;  2FPE A;  1NJI R;  3X25 B;  2DLP A;  1KQS A;  1XTD A;  2NWM A;  5IHK A;  1YIT T;  2D6F A;  1YHQ Q;  3A8H B;  2GQI A;  5CKE A;  2KR3 A;  1D1A A;  2K2V A;  1H8K A;  2P0Q A;  5GJW B;  2CH4 A;  3OW2 S;  2KRS A;  2MWO A;  1RI0 A;  4OMN A;  3MHX A;  2HBP A;  1LJO A;  2E70 A;  3S3N A;  2K57 A;  5GMK j;  1YI2 Q;  5IH2 A;  3LLR A;  1N27 A;  1AVZ C;  4AFS C;  2QK0 A;  4P5N A;  3P8H A;  2D1X A;  1C1A A;  4OF1 A;  4XTV A;  5CQX A;  3OYB A;  3A1P A;  2A0F B;  4RTX A;  5GAO n;  4FU6 A;  1WJS A;  4J5Y A;  1PG5 B;  2DX1 A;  2F5T X;  3NTK A;  3QDF A;  2C0O A;  2SRC A;  2XD0 A;  1GFD A;  2ZPI B;  4X9D A;  4B9X A;  4J7F A;  2IPO B;  2LDM A;  2W0Z A;  3EG3 A;  1UHF A;  2LRQ A;  4LNP A;  1VQN A;  3HSB A;  4DEY A;  2R58 A;  4AG2 C;  1KJW A;  5FU6 C;  3RNJ A;  1SF9 A;  4BDZ A;  3HPW A;  3ASK A;  2DMO A;  2HSE B;  2KXC A;  4X34 A;  3CCE A;  2GFA A;  2EYY A;  1D0Y A;  2NUT B;  4JLI A;  3OYJ A;  4PJO B;  2E5Q A;  1JXO A;  3EG1 A;  4C5I A;  4OB3 B;  4C92 G;  1D1C A;  4UC4 A;  2RM4 A;  4OB1 B;  4J6X A;  4OB0 B;  2JT4 A;  4PJO E;  3UAT A;  1G3Y A;  5KYN A;  2XHC A;  4B6M A;  1Q86 C;  1Z9Z A;  2DVJ A;  3QXE B;  4OML A;  2FPF A;  4J9G A;  2M0Y A;  2KVQ G;  1VQM A;  1QVF S;  2KYB A;  3PIP A;  3QDR B;  4AFQ C;  3M0P A;  1NPP A;  1RAG B;  2AHJ B;  2DTH A;  1OOT A;  2M02 A;  2YLC A;  3VYH B;  4EPC A;  1UG1 A;  3NHN A;  2ZPE B;  4BD3 A;  3LWI A;  3HHT B;  5A0L A;  4LDX A;  1AZG B;  3SHW A;  3DKM A;  1RAF B;  4ELZ C;  4RG8 A;  1H3Z A;  2GNC A;  2I0N A;  1I07 A;  1S1N A;  3JSC A;  2X4X A;  1OUL A;  2VKN A;  1M2O A;  4PFZ A;  5KYU A;  4BY6 C;  3VKI A;  2F2V A;  4PFP A;  2DET A;  3OMG A;  5GAM j;  1X27 A;  2DD4 A;  1KQ1 A;  1XQH A;  2ZGW A;  1T0H A;  5C6S A;  1IB8 A;  3BW1 A;  2XI9 A;  4Q5W A;  1D0X A;  4LDY A;  4M7A F;  1LVK A;  3LH5 A;  2LQ8 A;  2GCX A;  4VUB A;  4LDV A;  1ZA1 B;  4EIK A;  1G2B A;  1RLQ C;  4RKU E;  1K73 U;  2WAC A;  1WHG A;  2E12 A;  1ABQ A;  4HVU A;  4R56 A;  2O31 A;  2Z0W A;  2CRE A;  4M77 C;  3H0H A;  4J83 A;  3CCV Q;  4LUE A;  3BDL A;  5LJ3 g;  1WI7 A;  2A37 A;  1KD1 R;  2CZ1 B;  1E6H A;  2CSI A;  3G4S T;  4M78 G;  2J06 A;  3L2V A;  2DYI A;  4ZGD B;  3QBY A;  4C92 E;  2YDL A;  2G3R A;  4LD6 A;  3QYG B;  4F7U F;  1YJ9 Q;  1U1S A;  4QVZ A;  2KGT A;  3EFR A;  4N4G A;  4BI8 B;  3OS1 A;  4F7U E;  2BE7 D;  1BCO A;  5A0D A;  3CBO A;  2CT4 A;  2RI5 A;  2DXB A;  5GAM h;  4M75 A;  3NTH A;  3CCR Q;  4Z88 A;  1X75 C;  5FU7 B;  4RTV A;  4IUQ A;  4BI3 A;  2VGM A;  5LJ3 j;  1VQ8 A;  5DLQ E;  2HKN A;  1BI3 A;  4J8O A;  4V2S A;  4HCZ A;  2E65 A;  3OYA A;  1JQQ A;  4JJN K;  1QVF P;  2YHT A;  4JJC A;  3S3O A;  2YXY A;  4BDY A;  3UDC A;  2VUB A;  4NL2 A;  2FO0 A;  5D7U A;  1VQ7 T;  4BE1 A;  4ZN1 A;  2K3X A;  2CKK A;  2QQ9 A;  3MKD A;  1NLP C;  1VQ9 A;  3O8V A;  3R6N A;  4OP0 A;  1Q81 U;  4DA4 A;  3JCM d;  1ZSG A;  1PM3 A;  3V8J A;  1G3T A;  1Y96 A;  2CUD A;  1PD1 A;  5CKD A;  1WQW A;  1XJW B;  3EGD A;  4R55 A;  1QP2 A;  2RQT A;  3G71 T;  4BB7 A;  5HK0 A;  3CC2 Q;  3PMT A;  2FRY A;  3EGX B;  1PSF A;  3E1S A;  2OTJ A;  3I56 A;  2CP5 A;  2C0I A;  2PVD B;  2QAS A;  3NMZ C;  3G4S A;  3LYI A;  1QCO A;  1U06 A;  1D09 B;  2K6D A;  2HQH A;  1QCN A;  2CP6 A;  3I55 T;  2QEX Q;  1TTH B;  2AKL A;  4C92 F;  2E10 A;  2DPP B;  3I35 A;  3GIB A;  2RHX A;  3THK A;  4PNO A;  1YHQ T;  1CKA A;  3CCS A;  3LWH A;  2X3W D;  2XDD A;  1BI2 A;  1LNX A;  3JV3 A;  2L89 A;  1NM7 A;  4QT7 A;  2AZV A;  1IHV A;  1XOV A;  2O01 E;  1UDL A;  1PD0 A;  1AT1 B;  4C92 C;  3LH0 A;  2F5K A;  4C92 A;  4Z02 A;  4FW2 A;  1YBY A;  1M90 C;  2O4X B;  4QQG A;  1IRE B;  2NUZ A;  1VIE A;  1M1G A;  3JB9 H;  3GLX A;  1GFC A;  4RTY A;  3MEV A;  4PJJ A;  1TUC A;  3CCL Q;  4M75 E;  2KSS A;  4IIO A;  1Q7Y R;  4Y92 A;  2MF2 A;  2PUO B;  1YJW A;  4J9F A;  2ENM A;  1BIA A;  2YSQ A;  1QCF A;  2K4Y A;  1D1B A;  4C0D B;  8ATC B;  2GQV A;  4KUI A;  1JJ2 S;  4RTT A;  2K5F A;  2RNA A;  2RPN A;  3BDU A;  3EHQ A;  4EMG A;  4HVW A;  4Z8A A;  1AZE A;  3M0S A;  5CR2 A;  2EJF A;  3QUI A;  1B07 A;  2KEA A;  1H3H A;  1PHT A;  1VQM Q;  3I55 A;  2LC4 A;  3FRN A;  2RHI A;  2C06 A;  1W2B S;  1PKT A;  2J6F A;  4L59 A;  1UB4 A;  4O6J A;  4OMP A;  4D8K A;  5LJ3 f;  2LT4 A;  3MP6 A;  3SB2 A;  4ESR A;  1SSH A;  2KRM A;  5KH6 A;  3I5R A;  4M78 B;  4C8Q F;  1Q81 R;  4JPB W;  4M75 C;  4XK8 E;  3VS6 A;  2DM1 A;  2EYQ A;  2DYB A;  2F2W A;  1VQ6 Q;  1D0Z A;  1NE8 A;  2ZPG B;  3QHS A;  2HL3 A;  1M27 C;  3PIO A;  3CME A;  2J05 A;  3MP1 A;  1OYX A;  3EG9 A;  3A5Z B;  1YCS B;  3M53 A;  3M0R A;  2FZK B;  4IUV A;  4PK4 A;  4IKF A;  2DNU A;  4GLK A;  1W4S A;  2J7I A;  4RTZ A;  1BK2 A;  2ECZ A;  5KYU B;  1EX4 A;  1VQL Q;  1YJW T;  1BU1 A;  5CQY A;  4M75 D;  1YJ9 T;  2Y90 A;  1EFN A;  4ELY C;  3FIF A;  1ZX6 A;  5LJ3 d;  4TVR A;  2EWN A;  1S72 Q;  5KE2 A;  4M75 G;  1ZSZ B;  4E7Z A;  2MI6 A;  1U5S A;  2JOY A;  2X51 A;  4E47 A;  2EVR A;  3H9N A;  3OQ5 A;  2PNI A;  2RB6 A;  2Y4Y A;  4FIB A;  1KD1 U;  3OYF A;  4FW1 A;  1VQ7 Q;  3KXT A;  1OZ3 A;  4J9B A;  2A7Y A;  3UT1 A;  2WSC E;  1WA7 A;  1YJN Q;  1YWP A;  3CXC A;  2JTF A;  2EPD A;  1GCP A;  4J6Y A;  5D6X A;  4PJO G;  4FSS A;  4WF2 A;  1B7T A;  2KXD A;  3CQT A;  2X4J A;  4LDU A;  1FYN A;  4MZP A;  5LJ5 g;  5I21 A;  3DB3 A;  2KT8 A;  2EQK A;  1AWX A;  2PVG B;  1T3S A;  1JO8 A;  3E9F A;  3WXM B;  4R0K A;  2COW A;  4KH0 B;  2AZS A;  2HKQ B;  3MP8 A;  1PRM C;  1YIJ Q;  2GTO A;  1RAB B;  1TUG B;  5KYW B;  1PNJ A;  4O5V A;  3JCM e;  3LGL A;  2EYZ A;  3X24 B;  4C8Q G;  1UFF A;  1ZA2 B;  1AWJ A;  2X4Y A;  4J9H A;  4AG1 C;  3CCR A;  3OS5 A;  1OU8 A;  2DER A;  2ROT A;  2L5Q A;  4J6W A;  3OYG A;  3CCQ Q;  1VQP A;  2WSF E;  2ZCF B;  3M0Q A;  2QAZ A;  4EMK B;  1S72 A;  4M78 D;  4IUP A;  3G6E A;  1LOJ A;  1YIT A;  1JB0 E;  5GAN 7;  1YP5 A;  4ZTJ A;  2VWF A; 
#chains in the Genus database with same CATH homology
 2DTH A;  5KE3 A;  4PJO A;  4IUR A;  2LCL A;  1VIF A;  2RJD A;  4RMO A;  2YLC A;  2QQS A;  3P8D A;  5GAN j;  5LJ5 j;  5CK9 A;  2IVW A;  3M59 A;  3VYH B;  4EPC A;  3CCE T;  3M54 A;  1OI1 A;  3VUB A;  2ZPE B;  4BD3 A;  4C8Q B;  2FB7 A;  3OYH A;  1K9M C;  3LWI A;  3HHT B;  5A0L A;  4LDX A;  4C0D C;  4A4H A;  3G6E T;  3DKM A;  2KMT A;  1XNI A;  4ELZ C;  3OY9 A;  3CCV A;  4RG8 A;  1H3Z A;  5GAN e;  4Y28 E;  1FX7 A;  1K8A C;  2V8K A;  2KQW A;  2RD1 A;  3JSC A;  3OB9 A;  3R6O A;  4XTZ A;  5GAN 6;  4FM4 B;  2X4X A;  2K3Y A;  4RG2 A;  1VQ8 T;  3MEA A;  3TCJ A;  1VQ6 A;  3BFM A;  5LJ5 d;  4BY6 C;  4JS4 A;  3VKI A;  3OMG A;  1WJQ A;  5GAM j;  1RL2 A;  2DD4 A;  1OZ2 A;  1BI0 A;  1KQ1 A;  1XQH A;  4DOW A;  2ZGW A;  1BYM A;  5C6S A;  4PLL A;  3BW1 A;  4F7U B;  1UGR B;  2XI9 A;  2L3R A;  2LT1 A;  4Q5W A;  3V7S A;  4LDY A;  1Y96 B;  4M7A F;  4PJO D;  3M9Q A;  3JCM g;  3OYM A;  3OYL A;  3NTI A;  4OMF B;  1KD1 C;  2LQ8 A;  4M7A D;  5GMK l;  2GCX A;  4VUB A;  4MZT A;  4LDV A;  3JCM W;  3JRZ A;  2M16 A;  2X35 A;  4RKU E;  1K73 U;  2WAC A;  3UWN A;  2R5A A;  1Y7X A;  4PKC C;  2CS7 A;  2KDS A;  3QG1 A;  4M77 F;  5HKC A;  1KQS S;  2E12 A;  4M7D E;  4M78 C;  4F7U G;  4EMK A;  1BI1 A;  2R57 A;  5GAN 4;  3J81 E;  1VQM T;  1M8V A;  2JZ2 A;  4D6W A;  1VQ4 T;  3HRS A;  2ZPF B;  3MCA B;  3JB9 G;  1G5V A;  1HXD A;  4R56 A;  2RHY A;  2DIQ A;  4M77 C;  4J83 A;  1S72 T;  3BDL A;  3CC4 T;  1DJ7 B;  2X4W A;  3M55 A;  3HFO A;  5LJ3 g;  3SDZ A;  5CCA A;  4F7U A;  1B34 B;  2QEX A;  2LVM A;  3F70 A;  1R8O B;  2CZ6 B;  1FXX A;  1VQO T;  2CZ1 B;  4XTX A;  5L8R E;  3G4S T;  4M78 G;  4RCC A;  2DKG A;  3CCR T;  1Q7Y C;  1VQK A;  3L2V A;  4ZGD B;  1WQ7 A;  3OBY A;  4NOY A;  2EQU A;  3QBY A;  4C92 E;  5LL6 S;  3FDR A;  2G3R A;  4M77 A;  2P4T A;  3SFM A;  3CCM T;  5CKB A;  4LD6 A;  3SD4 A;  1SSF A;  3JCM c;  3QYG B;  1TH7 A;  2V8I A;  2XU8 A;  4PJO F;  2DJZ A;  4F7U F;  4A4G A;  1VQP T;  1U1S A;  2V8J A;  1D3B A;  4QVZ A;  3EFR A;  4N4G A;  1O9S A;  3RKY A;  4BI8 B;  2RJF A;  3OS1 A;  4F7U E;  2LQK A;  3OYN A;  1I5L A;  5A0D A;  1IZ6 A;  3GP8 A;  3S3M A;  3CBO A;  3DB4 A;  1KG1 A;  3GOX A;  2RI5 A;  2DXB A;  5GAM h;  4M75 A;  3NTH A;  3DLM A;  5GAN 5;  3L42 A;  1N9R A;  2DZ9 A;  3M5A A;  1X75 C;  5FU7 B;  1JBM A;  3TEE A;  5DY9 A;  3AHU A;  4IUQ A;  2DXC A;  4BI3 A;  2QTX A;  1VQK T;  3CMA T;  2VGM A;  2GF7 A;  4ZTJ A;  4LDW A;  2QQR A;  3VU3 C;  5M9O A;  5LJ3 j;  1NPR A;  1B34 A;  1Y07 A;  3G71 A;  1VQ8 A;  5DLQ E;  1ZHI A;  2RJE A;  1BI3 A;  4J8O A;  2JNG A;  1UGQ B;  4EMK C;  4HCZ A;  2E65 A;  3OYA A;  1QVG S;  1N8R U;  4JJN K;  4V2S A;  2YHT A;  2QEX T;  3S3O A;  5GAM f;  2EKO A;  4BDY A;  2OTJ T;  3TU4 K;  3UDC A;  3GPL A;  1M1K C;  2DAQ A;  1VQO A;  1QP3 A;  2VUB A;  4NL2 A;  5CKH A;  2KAF A;  4XTW A;  4E7J A;  4E7I A;  1VQ7 T;  4BE1 A;  4ME7 A;  3FEO A;  2K3X A;  4MML A;  2A3L A;  2CKK A;  3CPF A;  1I4K 1;  3ER0 A;  4C5G A;  4ZN1 A;  3QJY A;  3HFN A;  5GAO r;  1O75 A;  3E19 A;  3JCM h;  1Y71 A;  1D3B B;  2QQ9 A;  4M75 F;  3SWN B;  5GAN f;  5GAN 8;  3UPU A;  2K5L A;  2BKD N;  3JB9 D;  1VQ9 A;  3O8V A;  1M9S A;  1W2B A;  5GAM e;  2HNI A;  3FJP A;  4KT0 E;  3CCQ T;  4C8Q D;  4OP0 A;  3CMA A;  4M7D D;  5IN1 A;  3OA6 A;  5J3B A;  3MEW A;  4E7L A;  1M90 U;  3OYC A;  2VYT A;  3VYG A;  4LD9 K;  2CZ0 B;  4C5E A;  4DA4 A;  1Q81 U;  3JCM d;  2L8D A;  1UGP B;  3ZFJ A;  5KCH A;  3N5B B;  3VUZ A;  1NJI U;  1Q7Y U;  1MGQ A;  2OAU A;  3QYH B;  2XG8 D;  1G3T A;  1Y96 A;  3PNW C;  2DXT A;  3V8J A;  2QA4 A;  5CKD A;  1WQW A;  3QKJ A;  2M9U A;  4M75 B;  3OYY A;  5EG2 A;  3FB9 A;  1VQ4 A;  4R55 A;  2QI2 A;  3X20 B;  1QP2 A;  2DD5 A;  3RIR A;  1AHJ B;  3OYI A;  2RHU A;  4BB7 A;  4JDS A;  5HK0 A;  3PT9 A;  3G71 T;  4C0F A;  2K5I A;  2VGN A;  2KY9 A;  4M78 F;  5FRN A;  1KQ2 A;  3PMT A;  1JJ2 A;  3ZBD A;  1PSF A;  3E1S A;  5AYF A;  2EQJ A;  3OSV A;  3T9N A;  4C92 D;  3CCQ A;  2OTJ A;  3I56 A;  2PVD B;  3G4S A;  3OW2 A;  3LYI A;  3M58 A;  3LGF A;  3JB9 I;  3CCL T;  1ZQ1 A;  3M4G A;  3VV0 A;  2RHZ A;  2WSE E;  3C95 A;  3L1A A;  3I55 T;  3JB9 F;  5D6Y A;  1VUB A;  3ME9 A;  3L2R A;  4M78 A;  3RMQ A;  4M7A A;  4NL3 A;  3CCJ A;  2D9T A;  4C92 F;  3CC7 A;  4QQD A;  5GAM d;  4JS5 A;  4M7D C;  2EIF A;  4M77 G;  1WPY A;  5GAO p;  2E10 A;  4HT8 A;  2DPP B;  2O4X A;  3H8Z A;  3HKS A;  5GMK e;  3GIB A;  2RHX A;  1YHQ T;  4PNO A;  3V8L A;  2ZPH B;  3A8G B;  5KCO A;  4Y91 A;  3CCS A;  3CCS T;  3LWH A;  2XDB A;  2XDD A;  4PL6 A;  2JTM A;  5GAN 3;  1BI2 A;  2CZ7 B;  5D6W A;  1VQL T;  1LNX A;  3PTA A;  5LJ5 e;  4L5G A;  2XDP A;  2L89 A;  1YIJ A;  1QW1 A;  1VQ7 A;  4M7A G;  5GMK i;  1XOV A;  4HKE A;  2O01 E;  5DM7 R;  5I2M A;  3QO3 A;  4GY5 A;  2RJC A;  5LJ3 h;  4DOV A;  4C0G A;  4C92 C;  3LH0 A;  2F5K A;  4C92 A;  4CI0 C;  2PQW A;  2F69 A;  3QZ9 B;  2MWP A;  1KC8 C;  2E1H A;  2BIV A;  3GNF B;  4Z02 A;  4BE2 A;  4C0Z A;  3GNG A;  5FLX E;  3H6Z A;  1YBY A;  4JRI A;  3I56 T;  3CD6 A;  3CD6 T;  2E6N A;  3V7R A;  3X28 B;  2NLU A;  1M90 C;  1PSE A;  5GAN g;  3OSS C;  1K9M U;  2QDY B;  2O4X B;  3C4S A;  1I81 A;  1IRE B;  4QQG A;  4QVD A;  1VIE A;  1M1G A;  2M1H A;  2XID A;  3JB9 H;  5IT9 E;  4M7D B;  4OGC A;  3GLX A;  2QA4 T;  3KUF A;  2XK0 A;  2RA2 A;  3MEV A;  2KK4 A;  1N9S A;  4M78 E;  4M75 E;  2KSS A;  3G7Z A;  1K73 C;  2MF2 A;  2PUO B;  1N8R C;  4E7K A;  3RMS A;  1YI2 A;  1YJW A;  2PUK B;  1BIA A;  2MMP A;  2K4Y A;  2QQB A;  4C0D B;  2JUF A;  1VQL A;  2YRV A;  4N4H A;  2GQV A;  2PVO B;  4KUI A;  4A54 A;  2K5F A;  1P92 A;  3OYK A;  4JRQ A;  1JJ2 S;  1YJN A;  4M7D F;  1YJN T;  5CVI A;  3BDU A;  2DTO A;  3X26 B;  4EMG A;  2P0K A;  1U8R A;  3CPW A;  5HK3 A;  2FYK A;  3S6W A;  2FHD A;  4EDU A;  3TRE A;  2VV5 A;  1N6A A;  2DO3 A;  5CR2 A;  2RI2 A;  3CC7 T;  4BY6 B;  2EJF A;  3QUI A;  5CIU A;  2Y4X A;  4L6V 5;  4XU1 A;  2I2L A;  3JB9 J;  1Q81 C;  2EQM A;  3Q1J A;  4C5H A;  3MEU A;  3JCM Q;  4HCC A;  1UEB A;  3L2Q A;  3CCL A;  1YHQ A;  2VXE A;  1G3W A;  5CO7 A;  3HRU A;  2B8A A;  3JCM V;  3I55 A;  1MHN A;  3C94 A;  2FVU A;  2LC4 A;  3OYE A;  3QJ6 A;  3FRN A;  2RHI A;  3HP9 A;  3RES A;  4A4E A;  3OYD A;  5J26 A;  4E7H A;  1W2B S;  2C06 A;  4C8Q A;  4A53 A;  4M7D A;  3CEY A;  1V29 B;  4L59 A;  1UB4 A;  4O6J A;  3SWN A;  4C8Q E;  2RK1 A;  4OB2 B;  3GF5 A;  2LT4 A;  3MP6 A;  2YLB A;  3CBP A;  4N0A C;  5LJ3 f;  3SB2 A;  4HA8 A;  4ZN3 A;  3FLG A;  3QPH A;  2RH2 A;  1QVF A;  3RER A;  5KH6 A;  3VJP A;  2DXU A;  4JRK A;  5HY6 A;  4M78 B;  1YJ9 A;  4C8Q F;  1Q82 C;  2RO0 A;  4M75 C;  5FU6 B;  4J7I A;  3CPW S;  1YIJ T;  4M7D G;  4XK8 E;  1WJR A;  3CC2 T;  4DQ2 A;  3C12 A;  5CAI A;  5J39 A;  1VQ5 A;  3QSU A;  2EYQ A;  4BAC A;  3CXC S;  2FL7 A;  1Q82 U;  1VQ9 T;  1NE8 A;  1Q86 U;  2ZPG B;  2QQA A;  2VXF A;  2HQE A;  3M4Y A;  3QHS A;  4QW2 A;  3EAE A;  3PIO A;  3CME A;  4XU2 A;  3MP1 A;  3RUX A;  3DLL A;  1OYX A;  2LX9 A;  3A5Z B;  4PLI A;  3M53 A;  1H64 1;  3CCU T;  2OTL T;  4IUV A;  4IKF A;  5A2Q E;  4MDX A;  4XQ3 A;  4II1 A;  4GLK A;  1G3S A;  1W4S A;  2DK3 A;  4M7A B;  2JVV A;  4BE0 A;  1YI2 T;  1YJW T;  4HT9 A;  4YTL A;  3OMC A;  4HCB A;  1K8A U;  5CQY A;  5I2S A;  3A8L B;  5GAN 2;  4M75 D;  2XIC A;  5IAY A;  4IUU A;  1YJ9 T;  2Y90 A;  1HK9 A;  4OVA A;  3V7C A;  5A0G A;  4ELY C;  2RI3 A;  3JCM X;  5GAO q;  4BI4 A;  3WVE B;  1M4Z A;  1BKB A;  3CBM A;  3FIF A;  4XAX B;  3URG A;  3HL8 A;  2E6Z A;  4XTY A;  1M5Q 1;  5LJ3 d;  2LCC A;  3PMI A;  1VQ5 T;  2OTL A;  4TVR A;  1WGS A;  3CCJ T;  4QVC A;  2EWN A;  3NFC A;  4FT2 A;  2HD0 A;  2R5M A;  3INZ A;  3MET A;  2P0P A;  3A8M B;  2EJ9 A;  3QZ5 B;  5C0M A;  5KE2 A;  3X25 B;  5FRM A;  4M75 G;  1KQS A;  1XTD A;  2MI6 A;  1QVP A;  2JOY A;  4EMH A;  4XTU A;  1YIT T;  1X01 A;  2D6F A;  4E47 A;  3JCM f;  3WVD B;  3ZEH A;  4N0A A;  3OQ5 A;  5LJ5 f;  4XU3 A;  1KHI A;  2RB6 A;  2Y4Y A;  3A8H B;  4FIB A;  1KD1 U;  5CKE A;  1GXI E;  5FU7 C;  3SWN C;  2ZZD A;  2K2V A;  1KHC A;  3OYF A;  4KBM B;  4X9C A;  2P0Q A;  3KXT A;  2M0O A;  3RKX A;  2IG0 A;  3OS2 A;  1OZ3 A;  5GMK h;  2A7Y A;  3UT1 A;  3OW2 S;  2WSC E;  2MWO A;  1UGS B;  1ZBX A;  1RI0 A;  4RCB A;  4NS5 A;  3L2W A;  2ZPB B;  3MHX A;  1NJI C;  2HBP A;  1LJO A;  2DTI A;  3PGG A;  3CXC A;  1KC8 U;  2E70 A;  3L2Z A;  3PFS A;  2JTF A;  3S3N A;  1WNL A;  2K57 A;  2RK2 A;  4J6Y A;  3JCM b;  1I8F A;  5GMK j;  3JAM E;  3KBG A;  2E41 A;  3LW5 E;  5D6X A;  3CC4 A;  3LLR A;  5GAO l;  5GAN h;  3OS0 A;  1N27 A;  4PJO G;  2CYZ B;  3M56 A;  3JCM J;  4JRP A;  4WF2 A;  2D0Q B;  4JLG A;  4N4I A;  1BIB A;  2QXF A;  3P8H A;  4P5N A;  4PJO C;  4OF1 A;  4XTV A;  4ZGE B;  3MO8 A;  1M1F A;  3V8K A;  5CQX A;  3OYB A;  3L2U A;  1M1K U;  3CCU A;  2X4J A;  2XKO C;  3CCM A;  4LDU A;  5GAO n;  4FU6 A;  4MZP A;  4A4F A;  5LJ5 g;  1WJS A;  4ZTF A;  4J5Y A;  2LNV A;  2F5T X;  3DB3 A;  3NTK A;  5I21 A;  4BUG A;  2EQK A;  2XD0 A;  4M77 B;  2PVG B;  2ZPI B;  3E9F A;  4X9D A;  3WXM B;  2HQX A;  3J80 E;  5GAM g;  2HAX A;  3MP8 A;  4B9X A;  4J7F A;  4FSX A;  2LDM A;  4ATO A;  1NZ9 A;  2LRQ A;  2MAM A;  2DVE A;  1VQN T;  1VQN A;  4M77 E;  3CME T;  3HSB A;  1X6O A;  2R58 A;  5FU6 C;  5LJ5 h;  4O5V A;  4QQ6 A;  1U1T A;  4FT4 A;  4JUV A;  3A8O B;  3JCM e;  3HPW A;  5GAN d;  4BDZ A;  3ASK A;  1VQ6 T;  3LGL A;  3X24 B;  4C8Q G;  2DEQ A;  4M77 D;  3JCM P;  5DLO A;  4X34 A;  3BY7 A;  2CGH A;  2DIG A;  2BUD A;  3CCE A;  2GFA A;  2X4Y A;  2EJG A;  3LX7 A;  4IUT A;  3E9G A;  4JLI A;  3CCR A;  4KUL A;  3OS5 A;  4M7A E;  1YCY A;  3OYJ A;  4MDW A;  2EAY A;  4PJO B;  3HRT A;  3FC3 A;  2E5Q A;  4C8Q C;  4CRI A;  4KUD K;  5FRO A;  4C5I A;  1FWZ A;  2DZC A;  4OB3 B;  2L5Q A;  3QII A;  4C92 G;  4J6W A;  3CCV T;  3OYG A;  4UC4 A;  1JRI A;  1VQP A;  1QVG A;  2PU9 B;  2RM4 A;  2WSF E;  4FL6 A;  4OB1 B;  5GAO m;  2ZCF B;  4J6X A;  3EFS A;  4OB0 B;  4PJO E;  4M7A C;  5GMK m;  3CC2 A;  1G3Y A;  4B9W A;  2VC8 A;  4EMK B;  2E64 A;  2XHC A;  4M78 D;  4IUP A;  4C92 B;  5LJ3 e;  1S72 A;  3J7A F;  1Q86 C;  3G6E A;  4OGE A;  3RKW A;  3OBW A;  3QXE B;  3M57 A;  4MZM A;  5CKF A;  1VQM A;  2KVQ G;  1LOJ A;  4XU0 A;  1QVF S;  2EFI A;  4ZGJ B;  4A4K A;  2JN0 A;  1YIT A;  1JB0 E;  3PIP A;  1EIF A;  3QDR B;  2LTO A;  4MMK A;  5GAN 7;  3P8B B;  2GFU A;  1NPP A;  2AHJ B;  2H3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...