2HQXA

Crystal structure of human p100 tudor domain conserved region
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
TQFQKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFSTRVLPAQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P100 CO-ACTIVATOR TUDOR DOMAIN
publication title Crystal Structure of Human P100 Tudor Domain Conserved Region
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
A PF00567 TUDOR Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2hqxA01
2RJEA 5C0MA 3P8HA 4BDZA 2MWPA 2BUDA 2XDPA 4C5EA 4ZTFA 4BDYA 2GF7A 2HQEA 4RG2A 2R5MA 2O4XA 2X35A 3LGLA 3UWNA 4BE1A 1XNIA 2RO0A 3O8VA 4X34A 4A4GA 3QKJA 2F5KA 3L2VA 3ASKA 5FROA 4IUVA 2FHDA 2M0OA 3ME9A 2JTFA 4C5GA 5FRNA 2P0KA 3DLMA 2BIVA 2E6NA 2RJCA 2EKOA 2CKKA 4N4HA 2RJDA 5M9OA 3OYFA 2R5AA 4PLIA 2EQJA 4N4GA 5C6SA 4FL6A 2QQSA 2RJFA 4CRIA 3QIIA 1KHCA 1WJQA 3H8ZA 2XK0A 3OYCA 4IUPA 3LH0A 3PNWC 3OS1A 5J26A 2EQKA 3S3MA 2IG0A 2RHYA 2YRVA 4GY5A 4B9WA 4QQ6A 4L59A 3OYJA 5CIUA 4QVZA 2LVMA 4A4EA 3OYNA 2VYTA 3OA6A 3LGFA 3SD4A 5KCOA 3NTHA 3OYBA 3OYAA 2X4XA 2BKDN 5D6XA 3MP8A 3M9QA 5KH6A 3CEYA 2EQMA 2M1HA 1SSFA 3H6ZA 4IUQA 3MO8A 4QQGA 4QW2A 2NLUA 1OZ3A 3LYIA 3L2UA 4PLLA 2K3YA 2L89A 3MP1A 3PMIA 3S3OA 2RHZA 3EAEA 2QQRA 2WACA 5IAYA 2M16A 3FLGA 2JZ2A 3LX7A 2RI5A 4BE2A 4E7KA 3MEVA 2RHUA 3META 1RI0A 2LTOA 5KCHA 3QBYA 3Q1JA 3NTKA 3OMGA 3OYMA 4E7LA 2B8AA 3L2RA 3OYEA 4HCZA 4C5IA 2O4XB 3NTIA 3OS2A 4IURA 3OYIA 3E9GA 3DB3A 5D6YA 2EQUA 4NS5A 1WGSA 4IKFA 5KE3A 1H3ZA 2RI3A 1WJRA 4IUUA 5D6WA 4PL6A 3BDLA 2LRQA 4C5HA 2D9TA 3KUFA 3OS0A 2R57A 3P8DA 2HQXA 5FRMA 2L8DA 2LDMA 4N4IA 3FC3A 2GFAA 4UC4A 4E7HA 2G3RA 3OYDA 4QQDA 4IUTA 1OZ2A 3FDRA 4BD3A 3OY9A 4E7IA 2DIQA 4A4HA 1G5VA 3ZEHA 3OB9A 3UT1A 3PMTA 3OYLA 4ZTJA 3F70A 3E9FA 5KE2A 3LLRA 2RHXA 1MHNA 4LD6A 4Z02A 2K3XA 4A4FA 4BE0A 2DAQA 3S3NA 3OMCA 3MP6A 1OYXA 2LCCA 3FEOA 4E7JA 3OQ5A 3S6WA 1WJSA 2E5QA 2RHIA 2X4YA 3L42A 5IN1A 3OYGA 2X4WA 3L2WA 3OYHA 3L2QA 4B9XA 3GOXA 4OVAA 4Q5WA 3PFSA 2L3RA 4EDUA 1N27A 5J39A 4BACA 2DIGA 2R58A 3QJ6A 4II1A 2MWOA 3MEWA 3MEAA 1OI1A 3MEUA 4FU6A 2GFUA 3OYKA 3C4SA 2EFIA 2RI2A 2PQWA 3DB4A
chains in the Genus database with same CATH superfamily
2O31A 3A8HB 3E19A 1N9RA 4C5EA 5LJ5g 3CC2A 1X43A 3RKXA 1QMCA 1KQ2A 2LQ8A 1X75C 3C95A 1PWTA 5FROA 2CP7A 2KDSA 4JZ4A 4L6V5 3VRZA 1D1CA 5FU7B 1M1GA 3VKIA 2FL7A 1C0MA 3CPWS 2ZPBB 1IGQA 3CBMA 2QTXA 5GAN8 2FVUA 1PC0A 1PD1A 2YRVA 3TEEA 1M8VA 4EMHA 2E10A 3I55T 2VYTA 3CCRT 3CPFA 1RAAB 3URGA 5KYYB 2BKDN 2RQVA 3CEYA 1TUDA 3MO8A 2M51A 2YWWA 3M55A 1BI3A 1VIEA 2L89A 4FSXA 5IHNA 5LL6S 3CCLA 4M7DB 3ER0A 4XTZA 8ATCB 1B7TA 1MV0B 2DFUA 3GNGA 5IXFA 4HKEA 4C5IA 3R6OA 4PJOE 4M7DD 4IURA 3RR6A 1WGSA 4IKFA 4AFUC 1EIFA 1WJRA 4M7DF 1VQ9A 4JS5A 3RKWA 2FZCB 3EFOB 3H9NA 1KG1A 1YN8A 1XJWB 1IB8A 4UC4A 1AHJB 2IPOB 1QVFS 4BD3A 1M2OA 1YJ9A 3PIPA 4KGZB 1KHIA 1BK2A 3VYHB 3V7RA 2CZ6B 1H92A 2X51A 2LT1A 1AT1B 2EGAA 1YJNT 2V1QA 5GAOm 3GNFB 1QVFA 2DTOA 2QYZA 4C92C 1BCMA 1QWFA 3VS5A 2V8KA 3WXMB 2J6OA 3ZFJA 3I56T 2EW3A 1NE8A 1KK7A 3JRZA 4BDZA 1M9SA 3CD6Q 1VQKT 3SDZA 2O4XA 3I5RA 3LGLA 4BE1A 4ANJA 3BFMA 1M90R 2RO0A 1BBZA 1NPPA 1QP3A 4E7SA 1PG5B 2DL5A 2HNIA 1K8AR 2MI6A 3CCUT 3OS1A 2EQKA 4GY5A 1AWOA 1J3TA 1X01A 2D6FA 2PUKB 4AFZC 3OYBA 1WPYA 3OYAA 5GAMd 2RQRA 3M9QA 3BE3A 1PHTA 2F2XA 3JCMJ 1BB9A 4AFQC 4ATOA 1IO6A 3PE0A 2HBPA 3JB9G 2AHJB 5GAMe 3VRYA 2DA9A 3CC4A 3QYGB 2EBPA 5GAN2 4MDWA 2DM1A 2RPNA 2LQKA 3GF5A 2XDBA 4BUGA 3G4SQ 2BE7D 4JLIA 2PZ1A 2K4YA 2C0OA 3OYIA 2DILA 1SKUB 4RG8A 1N8RC 4FCYA 1UFFA 2E5KA 2DRMA 1ZUUA 3A1PA 4C5HA 4EMGA 2HQXA 1WQWA 1ZSZB 2LDMA 4N4IA 1G3TA 2G3RA 4OF1A 5GMKi 4HT8A 4E7IA 2JJ9A 1JXOA 2E41A 3OB9A 4A4HA 3LLRA 1RAHB 4LN2A 2DO3A 2DAQA 3SEMA 2DERA 2LCCA 3M54A 4KH0B 2KSSA 4XU0A 4KT0E 5A2QE 2KT1A 4PJOD 2KVQG 1QLYA 1YCSB 2WSCE 1RADB 1K1ZA 4E7KA 4FT2A 1KD1R 5KYUA 1GL5A 2K5IA 4ZTFA 4BDYA 5LJ3f 3CC7A 2LT4A 1PD0A 4GBQA 1H641 2OJ2A 1WXTA 1K9MR 2MPXC 5CKEA 1F1BB 2YRDA 1VQPA 1W6XA 1WX6A 1BI1A 2E64A 1BIAA 1ZUYA 3OA6A 4E7ZA 4M75E 3CBPA 2ZPEB 2DZCA 1MMAA 5GANd 3CCUQ 3VS0A 1YITT 5A0LA 2KRNA 4HVVA 2KYBA 4PLLA 2E65A 3KXTA 2VXFA 2A08A 4DEXA 5GANe 2EWNA 2KGTA 1K9AA 4CC7A 4FT4A 3L2ZA 2LTOA 4V2SA 4JJNK 1OX9A 4FYWB 2V8JA 3JCMf 2C06A 3X24B 3OS2A 4RTVA 3CCVQ 2DJQA 4YTLA 2D0QB 4MMKA 3OBWA 2RI3A 4IUUA 1M3BA 5GAN5 5HKCA 3CCMA 4F7UE 2LMJA 4OGEA 3BDUA 4M7AG 4GLKA 4OP0A 3HRUA 1JB0E 1NG2A 1K73R 4KRTA 4KH1B 2QEXQ 5KYYA 2JS0A 1TTHB 4A4FA 3G71A 2K3BA 1VYVA 1UHCA 5GAMj 1BIBA 3FEOA 1YJWT 4C8QG 5GMKm 1EZZB 2KRSA 4M7DA 3LWHA 1JEGA 1FX7A 2EIFA 2QA4T 2ABLA 1D09B 3MEAA 4EIKA 4OB0B 5I11A 1PKSA 2D0NA 4BY6C 3FJ5A 1UJYA 1E6GA 5CKHA 3EHRA 3LH5A 2OTLQ 2KQWA 2J7IA 2Y4XA 4RUGA 3AHUA 4KGXB 1Q82R 3EFOA 3UATA 3JCMb 3V8JA 1Y7XA 3SHWA 3JCMV 1BYMA 6AT1B 2A3LA 2JTMA 1WDXA 1M1KC 3SD4A 1VQPT 2X4XA 2M02A 2M1HA 3V7SA 3RKYA 2FG0A 1WNLA 2K3YA 2AKLA 2LJ3A 4C0DB 3A8MB 4ZN3A 3ULRB 2RN8A 4BE2A 1RI0A 3O5ZA 4M75B 4Y91A 5I2MA 4LD9K 5FU6C 1GCQA 1S72A 1OU9A 2JXBA 1TS9A 1WQ7A 2ZPFB 4HCZA 2DL4A 2CYZB 5I21A 3CQTA 2E70A 3SWNC 3V8LA 3QG1A 4M7AC 4M75D 5GAN4 5D6WA 3BW1A 1QCOA 3HPWA 4XTUA 2VGNA 3HKSA 3KUFA 3OS0A 2CP0A 5FRMA 4M75F 2COZA 2P4TA 4JLGA 2B86A 2A0FB 1ZX6A 5HCKA 1WIEA 2VGMA 3ZEHA 3M0PA 4KGVB 4C8QC 3CCMT 3F70A 4JDSA 5L23A 1UJ0A 2CREA 1M90U 1JJ2P 4JUVA 4HCKA 4RTTA 2YUNA 2X4YA 5GANj 4F7UB 1LOJA 4J6XA 3OYHA 2JOYA 2OAWA 2KR3A 1K8AU 2MAMA 4FU6A 1SRMA 2RI2A 1WXBA 1R77A 4LUDA 4C92E 1VQMT 2QGGA 4F7UF 1MV3A 3O8VA 3EG9B 1VQ4T 3SFMA 2FHDA 3CPWP 3E2UA 2I2LA 4BI3A 3FIFA 1ZSZA 2FRWA 2R5AA 5GAMh 4LUEA 2DK3A 4AG2C 4M77G 2D1XA 1I5OB 4HVUA 4J8OA 2GBQA 2LC4A 3X28B 4OMQA 3A8GB 5CQXA 4BI4A 3OYNA 2PVOB 4M77D 3T9NA 4M78B 2GNCA 2EJGA 1T0JA 3CCET 4QQGA 3CCSA 2K7AA 3EH2A 3CMEQ 2EVRA 3EGDB 3M0TA 5GAMg 2LJ0A 1KC8R 2LNVA 5CK9A 3META 3E1SA 2PTKA 9ATCB 4M78F 1QQJA 1PSFA 2EYXA 2DX1A 1H3HA 1H3ZA 1QCFA 4X9DA 3JCMc 1NM7A 1S72T 2NUPB 1UB4A 3JCMQ 4CC3A 4PKCC 2H3EB 2RNAA 2BTTA 2MF2A 4E7HA 1IREB 2ZAEA 3KFVA 4JJDA 1U8RA 1KD1U 3G6ET 1AZEA 3QXEB 1MNEA 2ZGWA 2MCNA 3IQLA 3G4SA 1MMGA 1RUWA 4NL2A 1XTDA 5AT1B 4QT7A 1K9MU 1QVPA 2GCXA 1M3CA 2DIGA 1VQLT 1WYXA 4R56A 1Y71A 3TSWA 2XDDA 1Q95G 2M0OA 4JRQA 2AIRB 1Y07A 3U23A 1W2BS 4XTWA 1MGQA 1JU5C 2BZ8A 1BU1A 3A5ZB 4K11A 4LDWA 2KBTA 2KYMA 1YIJQ 1I5LA 2CZ7B 4IUVA 1OPKA 2HBWA 3HL8A 1AOJA 2RMOA 5GANh 1SRLA 2K5LA 8AT1B 2C0IA 2OTJQ 1T3LA 1YHQQ 3QJYA 1TXQA 1VQNA 1I0CA 2EYZA 3KBGA 2FPDA 1IHWA 1JJ2A 1BI0A 5KH6A 4C92D 3HTRA 4OMNA 4IUQA 1VQ6Q 4QW2A 3LYIA 4J7IA 3ZL7C 1FYNA 1UDLA 5GANg 2KRMA 3FLGA 2JZ2A 1K73U 3OYYA 3X26B 3M56A 1GCPA 3Q1JA 2YLBA 2WSFE 3CPWA 1V29B 4FSSA 2MOXA 4XU1A 1WA7A 3M0UA 2D9TA 1WZOA 2R57A 3I35A 1CSKA 1Q7YC 2GFAA 4RCCA 1AWXA 4D8KA 3CMAQ 4A4KA 3UT1A 1PRMC 3E9FA 1NYGA 2QG9B 1NJIU 1KIKA 2JN0A 1NZ9A 3CCVA 1M30A 1SG5A 3NFCA 3CCQQ 5FLXE 3AT1B 5LJ5f 3FJPA 1Q82U 4MDXA 1YCYA 2CUDA 2EJFA 4MZTA 1OQKA 2EYYA 2MWOA 3CBOA 2HL3A 4M75A 3DB4A 3L1AA 2HCKA 1YWOA 5GMKe 2QEXA 1VQ8T 2DYIA 3TREA 2JUFA 2VUBA 3JCMX 5GAOq 3JCMW 2EKHA 3ME9A 1VOMA 2P0QA 1VQOT 3D7SB 3DLMA 1WFWA 2EKOA 2CKKA 1N8RR 2KK4A 3QIIA 2P4RA 2KT8A 4ZGJB 2RHYA 2HKNA 2DL7A 3HHTB 1Z9QA 2YRCA 4A4EA 3BY7A 4ORZA 1YI2T 4F7UA 2OTLA 1Q86U 2EQMA 2DTHA 3EHQA 1VQNT 2NLUA 4N0AA 4QVCA 3CC2T 2JVVA 1ACMB 2HSEB 2O88A 1RL2A 3JCMP 1WHMA 4QKUA 2NUTB 5GJVB 1I8FA 4XU3A 1PRLC 2RD1A 3EG9A 1AZGB 2K5FA 4HCBA 1HSQA 1TG0A 2EQIA 2CH4W 2EQUA 4RKUE 3GBQA 4Z88A 2DL8A 3I55Q 3CCRQ 5GAOr 1OV3A 4IIMA 2DMOA 2KXCA 2KEAA 4NOYA 2DXUA 2DIQA 4X9CA 4ZTJA 3OYLA 4M7AE 5CCAA 4M78A 4AMCA 4FIBA 3CCLT 4O5VA 3JB9D 2L2PA 5CQYA 5CR2A 5IN1A 3EGDA 3A98A 4IIOA 3QUIA 4PJLA 3MPUB 2DEQA 1ABQA 4C8QE 2XD0A 5GAN7 2LZ6B 4AG1C 4J9EA 1EFNA 1OI1A 3OYKA 1Q81U 4LDYA 5C6SA 2PUOB 2XDPA 2EJ9A 3HFOA 4C0ZA 1VQ9T 2VB6A 1YBYA 2R5MA 3UWNA 4PJOB 5ECAA 4X34A 3NGPA 5EG2A 3G7ZA 5FRNA 1EX4A 2NUPA 1YJ9T 4EMKB 1D1BA 1QCNA 4ESRA 4FYXB 1KC8U 2LJ1A 1YJNQ 4PJOF 3S3MA 4FM4B 2ZZDA 4OMOA 3OYJA 3QWYA 3NTHA 1S1NA 2CP6A 1ZSGA 3MP8A 2VC8A 3I56Q 2XICA 3C12A 2PU9B 4BY6B 2Z0WA 4JJBA 4DOWA 1VQKQ 5GMKj 3QDRB 2QQ9A 2V26A 4F16A 4F17A 4MZPA 2KY9A 2ED1A 1K76A 2HSPA 3M4YA 1PKTA 2RI5A 4DBHA 1GCQC 2DE0X 1WHLA 4LNPA 3NTKA 1LJOA 3RNJA 2H8HA 1OPLA 1M1FA 3QZ9B 1A0NB 1QW1A 1UGVA 1Y0MA 5D6YA 3R6NA 2SEMA 2ZPGB 1SSHA 5DY9A 3CMEA 4ZN1A 2M9UA 2HKQB 1XQHA 1VA7A 3PMTA 3MKDA 2ROLA 4OMPA 2EYWA 4Z02A 5HK3A 2E3HA 3CC4T 1WJSA 2RHIA 3L42A 3JB9J 3L2QA 1VQ5A 1I81A 1WHHA 3M0RA 1CKBA 3CCJA 1VQ7A 2HL5C 2CSQA 3SWNB 1G8XA 4XQ3A 5IHKA 3MEUA 1VUBA 2DRKA 5CKBA 2IIMA 1WHKA 2YDLA 2HQEA 1HK9A 4PK4A 1LCKA 2VVKA 4DA4A 4M7AD 1C1AA 3H0FA 1ZSZC 4RMOA 2A28A 2CP3A 5M9OA 1G2BA 3JB9I 5IT9E 2K57A 1SPKA 1QVGP 3M59A 4C8QD 3OYCA 2QDYB 2KAFA 1R0CB 1SEMA 1DJ7B 2O9SA 4M77E 1WLPB 1NJIR 1JBMA 1C6VX 4OGCA 2DXTA 2DETA 1YIJA 2NYSA 2DNUA 1W70A 2YUOA 3CC7T 2BZYA 4J9FA 1HD3A 2EYQA 3VUBA 2QQAA 5CKFA 2CH4A 4P5NA 1TWBA 2O01E 2RK1A 3VS2A 2OTJA 2HD0A 1YHQA 1YP5A 2Y4YA 3RESA 1UGSB 1K0XA 3L2RA 3MCAB 1PM3A 2J05A 4JZ3A 1NEGA 1VQ6A 5KE3A 4CI0C 3BDLA 4FW1A 3V8KA 3EG2A 2L3SA 4ZGDB 4OB1B 2DD4A 1B34B 1RAFB 4QQDA 4B6MA 1YITQ 5GMKh 2DVJA 1G3YA 1UGRB 2FB7A 3OMCA 1KQSP 1MNDA 1Q86R 1UGQB 4RCBA 2RK2A 2ZPIB 3L2WA 3GIBA 3QO3A 2CP2A 2NUTA 1W2BP 4II1A 1N8RU 1U1TA 2PVDB 2EFIA 3EFRA 3M58A 2RJEA 1VQ5T 2J6FA 3CMAA 2CUBA 2JNGA 4CC2A 1D0XA 3CCJT 3GLXA 5LJ3d 1VQ7T 1E6HA 4QVDA 1I07A 1RAEB 3UA6A 4J9DA 1UGPB 3JB9H 1TH7A 3ASKA 1OX8A 2LX7A 4DOVA 2JTFA 4C5GA 1WHGA 1OEBA 5LJ3e 1ZQ1A 1UECA 2V1RA 1HYOA 3OYFA 3G71T 2EQJA 4N4GA 2QQSA 2DBKA 1IRXA 2FZGB 1KHCA 2QK0A 1YJWQ 2ECZA 5J26A 2EPDA 3G1JA 5CO7A 4B9WA 1KQ1A 4QQ6A 2COYA 4F14A 2YHTA 2CT4A 2QA4Q 4F7UG 3H6ZA 5L8RE 2C0TA 2CGHA 1FXXA 3S3OA 2L5QA 2J6KA 2QAZA 2K2VA 2M16A 4M77B 3A8LB 1Q81R 1Y57A 4PJOA 3OSSC 1UUEA 3CC7Q 3CD6A 1QVGS 1ZA1B 3VYGA 3JCMd 3OYEA 7AT1B 2X4JA 4EMKA 2Y90A 1GRIA 3E9GA 4WTOB 1O9SA 3N5BB 2DL3A 2EGCA 1YWPA 4M77F 4JRKA 3J81E 1E7OA 1QVGA 3JCMe 1X27A 1VQPQ 1HJDA 1MMDA 3V7CA 2VASA 2YXYA 4HCCA 1QP2A 2YT6A 3EG1A 1IZ6A 4A53A 4J6WA 1RABB 4M78G 2XU8A 1FMWA 4J9BA 1M2VB 2FEIA 3H0IA 4EPCA 1BKBA 4M4ZA 3HRSA 3ZBDA 3I55A 3CCRA 2GFUA 4F04B 2RA2A 1HXDA 1B3QA 2SRCA 3M0QA 3QKJA 2QDLA 2QGFB 4PJMA 4N4HA 3CCMQ 1KQSS 2ROTA 4LXCA 3C94A 4CRIA 2DD5A 5AYFA 1M8MA 4J9CA 3OBYA 4IUPA 2ENMA 5I22A 1LVKA 2O2OA 2XMFA 4X1VA 2JM9A 3X25B 1ARKA 5FW9A 4FW2A 1KQSA 4Z8AA 5GAMf 4N0AC 1IHVA 3RERA 2HEQA 1SSFA 3I9QA 1KJWA 5DLOA 2JS2A 3SWNA 1W2BA 1MMNA 2P84A 4DQ2A 1O75A 1VQMQ 2QQRA 1VQ4Q 2OAUA 3RMSA 4C92B 4LDUA 3HP9A 4R0KA 1MUZA 5LJ3j 2J06A 1U06A 1FMVA 3I56A 1ZBXA 2DEUA 4FYYB 3CD6T 1M1KU 1SHGA 2YUQA 4ME7A 1VQKA 3GP8A 1TOVA 3M53A 4C92F 3REBB 3VJPA 3JV3A 2L8DA 3VS7A 2GTOA 4AFSC 3CCST 3VS3A 2W0ZA 4M78C 3CCEQ 2LP5A 4WF2A 4LD6A 1YNZA 1JXMA 4XTVA 1XOVA 3MP6A 3OS5A 2HZYA 2QXFA 2XG8D 4L5GA 2E5QA 1D3BB 3CCUA 2VV5A 4Q5WA 3RUXA 5A0GA 4FYVB 5J39A 4NL3A 2K2MA 1IGUA 1M3AA 2RQTA 1QKWA 1X2QA 2DPPB 5GAOp 2F1LA 2GQIA 3P8HA 1WHJA 3QWXX 1Z9ZA 1JRIA 1R0BG 2DBMA 2COWA 4RG2A 2HQHA 1S72Q 3FB9A 4J9HA 2DKGA 4RTXA 2DXCA 1D0YA 2BIVA 1NLPC 5GAOn 2V8IA 2RJDA 3VS4A 3G6EQ 1SHFA 2BE9B 3PIOA 4J83A 1X6GA 1B34A 3G4ST 4M7DG 2PVGB 3H8ZA 5GAN3 2K9GA 3QSUA 2PNIA 1ZHIA 1UE9A 4JRIA 1VQLQ 5D6XA 5GANf 4C0GA 2A37A 4A54A 3CXCP 3TSZA 2EAYA 1OZ3A 3L2UA 2H3JA 4PFOA 1PCXA 3P8BB 2MMPA 4XK8E 5J3BA 2YLCA 4J6YA 1QWEA 2QI2A 3TQ7P 3M5AA 4O6JA 3PVLA 3THKA 4CC4B 4D8DA 4J7FA 1CKAA 1RI9A 2O9VA 5FWBA 2D8HA 5GAOl 1U5SA 4HA8A 2RF0A 4LDXA 4JPBW 2LQWA 2GTJA 5DLQE 1OZ2A 2LX9A 3EFSA 3OY9A 2XI9A 1T0HA 2CP5A 2CDTA 4VUBA 4BE0A 3REAB 3VS1A 5FU7C 2NUZA 1TUCA 2KMTA 3CCSQ 5LJ3h 1TSFA 4J9IA 4MZMA 2KI7A 2CZ1B 2YSQA 4M77A 4J9GA 1OU8A 3MEWA 4OMLA 4AT1B 2PQWA 5C0MA 1YITA 2MWPA 2BUDA 1VYUA 2E6ZA 4JS4A 2AKKA 1LPLA 3LWIA 1NEBA 2BZXA 2HAXA 2E6NA 2ESWA 2RJCA 2NWMA 4M7DC 3UPUA 5LJ3g 3JB9F 1YFNA 3A8OB 5GAN6 4PLIA 4FL6A 2RJFA 4BI8B 3DLLA 5KYWB 3CCVT 2XK0A 1H8KA 3PNWC 2EGEA 4Z89A 1Y96B 2LCLA 4L59A 4TVRA 1M2VA 1N6AA 2E3IA 2RH2A 2KNBB 5KYXB 5CVIA 2QEXT 3X20B 1VQ8Q 4KBMB 3JCMh 1ZA2B 1X69A 4ELYC 2DJZA 2HMAA 4XTXA 1YJWA 3LX7A 4ZGEB 1VQOQ 1M90C 2P0PA 3GPLA 4PJOG 1GXIE 3OMGA 1TU0B 2CSIA 1OOTA 2DLPA 2QA4A 4JRPA 4A63B 1K8AC 1R8OB 4NS5A 4PL6A 2IVWA 3CXCS 3JCMg 2F5TX 3NMZC 3P8DA 2OTLT 1YI2Q 2DZ9A 3EGXB 2LCSA 2DVEA 1VQNQ 4KULA 3OW2P 3CC2Q 5KE2A 2RHXA 2DF6A 3S3NA 3H0HA 2JTEA 3CXCA 3S6WA 4KUIA 3TVTA 2X4WA 4PFZA 5LJ5d 2KROA 2MYSA 3PFSA 2L3RA 4HVWA 3OSVA 4C92A 2F69A 2VKNA 1U3OA 4XAXB 3FRNA 5LJ5e 4PJJA 2X35A 1Q7YU 2AT1B 1ABOA 2KE9A 1T3SA 4OB3B 1B07A 1NBEB 2F2WA 5FWCA 2QQBA 1M1KR 2ED0A 5IXBA 5FU6B 1WI7A 2YUPA 2ZCFB 3PT9A 2LQNA 5I2SA 3CCLQ 2X9HA 2XIDA 3LH0A 4M7AB 1RLPC 3RIRA 3JSCA 3HSBA 2IG0A 4RTWA 3PVQA 1D1AA 1X6OA 1RLQC 1UG1A 3LGFA 1AWWA 5KCOA 1D3BA 3QPHA 3WVEB 1M5Q1 3EH1A 4C8QB 2I0NA 3MHXA 1I4K1 3VS6A 1VQ9Q 3PMIA 4M7AF 2RHZA 3EAEA 1KD1C 4PJOC 4C0FA 1V1CA 2RHUA 4Y28E 3LW5E 1M4ZA 5D7UA 1YJ9Q 1BCOA 3JAME 4EMKC 5CAIA 2L0AA 2OI3A 4E7LA 4C8QF 1K9MC 1AD5A 3NTIA 5GJWB 3DB3A 5GMKl 1OULA 2XHCA 1N9SA 3WVDB 4PJNA 1VQMA 1BI2A 4RTUA 2E12A 3RMQA 4R55A 2E1HA 3FC3A 1VQ4A 2CZ0B 3FDRA 4J5YA 1G5VA 2RB6A 3PTAA 3M0SA 4PFPA 2QTVA 2AZSA 3QDFA 3UA7A 2X3XD 2ATCB 4JJCA 4M78E 2JM8A 3EGUA 4LDVA 4EDUA 1N27A 4DBRA 1GFDA 1W4SA 3J7AF 2JW4A 2DTIA 1ZUKA 3HFNA 3CCEA 3CMET 2GF7A 1RAGB 1UHFA 1XNIA 1NLOC 5HY6A 4A4GA 2F5KA 3OW2S 4HT9A 3MJXA 2HDAA 5A0DA 2VWFA 1N5ZA 4DBFA 2W10A 2GGRA 1K73C 1X2KA 2LNHB 1WJQA 5EC7A 3QYHB 3TCJA 1TUGB 1ZBJA 3CC4Q 3OW2A 3RDVA 4M75G 3RBBB 2AZVA 2GQVA 1JQQA 1WXUA 2LVMA 4HXJA 1FMKA 2AK5A 4ZNXA 1G3WA 1P92A 3CCQA 2MK5A 5LJ5j 3G6EA 2E4HA 2D8JA 1K0SA 4DEYA 2WACA 2OX7A 5IAYA 3TU4K 1NJIC 1KSWA 2K79A 3MEVA 5KCHA 2CS7A 3C0CA 3QBYA 2A36A 4E6RA 3OYMA 2B8AA 1VQLA 1Q82C 1KFZA 2O4XB 2VXEA 3EG0A 1UTIA 3NPFA 1VIFA 1RACB 4OMFB 3QHSA 1IXDA 2LRQA 5KYWA 2F2VA 1I1JA 2X3WD 1Y96A 2JT4A 1YIJT 3OYDA 1GBQA 3J80E 1NYFA 5IH2A 4PNOA 1MHNA 1G3SA 1OYXA 2OTJT 2CT3A 1NPRA 2FZKB 5KYXA 4E7JA 1YHQT 2FPFA 3H41A 4KUDK 3M4GA 2FPEA 1GFCA 2JMAA 4D6WA 5HK0A 2R58A 3QJ6A 2ZPHB 3UDCA 3C4SA 4E2FB 2FO0A 2XKOC 3MP1A 1VQ6T 1Q86C 1W1FA 4Y92A 3L2VA 1K4US 4C0DC 3INZA 2P0KA 5IHIA 5KYNA 3VU3C 1AWJA 5CKDA 4M75C 3EGXA 3M57A 4M78D 2K6DA 1LNXA 4RTZA 4BB7A 1D0ZA 4DBQA 3UF4A 4XU2A 1PNJA 1FWZA 2FYKA 5CIUA 4M7DE 1ZLMA 2RQUA 4MMLA 4QVZA 1X6BA 2RQWA 2MIOA 2RM4A 1VYTA 3CMAT 3NHNA 4E47A 1VQ5Q 1RAIB 4XTYA 4OB2B 3CCJQ 1QVFP 1VQ7Q 2KXDA 3VUZA 3I5SA 1U1SA 2M0YA 3CCQT 1M27C 1AVZC 4ELZC 1Q7YR 5KYUB 3G71Q 4OMMA 1AEYA 1SF9A 2L3QA 4RTYA 5DM7R 1V76A 3SB2A 1Q81C 1VQ8A 2WSEE 1QKXA 2QASA 1JO8A 4M7AA 3EG3A 3PGGA 4GLMA 2DXBA 1UEBA 4IUTA 5LJ5h 1VQOA 1YJNA 3VV0A 2K3XA 1G83A 4C8QA 3OQ5A 1GBRA 1PSEA 3QZ5B 3OYGA 2A7YA 3HRTA 4M77C 4B9XA 3GOXA 4OVAA 2DYBA 1KC8C 1JJ2S 4BACA 4WCIA 2FRYA 2L3PA 3DKMA 1YI2A 4LE9A 4C92G 2JMCA 2G6FX
chains in the Genus database with same CATH topology
5C0MA 3A8HB 2MWPA 2BUDA 1N9RA 3E19A 1YITA 4C5EA 5LJ5g 2HQEA 4C92E 2E6ZA 4JS4A 3CC2A 1HK9A 3RKXA 1VQMT 4F7UF 3O8VA 1KQ2A 2LQ8A 4DA4A 1VQ4T 4M7AD 1X75C 3C95A 3SFMA 5FROA 2FHDA 3LWIA 4RMOA 2KDSA 4L6V5 2I2LA 2E6NA 2RJCA 2HAXA 4M7DC 3UPUA 4BI3A 5LJ3g 3JB9F 5FU7B 3FIFA 3A8OB 5GAN6 5M9OA 2R5AA 4PLIA 5GAMh 1M1GA 3VKIA 2FL7A 4FL6A 3JB9I 3CPWS 2K57A 2ZPBB 3CBMA 2RJFA 2DK3A 4BI8B 5IT9E 3DLLA 3CCVT 4M77G 2XK0A 2QTXA 3M59A 4C8QD 2FVUA 5GAN8 3OYCA 3PNWC 1Y96B 4J8OA 2QDYB 2KAFA 2YRVA 2LCLA 3TEEA 1DJ7B 2LC4A 3X28B 4L59A 4EMHA 4M77E 1M8VA 2E10A 3A8GB 5CQXA 4BI4A 3OYNA 3I55T 2VYTA 3CCRT 4TVRA 1JBMA 3CPFA 4OGCA 1N6AA 3URGA 2DXTA 2BKDN 2PVOB 4M77D 3T9NA 4M78B 2RH2A 1YIJA 3CEYA 2EJGA 3MO8A 3CCET 4QQGA 5CVIA 3CCSA 2QEXT 3X20B 3M55A 3CC7T 1BI3A 1VIEA 2EYQA 4KBMB 2L89A 3JCMh 4FSXA 5LL6S 2QQAA 3VUBA 5CKFA 3CCLA 5GAMg 4P5NA 4ELYC 2DJZA 2O01E 2RK1A 4XTXA 2LNVA 1YJWA 2HD0A 3ER0A 3LX7A 4XTZA 4ZGEB 5CK9A 1YHQA 3META 1M90C 2P0PA 3E1SA 3GPLA 2Y4YA 4PJOG 3GNGA 1GXIE 3RESA 1UGSB 4M78F 3OMGA 1PSFA 3L2RA 4HKEA 3MCAB 4C5IA 3R6OA 4PJOE 4M7DD 4IURA 2QA4A 4JRPA 1K8AC 1R8OB 4NS5A 1VQ6A 1WGSA 4IKFA 3JCMc 4X9DA 5KE3A 1H3ZA 1EIFA 1WJRA 4CI0C 4PL6A 3BDLA 2IVWA 1S72T 4M7DF 1VQ9A 1UB4A 4JS5A 3JCMQ 3RKWA 3V8KA 3CXCS 3JCMg 2F5TX 3P8DA 4PKCC 4OB1B 4ZGDB 2OTLT 1KG1A 2DZ9A 2MF2A 1AHJB 2DD4A 1B34B 4UC4A 4QQDA 4E7HA 1IREB 1QVFS 4BD3A 2DVEA 5GMKh 4KULA 1U8RA 1G3YA 1YJ9A 1KD1U 1UGRB 3G6ET 2FB7A 5KE2A 3PIPA 2RHXA 3QXEB 3S3NA 2ZGWA 3OMCA 1KHIA 3G4SA 3VYHB 3CXCA 3V7RA 2CZ6B 1UGQB 4RCBA 3S6WA 4NL2A 2LT1A 1YJNT 1XTDA 4KUIA 2X4WA 5GAOm 2RK2A 2ZPIB 3L2WA 3GNFB 1QVFA 2DTOA 5LJ5d 1K9MU 4C92C 4M7DB 1QVPA 3PFSA 3GIBA 2GCXA 2L3RA 3QO3A 2DIGA 1VQLT 2V8KA 4II1A 1Y71A 3OSVA 4C92A 4R56A 1N8RU 1U1TA 2F69A 3WXMB 2PVDB 3ZFJA 3I56T 2XDDA 2EFIA 2M0OA 1NE8A 3EFRA 3JRZA 2RJEA 3M58A 4XAXB 3FRNA 4JRQA 1VQ5T 1Y07A 4BDZA 1W2BS 3CMAA 1M9SA 2JNGA 4XTWA 5LJ5e 1MGQA 1VQKT 3CCJT 3GLXA 3SDZA 5LJ3d 1VQ7T 4QVDA 2X35A 2O4XA 1Q7YU 3LGLA 4BE1A 3BFMA 1UGPB 2RO0A 3JB9H 1TH7A 3A5ZB 1NPPA 4LDWA 3ASKA 4OB3B 1I5LA 1QP3A 2CZ7B 4IUVA 4DOVA 2JTFA 4C5GA 2QQBA 5FU6B 5LJ3e 1ZQ1A 3HL8A 2HNIA 3OYFA 2ZCFB 3G71T 3PT9A 2EQJA 4N4GA 2QQSA 5I2SA 5GANh 2K5LA 1KHCA 2MI6A 3LH0A 2XIDA 3CCUT 4M7AB 3RIRA 5J26A 2EQKA 3OS1A 3JSCA 3HSBA 2IG0A 5CO7A 3QJYA 4GY5A 4B9WA 1KQ1A 4QQ6A 1VQNA 1X01A 1X6OA 3KBGA 2D6FA 2PUKB 3LGFA 3OYBA 5KCOA 1D3BA 1WPYA 3OYAA 5GAMd 1JJ2A 1BI0A 2YHTA 3QPHA 3WVEB 3M9QA 5KH6A 1M5Q1 4C92D 4F7UG 3H6ZA 4IUQA 5L8RE 4C8QB 4QW2A 3JCMJ 3MHXA 3LYIA 2CGHA 4J7IA 1I4K1 1FXXA 4ATOA 3PMIA 3S3OA 4M7AF 2RHZA 2L5QA 2HBPA 3EAEA 3JB9G 1KD1C 2AHJB 5GAMe 4PJOC 2K2VA 4C0FA 2M16A 5GANg 3FLGA 4M77B 3A8LB 2JZ2A 3CC4A 3QYGB 2RHUA 1K73U 4Y28E 3LW5E 1M4ZA 4PJOA 3OSSC 3OYYA 3X26B 5GAN2 3M56A 4MDWA 3CD6A 3Q1JA 3JAME 1QVGS 4EMKC 3VYGA 5CAIA 2YLBA 4E7LA 2LQKA 3GF5A 4C8QF 3JCMd 4BUGA 3OYEA 1K9MC 2XDBA 4JLIA 2X4JA 2WSFE 3NTIA 4EMKA 2Y90A 2K4YA 3CPWA 3OYIA 3E9GA 3DB3A 5GMKl 4RG8A 1N8RC 1V29B 1O9SA 4XU1A 3N5BB 2XHCA 1N9SA 3WVDB 4M77F 4JRKA 4C5HA 4EMGA 3J81E 2D9TA 1QVGA 3JCMe 1VQMA 1BI2A 2R57A 2E12A 3RMQA 2HQXA 1WQWA 4R55A 2E1HA 2LDMA 1G3TA 2GFAA 4N4IA 3FC3A 1VQ4A 1Q7YC 2G3RA 4OF1A 2CZ0B 5GMKi 3FDRA 4J5YA 4HT8A 4RCCA 4E7IA 3V7CA 4A4HA 1G5VA 2E41A 2RB6A 3OB9A 3UT1A 1QP2A 4A4KA 3PTAA 4HCCA 3E9FA 3LLRA 2DO3A 2DAQA 1IZ6A 4A53A 1NJIU 4J6WA 2LCCA 4M78G 3M54A 2XU8A 2JN0A 1NZ9A 3CCVA 2KSSA 4XU0A 4KT0E 3NFCA 4M78E 5FLXE 5LJ5f 4LDVA 5A2QE 4EPCA 1BKBA 3FJPA 1Q82U 4PJOD 4EDUA 1N27A 3HRSA 4MDXA 1YCYA 2EJFA 4MZTA 3ZBDA 3I55A 3CCRA 1W4SA 2KVQG 2MWOA 3J7AF 3CBOA 2GFUA 2WSCE 4M75A 4E7KA 3DB4A 4FT2A 2DTIA 3L1AA 2RA2A 1HXDA 3HFNA 3CCEA 2K5IA 4ZTFA 3CMET 4BDYA 2GF7A 5LJ3f 5GMKe 2QEXA 1VQ8T 3CC7A 2LT4A 3TREA 2JUFA 1XNIA 2VUBA 5HY6A 4A4GA 3JCMX 3QKJA 5GAOq 2F5KA 3JCMW 3OW2S 4HT9A 1H641 3ME9A 1VQOT 2P0QA 5A0DA 3DLMA 2EKOA 2CKKA 4N4HA 1KQSS 5CKEA 1K73C 3C94A 2KK4A 4CRIA 2DD5A 3QIIA 5AYFA 1WJQA 1VQPA 3QYHB 3OBYA 4IUPA 3TCJA 1BI1A 2E64A 3OW2A 4ZGJB 2RHYA 1BIAA 4M75G 3HHTB 3X25B 2GQVA 2LVMA 4A4EA 3BY7A 3OA6A 1KQSA 4M75E 3CBPA 2ZPEB 5GAMf 2DZCA 4F7UA 1YI2T 2OTLA 5GANd 4N0AC 1Q86U 3RERA 2EQMA 1SSFA 1YITT 2DTHA 5A0LA 1VQNT 1G3WA 5DLOA 2NLUA 1P92A 4N0AA 4QVCA 3CC2T 3CCQA 2JVVA 4PLLA 3SWNA 5LJ5j 2E65A 3G6EA 3KXTA 1W2BA 4DQ2A 1O75A 2QQRA 1RL2A 2VXFA 2WACA 5IAYA 3JCMP 5GANe 2EWNA 2OAUA 3TU4K 1NJIC 3RMSA 1I8FA 4FT4A 4LDUA 4XU3A 3HP9A 3MEVA 4C92B 3L2ZA 2LTOA 5KCHA 4V2SA 4JJNK 2CS7A 3QBYA 2RD1A 5LJ3j 3OYMA 2V8JA 2B8AA 3JCMf 1VQLA 2C06A 1Q82C 2K5FA 3X24B 3OS2A 2O4XB 2VXEA 4HCBA 4YTLA 1ZBXA 3I56A 2D0QB 2EQUA 3OBWA 4MMKA 3CD6T 1VIFA 4OMFB 1M1KU 2RI3A 3QHSA 4IUUA 2OTJA 4ME7A 4RKUE 5GAN5 1VQKA 2LRQA 5HKCA 3GP8A 3M53A 3CCMA 4F7UE 4C92F 4OGEA 5GAOr 3VJPA 1Y96A 3BDUA 2L8DA 4GLKA 4OP0A 1YIJT 4M7AG 1YHQT 3HRUA 1JB0E 3OYDA 3J80E 3CCST 4M78C 4NOYA 2DXUA 2DIQA 4X9CA 4ZTJA 3OYLA 4M7AE 4PNOA 5CCAA 4WF2A 1MHNA 4LD6A 4M78A 4A4FA 4FIBA 4XTVA 4O5VA 3G71A 3CCLT 1G3SA 1OYXA 1XOVA 3MP6A 3JB9D 3OS5A 2OTJT 5GAMj 1BIBA 1NPRA 2QXFA 3FEOA 5CQYA 4C8QG 2XG8D 5CR2A 4E7JA 4L5GA 5IN1A 2E5QA 1D3BB 5GMKm 4KUDK 3M4GA 3CCUA 2VV5A 3QUIA 4Q5WA 2DEQA 3RUXA 4C8QE 2XD0A 5A0GA 5GAN7 5J39A 4NL3A 4D6WA 4M7DA 3LWHA 5HK0A 1FX7A 2R58A 3QJ6A 2EIFA 2QA4T 3MEAA 1OI1A 2ZPHB 3OYKA 4OB0B 2DPPB 3C4SA 3MP1A 2XKOC 4LDYA 3UDCA 5C6SA 5GAOp 1Q81U 1VQ6T 3P8HA 2PUOB 1Q86C 1JRIA 2EJ9A 2XDPA 3HFOA 4C0ZA 1VQ9T 1YBYA 4RG2A 2R5MA 4BY6C 3UWNA 4PJOB 5CKHA 3FB9A 4X34A 5EG2A 2KQWA 3L2VA 3G7ZA 5FRNA 4C0DC 2DKGA 2DXCA 3INZA 2P0KA 2BIVA 2Y4XA 1YJ9T 3AHUA 4EMKB 5GAOn 2V8IA 2RJDA 3JCMb 3VU3C 3V8JA 3PIOA 4J83A 1Y7XA 5CKDA 3G4ST 1B34A 4M75C 3M57A 4M78D 3JCMV 4M7DG 2PVGB 3H8ZA 1BYMA 1KC8U 1LNXA 5GAN3 4PJOF 2A3LA 4FM4B 4BB7A 3S3MA 2JTMA 3QSUA 2ZZDA 4XU2A 1FWZA 1ZHIA 2FYKA 5CIUA 4MMLA 3OYJA 4M7DE 4QVZA 4JRIA 1M1KC 3SD4A 1VQPT 3NTHA 1YJWT 2X4XA 5D6XA 3MP8A 2VC8A 5GANf 4C0GA 2M1HA 2RM4A 2XICA 3C12A 2PU9B 3V7SA 3RKYA 4A54A 4BY6B 4E47A 3CMAT 2EAYA 4XTYA 1OZ3A 1WNLA 4DOWA 4OB2B 3L2UA 2K3YA 5GMKj 2H3JA 3QDRB 4C0DB 2QQ9A 3P8BB 2MMPA 4MZPA 4XK8E 2KY9A 3A8MB 4ZN3A 3VUZA 1U1SA 5J3BA 3M4YA 2RI5A 4BE2A 2YLCA 4J6YA 2QI2A 3CCQT 1RI0A 4M75B 4Y91A 4ELZC 3NTKA 5I2MA 4LD9K 1LJOA 3M5AA 4O6JA 5FU6C 1M1FA 1S72A 2ZPFB 1WQ7A 4HCZA 3QZ9B 4J7FA 1QW1A 2CYZB 5I21A 5D6YA 2E70A 3SWNC 5GAOl 3V8LA 5DM7R 3QG1A 3SB2A 4M75D 5GAN4 4M7AC 4HA8A 2ZPGB 1Q81C 5D6WA 3BW1A 5DY9A 3CMEA 1VQ8A 4ZN1A 2WSEE 3L2QA 4LDXA 3HPWA 4XTUA 2VGNA 3HKSA 3KUFA 2M9UA 3OS0A 4M7AA 5FRMA 3PGGA 4M75F 2P4TA 5DLQE 1XQHA 4JLGA 2DXBA 1UEBA 1OZ2A 2LX9A 3EFSA 4IUTA 5LJ5h 2XI9A 3OY9A 1VQOA 2VGMA 1YJNA 3ZEHA 3PMTA 3CCMT 4C8QC 3F70A 3VV0A 4VUBA 4JDSA 4Z02A 2K3XA 4BE0A 5HK3A 4C8QA 5FU7C 1M90U 3OQ5A 1PSEA 4JUVA 3CC4T 1WJSA 2X4YA 2RHIA 3L42A 2KMTA 3QZ5B 5GANj 3OYGA 4F7UB 3JB9J 1LOJA 2A7YA 3HRTA 4J6XA 4M77C 2JOYA 5LJ3h 4B9XA 4OVAA 3OYHA 3GOXA 1KC8C 1VQ5A 1I81A 4MZMA 1JJ2S 4BACA 2CZ1B 3CCJA 4M77A 1VQ7A 1K8AU 3SWNB 3DKMA 4XQ3A 3MEWA 2MAMA 1YI2A 3MEUA 4FU6A 1VUBA 4C92G 5CKBA 2RI2A 2PQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RJE A;  5C0M A;  3P8H A;  4BDZ A;  2MWP A;  2BUD A;  2XDP A;  4C5E A;  4ZTF A;  4BDY A;  2GF7 A;  2HQE A;  4RG2 A;  2R5M A;  2O4X A;  2X35 A;  3LGL A;  3UWN A;  4BE1 A;  1XNI A;  2RO0 A;  3O8V A;  4X34 A;  4A4G A;  3QKJ A;  2F5K A;  3L2V A;  3ASK A;  5FRO A;  4IUV A;  2FHD A;  2M0O A;  3ME9 A;  2JTF A;  4C5G A;  5FRN A;  2P0K A;  3DLM A;  2BIV A;  2E6N A;  2RJC A;  2EKO A;  2CKK A;  4N4H A;  2RJD A;  5M9O A;  3OYF A;  2R5A A;  4PLI A;  2EQJ A;  4N4G A;  5C6S A;  4FL6 A;  2QQS A;  2RJF A;  4CRI A;  3QII A;  1KHC A;  1WJQ A;  3H8Z A;  2XK0 A;  3OYC A;  4IUP A;  3LH0 A;  3PNW C;  3OS1 A;  5J26 A;  2EQK A;  3S3M A;  2IG0 A;  2RHY A;  2YRV A;  4GY5 A;  4B9W A;  4QQ6 A;  4L59 A;  3OYJ A;  5CIU A;  4QVZ A;  2LVM A;  4A4E A;  3OYN A;  2VYT A;  3OA6 A;  3LGF A;  3SD4 A;  5KCO A;  3NTH A;  3OYB A;  3OYA A;  2X4X A;  2BKD N;  5D6X A;  3MP8 A;  3M9Q A;  5KH6 A;  3CEY A;  2EQM A;  2M1H A;  1SSF A;  3H6Z A;  4IUQ A;  3MO8 A;  4QQG A;  4QW2 A;  2NLU A;  1OZ3 A;  3LYI A;  3L2U A;  4PLL A;  2K3Y A;  2L89 A;  3MP1 A;  3PMI A;  3S3O A;  2RHZ A;  3EAE A;  2QQR A;  2WAC A;  5IAY A;  2M16 A;  3FLG A;  2JZ2 A;  3LX7 A;  2RI5 A;  4BE2 A;  4E7K A;  3MEV A;  2RHU A;  3MET A;  1RI0 A;  2LTO A;  5KCH A;  3QBY A;  3Q1J A;  3NTK A;  3OMG A;  3OYM A;  4E7L A;  2B8A A;  3L2R A;  3OYE A;  4HCZ A;  4C5I A;  2O4X B;  3NTI A;  3OS2 A;  4IUR A;  3OYI A;  3E9G A;  3DB3 A;  5D6Y A;  2EQU A;  4NS5 A;  1WGS A;  4IKF A;  5KE3 A;  1H3Z A;  2RI3 A;  1WJR A;  4IUU A;  5D6W A;  4PL6 A;  3BDL A;  2LRQ A;  4C5H A;  2D9T A;  3KUF A;  3OS0 A;  2R57 A;  3P8D A;  2HQX A;  5FRM A;  2L8D A;  2LDM A;  4N4I A;  3FC3 A;  2GFA A;  4UC4 A;  4E7H A;  2G3R A;  3OYD A;  4QQD A;  4IUT A;  1OZ2 A;  3FDR A;  4BD3 A;  3OY9 A;  4E7I A;  2DIQ A;  4A4H A;  1G5V A;  3ZEH A;  3OB9 A;  3UT1 A;  3PMT A;  3OYL A;  4ZTJ A;  3F70 A;  3E9F A;  5KE2 A;  3LLR A;  2RHX A;  1MHN A;  4LD6 A;  4Z02 A;  2K3X A;  4A4F A;  4BE0 A;  2DAQ A;  3S3N A;  3OMC A;  3MP6 A;  1OYX A;  2LCC A;  3FEO A;  4E7J A;  3OQ5 A;  3S6W A;  1WJS A;  2E5Q A;  2RHI A;  2X4Y A;  3L42 A;  5IN1 A;  3OYG A;  2X4W A;  3L2W A;  3OYH A;  3L2Q A;  4B9X A;  3GOX A;  4OVA A;  4Q5W A;  3PFS A;  2L3R A;  4EDU A;  1N27 A;  5J39 A;  4BAC A;  2DIG A;  2R58 A;  3QJ6 A;  4II1 A;  2MWO A;  3MEW A;  3MEA A;  1OI1 A;  3MEU A;  4FU6 A;  2GFU A;  3OYK A;  3C4S A;  2EFI A;  2RI2 A;  2PQW A;  3DB4 A; 
#chains in the Genus database with same CATH topology
 2O31 A;  3A8H B;  3E19 A;  1N9R A;  4C5E A;  5LJ5 g;  3CC2 A;  1X43 A;  3RKX A;  1QMC A;  1KQ2 A;  2LQ8 A;  1X75 C;  3C95 A;  1PWT A;  5FRO A;  2CP7 A;  2KDS A;  4JZ4 A;  4L6V 5;  3VRZ A;  1D1C A;  5FU7 B;  1M1G A;  3VKI A;  2FL7 A;  1C0M A;  3CPW S;  2ZPB B;  1IGQ A;  3CBM A;  2QTX A;  5GAN 8;  2FVU A;  1PC0 A;  1PD1 A;  2YRV A;  3TEE A;  1M8V A;  4EMH A;  2E10 A;  3I55 T;  2VYT A;  3CCR T;  3CPF A;  1RAA B;  3URG A;  5KYY B;  2BKD N;  2RQV A;  3CEY A;  1TUD A;  3MO8 A;  2M51 A;  2YWW A;  3M55 A;  1BI3 A;  1VIE A;  2L89 A;  4FSX A;  5IHN A;  5LL6 S;  3CCL A;  4M7D B;  3ER0 A;  4XTZ A;  8ATC B;  1B7T A;  1MV0 B;  2DFU A;  3GNG A;  5IXF A;  4HKE A;  4C5I A;  3R6O A;  4PJO E;  4M7D D;  4IUR A;  3RR6 A;  1WGS A;  4IKF A;  4AFU C;  1EIF A;  1WJR A;  4M7D F;  1VQ9 A;  4JS5 A;  3RKW A;  2FZC B;  3EFO B;  3H9N A;  1KG1 A;  1YN8 A;  1XJW B;  1IB8 A;  4UC4 A;  1AHJ B;  2IPO B;  1QVF S;  4BD3 A;  1M2O A;  1YJ9 A;  3PIP A;  4KGZ B;  1KHI A;  1BK2 A;  3VYH B;  3V7R A;  2CZ6 B;  1H92 A;  2X51 A;  2LT1 A;  1AT1 B;  2EGA A;  1YJN T;  2V1Q A;  5GAO m;  3GNF B;  1QVF A;  2DTO A;  2QYZ A;  4C92 C;  1BCM A;  1QWF A;  3VS5 A;  2V8K A;  3WXM B;  2J6O A;  3ZFJ A;  3I56 T;  2EW3 A;  1NE8 A;  1KK7 A;  3JRZ A;  4BDZ A;  1M9S A;  3CD6 Q;  1VQK T;  3SDZ A;  2O4X A;  3I5R A;  3LGL A;  4BE1 A;  4ANJ A;  3BFM A;  1M90 R;  2RO0 A;  1BBZ A;  1NPP A;  1QP3 A;  4E7S A;  1PG5 B;  2DL5 A;  2HNI A;  1K8A R;  2MI6 A;  3CCU T;  3OS1 A;  2EQK A;  4GY5 A;  1AWO A;  1J3T A;  1X01 A;  2D6F A;  2PUK B;  4AFZ C;  3OYB A;  1WPY A;  3OYA A;  5GAM d;  2RQR A;  3M9Q A;  3BE3 A;  1PHT A;  2F2X A;  3JCM J;  1BB9 A;  4AFQ C;  4ATO A;  1IO6 A;  3PE0 A;  2HBP A;  3JB9 G;  2AHJ B;  5GAM e;  3VRY A;  2DA9 A;  3CC4 A;  3QYG B;  2EBP A;  5GAN 2;  4MDW A;  2DM1 A;  2RPN A;  2LQK A;  3GF5 A;  2XDB A;  4BUG A;  3G4S Q;  2BE7 D;  4JLI A;  2PZ1 A;  2K4Y A;  2C0O A;  3OYI A;  2DIL A;  1SKU B;  4RG8 A;  1N8R C;  4FCY A;  1UFF A;  2E5K A;  2DRM A;  1ZUU A;  3A1P A;  4C5H A;  4EMG A;  2HQX A;  1WQW A;  1ZSZ B;  2LDM A;  4N4I A;  1G3T A;  2G3R A;  4OF1 A;  5GMK i;  4HT8 A;  4E7I A;  2JJ9 A;  1JXO A;  2E41 A;  3OB9 A;  4A4H A;  3LLR A;  1RAH B;  4LN2 A;  2DO3 A;  2DAQ A;  3SEM A;  2DER A;  2LCC A;  3M54 A;  4KH0 B;  2KSS A;  4XU0 A;  4KT0 E;  5A2Q E;  2KT1 A;  4PJO D;  2KVQ G;  1QLY A;  1YCS B;  2WSC E;  1RAD B;  1K1Z A;  4E7K A;  4FT2 A;  1KD1 R;  5KYU A;  1GL5 A;  2K5I A;  4ZTF A;  4BDY A;  5LJ3 f;  3CC7 A;  2LT4 A;  1PD0 A;  4GBQ A;  1H64 1;  2OJ2 A;  1WXT A;  1K9M R;  2MPX C;  5CKE A;  1F1B B;  2YRD A;  1VQP A;  1W6X A;  1WX6 A;  1BI1 A;  2E64 A;  1BIA A;  1ZUY A;  3OA6 A;  4E7Z A;  4M75 E;  3CBP A;  2ZPE B;  2DZC A;  1MMA A;  5GAN d;  3CCU Q;  3VS0 A;  1YIT T;  5A0L A;  2KRN A;  4HVV A;  2KYB A;  4PLL A;  2E65 A;  3KXT A;  2VXF A;  2A08 A;  4DEX A;  5GAN e;  2EWN A;  2KGT A;  1K9A A;  4CC7 A;  4FT4 A;  3L2Z A;  2LTO A;  4V2S A;  4JJN K;  1OX9 A;  4FYW B;  2V8J A;  3JCM f;  2C06 A;  3X24 B;  3OS2 A;  4RTV A;  3CCV Q;  2DJQ A;  4YTL A;  2D0Q B;  4MMK A;  3OBW A;  2RI3 A;  4IUU A;  1M3B A;  5GAN 5;  5HKC A;  3CCM A;  4F7U E;  2LMJ A;  4OGE A;  3BDU A;  4M7A G;  4GLK A;  4OP0 A;  3HRU A;  1JB0 E;  1NG2 A;  1K73 R;  4KRT A;  4KH1 B;  2QEX Q;  5KYY A;  2JS0 A;  1TTH B;  4A4F A;  3G71 A;  2K3B A;  1VYV A;  1UHC A;  5GAM j;  1BIB A;  3FEO A;  1YJW T;  4C8Q G;  5GMK m;  1EZZ B;  2KRS A;  4M7D A;  3LWH A;  1JEG A;  1FX7 A;  2EIF A;  2QA4 T;  2ABL A;  1D09 B;  3MEA A;  4EIK A;  4OB0 B;  5I11 A;  1PKS A;  2D0N A;  4BY6 C;  3FJ5 A;  1UJY A;  1E6G A;  5CKH A;  3EHR A;  3LH5 A;  2OTL Q;  2KQW A;  2J7I A;  2Y4X A;  4RUG A;  3AHU A;  4KGX B;  1Q82 R;  3EFO A;  3UAT A;  3JCM b;  3V8J A;  1Y7X A;  3SHW A;  3JCM V;  1BYM A;  6AT1 B;  2A3L A;  2JTM A;  1WDX A;  1M1K C;  3SD4 A;  1VQP T;  2X4X A;  2M02 A;  2M1H A;  3V7S A;  3RKY A;  2FG0 A;  1WNL A;  2K3Y A;  2AKL A;  2LJ3 A;  4C0D B;  3A8M B;  4ZN3 A;  3ULR B;  2RN8 A;  4BE2 A;  1RI0 A;  3O5Z A;  4M75 B;  4Y91 A;  5I2M A;  4LD9 K;  5FU6 C;  1GCQ A;  1S72 A;  1OU9 A;  2JXB A;  1TS9 A;  1WQ7 A;  2ZPF B;  4HCZ A;  2DL4 A;  2CYZ B;  5I21 A;  3CQT A;  2E70 A;  3SWN C;  3V8L A;  3QG1 A;  4M7A C;  4M75 D;  5GAN 4;  5D6W A;  3BW1 A;  1QCO A;  3HPW A;  4XTU A;  2VGN A;  3HKS A;  3KUF A;  3OS0 A;  2CP0 A;  5FRM A;  4M75 F;  2COZ A;  2P4T A;  4JLG A;  2B86 A;  2A0F B;  1ZX6 A;  5HCK A;  1WIE A;  2VGM A;  3ZEH A;  3M0P A;  4KGV B;  4C8Q C;  3CCM T;  3F70 A;  4JDS A;  5L23 A;  1UJ0 A;  2CRE A;  1M90 U;  1JJ2 P;  4JUV A;  4HCK A;  4RTT A;  2YUN A;  2X4Y A;  5GAN j;  4F7U B;  1LOJ A;  4J6X A;  3OYH A;  2JOY A;  2OAW A;  2KR3 A;  1K8A U;  2MAM A;  4FU6 A;  1SRM A;  2RI2 A;  1WXB A;  1R77 A;  4LUD A;  4C92 E;  1VQM T;  2QGG A;  4F7U F;  1MV3 A;  3O8V A;  3EG9 B;  1VQ4 T;  3SFM A;  2FHD A;  3CPW P;  3E2U A;  2I2L A;  4BI3 A;  3FIF A;  1ZSZ A;  2FRW A;  2R5A A;  5GAM h;  4LUE A;  2DK3 A;  4AG2 C;  4M77 G;  2D1X A;  1I5O B;  4HVU A;  4J8O A;  2GBQ A;  2LC4 A;  3X28 B;  4OMQ A;  3A8G B;  5CQX A;  4BI4 A;  3OYN A;  2PVO B;  4M77 D;  3T9N A;  4M78 B;  2GNC A;  2EJG A;  1T0J A;  3CCE T;  4QQG A;  3CCS A;  2K7A A;  3EH2 A;  3CME Q;  2EVR A;  3EGD B;  3M0T A;  5GAM g;  2LJ0 A;  1KC8 R;  2LNV A;  5CK9 A;  3MET A;  3E1S A;  2PTK A;  9ATC B;  4M78 F;  1QQJ A;  1PSF A;  2EYX A;  2DX1 A;  1H3H A;  1H3Z A;  1QCF A;  4X9D A;  3JCM c;  1NM7 A;  1S72 T;  2NUP B;  1UB4 A;  3JCM Q;  4CC3 A;  4PKC C;  2H3E B;  2RNA A;  2BTT A;  2MF2 A;  4E7H A;  1IRE B;  2ZAE A;  3KFV A;  4JJD A;  1U8R A;  1KD1 U;  3G6E T;  1AZE A;  3QXE B;  1MNE A;  2ZGW A;  2MCN A;  3IQL A;  3G4S A;  1MMG A;  1RUW A;  4NL2 A;  1XTD A;  5AT1 B;  4QT7 A;  1K9M U;  1QVP A;  2GCX A;  1M3C A;  2DIG A;  1VQL T;  1WYX A;  4R56 A;  1Y71 A;  3TSW A;  2XDD A;  1Q95 G;  2M0O A;  4JRQ A;  2AIR B;  1Y07 A;  3U23 A;  1W2B S;  4XTW A;  1MGQ A;  1JU5 C;  2BZ8 A;  1BU1 A;  3A5Z B;  4K11 A;  4LDW A;  2KBT A;  2KYM A;  1YIJ Q;  1I5L A;  2CZ7 B;  4IUV A;  1OPK A;  2HBW A;  3HL8 A;  1AOJ A;  2RMO A;  5GAN h;  1SRL A;  2K5L A;  8AT1 B;  2C0I A;  2OTJ Q;  1T3L A;  1YHQ Q;  3QJY A;  1TXQ A;  1VQN A;  1I0C A;  2EYZ A;  3KBG A;  2FPD A;  1IHW A;  1JJ2 A;  1BI0 A;  5KH6 A;  4C92 D;  3HTR A;  4OMN A;  4IUQ A;  1VQ6 Q;  4QW2 A;  3LYI A;  4J7I A;  3ZL7 C;  1FYN A;  1UDL A;  5GAN g;  2KRM A;  3FLG A;  2JZ2 A;  1K73 U;  3OYY A;  3X26 B;  3M56 A;  1GCP A;  3Q1J A;  2YLB A;  2WSF E;  3CPW A;  1V29 B;  4FSS A;  2MOX A;  4XU1 A;  1WA7 A;  3M0U A;  2D9T A;  1WZO A;  2R57 A;  3I35 A;  1CSK A;  1Q7Y C;  2GFA A;  4RCC A;  1AWX A;  4D8K A;  3CMA Q;  4A4K A;  3UT1 A;  1PRM C;  3E9F A;  1NYG A;  2QG9 B;  1NJI U;  1KIK A;  2JN0 A;  1NZ9 A;  3CCV A;  1M30 A;  1SG5 A;  3NFC A;  3CCQ Q;  5FLX E;  3AT1 B;  5LJ5 f;  3FJP A;  1Q82 U;  4MDX A;  1YCY A;  2CUD A;  2EJF A;  4MZT A;  1OQK A;  2EYY A;  2MWO A;  3CBO A;  2HL3 A;  4M75 A;  3DB4 A;  3L1A A;  2HCK A;  1YWO A;  5GMK e;  2QEX A;  1VQ8 T;  2DYI A;  3TRE A;  2JUF A;  2VUB A;  3JCM X;  5GAO q;  3JCM W;  2EKH A;  3ME9 A;  1VOM A;  2P0Q A;  1VQO T;  3D7S B;  3DLM A;  1WFW A;  2EKO A;  2CKK A;  1N8R R;  2KK4 A;  3QII A;  2P4R A;  2KT8 A;  4ZGJ B;  2RHY A;  2HKN A;  2DL7 A;  3HHT B;  1Z9Q A;  2YRC A;  4A4E A;  3BY7 A;  4ORZ A;  1YI2 T;  4F7U A;  2OTL A;  1Q86 U;  2EQM A;  2DTH A;  3EHQ A;  1VQN T;  2NLU A;  4N0A A;  4QVC A;  3CC2 T;  2JVV A;  1ACM B;  2HSE B;  2O88 A;  1RL2 A;  3JCM P;  1WHM A;  4QKU A;  2NUT B;  5GJV B;  1I8F A;  4XU3 A;  1PRL C;  2RD1 A;  3EG9 A;  1AZG B;  2K5F A;  4HCB A;  1HSQ A;  1TG0 A;  2EQI A;  2CH4 W;  2EQU A;  4RKU E;  3GBQ A;  4Z88 A;  2DL8 A;  3I55 Q;  3CCR Q;  5GAO r;  1OV3 A;  4IIM A;  2DMO A;  2KXC A;  2KEA A;  4NOY A;  2DXU A;  2DIQ A;  4X9C A;  4ZTJ A;  3OYL A;  4M7A E;  5CCA A;  4M78 A;  4AMC A;  4FIB A;  3CCL T;  4O5V A;  3JB9 D;  2L2P A;  5CQY A;  5CR2 A;  5IN1 A;  3EGD A;  3A98 A;  4IIO A;  3QUI A;  4PJL A;  3MPU B;  2DEQ A;  1ABQ A;  4C8Q E;  2XD0 A;  5GAN 7;  2LZ6 B;  4AG1 C;  4J9E A;  1EFN A;  1OI1 A;  3OYK A;  1Q81 U;  4LDY A;  5C6S A;  2PUO B;  2XDP A;  2EJ9 A;  3HFO A;  4C0Z A;  1VQ9 T;  2VB6 A;  1YBY A;  2R5M A;  3UWN A;  4PJO B;  5ECA A;  4X34 A;  3NGP A;  5EG2 A;  3G7Z A;  5FRN A;  1EX4 A;  2NUP A;  1YJ9 T;  4EMK B;  1D1B A;  1QCN A;  4ESR A;  4FYX B;  1KC8 U;  2LJ1 A;  1YJN Q;  4PJO F;  3S3M A;  4FM4 B;  2ZZD A;  4OMO A;  3OYJ A;  3QWY A;  3NTH A;  1S1N A;  2CP6 A;  1ZSG A;  3MP8 A;  2VC8 A;  3I56 Q;  2XIC A;  3C12 A;  2PU9 B;  4BY6 B;  2Z0W A;  4JJB A;  4DOW A;  1VQK Q;  5GMK j;  3QDR B;  2QQ9 A;  2V26 A;  4F16 A;  4F17 A;  4MZP A;  2KY9 A;  2ED1 A;  1K76 A;  2HSP A;  3M4Y A;  1PKT A;  2RI5 A;  4DBH A;  1GCQ C;  2DE0 X;  1WHL A;  4LNP A;  3NTK A;  1LJO A;  3RNJ A;  2H8H A;  1OPL A;  1M1F A;  3QZ9 B;  1A0N B;  1QW1 A;  1UGV A;  1Y0M A;  5D6Y A;  3R6N A;  2SEM A;  2ZPG B;  1SSH A;  5DY9 A;  3CME A;  4ZN1 A;  2M9U A;  2HKQ B;  1XQH A;  1VA7 A;  3PMT A;  3MKD A;  2ROL A;  4OMP A;  2EYW A;  4Z02 A;  5HK3 A;  2E3H A;  3CC4 T;  1WJS A;  2RHI A;  3L42 A;  3JB9 J;  3L2Q A;  1VQ5 A;  1I81 A;  1WHH A;  3M0R A;  1CKB A;  3CCJ A;  1VQ7 A;  2HL5 C;  2CSQ A;  3SWN B;  1G8X A;  4XQ3 A;  5IHK A;  3MEU A;  1VUB A;  2DRK A;  5CKB A;  2IIM A;  1WHK A;  2YDL A;  2HQE A;  1HK9 A;  4PK4 A;  1LCK A;  2VVK A;  4DA4 A;  4M7A D;  1C1A A;  3H0F A;  1ZSZ C;  4RMO A;  2A28 A;  2CP3 A;  5M9O A;  1G2B A;  3JB9 I;  5IT9 E;  2K57 A;  1SPK A;  1QVG P;  3M59 A;  4C8Q D;  3OYC A;  2QDY B;  2KAF A;  1R0C B;  1SEM A;  1DJ7 B;  2O9S A;  4M77 E;  1WLP B;  1NJI R;  1JBM A;  1C6V X;  4OGC A;  2DXT A;  2DET A;  1YIJ A;  2NYS A;  2DNU A;  1W70 A;  2YUO A;  3CC7 T;  2BZY A;  4J9F A;  1HD3 A;  2EYQ A;  3VUB A;  2QQA A;  5CKF A;  2CH4 A;  4P5N A;  1TWB A;  2O01 E;  2RK1 A;  3VS2 A;  2OTJ A;  2HD0 A;  1YHQ A;  1YP5 A;  2Y4Y A;  3RES A;  1UGS B;  1K0X A;  3L2R A;  3MCA B;  1PM3 A;  2J05 A;  4JZ3 A;  1NEG A;  1VQ6 A;  5KE3 A;  4CI0 C;  3BDL A;  4FW1 A;  3V8K A;  3EG2 A;  2L3S A;  4ZGD B;  4OB1 B;  2DD4 A;  1B34 B;  1RAF B;  4QQD A;  4B6M A;  1YIT Q;  5GMK h;  2DVJ A;  1G3Y A;  1UGR B;  2FB7 A;  3OMC A;  1KQS P;  1MND A;  1Q86 R;  1UGQ B;  4RCB A;  2RK2 A;  2ZPI B;  3L2W A;  3GIB A;  3QO3 A;  2CP2 A;  2NUT A;  1W2B P;  4II1 A;  1N8R U;  1U1T A;  2PVD B;  2EFI A;  3EFR A;  3M58 A;  2RJE A;  1VQ5 T;  2J6F A;  3CMA A;  2CUB A;  2JNG A;  4CC2 A;  1D0X A;  3CCJ T;  3GLX A;  5LJ3 d;  1VQ7 T;  1E6H A;  4QVD A;  1I07 A;  1RAE B;  3UA6 A;  4J9D A;  1UGP B;  3JB9 H;  1TH7 A;  3ASK A;  1OX8 A;  2LX7 A;  4DOV A;  2JTF A;  4C5G A;  1WHG A;  1OEB A;  5LJ3 e;  1ZQ1 A;  1UEC A;  2V1R A;  1HYO A;  3OYF A;  3G71 T;  2EQJ A;  4N4G A;  2QQS A;  2DBK A;  1IRX A;  2FZG B;  1KHC A;  2QK0 A;  1YJW Q;  2ECZ A;  5J26 A;  2EPD A;  3G1J A;  5CO7 A;  4B9W A;  1KQ1 A;  4QQ6 A;  2COY A;  4F14 A;  2YHT A;  2CT4 A;  2QA4 Q;  4F7U G;  3H6Z A;  5L8R E;  2C0T A;  2CGH A;  1FXX A;  3S3O A;  2L5Q A;  2J6K A;  2QAZ A;  2K2V A;  2M16 A;  4M77 B;  3A8L B;  1Q81 R;  1Y57 A;  4PJO A;  3OSS C;  1UUE A;  3CC7 Q;  3CD6 A;  1QVG S;  1ZA1 B;  3VYG A;  3JCM d;  3OYE A;  7AT1 B;  2X4J A;  4EMK A;  2Y90 A;  1GRI A;  3E9G A;  4WTO B;  1O9S A;  3N5B B;  2DL3 A;  2EGC A;  1YWP A;  4M77 F;  4JRK A;  3J81 E;  1E7O A;  1QVG A;  3JCM e;  1X27 A;  1VQP Q;  1HJD A;  1MMD A;  3V7C A;  2VAS A;  2YXY A;  4HCC A;  1QP2 A;  2YT6 A;  3EG1 A;  1IZ6 A;  4A53 A;  4J6W A;  1RAB B;  4M78 G;  2XU8 A;  1FMW A;  4J9B A;  1M2V B;  2FEI A;  3H0I A;  4EPC A;  1BKB A;  4M4Z A;  3HRS A;  3ZBD A;  3I55 A;  3CCR A;  2GFU A;  4F04 B;  2RA2 A;  1HXD A;  1B3Q A;  2SRC A;  3M0Q A;  3QKJ A;  2QDL A;  2QGF B;  4PJM A;  4N4H A;  3CCM Q;  1KQS S;  2ROT A;  4LXC A;  3C94 A;  4CRI A;  2DD5 A;  5AYF A;  1M8M A;  4J9C A;  3OBY A;  4IUP A;  2ENM A;  5I22 A;  1LVK A;  2O2O A;  2XMF A;  4X1V A;  2JM9 A;  3X25 B;  1ARK A;  5FW9 A;  4FW2 A;  1KQS A;  4Z8A A;  5GAM f;  4N0A C;  1IHV A;  3RER A;  2HEQ A;  1SSF A;  3I9Q A;  1KJW A;  5DLO A;  2JS2 A;  3SWN A;  1W2B A;  1MMN A;  2P84 A;  4DQ2 A;  1O75 A;  1VQM Q;  2QQR A;  1VQ4 Q;  2OAU A;  3RMS A;  4C92 B;  4LDU A;  3HP9 A;  4R0K A;  1MUZ A;  5LJ3 j;  2J06 A;  1U06 A;  1FMV A;  3I56 A;  1ZBX A;  2DEU A;  4FYY B;  3CD6 T;  1M1K U;  1SHG A;  2YUQ A;  4ME7 A;  1VQK A;  3GP8 A;  1TOV A;  3M53 A;  4C92 F;  3REB B;  3VJP A;  3JV3 A;  2L8D A;  3VS7 A;  2GTO A;  4AFS C;  3CCS T;  3VS3 A;  2W0Z A;  4M78 C;  3CCE Q;  2LP5 A;  4WF2 A;  4LD6 A;  1YNZ A;  1JXM A;  4XTV A;  1XOV A;  3MP6 A;  3OS5 A;  2HZY A;  2QXF A;  2XG8 D;  4L5G A;  2E5Q A;  1D3B B;  3CCU A;  2VV5 A;  4Q5W A;  3RUX A;  5A0G A;  4FYV B;  5J39 A;  4NL3 A;  2K2M A;  1IGU A;  1M3A A;  2RQT A;  1QKW A;  1X2Q A;  2DPP B;  5GAO p;  2F1L A;  2GQI A;  3P8H A;  1WHJ A;  3QWX X;  1Z9Z A;  1JRI A;  1R0B G;  2DBM A;  2COW A;  4RG2 A;  2HQH A;  1S72 Q;  3FB9 A;  4J9H A;  2DKG A;  4RTX A;  2DXC A;  1D0Y A;  2BIV A;  1NLP C;  5GAO n;  2V8I A;  2RJD A;  3VS4 A;  3G6E Q;  1SHF A;  2BE9 B;  3PIO A;  4J83 A;  1X6G A;  1B34 A;  3G4S T;  4M7D G;  2PVG B;  3H8Z A;  5GAN 3;  2K9G A;  3QSU A;  2PNI A;  1ZHI A;  1UE9 A;  4JRI A;  1VQL Q;  5D6X A;  5GAN f;  4C0G A;  2A37 A;  4A54 A;  3CXC P;  3TSZ A;  2EAY A;  1OZ3 A;  3L2U A;  2H3J A;  4PFO A;  1PCX A;  3P8B B;  2MMP A;  4XK8 E;  5J3B A;  2YLC A;  4J6Y A;  1QWE A;  2QI2 A;  3TQ7 P;  3M5A A;  4O6J A;  3PVL A;  3THK A;  4CC4 B;  4D8D A;  4J7F A;  1CKA A;  1RI9 A;  2O9V A;  5FWB A;  2D8H A;  5GAO l;  1U5S A;  4HA8 A;  2RF0 A;  4LDX A;  4JPB W;  2LQW A;  2GTJ A;  5DLQ E;  1OZ2 A;  2LX9 A;  3EFS A;  3OY9 A;  2XI9 A;  1T0H A;  2CP5 A;  2CDT A;  4VUB A;  4BE0 A;  3REA B;  3VS1 A;  5FU7 C;  2NUZ A;  1TUC A;  2KMT A;  3CCS Q;  5LJ3 h;  1TSF A;  4J9I A;  4MZM A;  2KI7 A;  2CZ1 B;  2YSQ A;  4M77 A;  4J9G A;  1OU8 A;  3MEW A;  4OML A;  4AT1 B;  2PQW A;  5C0M A;  1YIT A;  2MWP A;  2BUD A;  1VYU A;  2E6Z A;  4JS4 A;  2AKK A;  1LPL A;  3LWI A;  1NEB A;  2BZX A;  2HAX A;  2E6N A;  2ESW A;  2RJC A;  2NWM A;  4M7D C;  3UPU A;  5LJ3 g;  3JB9 F;  1YFN A;  3A8O B;  5GAN 6;  4PLI A;  4FL6 A;  2RJF A;  4BI8 B;  3DLL A;  5KYW B;  3CCV T;  2XK0 A;  1H8K A;  3PNW C;  2EGE A;  4Z89 A;  1Y96 B;  2LCL A;  4L59 A;  4TVR A;  1M2V A;  1N6A A;  2E3I A;  2RH2 A;  2KNB B;  5KYX B;  5CVI A;  2QEX T;  3X20 B;  1VQ8 Q;  4KBM B;  3JCM h;  1ZA2 B;  1X69 A;  4ELY C;  2DJZ A;  2HMA A;  4XTX A;  1YJW A;  3LX7 A;  4ZGE B;  1VQO Q;  1M90 C;  2P0P A;  3GPL A;  4PJO G;  1GXI E;  3OMG A;  1TU0 B;  2CSI A;  1OOT A;  2DLP A;  2QA4 A;  4JRP A;  4A63 B;  1K8A C;  1R8O B;  4NS5 A;  4PL6 A;  2IVW A;  3CXC S;  3JCM g;  2F5T X;  3NMZ C;  3P8D A;  2OTL T;  1YI2 Q;  2DZ9 A;  3EGX B;  2LCS A;  2DVE A;  1VQN Q;  4KUL A;  3OW2 P;  3CC2 Q;  5KE2 A;  2RHX A;  2DF6 A;  3S3N A;  3H0H A;  2JTE A;  3CXC A;  3S6W A;  4KUI A;  3TVT A;  2X4W A;  4PFZ A;  5LJ5 d;  2KRO A;  2MYS A;  3PFS A;  2L3R A;  4HVW A;  3OSV A;  4C92 A;  2F69 A;  2VKN A;  1U3O A;  4XAX B;  3FRN A;  5LJ5 e;  4PJJ A;  2X35 A;  1Q7Y U;  2AT1 B;  1ABO A;  2KE9 A;  1T3S A;  4OB3 B;  1B07 A;  1NBE B;  2F2W A;  5FWC A;  2QQB A;  1M1K R;  2ED0 A;  5IXB A;  5FU6 B;  1WI7 A;  2YUP A;  2ZCF B;  3PT9 A;  2LQN A;  5I2S A;  3CCL Q;  2X9H A;  2XID A;  3LH0 A;  4M7A B;  1RLP C;  3RIR A;  3JSC A;  3HSB A;  2IG0 A;  4RTW A;  3PVQ A;  1D1A A;  1X6O A;  1RLQ C;  1UG1 A;  3LGF A;  1AWW A;  5KCO A;  1D3B A;  3QPH A;  3WVE B;  1M5Q 1;  3EH1 A;  4C8Q B;  2I0N A;  3MHX A;  1I4K 1;  3VS6 A;  1VQ9 Q;  3PMI A;  4M7A F;  2RHZ A;  3EAE A;  1KD1 C;  4PJO C;  4C0F A;  1V1C A;  2RHU A;  4Y28 E;  3LW5 E;  1M4Z A;  5D7U A;  1YJ9 Q;  1BCO A;  3JAM E;  4EMK C;  5CAI A;  2L0A A;  2OI3 A;  4E7L A;  4C8Q F;  1K9M C;  1AD5 A;  3NTI A;  5GJW B;  3DB3 A;  5GMK l;  1OUL A;  2XHC A;  1N9S A;  3WVD B;  4PJN A;  1VQM A;  1BI2 A;  4RTU A;  2E12 A;  3RMQ A;  4R55 A;  2E1H A;  3FC3 A;  1VQ4 A;  2CZ0 B;  3FDR A;  4J5Y A;  1G5V A;  2RB6 A;  3PTA A;  3M0S A;  4PFP A;  2QTV A;  2AZS A;  3QDF A;  3UA7 A;  2X3X D;  2ATC B;  4JJC A;  4M78 E;  2JM8 A;  3EGU A;  4LDV A;  4EDU A;  1N27 A;  4DBR A;  1GFD A;  1W4S A;  3J7A F;  2JW4 A;  2DTI A;  1ZUK A;  3HFN A;  3CCE A;  3CME T;  2GF7 A;  1RAG B;  1UHF A;  1XNI A;  1NLO C;  5HY6 A;  4A4G A;  2F5K A;  3OW2 S;  4HT9 A;  3MJX A;  2HDA A;  5A0D A;  2VWF A;  1N5Z A;  4DBF A;  2W10 A;  2GGR A;  1K73 C;  1X2K A;  2LNH B;  1WJQ A;  5EC7 A;  3QYH B;  3TCJ A;  1TUG B;  1ZBJ A;  3CC4 Q;  3OW2 A;  3RDV A;  4M75 G;  3RBB B;  2AZV A;  2GQV A;  1JQQ A;  1WXU A;  2LVM A;  4HXJ A;  1FMK A;  2AK5 A;  4ZNX A;  1G3W A;  1P92 A;  3CCQ A;  2MK5 A;  5LJ5 j;  3G6E A;  2E4H A;  2D8J A;  1K0S A;  4DEY A;  2WAC A;  2OX7 A;  5IAY A;  3TU4 K;  1NJI C;  1KSW A;  2K79 A;  3MEV A;  5KCH A;  2CS7 A;  3C0C A;  3QBY A;  2A36 A;  4E6R A;  3OYM A;  2B8A A;  1VQL A;  1Q82 C;  1KFZ A;  2O4X B;  2VXE A;  3EG0 A;  1UTI A;  3NPF A;  1VIF A;  1RAC B;  4OMF B;  3QHS A;  1IXD A;  2LRQ A;  5KYW A;  2F2V A;  1I1J A;  2X3W D;  1Y96 A;  2JT4 A;  1YIJ T;  3OYD A;  1GBQ A;  3J80 E;  1NYF A;  5IH2 A;  4PNO A;  1MHN A;  1G3S A;  1OYX A;  2OTJ T;  2CT3 A;  1NPR A;  2FZK B;  5KYX A;  4E7J A;  1YHQ T;  2FPF A;  3H41 A;  4KUD K;  3M4G A;  2FPE A;  1GFC A;  2JMA A;  4D6W A;  5HK0 A;  2R58 A;  3QJ6 A;  2ZPH B;  3UDC A;  3C4S A;  4E2F B;  2FO0 A;  2XKO C;  3MP1 A;  1VQ6 T;  1Q86 C;  1W1F A;  4Y92 A;  3L2V A;  1K4U S;  4C0D C;  3INZ A;  2P0K A;  5IHI A;  5KYN A;  3VU3 C;  1AWJ A;  5CKD A;  4M75 C;  3EGX A;  3M57 A;  4M78 D;  2K6D A;  1LNX A;  4RTZ A;  4BB7 A;  1D0Z A;  4DBQ A;  3UF4 A;  4XU2 A;  1PNJ A;  1FWZ A;  2FYK A;  5CIU A;  4M7D E;  1ZLM A;  2RQU A;  4MML A;  4QVZ A;  1X6B A;  2RQW A;  2MIO A;  2RM4 A;  1VYT A;  3CMA T;  3NHN A;  4E47 A;  1VQ5 Q;  1RAI B;  4XTY A;  4OB2 B;  3CCJ Q;  1QVF P;  1VQ7 Q;  2KXD A;  3VUZ A;  3I5S A;  1U1S A;  2M0Y A;  3CCQ T;  1M27 C;  1AVZ C;  4ELZ C;  1Q7Y R;  5KYU B;  3G71 Q;  4OMM A;  1AEY A;  1SF9 A;  2L3Q A;  4RTY A;  5DM7 R;  1V76 A;  3SB2 A;  1Q81 C;  1VQ8 A;  2WSE E;  1QKX A;  2QAS A;  1JO8 A;  4M7A A;  3EG3 A;  3PGG A;  4GLM A;  2DXB A;  1UEB A;  4IUT A;  5LJ5 h;  1VQO A;  1YJN A;  3VV0 A;  2K3X A;  1G83 A;  4C8Q A;  3OQ5 A;  1GBR A;  1PSE A;  3QZ5 B;  3OYG A;  2A7Y A;  3HRT A;  4M77 C;  4B9X A;  3GOX A;  4OVA A;  2DYB A;  1KC8 C;  1JJ2 S;  4BAC A;  4WCI A;  2FRY A;  2L3P A;  3DKM A;  1YI2 A;  4LE9 A;  4C92 G;  2JMC A;  2G6F X; 
#chains in the Genus database with same CATH homology
 5C0M A;  3A8H B;  2MWP A;  2BUD A;  1N9R A;  3E19 A;  1YIT A;  4C5E A;  5LJ5 g;  2HQE A;  4C92 E;  2E6Z A;  4JS4 A;  3CC2 A;  1HK9 A;  3RKX A;  1VQM T;  4F7U F;  3O8V A;  1KQ2 A;  2LQ8 A;  4DA4 A;  1VQ4 T;  4M7A D;  1X75 C;  3C95 A;  3SFM A;  5FRO A;  2FHD A;  3LWI A;  4RMO A;  2KDS A;  4L6V 5;  2I2L A;  2E6N A;  2RJC A;  2HAX A;  4M7D C;  3UPU A;  4BI3 A;  5LJ3 g;  3JB9 F;  5FU7 B;  3FIF A;  3A8O B;  5GAN 6;  5M9O A;  2R5A A;  4PLI A;  5GAM h;  1M1G A;  3VKI A;  2FL7 A;  4FL6 A;  3JB9 I;  3CPW S;  2K57 A;  2ZPB B;  3CBM A;  2RJF A;  2DK3 A;  4BI8 B;  5IT9 E;  3DLL A;  3CCV T;  4M77 G;  2XK0 A;  2QTX A;  3M59 A;  4C8Q D;  2FVU A;  5GAN 8;  3OYC A;  3PNW C;  1Y96 B;  4J8O A;  2QDY B;  2KAF A;  2YRV A;  2LCL A;  3TEE A;  1DJ7 B;  2LC4 A;  3X28 B;  4L59 A;  4EMH A;  4M77 E;  1M8V A;  2E10 A;  3A8G B;  5CQX A;  4BI4 A;  3OYN A;  3I55 T;  2VYT A;  3CCR T;  4TVR A;  1JBM A;  3CPF A;  4OGC A;  1N6A A;  3URG A;  2DXT A;  2BKD N;  2PVO B;  4M77 D;  3T9N A;  4M78 B;  2RH2 A;  1YIJ A;  3CEY A;  2EJG A;  3MO8 A;  3CCE T;  4QQG A;  5CVI A;  3CCS A;  2QEX T;  3X20 B;  3M55 A;  3CC7 T;  1BI3 A;  1VIE A;  2EYQ A;  4KBM B;  2L89 A;  3JCM h;  4FSX A;  5LL6 S;  2QQA A;  3VUB A;  5CKF A;  3CCL A;  5GAM g;  4P5N A;  4ELY C;  2DJZ A;  2O01 E;  2RK1 A;  4XTX A;  2LNV A;  1YJW A;  2HD0 A;  3ER0 A;  3LX7 A;  4XTZ A;  4ZGE B;  5CK9 A;  1YHQ A;  3MET A;  1M90 C;  2P0P A;  3E1S A;  3GPL A;  2Y4Y A;  4PJO G;  3GNG A;  1GXI E;  3RES A;  1UGS B;  4M78 F;  3OMG A;  1PSF A;  3L2R A;  4HKE A;  3MCA B;  4C5I A;  3R6O A;  4PJO E;  4M7D D;  4IUR A;  2QA4 A;  4JRP A;  1K8A C;  1R8O B;  4NS5 A;  1VQ6 A;  1WGS A;  4IKF A;  3JCM c;  4X9D A;  5KE3 A;  1H3Z A;  1EIF A;  1WJR A;  4CI0 C;  4PL6 A;  3BDL A;  2IVW A;  1S72 T;  4M7D F;  1VQ9 A;  1UB4 A;  4JS5 A;  3JCM Q;  3RKW A;  3V8K A;  3CXC S;  3JCM g;  2F5T X;  3P8D A;  4PKC C;  4OB1 B;  4ZGD B;  2OTL T;  1KG1 A;  2DZ9 A;  2MF2 A;  1AHJ B;  2DD4 A;  1B34 B;  4UC4 A;  4QQD A;  4E7H A;  1IRE B;  1QVF S;  4BD3 A;  2DVE A;  5GMK h;  4KUL A;  1U8R A;  1G3Y A;  1YJ9 A;  1KD1 U;  1UGR B;  3G6E T;  2FB7 A;  5KE2 A;  3PIP A;  2RHX A;  3QXE B;  3S3N A;  2ZGW A;  3OMC A;  1KHI A;  3G4S A;  3VYH B;  3CXC A;  3V7R A;  2CZ6 B;  1UGQ B;  4RCB A;  3S6W A;  4NL2 A;  2LT1 A;  1YJN T;  1XTD A;  4KUI A;  2X4W A;  5GAO m;  2RK2 A;  2ZPI B;  3L2W A;  3GNF B;  1QVF A;  2DTO A;  5LJ5 d;  1K9M U;  4C92 C;  4M7D B;  1QVP A;  3PFS A;  3GIB A;  2GCX A;  2L3R A;  3QO3 A;  2DIG A;  1VQL T;  2V8K A;  4II1 A;  1Y71 A;  3OSV A;  4C92 A;  4R56 A;  1N8R U;  1U1T A;  2F69 A;  3WXM B;  2PVD B;  3ZFJ A;  3I56 T;  2XDD A;  2EFI A;  2M0O A;  1NE8 A;  3EFR A;  3JRZ A;  2RJE A;  3M58 A;  4XAX B;  3FRN A;  4JRQ A;  1VQ5 T;  1Y07 A;  4BDZ A;  1W2B S;  3CMA A;  1M9S A;  2JNG A;  4XTW A;  5LJ5 e;  1MGQ A;  1VQK T;  3CCJ T;  3GLX A;  3SDZ A;  5LJ3 d;  1VQ7 T;  4QVD A;  2X35 A;  2O4X A;  1Q7Y U;  3LGL A;  4BE1 A;  3BFM A;  1UGP B;  2RO0 A;  3JB9 H;  1TH7 A;  3A5Z B;  1NPP A;  4LDW A;  3ASK A;  4OB3 B;  1I5L A;  1QP3 A;  2CZ7 B;  4IUV A;  4DOV A;  2JTF A;  4C5G A;  2QQB A;  5FU6 B;  5LJ3 e;  1ZQ1 A;  3HL8 A;  2HNI A;  3OYF A;  2ZCF B;  3G71 T;  3PT9 A;  2EQJ A;  4N4G A;  2QQS A;  5I2S A;  5GAN h;  2K5L A;  1KHC A;  2MI6 A;  3LH0 A;  2XID A;  3CCU T;  4M7A B;  3RIR A;  5J26 A;  2EQK A;  3OS1 A;  3JSC A;  3HSB A;  2IG0 A;  5CO7 A;  3QJY A;  4GY5 A;  4B9W A;  1KQ1 A;  4QQ6 A;  1VQN A;  1X01 A;  1X6O A;  3KBG A;  2D6F A;  2PUK B;  3LGF A;  3OYB A;  5KCO A;  1D3B A;  1WPY A;  3OYA A;  5GAM d;  1JJ2 A;  1BI0 A;  2YHT A;  3QPH A;  3WVE B;  3M9Q A;  5KH6 A;  1M5Q 1;  4C92 D;  4F7U G;  3H6Z A;  4IUQ A;  5L8R E;  4C8Q B;  4QW2 A;  3JCM J;  3MHX A;  3LYI A;  2CGH A;  4J7I A;  1I4K 1;  1FXX A;  4ATO A;  3PMI A;  3S3O A;  4M7A F;  2RHZ A;  2L5Q A;  2HBP A;  3EAE A;  3JB9 G;  1KD1 C;  2AHJ B;  5GAM e;  4PJO C;  2K2V A;  4C0F A;  2M16 A;  5GAN g;  3FLG A;  4M77 B;  3A8L B;  2JZ2 A;  3CC4 A;  3QYG B;  2RHU A;  1K73 U;  4Y28 E;  3LW5 E;  1M4Z A;  4PJO A;  3OSS C;  3OYY A;  3X26 B;  5GAN 2;  3M56 A;  4MDW A;  3CD6 A;  3Q1J A;  3JAM E;  1QVG S;  4EMK C;  3VYG A;  5CAI A;  2YLB A;  4E7L A;  2LQK A;  3GF5 A;  4C8Q F;  3JCM d;  4BUG A;  3OYE A;  1K9M C;  2XDB A;  4JLI A;  2X4J A;  2WSF E;  3NTI A;  4EMK A;  2Y90 A;  2K4Y A;  3CPW A;  3OYI A;  3E9G A;  3DB3 A;  5GMK l;  4RG8 A;  1N8R C;  1V29 B;  1O9S A;  4XU1 A;  3N5B B;  2XHC A;  1N9S A;  3WVD B;  4M77 F;  4JRK A;  4C5H A;  4EMG A;  3J81 E;  2D9T A;  1QVG A;  3JCM e;  1VQM A;  1BI2 A;  2R57 A;  2E12 A;  3RMQ A;  2HQX A;  1WQW A;  4R55 A;  2E1H A;  2LDM A;  1G3T A;  2GFA A;  4N4I A;  3FC3 A;  1VQ4 A;  1Q7Y C;  2G3R A;  4OF1 A;  2CZ0 B;  5GMK i;  3FDR A;  4J5Y A;  4HT8 A;  4RCC A;  4E7I A;  3V7C A;  4A4H A;  1G5V A;  2E41 A;  2RB6 A;  3OB9 A;  3UT1 A;  1QP2 A;  4A4K A;  3PTA A;  4HCC A;  3E9F A;  3LLR A;  2DO3 A;  2DAQ A;  1IZ6 A;  4A53 A;  1NJI U;  4J6W A;  2LCC A;  4M78 G;  3M54 A;  2XU8 A;  2JN0 A;  1NZ9 A;  3CCV A;  2KSS A;  4XU0 A;  4KT0 E;  3NFC A;  4M78 E;  5FLX E;  5LJ5 f;  4LDV A;  5A2Q E;  4EPC A;  1BKB A;  3FJP A;  1Q82 U;  4PJO D;  4EDU A;  1N27 A;  3HRS A;  4MDX A;  1YCY A;  2EJF A;  4MZT A;  3ZBD A;  3I55 A;  3CCR A;  1W4S A;  2KVQ G;  2MWO A;  3J7A F;  3CBO A;  2GFU A;  2WSC E;  4M75 A;  4E7K A;  3DB4 A;  4FT2 A;  2DTI A;  3L1A A;  2RA2 A;  1HXD A;  3HFN A;  3CCE A;  2K5I A;  4ZTF A;  3CME T;  4BDY A;  2GF7 A;  5LJ3 f;  5GMK e;  2QEX A;  1VQ8 T;  3CC7 A;  2LT4 A;  3TRE A;  2JUF A;  1XNI A;  2VUB A;  5HY6 A;  4A4G A;  3JCM X;  3QKJ A;  5GAO q;  2F5K A;  3JCM W;  3OW2 S;  4HT9 A;  1H64 1;  3ME9 A;  1VQO T;  2P0Q A;  5A0D A;  3DLM A;  2EKO A;  2CKK A;  4N4H A;  1KQS S;  5CKE A;  1K73 C;  3C94 A;  2KK4 A;  4CRI A;  2DD5 A;  3QII A;  5AYF A;  1WJQ A;  1VQP A;  3QYH B;  3OBY A;  4IUP A;  3TCJ A;  1BI1 A;  2E64 A;  3OW2 A;  4ZGJ B;  2RHY A;  1BIA A;  4M75 G;  3HHT B;  3X25 B;  2GQV A;  2LVM A;  4A4E A;  3BY7 A;  3OA6 A;  1KQS A;  4M75 E;  3CBP A;  2ZPE B;  5GAM f;  2DZC A;  4F7U A;  1YI2 T;  2OTL A;  5GAN d;  4N0A C;  1Q86 U;  3RER A;  2EQM A;  1SSF A;  1YIT T;  2DTH A;  5A0L A;  1VQN T;  1G3W A;  5DLO A;  2NLU A;  1P92 A;  4N0A A;  4QVC A;  3CC2 T;  3CCQ A;  2JVV A;  4PLL A;  3SWN A;  5LJ5 j;  2E65 A;  3G6E A;  3KXT A;  1W2B A;  4DQ2 A;  1O75 A;  2QQR A;  1RL2 A;  2VXF A;  2WAC A;  5IAY A;  3JCM P;  5GAN e;  2EWN A;  2OAU A;  3TU4 K;  1NJI C;  3RMS A;  1I8F A;  4FT4 A;  4LDU A;  4XU3 A;  3HP9 A;  3MEV A;  4C92 B;  3L2Z A;  2LTO A;  5KCH A;  4V2S A;  4JJN K;  2CS7 A;  3QBY A;  2RD1 A;  5LJ3 j;  3OYM A;  2V8J A;  2B8A A;  3JCM f;  1VQL A;  2C06 A;  1Q82 C;  2K5F A;  3X24 B;  3OS2 A;  2O4X B;  2VXE A;  4HCB A;  4YTL A;  1ZBX A;  3I56 A;  2D0Q B;  2EQU A;  3OBW A;  4MMK A;  3CD6 T;  1VIF A;  4OMF B;  1M1K U;  2RI3 A;  3QHS A;  4IUU A;  2OTJ A;  4ME7 A;  4RKU E;  5GAN 5;  1VQK A;  2LRQ A;  5HKC A;  3GP8 A;  3M53 A;  3CCM A;  4F7U E;  4C92 F;  4OGE A;  5GAO r;  3VJP A;  1Y96 A;  3BDU A;  2L8D A;  4GLK A;  4OP0 A;  1YIJ T;  4M7A G;  1YHQ T;  3HRU A;  1JB0 E;  3OYD A;  3J80 E;  3CCS T;  4M78 C;  4NOY A;  2DXU A;  2DIQ A;  4X9C A;  4ZTJ A;  3OYL A;  4M7A E;  4PNO A;  5CCA A;  4WF2 A;  1MHN A;  4LD6 A;  4M78 A;  4A4F A;  4FIB A;  4XTV A;  4O5V A;  3G71 A;  3CCL T;  1G3S A;  1OYX A;  1XOV A;  3MP6 A;  3JB9 D;  3OS5 A;  2OTJ T;  5GAM j;  1BIB A;  1NPR A;  2QXF A;  3FEO A;  5CQY A;  4C8Q G;  2XG8 D;  5CR2 A;  4E7J A;  4L5G A;  5IN1 A;  2E5Q A;  1D3B B;  5GMK m;  4KUD K;  3M4G A;  3CCU A;  2VV5 A;  3QUI A;  4Q5W A;  2DEQ A;  3RUX A;  4C8Q E;  2XD0 A;  5A0G A;  5GAN 7;  5J39 A;  4NL3 A;  4D6W A;  4M7D A;  3LWH A;  5HK0 A;  1FX7 A;  2R58 A;  3QJ6 A;  2EIF A;  2QA4 T;  3MEA A;  1OI1 A;  2ZPH B;  3OYK A;  4OB0 B;  2DPP B;  3C4S A;  3MP1 A;  2XKO C;  4LDY A;  3UDC A;  5C6S A;  5GAO p;  1Q81 U;  1VQ6 T;  3P8H A;  2PUO B;  1Q86 C;  1JRI A;  2EJ9 A;  2XDP A;  3HFO A;  4C0Z A;  1VQ9 T;  1YBY A;  4RG2 A;  2R5M A;  4BY6 C;  3UWN A;  4PJO B;  5CKH A;  3FB9 A;  4X34 A;  5EG2 A;  2KQW A;  3L2V A;  3G7Z A;  5FRN A;  4C0D C;  2DKG A;  2DXC A;  3INZ A;  2P0K A;  2BIV A;  2Y4X A;  1YJ9 T;  3AHU A;  4EMK B;  5GAO n;  2V8I A;  2RJD A;  3JCM b;  3VU3 C;  3V8J A;  3PIO A;  4J83 A;  1Y7X A;  5CKD A;  3G4S T;  1B34 A;  4M75 C;  3M57 A;  4M78 D;  3JCM V;  4M7D G;  2PVG B;  3H8Z A;  1BYM A;  1KC8 U;  1LNX A;  5GAN 3;  4PJO F;  2A3L A;  4FM4 B;  4BB7 A;  3S3M A;  2JTM A;  3QSU A;  2ZZD A;  4XU2 A;  1FWZ A;  1ZHI A;  2FYK A;  5CIU A;  4MML A;  3OYJ A;  4M7D E;  4QVZ A;  4JRI A;  1M1K C;  3SD4 A;  1VQP T;  3NTH A;  1YJW T;  2X4X A;  5D6X A;  3MP8 A;  2VC8 A;  5GAN f;  4C0G A;  2M1H A;  2RM4 A;  2XIC A;  3C12 A;  2PU9 B;  3V7S A;  3RKY A;  4A54 A;  4BY6 B;  4E47 A;  3CMA T;  2EAY A;  4XTY A;  1OZ3 A;  1WNL A;  4DOW A;  4OB2 B;  3L2U A;  2K3Y A;  5GMK j;  2H3J A;  3QDR B;  4C0D B;  2QQ9 A;  3P8B B;  2MMP A;  4MZP A;  4XK8 E;  2KY9 A;  3A8M B;  4ZN3 A;  3VUZ A;  1U1S A;  5J3B A;  3M4Y A;  2RI5 A;  4BE2 A;  2YLC A;  4J6Y A;  2QI2 A;  3CCQ T;  1RI0 A;  4M75 B;  4Y91 A;  4ELZ C;  3NTK A;  5I2M A;  4LD9 K;  1LJO A;  3M5A A;  4O6J A;  5FU6 C;  1M1F A;  1S72 A;  2ZPF B;  1WQ7 A;  4HCZ A;  3QZ9 B;  4J7F A;  1QW1 A;  2CYZ B;  5I21 A;  5D6Y A;  2E70 A;  3SWN C;  5GAO l;  3V8L A;  5DM7 R;  3QG1 A;  3SB2 A;  4M75 D;  5GAN 4;  4M7A C;  4HA8 A;  2ZPG B;  1Q81 C;  5D6W A;  3BW1 A;  5DY9 A;  3CME A;  1VQ8 A;  4ZN1 A;  2WSE E;  3L2Q A;  4LDX A;  3HPW A;  4XTU A;  2VGN A;  3HKS A;  3KUF A;  2M9U A;  3OS0 A;  4M7A A;  5FRM A;  3PGG A;  4M75 F;  2P4T A;  5DLQ E;  1XQH A;  4JLG A;  2DXB A;  1UEB A;  1OZ2 A;  2LX9 A;  3EFS A;  4IUT A;  5LJ5 h;  2XI9 A;  3OY9 A;  1VQO A;  2VGM A;  1YJN A;  3ZEH A;  3PMT A;  3CCM T;  4C8Q C;  3F70 A;  3VV0 A;  4VUB A;  4JDS A;  4Z02 A;  2K3X A;  4BE0 A;  5HK3 A;  4C8Q A;  5FU7 C;  1M90 U;  3OQ5 A;  1PSE A;  4JUV A;  3CC4 T;  1WJS A;  2X4Y A;  2RHI A;  3L42 A;  2KMT A;  3QZ5 B;  5GAN j;  3OYG A;  4F7U B;  3JB9 J;  1LOJ A;  2A7Y A;  3HRT A;  4J6X A;  4M77 C;  2JOY A;  5LJ3 h;  4B9X A;  4OVA A;  3OYH A;  3GOX A;  1KC8 C;  1VQ5 A;  1I81 A;  4MZM A;  1JJ2 S;  4BAC A;  2CZ1 B;  3CCJ A;  4M77 A;  1VQ7 A;  1K8A U;  3SWN B;  3DKM A;  4XQ3 A;  3MEW A;  2MAM A;  1YI2 A;  3MEU A;  4FU6 A;  1VUB A;  4C92 G;  5CKB A;  2RI2 A;  2PQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...