2HQXA

Crystal structure of human p100 tudor domain conserved region
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
TQFQKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFSTRVLPAQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P100 CO-ACTIVATOR TUDOR DOMAIN
publication title Crystal Structure of Human P100 Tudor Domain Conserved Region
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
A PF00567 TUDOR Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2hqxA01
3LH0A 4RG2A 2HQXA 2QQSA 3EAEA 1OYXA 4BD3A 2G3RA 2EQJA 2RJCA 3GOXA 1OZ2A 4N4GA 3FEOA 2JZ2A 3H6ZA 4QW2A 3OYHA 2EQKA 4Z02A 3UT1A 4B9WA 2K3YA 2GFAA 3CEYA 3H8ZA 1WGSA 3NTHA 4PLIA 3MP1A 5FRMA 2L3RA 4LD6A 1KHCA 4Q5WA 3OQ5A 2M0OA 3LYIA 3OS2A 2NLUA 4C5EA 1RI0A 4C5GA 2X4YA 3MEUA 3QJ6A 4OVAA 4C5IA 3QKJA 2MWPA 3OMCA 3S3OA 3PNWC 2RJEA 3MP8A 4HCZA 4IURA 3OYLA 2LDMA 2F5KA 2P0KA 2RHZA 2K3XA 5CIUA 3M9QA 5KCHA 3S3MA 2B8AA 3OYCA 3DB3A 3Q1JA 1MHNA 2E6NA 3ASKA 2R57A 2XK0A 2RHYA 3MEAA 4PLLA 1XNIA 4QVZA 4E7KA 4A4EA 3LX7A 3S3NA 3META 2RHUA 4L59A 1WJRA 3E9GA 5IN1A 5IAYA 3E9FA 2QQRA 3ZEHA 2O4XB 3C4SA 2XDPA 3UWNA 4B9XA 1WJQA 3QIIA 3OS0A 1OI1A 4E7JA 1WJSA 3DLMA 5KH6A 2O4XA 2DIQA 3OS1A 4PL6A 4N4IA 3MO8A 3L2UA 4C5HA 4E7HA 4II1A 2L89A 4E7IA 4ZTJA 2WACA 2RI3A 4UC4A 2R58A 5FRNA 4IUVA 3FC3A 3MEWA 2GF7A 3OYBA 1G5VA 3ME9A 3OA6A 2DAQA 5KCOA 2JTFA 3SD4A 3OYNA 4BDZA 3PFSA 4A4FA 2RHIA 4BACA 3O8VA 2M1HA 2YRVA 4IUTA 5C0MA 2L8DA 2X4XA 4BE1A 2RO0A 5D6YA 2EKOA 3LLRA 3LGFA 3L2QA 5KE3A 4ZTFA 3DB4A 4BE2A 5FROA 3OYKA 4A4GA 3L2VA 4IUPA 2R5MA 2RJFA 5C6SA 3PMIA 2BIVA 2EQMA 2RHXA 3OYEA 3NTKA 1H3ZA 1SSFA 4IUUA 3NTIA 4QQ6A 2LRQA 2BUDA 2RI5A 2CKKA 3MP6A 3PMTA 3OYGA 3L2RA 3OYDA 4BDYA 2RJDA 3OMGA 3OYAA 3MEVA 4IUQA 4X34A 3L2WA 4BE0A 3FDRA 5M9OA 3L42A 2DIGA 4IKFA 2X35A 2X4WA 3BDLA 2EQUA 4FL6A 3LGLA 4GY5A 4A4HA 2E5QA 3FLGA 5J39A 1N27A 2GFUA 3P8DA 5J26A 2EFIA 2LTOA 4QQDA 3OY9A 2M16A 2BKDN 3S6WA 2LCCA 2FHDA 4NS5A 3OB9A 3QBYA 2MWOA 3P8HA 4FU6A 2HQEA 2VYTA 3KUFA 3F70A 2RI2A 4EDUA 3OYIA 3OYMA 2IG0A 4E7LA 1OZ3A 5D6WA 5D6XA 4CRIA 2LVMA 2R5AA 4N4HA 2D9TA 5KE2A 2PQWA 4QQGA 3OYJA 3OYFA
chains in the Genus database with same CATH superfamily
1W6XA 1H8KA 4N0AC 2DL4A 2RJCA 1M1FA 2C0OA 5GAN3 2VWFA 3FEOA 2EQKA 2RQWA 1QKXA 3CPWS 1ARKA 1G3YA 4EMKB 2HL3A 1KHCA 2PNIA 1I5OB 2DRMA 3LYIA 4C5EA 2X4YA 2VC8A 1MMNA 3CCSQ 1RAIB 3TCJA 3CCST 5L8RE 4IURA 3TSWA 4C92E 5KYUA 1NEGA 1U1SA 2K2VA 1V76A 4PJOC 3S3NA 1SKUB 1YITA 2KK4A 1T3LA 2O4XB 4XTZA 2XG8D 3OS0A 2ESWA 4M7AB 1UFFA 3C95A 3MO8A 2QI2A 2L3PA 3G6EA 2CH4W 5LJ3h 2JN0A 1BB9A 4OMQA 1K76A 2P4TA 3FJ5A 2HD0A 3CCLQ 1R8OB 4LDVA 2XIDA 4M7DA 1JJ2S 2D1XA 3VV0A 3EG3A 1WHHA 1YN8A 3N5BB 2RQVA 2QTXA 2FPDA 1NLPC 2J6OA 4D6WA 2EWNA 2IVWA 1NYGA 2V1QA 4ORZA 2JXBA 5IH2A 3I35A 1TH7A 5CKBA 4A54A 2GFUA 4XU2A 2RQRA 4XQ3A 4OF1A 4TVRA 4Z88A 1K73C 4LNPA 2RI2A 4E7LA 4FM4B 2LVMA 3X24B 3EGXB 2VKNA 1RAAB 4OGCA 1K73U 2KNBB 1N8RC 1AWJA 1YJNQ 2HDAA 1TU0B 2ED1A 3NPFA 1HK9A 1YJNT 2E3IA 1QCNA 3OW2A 2ZPBB 5GANg 5GAN2 2DJZA 3VU3C 4E2FB 4J5YA 4M75C 3QDRB 3QKJA 5KYXA 4HCZA 5LJ3f 3JCMQ 2HKQB 1PRLC 2XU8A 1E7OA 1WX6A 1WFWA 4E7KA 2H8HA 1AVZC 1NYFA 1WJRA 3E9GA 3QWXX 5IAYA 3M56A 3ZEHA 1FYNA 1OI1A 2VUBA 4E7HA 3RESA 4ZTJA 3SWNB 4C8QB 1G5VA 3BFMA 1PHTA 1RAHB 3SD4A 2PUOB 2E64A 2RHIA 4BACA 4XU1A 1U8RA 2KE9A 3URGA 1Q86C 3E2UA 5DLOA 4ZTFA 5A0LA 1FMVA 1Y96B 3OYEA 4MZMA 2RPNA 2GGRA 5KYNA 2LRQA 1KJWA 2BUDA 2CKKA 4JS4A 1M27C 1NPRA 4J9CA 3MEVA 4X34A 1WHLA 4C0DB 3TSZA 2X4WA 2VVKA 2EQUA 2KT8A 3RKWA 4J9GA 4C8QD 3CCEA 2AKLA 4M77E 1HD3A 2DEUA 4JLIA 1TUCA 5LJ3g 1WI7A 4JJCA 1K9AA 1IZ6A 3H0IA 2D9TA 1WQWA 2XDDA 4RTTA 4VUBA 2DMOA 4MZTA 9ATCB 4M78E 3GOXA 2X3XD 4CC3A 1W2BA 1M90R 2ZCFB 2X3WD 2XI9A 3JCMP 3MCAB 1M4ZA 4GLMA 4LD6A 2DBKA 3KFVA 1Y07A 4EMKA 1OU9A 2J06A 2CT4A 4MDWA 5ECAA 1K9MC 1H92A 1BKBA 2LQNA 1UECA 1NEBA 3TU4K 3CMEA 2DA9A 1SRLA 4AFQC 4EMHA 1K8AC 4PJOF 3OYCA 3CCVQ 1K9MU 3QYHB 3CCVT 3SFMA 2HKNA 2LP5A 4PLLA 3LX7A 2DD5A 1WQ7A 2DYIA 3EH1A 4OMFB 1TG0A 4JZ3A 3I55Q 1QVGS 3CCEQ 4MMKA 3I55T 2O4XA 3CCET 4PL6A 4N4IA 4M7AA 4KGZB 1VQ8A 3CBPA 1PNJA 2EW3A 2AK5A 3I5RA 3OW2P 2EYQA 5LJ5h 3IQLA 1ZSZC 2KYBA 1FX7A 3TEEA 1KQSS 2V8KA 4JS5A 1H3HA 2ZGWA 1PSFA 3GLXA 3VS2A 1TUDA 4DBFA 3RNJA 2LC4A 3L2VA 2P0PA 1XOVA 3BW1A 1X2QA 1CKBA 4PJNA 2V8IA 2RI5A 1JJ2A 4BE0A 1Q7YR 2Z0WA 2DIGA 3CC2Q 4C92C 3CC2T 2LJ0A 1OU8A 2O01E 1AT1B 5J39A 3RMQA 2LCCA 5A2QE 3EGUA 1T3SA 2IG0A 4AFZC 3V7RA 5D6XA 1QW1A 2PQWA 1VQ4Q 1VQ4T 1OYXA 3EGXA 5GANd 1VQ8Q 3NGPA 2VV5A 1VQ8T 4FSXA 1VQMQ 1VQMT 3UT1A 4B9WA 2XD0A 2Y4XA 4M75F 3H41A 2CUBA 2ABLA 2CYZB 2E4HA 5GJVB 3EG9B 4A63B 5HKCA 3MEUA 1O75A 3I56A 4J9FA 1Q82R 5L23A 5GAOn 3CCQQ 2K3XA 2BTTA 5LJ5f 3CCQT 1YBYA 5GJWB 2D0NA 1JXMA 3VKIA 3BE3A 4RKUE 1WXTA 3UWNA 2MMPA 1XTDA 3VUBA 3FIFA 4M7DE 2QQBA 2BE9B 1BCMA 2CZ0B 1W2BP 2WACA 3QSUA 5FU6B 1TTHB 4XTXA 2JTFA 3SWNA 1U06A 1VQ5Q 3QO3A 3PFSA 4C8QA 1VQ5T 4PFZA 2X4XA 1NJIR 2A28A 5KE3A 1PKTA 3CPWP 3OYKA 4A4GA 4AFSC 2MCNA 1GBRA 5C6SA 3A98A 2O2OA 1SSFA 2COYA 3OYYA 3VS3A 1Y96A 3OMGA 1C1AA 3PVLA 4IUQA 5I21A 2CP5A 1IHWA 2MPXC 5GAOq 1QWFA 3CC7A 3M59A 2DEQA 3P8BB 1NLOC 1GRIA 3X20B 1N27A 3OY9A 2ZAEA 2LQKA 2OJ2A 1ZLMA 2HQEA 2JOYA 3F70A 5LJ5g 2DX1A 4EPCA 3OYMA 1BI1A 3J7AF 3GNFB 5KE2A 2DM1A 3LWHA 2CH4A 1VQ7A 4QQGA 1IHVA 4PJOG 3QJYA 4Z89A 4BD3A 5EG2A 2ROLA 1QVFS 3GP8A 3H6ZA 3SEMA 2YUOA 1G8XA 1JJ2P 1R0BG 4M7DD 3SHWA 1YHQA 3OS2A 5GANj 3SDZA 4J9HA 4KUDK 2J6KA 2MWPA 1QP3A 3REAB 2DKGA 3BY7A 3CCMA 4LDUA 3CCRA 2DL5A 2FZGB 2NUZA 3V8KA 4HCCA 2VXFA 2MOXA 5GAN8 1MHNA 3G7ZA 1YIJA 1BIAA 4FT4A 4GLKA 1TSFA 5KYYB 1ZBXA 3VYHB 1Y7XA 2NYSA 4F7UF 2LCLA 2C0IA 1OX8A 2QQRA 3ZBDA 4M77C 2QASA 2KRMA 1K1ZA 3CMAA 2OTLA 2E3HA 1UEBA 1YI2A 1YNZA 1WZOA 4LDYA 3G71A 2OTJQ 1BI3A 1GFDA 2OTJT 3JSCA 1ZUUA 4M78C 3ZL7C 1AD5A 2I2LA 2PTKA 5LJ3e 1K0XA 4PFPA 3FRNA 2R5MA 4E47A 4OMOA 1BBZA 4J6WA 1H3ZA 2QQ9A 3PMTA 3L2RA 4C92F 4RG8A 3CCUQ 4D8DA 3CCUT 1YJWA 3LGLA 1B34B 2QA4Q 1M3BA 1MGQA 1KSWA 2QA4T 2DK3A 2MF2A 3CCRT 1KIKA 5GAMh 1CSKA 1VQOQ 1EX4A 4M75G 1VQOT 2COWA 4NS5A 5A0GA 1ZA2B 2D0QB 2CUDA 4RUGA 1N9SA 2E12A 1TUGB 4MMLA 1OZ3A 2ROTA 3CMAQ 2DXUA 3EAEA 2OTLQ 3CMAT 2RM4A 4JJDA 2BE7D 2OTLT 2QEXA 1M8VA 1YI2Q 2DL3A 5CR2A 1YI2T 1ZUYA 4Z02A 4C0GA 1YJ9A 2K2MA 2HQHA 1UB4A 1NG2A 3M0PA 1VQLA 4AFUC 2B86A 5AYFA 3HKSA 3EG9A 3WVDB 4JZ4A 4CC4B 4DBRA 2ZPGB 1TXQA 2CZ6B 2VB6A 2RMOA 2L3QA 1UHCA 2XHCA 5AT1B 4M7AE 2R57A 5GAOm 5GMKm 3META 4L59A 2LX7A 2G6FX 4KGVB 1PM3A 1AWWA 1NBEB 2QG9B 1X75C 1OEBA 1W1FA 4OB3B 4UC4A 1Y71A 3MEWA 1S72A 3OA6A 2L2PA 4QVCA 3VRZA 2CP2A 3I5SA 1Q81C 3RMSA 4XTYA 2M0YA 2KT1A 4HVVA 1PKSA 3EFOB 4FW1A 5GAMf 1RLQC 4RCCA 4DBQA 1GCQA 1OV3A 2YT6A 3CXCA 1Q81U 1UGPB 2SRCA 1SRMA 4E7ZA 4E7SA 1MNEA 3X26B 3MP6A 1M3CA 4HVWA 3PE0A 1I4K1 3OYAA 1VA7A 3L42A 3QPHA 2YLCA 4C0ZA 3INZA 3JB9H 1EZZB 3M54A 1ZX6A 2VYTA 3OYIA 1N8RR 1JU5C 1XJWB 2QQAA 5D6WA 4M7DC 1QWEA 2AZVA 2LMJA 1XQHA 1EFNA 2DTOA 1MMDA 4M7AD 1E6GA 2FB7A 2DXTA 4OB0B 1X6GA 4F7UG 2FL7A 1PSEA 2DO3A 4JRKA 5FU7B 3OQ5A 2M0OA 2HEQA 3UF4A 4RTZA 2NLUA 1YITQ 4L5GA 1YITT 4GBQA 2PVDB 4AG2C 1LVKA 1N5ZA 3R6OA 4NL2A 5GAMg 2DERA 1ABQA 3A8MB 3G6EQ 3G6ET 4M77F 2I0NA 2O31A 3LW5E 5KYYA 3E9FA 3JB9D 3JV3A 1WJQA 3PGGA 4C8QE 2A08A 3DLMA 1LJOA 2FZCB 1TOVA 4C92G 4RTYA 1VYVA 2JTMA 4IUVA 1Q86R 4M78F 2GF7A 2YUNA 3KBGA 4XAXB 5KCOA 3JCMh 4BI4A 2HCKA 1IO6A 2E10A 1VYTA 5GAN6 2DJQA 3JRZA 4ATOA 3M0TA 3CC4A 5LJ5e 2KQWA 3PT9A 1X01A 3JB9I 3O5ZA 3DB4A 4IIMA 4KGXB 2IPOB 3H0FA 2M9UA 5I22A 3QZ9B 2LNHB 2GTJA 2HBWA 4J7IA 2PUKB 1SG5A 3QWYA 3VUZA 3UPUA 2EYYA 1VQ6A 2RQTA 2LJ1A 2Y4YA 1B34A 3S6WA 2JNGA 3BDUA 2YRCA 4XTVA 3SB2A 3JCMb 1UJYA 2EGAA 2FRYA 2R5AA 1IB8A 2A0FB 1UHFA 2QQSA 1QP2A 4PKCC 3CXCP 4RTXA 2JZ2A 1YCYA 4D8KA 1WA7A 1UUEA 4DEXA 2YXYA 3NTHA 3JCMV 1HSQA 1E6HA 3M0RA 4LE9A 5IHIA 5FWBA 1K8AR 2DFUA 1U1TA 3VS6A 2V26A 3VJPA 2LDMA 2F5KA 3QHSA 5GAN7 1KHIA 2EJ9A 4FSSA 1KFZA 4R0KA 2E70A 3JCMf 1RAFB 1X2KA 2E6NA 4F17A 2XK0A 4Y28E 1LNXA 2RHUA 1ZQ1A 1BCOA 5CCAA 2YRDA 2DNUA 2KSSA 2RH2A 4P5NA 2L89A 3GNGA 2DILA 2EJFA 1WHJA 2RD1A 4BI3A 3CPWA 5FRNA 1KQ2A 2HNIA 4EMKC 1VQNA 4Z8AA 5IHKA 4DBHA 2CREA 1I07A 4IUTA 4F14A 5I2SA 1QVFP 2VGMA 3CBMA 2KRNA 2HZYA 4BY6B 3L2QA 4HVUA 3A1PA 1X69A 4BE2A 4X1VA 3EFOA 1F1BB 2BIVA 1QMCA 4JPBW 4M77B 2KMTA 5GAOp 2NUPB 2WSEE 4FW2A 1A0NB 3E1SA 2K9GA 3EHRA 3VS7A 2DE0X 2DPPB 5CKEA 5CO7A 4M7AC 4QQDA 4CC2A 5KYWB 8AT1B 2FPFA 2LNVA 3QDFA 4RTWA 1M90C 4M7DF 1R77A 2E1HA 4J9BA 2L5QA 3JCMW 2AHJB 2WSCE 2NUTB 3LH0A 1VUBA 2DTIA 2V8JA 1M90U 3CD6A 3ULRB 3CMEQ 4M77G 4ZGEB 2GTOA 2HBPA 3CMET 5CK9A 4RMOA 2RA2A 2KAFA 4JRIA 3V8LA 1WXBA 2CGHA 4PK4A 2KEAA 4Q5WA 3ZFJA 2K5LA 4AG1C 1FMWA 3HTRA 4HCBA 3HRUA 2RJEA 4M78G 3OYLA 1D09B 1V1CA 1PD1A 4ZNXA 3U23A 1W4SA 2J6FA 1RLPC 4A4EA 3TREA 1D1BA 3J81E 2O9VA 4NOYA 4J9EA 4B9XA 4E7JA 4V2SA 1RACB 2DIQA 3RR6A 3OS1A 4JLGA 4J6XA 4HCKA 3JCMX 5EC7A 2C06A 3V7SA 2YSQA 3JAME 3EH2A 4JJNK 1JQQA 1M1KC 2RO0A 3C0CA 2DBMA 3RKXA 1ABOA 1IRXA 5IXFA 3L2ZA 1WDXA 1M1KU 3NTKA 3WXMB 1Q7YU 1LCKA 3OYGA 1Y0MA 3M0QA 2DETA 4X9CA 2FZKB 1FWZA 3UA7A 1SEMA 2K7AA 1DJ7B 4OB2B 2LTOA 2X4JA 3NMZC 2BKDN 2QK0A 5CKFA 1G2BA 1KC8C 3OB9A 3SWNC 2HAXA 4PJJA 4PJOB 4C8QC 5GAMe 1WXUA 2MIOA 3VS4A 2CP0A 6AT1B 1KC8U 2W0ZA 4QKUA 1VQ9A 1ZHIA 2OAWA 5GAN5 3I56Q 5LJ3d 4HXJA 3MJXA 3I56T 2LQ8A 2FYKA 4PJMA 5FWCA 4PLIA 1WNLA 1JO8A 1X6BA 4KH1B 4C0DC 1HJDA 4C5GA 3OS5A 3QJ6A 2K4YA 1SF9A 2FRWA 2MYSA 3S3OA 3PNWC 1M30A 4PJOD 1AOJA 3X25B 1VOMA 1PCXA 1Z9QA 1LPLA 4OMLA 2CZ1B 2EBPA 3H0HA 1YFNA 1I8FA 2M51A 1B7TA 1XNIA 4Y91A 1UGRB 2NWMA 5GMKi 1NPPA 2XDPA 1JBMA 2ZPIB 1WJSA 1X43A 2ATCB 1NJIC 1KD1R 5HK0A 1BK2A 5GMKj 5DM7R 2DTHA 2JVVA 2COZA 1NJIU 2JS0A 1VQ9Q 1VQ9T 1UJ0A 2A3LA 2EIFA 1PD0A 2F2VA 3LGFA 3A5ZB 5J3BA 3CC7Q 2DL7A 2KVQG 3CC7T 1CKAA 1ACMB 1VYUA 4M7DG 1FMKA 1RAGB 1SPKA 3M0SA 1N6AA 4LDXA 4BUGA 2RHXA 4OP0A 3OW2S 2DD4A 4IUUA 2J7IA 5IXBA 2KR3A 1Q95G 2P84A 4M77A 3VS1A 2E6ZA 2NUPA 4M7AF 4M75B 7AT1B 3HFOA 1QVGA 2C0TA 1VQ7Q 2LCSA 1T0HA 3FLGA 1VQ7T 2VASA 2M16A 1D0YA 1AEYA 1WYXA 2RQUA 5KYWA 2IIMA 2L0AA 1KQSA 1YHQQ 4HA8A 2GNCA 2X9HA 2H3EB 4LUDA 4LN2A 1YHQT 1BI2A 4MDXA 2NUTA 1HYOA 2V1RA 2CP7A 1QQJA 4YTLA 3CCMQ 3CCRQ 4J7FA 3CCMT 1D3BB 1Z9ZA 1WGSA 3JB9F 3G1JA 1YIJQ 1ZUKA 2QYZA 4OMMA 4KBMB 1YIJT 3EHQA 2HMAA 5CKHA 5LJ3j 3OMCA 4JRPA 4KULA 4L6V5 1P92A 3DLLA 2RHZA 5DLQE 3HSBA 3M9QA 1ZA1B 5HY6A 3QYGB 1M9SA 3RKYA 3G71Q 4LXCA 4IIOA 2OAUA 3G71T 3CCSA 3QIIA 1I1JA 2BZ8A 5KH6A 2YUPA 1Q81R 1I0CA 5DY9A 2DYBA 5GANh 3H9NA 2QTVA 4E7IA 1B07A 3J80E 4BDZA 4XTUA 4J8OA 1VIFA 1RABB 1TS9A 2EYWA 3FJPA 2PZ1A 3JCMe 1YJWQ 1TWBA 4N0AA 4O6JA 1YJWT 2YLBA 2KY9A 1IREB 1W2BS 3PIOA 2EQMA 2RF0A 4MZPA 4DQ2A 4QQ6A 1RUWA 3CCLA 1MMGA 5I2MA 2OX7A 3HPWA 3VS0A 5GAN4 4PJLA 5CQYA 2QDYB 4GY5A 1WHMA 2E5QA 2DXCA 1OX9A 3P8DA 2EJGA 3X28B 4C8QF 3T9NA 4LUEA 4KT0E 2RN8A 2QEXQ 5CVIA 5FU6C 2QEXT 2KXDA 3E19A 3UDCA 1YJ9Q 4PJOA 1YJ9T 2CZ7B 1SHFA 3GBQA 3OYJA 1VQLQ 1JXOA 2LQWA 3LWIA 4F7UB 1GCQC 1VQLT 2KI7A 4RG2A 2KROA 1AWOA 1OOTA 2G3RA 2EQJA 2KBTA 3PTAA 2YUQA 4N4GA 1S1NA 2O9SA 1K73R 3OYHA 5LJ5d 3M55A 4WTOB 2E5KA 2MAMA 1ZSZB 4EMGA 1M2OA 1QVGP 1I5LA 5GANf 2K6DA 1YJNA 4PFOA 2X51A 1YWOA 1QCFA 1C0MA 3S3MA 2JW4A 2ED0A 5GMKl 4PNOA 5GAOl 1AHJB 2EKHA 2FPEA 3CCLT 4OB1B 2RHYA 1KK7A 1S72Q 1S72T 3HRTA 4C92B 1KQSP 3QXEB 3A8HB 1M8MA 1NZ9A 2DL8A 3D7SB 1K4US 2H3JA 1QVFA 1Y57A 4FIBA 4C5HA 4J9DA 1OPKA 2CP3A 2CDTA 3PVQA 2R58A 4A4KA 2E65A 2LJ3A 1D0ZA 2K79A 4M7AG 1BU1A 4M4ZA 2HSEB 2EYZA 3HHTB 3NHNA 2F2XA 5D6YA 3LLRA 1ZSGA 2J05A 1BYMA 4XTWA 1QCOA 4R56A 1ZBJA 4IUPA 5D7UA 1FXXA 4C92D 2A37A 4WCIA 1MMAA 4NL3A 2DLPA 3LH5A 3HP9A 3FDRA 1UE9A 4ME7A 5FLXE 5M9OA 4ELZC 3BDLA 2RK2A 2JUFA 4M75A 3MHXA 5J26A 2EFIA 3JB9G 1N8RU 2FHDA 4BI8B 3NFCA 1J3TA 2K5IA 4RCBA 2CSIA 1T0JA 3UA6A 3OYFA 8ATCB 1WHKA 3EFSA 2KXCA 2XMFA 4FYVB 2AKKA 3RDVA 2GQVA 3CBOA 1I81A 2K3YA 3CEYA 2YHTA 1H641 2L3RA 1D3BA 1GL5A 1U5SA 4QVDA 4AT1B 1M1GA 2HL5C 5LJ5j 4CC7A 3EG1A 3A8LB 1G83A 1BIBA 1MV3A 1MNDA 1GFCA 5CKDA 2FVUA 4FT2A 4QVZA 1K9MR 2VGNA 1UGVA 3C4SA 4KH0B 1GXIE 1OQKA 2KDSA 2PVGB 1VQKA 3CC4Q 2FG0A 1C6VX 4CI0C 3CC4T 3CCVA 3L2UA 1Q86U 1AZGB 3RIRA 3DKMA 1RI9A 3MPUB 2PU9B 3OYNA 1NM7A 2M1HA 3I55A 4Y92A 2M02A 4C8QG 1WLPB 2GQIA 3HFNA 1VQ6Q 1VQ6T 2VXEA 3PMIA 3JCMJ 2JJ9A 1IGUA 1KG1A 1WHGA 2FO0A 2RJDA 3GPLA 2ZPFB 1G3WA 4IKFA 2PVOB 2X35A 5CAIA 4A4HA 1WPYA 3R6NA 5IHNA 2KRSA 4A53A 4EDUA 3PIPA 1AWXA 3CC2A 4ESRA 3KXTA 1VQKQ 1G3TA 1VQKT 1M2VB 4OMNA 1N9RA 1PG5B 1NE8A 1D1AA 4F7UA 2DXBA 1OZ2A 3HRSA 5HK3A 1QLYA 1UTIA 3H8ZA 2WSFE 1K8AU 4JUVA 5I11A 4FYWB 4M78B 1VQ4A 2ENMA 1ZSZA 2D8HA 2ECZA 1RI0A 3JCMg 3EFRA 3OBWA 1JRIA 4HT8A 5FW9A 2FEIA 3EGDB 2E41A 1VQMA 4DEYA 1SSHA 5CIUA 1UDLA 1G3SA 4M77D 4QT7A 3M0UA 1PWTA 1VQNQ 5IN1A 3C94A 5CQXA 1VQNT 4FCYA 1MV0B 3TVTA 4DOVA 2QXFA 4C92A 5GAMd 3CCQA 1WIEA 3JCMc 2EPDA 1LOJA 4M78D 1BI0A 1M1KR 4F04B 3OYBA 2DAQA 3UATA 3O8VA 5FU7C 2YRVA 3OBYA 5C0MA 5IT9E 4BE1A 4C0FA 2DRKA 2EAYA 4AMCA 1OPLA 2D8JA 3G4SA 1V29B 4O5VA 1RAEB 2RJFA 1YP5A 1VQPA 2F69A 1VQ5A 4ZN1A 2EVRA 3NTIA 2BZXA 4F16A 4BDYA 4ZGJB 2L3SA 4FL6A 1KC8R 1JB0E 4PJOE 1X6OA 3FB9A 3M4GA 1Q7YC 2EYXA 3CD6Q 2CS7A 3CD6T 1QVPA 3QBYA 4FU6A 3RBBB 2GCXA 2A36A 2QGFB 2ZPHB 2KGTA 2D6FA 4N4HA 2DVEA 2P4RA 3MKDA 2CT3A 3M58A 2OI3A 3EG0A 3TQ7P 1QKWA 3EG2A 4QW2A 2GBQA 2YDLA 1B3QA 1U3OA 4JRQA 3CCJA 3AHUA 4E6RA 2EGEA 3A8GB 4OGEA 3M57A 2P0QA 3M4YA 4C5IA 1X27A 4WF2A 3G4SQ 2EGCA 4RTVA 5KYUB 3GIBA 3G4ST 1VQPQ 3MP8A 3CXCS 4ELYC 1VQPT 2W10A 3Q1JA 3V8JA 1W70A 1VIEA 3ASKA 3VS5A 1Q82C 3A8OB 4BB7A 2XDBA 3RERA 5LL6S 2SEMA 3THKA 2ZZDA 1Q82U 2DF6A 1PRMC 1UGQB 1MUZA 3FC3A 2CSQA 4ANJA 2F2WA 4KRTA 4A4FA 5GANe 4M7DB 4K11A 2BZYA 2DZCA 2JMCA 2XICA 5GMKe 1KQ1A 2K57A 2L8DA 4HKEA 5GAMj 2EKOA 3QG1A 1JEGA 3RUXA 3CQTA 5FROA 5HCKA 4EIKA 3OSSC 2OTJA 2RB6A 2MK5A 4M75E 2RNAA 3CCJQ 4B6MA 3OYDA 3CCJT 3L2WA 1GBQA 1UGSB 3GF5A 4X9DA 2JTEA 2JS2A 3JB9J 4J83A 2EQIA 3ER0A 1IXDA 1OULA 2AIRB 3P8HA 3CCUA 1UG1A 3KUFA 4JDSA 1YCSB 2JM8A 2QA4A 2RK1A 4ZGDB 2HQXA 3L1AA 4BY6C 4KUIA 1M5Q1 1VQOA 1GCPA 1M2VA 3C12A 3AT1B 3JCMd 2GFAA 2MI6A 3MP1A 2K5FA 5FRMA 1R0CB 2LX9A 4FYXB 4FYYB 5KYXB 1PC0A 4M78A 4OVAA 1IGQA 3HL8A 1EIFA 4DA4A 2AZSA 2A7YA 2QAZA 2P0KA 1K0SA 5KCHA 2B8AA 3DB3A 3EGDA 1KD1C 4R55A 1HXDA 1D1CA 4J6YA 1YWPA 3MEAA 2JT4A 2YWWA 4M75D 2K3BA 2F5TX 1KD1U 3VRYA 1SHGA 3I9QA 2LT4A 4II1A 2LZ6B 2KYMA 2RI3A 3M5AA 1D0XA 5GAOr 3ME9A 2DVJA 5A0DA 4HT9A 2QDLA 2DZ9A 2JMAA 4DOWA 2HSPA 2F1LA 4ZN3A 3OSVA 3WVEB 4JJBA 2JM9A 2AT1B 4XU3A 3VYGA 3QZ5B 2XKOC 2CP6A 1AZEA 4OMPA 3M53A 5GMKh 1O9SA 3V7CA 1RL2A 2ZPEB 3REBB 4XK8E 3CPFA 1M3AA 2Y90A 2LT1A 1RADB 2O88A 2MWOA 4F7UE 2QGGA 4XU0A 4J9IA 3QUIA 4LD9K 4CRIA 4RTUA 4LDWA
chains in the Genus database with same CATH topology
3LH0A 3EFSA 1VUBA 2DTIA 4N0AC 4PJOG 3QJYA 2V8JA 1M90U 3CD6A 4BD3A 2GQVA 2RJCA 5EG2A 1QVFS 1M1FA 5GAN3 3GP8A 3FEOA 3CBOA 3H6ZA 4M77G 4ZGEB 2HBPA 3CMET 1I81A 2EQKA 5CK9A 4RMOA 2RA2A 2KAFA 1G3YA 3CPWS 2K3YA 3CEYA 4JRIA 3V8LA 2CGHA 4EMKB 2YHTA 1H641 2L3RA 1KHCA 4Q5WA 4M7DD 1D3BA 1YHQA 3ZFJA 2K5LA 3LYIA 3OS2A 4C5EA 5GANj 2X4YA 3SDZA 4HCBA 4KUDK 2VC8A 4QVDA 1M1GA 2MWPA 3HRUA 1QP3A 3TCJA 3CCST 2RJEA 5L8RE 5LJ5j 2DKGA 3BY7A 4M78G 4LDUA 4IURA 3A8LB 3OYLA 3CCRA 3CCMA 1BIBA 3V8KA 4HCCA 4C92E 2VXFA 5GAN8 1W4SA 1U1SA 1MHNA 3G7ZA 5CKDA 2FVUA 1YIJA 1BIAA 4FT2A 2K2VA 4FT4A 4GLKA 4PJOC 4QVZA 1ZBXA 4A4EA 3TREA 3VYHB 3S3NA 1Y7XA 2KK4A 1YITA 2VGNA 4F7UF 3J81E 2LCLA 2QQRA 3ZBDA 4M77C 2O4XB 3C4SA 4NOYA 2XG8D 4XTZA 1GXIE 2KDSA 2PVGB 4B9XA 3OS0A 4M7AB 1VQKA 4E7JA 4V2SA 4CI0C 2DIQA 3OS1A 3C95A 5GAOn 3CMAA 3CC4T 3MO8A 4JLGA 3L2UA 2QI2A 3CCVA 1Q86U 3RIRA 2OTLA 3DKMA 4J6XA 3G6EA 3JCMX 1UEBA 5LJ3h 2JN0A 1YI2A 2C06A 4LDYA 3G71A 3V7SA 1BI3A 2PU9B 3JAME 3OYNA 2OTJT 3JSCA 2P4TA 2HD0A 2M1HA 4M78C 1R8OB 3I55A 2I2LA 5LJ3e 4JJNK 1M1KC 2RO0A 4LDVA 2XIDA 4M7DA 1JJ2S 4C8QG 3VV0A 3FRNA 3RKXA 3N5BB 3HFNA 2R5MA 4ATOA 4E47A 2QTXA 2VXEA 1VQ6T 3L2ZA 3PMIA 3JCMJ 1M1KU 3NTKA 4J6WA 3WXMB 2QQ9A 1Q7YU 1H3ZA 1KG1A 4D6WA 3PMTA 3L2RA 2EWNA 2IVWA 4C92F 3OYGA 4RG8A 2RJDA 3GPLA 2ZPFB 3CCUT 1G3WA 4IKFA 2PVOB 2X35A 4X9CA 5CAIA 1TH7A 1YJWA 3LGLA 1B34B 1FWZA 4A4HA 1MGQA 2QA4T 1DJ7B 5CKBA 4A54A 1WPYA 2GFUA 2DK3A 2MF2A 4OB2B 3CCRT 2LTOA 2X4JA 5GAMh 4XU2A 4XQ3A 2BKDN 5CKFA 4OF1A 4M75G 1VQOT 1KC8C 4NS5A 3OB9A 4TVRA 5A0GA 3SWNC 4A53A 1K73C 2HAXA 4PJOB 2D0QB 4LDWA 4C8QC 2RI2A 4EDUA 3PIPA 1N9SA 2E12A 5GAMe 4MMLA 3CC2A 4E7LA 1OZ3A 3KXTA 4FM4B 2LVMA 3X24B 1G3TA 1VQKT 1KC8U 1VQ9A 1ZHIA 4OGCA 1K73U 5GAN5 1N9RA 2DXUA 3EAEA 1N8RC 3CMAT 1NE8A 2RM4A 4F7UA 2DXBA 2OTLT 1OZ2A 5LJ3d 2QEXA 3HRSA 1M8VA 3I56T 1HK9A 5CR2A 1YI2T 2LQ8A 5HK3A 1YJNT 4Z02A 2FYKA 3OW2A 4C0GA 3H8ZA 2ZPBB 1YJ9A 2WSFE 1K8AU 4JUVA 4PLIA 1WNLA 1UB4A 5GANg 5GAN2 4M78B 2DJZA 1VQLA 1VQ4A 4C0DC 3VU3C 4J5YA 1RI0A 3OS5A 3QJ6A 4M75C 3QDRB 5AYFA 4C5GA 2K4YA 3QKJA 3HKSA 3JCMg 3EFRA 3OBWA 1JRIA 3WVDB 4HT8A 3S3OA 3PNWC 3S3MA 2ZPGB 1VQMA 2E41A 4HCZA 4PJOD 5LJ3f 3X25B 2CZ6B 5CIUA 3JCMQ 1G3SA 2XHCA 2CZ1B 4M77D 1I8FA 4M7AE 2R57A 2XU8A 4Y91A 1XNIA 5GMKm 1UGRB 5GMKe 5GAOm 4E7KA 3META 4L59A 1WJRA 3E9GA 5IN1A 5IAYA 3C94A 3M56A 5CQXA 1VQNT 3ZEHA 1NPPA 5GMKi 2XDPA 1JBMA 2ZPIB 4DOVA 1OI1A 2QXFA 4C92A 1WJSA 5GAMd 1X75C 3CCQA 1NJIC 2VUBA 4E7HA 5HK0A 4OB3B 3JCMc 5GMKj 4M78D 1LOJA 2DTHA 3RESA 4UC4A 1BI0A 3SWNB 5DM7R 4ZTJA 1Y71A 2JVVA 3MEWA 4C8QB 1S72A 3OYBA 1G5VA 3BFMA 3OA6A 2DAQA 4QVCA 3SD4A 1Q81C 3RMSA 2PUOB 2E64A 2RHIA 4XTYA 3O8VA 4BACA 4XU1A 5FU7C 1NJIU 2YRVA 3OBYA 5C0MA 5IT9E 1U8RA 4BE1A 4C0FA 3URGA 1Q86C 2EAYA 1VQ9T 5DLOA 2A3LA 2EIFA 3LGFA 5J3BA 4RCCA 3A5ZB 5GAMf 2KVQG 3CC7T 4ZTFA 3G4SA 3CXCA 4M7DG 5A0LA 1V29B 1Q81U 4O5VA 1UGPB 2RJFA 1VQPA 1N6AA 4LDXA 4BUGA 1Y96B 3OYEA 2F69A 2RHXA 4MZMA 4OP0A 4ZN1A 2DD4A 4IUUA 3NTIA 3OW2S 2LRQA 1VQ5A 2BUDA 3X26B 2CKKA 3MP6A 4JS4A 1NPRA 4BDYA 1I4K1 4ZGJB 3MEVA 4M77A 4X34A 3OYAA 2E6ZA 3L42A 3QPHA 4C0DB 4M7AF 2X4WA 4M75B 2YLCA 2EQUA 3HFOA 4FL6A 1JB0E 3INZA 3RKWA 4C0ZA 1QVGA 4PJOE 1X6OA 3FLGA 3JB9H 1VQ7T 3FB9A 4C8QD 3M4GA 3CCEA 1Q7YC 2M16A 4M77E 2CS7A 3CD6T 1QVPA 4JLIA 3QBYA 5LJ3g 3M54A 4FU6A 2VYTA 3OYIA 2GCXA 2QQAA 2ZPHB 5D6WA 2D6FA 4M7DC 1IZ6A 4N4HA 2D9TA 1WQWA 2DVEA 3M58A 2XDDA 1KQSA 2DTOA 1XQHA 4HA8A 1YHQT 4M7AD 1BI2A 4VUBA 4MDXA 2FB7A 3CCQT 4MZTA 4M78E 3GOXA 2DXTA 4OB0B 4QW2A 4YTLA 1W2BA 2ZCFB 2XI9A 4J7FA 3CCMT 4F7UG 3JCMP 2FL7A 3MCAB 1D3BB 1M4ZA 1WGSA 4JRQA 1PSEA 4LD6A 2DO3A 3JB9F 4JRKA 5FU7B 3CCJA 1Y07A 3OQ5A 2M0OA 4EMKA 3AHUA 4KBMB 4MDWA 1YIJT 3A8GB 2NLUA 4OGEA 1K9MC 3M57A 2P0QA 4L5GA 3CC4A 1BKBA 3M4YA 1YITT 5CKHA 4C5IA 2PVDB 4WF2A 3OMCA 5LJ3j 3TU4K 4JRPA 3CMEA 4KULA 3GIBA 3G4ST 3R6OA 3MP8A 4L6V5 1P92A 3CXCS 4NL2A 4ELYC 5GAMg 2RHZA 5DLQE 4EMHA 3DLLA 1VQPT 3M9QA 4PJOF 1K8AC 3OYCA 3HSBA 3Q1JA 1K9MU 3QYHB 5HY6A 3V8JA 3CCVT 3A8MB 1VIEA 3ASKA 3SFMA 3QYGB 1M9SA 4M77F 4PLLA 3A8OB 3G6ET 3RKYA 1Q82C 4BB7A 3LX7A 2XDBA 2DD5A 3RERA 1WQ7A 2OAUA 3LW5E 4OMFB 3E9FA 5LL6S 3G71T 3JB9D 3CCSA 1WJQA 3PGGA 3QIIA 4C8QE 1QVGS 2ZZDA 4MMKA 3I55T 3DLMA 1LJOA 2O4XA 5KH6A 3CCET 4PL6A 4N4IA 1Q82U 4M7AA 5DY9A 5GANh 4E7IA 4C92G 1VQ8A 3CBPA 2JTMA 1UGQB 3J80E 4IUVA 3FC3A 4M78F 2GF7A 2EYQA 5LJ5h 3KBGA 4XAXB 5KCOA 4BDZA 1KQSS 4XTUA 3JCMh 4BI4A 5GANe 4A4FA 4M7DB 5GAN6 2E10A 2DZCA 4J8OA 1FX7A 1VIFA 1KQ1A 2K57A 2L8DA 2XICA 3JRZA 2V8KA 4HKEA 3TEEA 2EKOA 3QG1A 5GAMj 3FJPA 2ZGWA 5LJ5e 4JS5A 1PSFA 2KQWA 3GLXA 3PT9A 3RUXA 3JCMe 1X01A 3JB9I 3DB4A 4N0AA 5FROA 4O6JA 2LC4A 3L2VA 2P0PA 2YLBA 1YJWT 1XOVA 3OSSC 2KY9A 3BW1A 2RB6A 1IREB 4M75E 1W2BS 3PIOA 2OTJA 2EQMA 2M9UA 3QZ9B 4MZPA 4DQ2A 2V8IA 4QQ6A 3CCLA 2RI5A 5I2MA 3OYDA 1JJ2A 3CCJT 4J7IA 3HPWA 3L2WA 4BE0A 2PUKB 2DIGA 3VUZA 4C92C 5GAN4 1UGSB 3CC2T 3GF5A 4X9DA 5CQYA 2QDYB 3UPUA 4GY5A 2O01E 2E5QA 3JB9J 1VQ6A 4J83A 2DXCA 5J39A 3RMQA 3P8DA 3ER0A 2EJGA 1B34A 2Y4YA 3X28B 3S6WA 4C8QF 3T9NA 2JNGA 3BDUA 4XTVA 2LCCA 5A2QE 4KT0E 3SB2A 3JCMb 3P8HA 3CCUA 5CVIA 5FU6C 2QEXT 3KUFA 4JDSA 3E19A 3UDCA 2IG0A 3V7RA 4PJOA 5D6XA 1YJ9T 1QW1A 2CZ7B 2R5AA 2QA4A 2PQWA 2RK1A 3OYJA 3LWIA 4F7UB 1VQLT 1VQ4T 4RG2A 4ZGDB 2HQXA 2QQSA 1OYXA 3L1AA 4BY6C 4KUIA 1M5Q1 1QP2A 5GANd 1VQOA 3PTAA 2G3RA 2EQJA 2VV5A 4PKCC 1VQ8T 4FSXA 4N4GA 3C12A 2JZ2A 1YCYA 3OYHA 5LJ5d 3M55A 1VQMT 3UT1A 4B9WA 2XD0A 3JCMd 2GFAA 2MAMA 2Y4XA 3NTHA 2MI6A 3JCMV 3MP1A 2K5FA 5FRMA 4M75F 2LX9A 2CYZB 4EMGA 5HKCA 4M78A 3MEUA 4OVAA 1U1TA 1O75A 3HL8A 3I56A 1I5LA 5GANf 1EIFA 1YJNA 4DA4A 3VJPA 2A7YA 2LDMA 2F5KA 2P0KA 3QHSA 2K3XA 1KHIA 5GAN7 5KCHA 2EJ9A 2B8AA 5GMKl 4PNOA 5LJ5f 3DB3A 1YBYA 1AHJB 5GAOl 2E70A 4R55A 3JCMf 1KD1C 1HXDA 3CCLT 4OB1B 2E6NA 2XK0A 4J6YA 4Y28E 2RHYA 3MEAA 3VKIA 4RKUE 1LNXA 2RHUA 1ZQ1A 1S72T 3HRTA 4C92B 4M75D 5CCAA 3UWNA 3QXEB 2F5TX 2MMPA 1NZ9A 1XTDA 3A8HB 1KD1U 2LT4A 2H3JA 1QVFA 3VUBA 3FIFA 4M7DE 2QQBA 4FIBA 2KSSA 2RH2A 4C5HA 4II1A 2L89A 4P5NA 3GNGA 2CZ0B 3QSUA 2WACA 2EJFA 2RI3A 4A4KA 2R58A 2RD1A 2E65A 3M5AA 4BI3A 5FU6B 3CPWA 5FRNA 1KQ2A 5GAOr 4M7AG 4XTXA 2HNIA 3ME9A 4EMKC 1VQNA 2JTFA 5A0DA 3SWNA 3QO3A 3PFSA 4HT9A 2DZ9A 4C8QA 1VQ5T 4IUTA 4DOWA 4ZN3A 2X4XA 3HHTB 5I2SA 3OSVA 5D6YA 2VGMA 3WVEB 3CBMA 3LLRA 1BYMA 4BY6B 3L2QA 5KE3A 4XU3A 4XTWA 4R56A 4BE2A 3OYKA 4A4GA 4IUPA 3VYGA 3QZ5B 5C6SA 2BIVA 1FXXA 2XKOC 4C92D 4M77B 1SSFA 2KMTA 5GAOp 4NL3A 2WSEE 3M53A 3OYYA 1Y96A 3OMGA 5I21A 5GMKh 4IUQA 3HP9A 1O9SA 3FDRA 5FLXE 4ME7A 5M9OA 3E1SA 5GAOq 3V7CA 4ELZC 3BDLA 1RL2A 3CC7A 2RK2A 2ZPEB 2JUFA 2DPPB 3M59A 2DEQA 5CKEA 5CO7A 4XK8E 3CPFA 4M7AC 3P8BB 3MHXA 4M75A 3X20B 1N27A 2Y90A 5J26A 2EFIA 2LT1A 4QQDA 3OY9A 2LNVA 2LQKA 3JB9G 1N8RU 2FHDA 4BI8B 2MWOA 4F7UE 2HQEA 1M90C 3NFCA 4M7DF 4XU0A 2E1HA 2JOYA 2K5IA 3F70A 5LJ5g 4RCBA 4EPCA 3OYMA 3QUIA 1BI1A 3J7AF 2L5QA 4LD9K 3GNFB 3JCMW 5KE2A 4CRIA 3LWHA 1VQ7A 2AHJB 4QQGA 2WSCE 3OYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LH0 A;  4RG2 A;  2HQX A;  2QQS A;  3EAE A;  1OYX A;  4BD3 A;  2G3R A;  2EQJ A;  2RJC A;  3GOX A;  1OZ2 A;  4N4G A;  3FEO A;  2JZ2 A;  3H6Z A;  4QW2 A;  3OYH A;  2EQK A;  4Z02 A;  3UT1 A;  4B9W A;  2K3Y A;  2GFA A;  3CEY A;  3H8Z A;  1WGS A;  3NTH A;  4PLI A;  3MP1 A;  5FRM A;  2L3R A;  4LD6 A;  1KHC A;  4Q5W A;  3OQ5 A;  2M0O A;  3LYI A;  3OS2 A;  2NLU A;  4C5E A;  1RI0 A;  4C5G A;  2X4Y A;  3MEU A;  3QJ6 A;  4OVA A;  4C5I A;  3QKJ A;  2MWP A;  3OMC A;  3S3O A;  3PNW C;  2RJE A;  3MP8 A;  4HCZ A;  4IUR A;  3OYL A;  2LDM A;  2F5K A;  2P0K A;  2RHZ A;  2K3X A;  5CIU A;  3M9Q A;  5KCH A;  3S3M A;  2B8A A;  3OYC A;  3DB3 A;  3Q1J A;  1MHN A;  2E6N A;  3ASK A;  2R57 A;  2XK0 A;  2RHY A;  3MEA A;  4PLL A;  1XNI A;  4QVZ A;  4E7K A;  4A4E A;  3LX7 A;  3S3N A;  3MET A;  2RHU A;  4L59 A;  1WJR A;  3E9G A;  5IN1 A;  5IAY A;  3E9F A;  2QQR A;  3ZEH A;  2O4X B;  3C4S A;  2XDP A;  3UWN A;  4B9X A;  1WJQ A;  3QII A;  3OS0 A;  1OI1 A;  4E7J A;  1WJS A;  3DLM A;  5KH6 A;  2O4X A;  2DIQ A;  3OS1 A;  4PL6 A;  4N4I A;  3MO8 A;  3L2U A;  4C5H A;  4E7H A;  4II1 A;  2L89 A;  4E7I A;  4ZTJ A;  2WAC A;  2RI3 A;  4UC4 A;  2R58 A;  5FRN A;  4IUV A;  3FC3 A;  3MEW A;  2GF7 A;  3OYB A;  1G5V A;  3ME9 A;  3OA6 A;  2DAQ A;  5KCO A;  2JTF A;  3SD4 A;  3OYN A;  4BDZ A;  3PFS A;  4A4F A;  2RHI A;  4BAC A;  3O8V A;  2M1H A;  2YRV A;  4IUT A;  5C0M A;  2L8D A;  2X4X A;  4BE1 A;  2RO0 A;  5D6Y A;  2EKO A;  3LLR A;  3LGF A;  3L2Q A;  5KE3 A;  4ZTF A;  3DB4 A;  4BE2 A;  5FRO A;  3OYK A;  4A4G A;  3L2V A;  4IUP A;  2R5M A;  2RJF A;  5C6S A;  3PMI A;  2BIV A;  2EQM A;  2RHX A;  3OYE A;  3NTK A;  1H3Z A;  1SSF A;  4IUU A;  3NTI A;  4QQ6 A;  2LRQ A;  2BUD A;  2RI5 A;  2CKK A;  3MP6 A;  3PMT A;  3OYG A;  3L2R A;  3OYD A;  4BDY A;  2RJD A;  3OMG A;  3OYA A;  3MEV A;  4IUQ A;  4X34 A;  3L2W A;  4BE0 A;  3FDR A;  5M9O A;  3L42 A;  2DIG A;  4IKF A;  2X35 A;  2X4W A;  3BDL A;  2EQU A;  4FL6 A;  3LGL A;  4GY5 A;  4A4H A;  2E5Q A;  3FLG A;  5J39 A;  1N27 A;  2GFU A;  3P8D A;  5J26 A;  2EFI A;  2LTO A;  4QQD A;  3OY9 A;  2M16 A;  2BKD N;  3S6W A;  2LCC A;  2FHD A;  4NS5 A;  3OB9 A;  3QBY A;  2MWO A;  3P8H A;  4FU6 A;  2HQE A;  2VYT A;  3KUF A;  3F70 A;  2RI2 A;  4EDU A;  3OYI A;  3OYM A;  2IG0 A;  4E7L A;  1OZ3 A;  5D6W A;  5D6X A;  4CRI A;  2LVM A;  2R5A A;  4N4H A;  2D9T A;  5KE2 A;  2PQW A;  4QQG A;  3OYJ A;  3OYF A; 
#chains in the Genus database with same CATH topology
 1W6X A;  1H8K A;  4N0A C;  2DL4 A;  2RJC A;  1M1F A;  2C0O A;  5GAN 3;  2VWF A;  3FEO A;  2EQK A;  2RQW A;  1QKX A;  3CPW S;  1ARK A;  1G3Y A;  4EMK B;  2HL3 A;  1KHC A;  2PNI A;  1I5O B;  2DRM A;  3LYI A;  4C5E A;  2X4Y A;  2VC8 A;  1MMN A;  3CCS Q;  1RAI B;  3TCJ A;  3CCS T;  5L8R E;  4IUR A;  3TSW A;  4C92 E;  5KYU A;  1NEG A;  1U1S A;  2K2V A;  1V76 A;  4PJO C;  3S3N A;  1SKU B;  1YIT A;  2KK4 A;  1T3L A;  2O4X B;  4XTZ A;  2XG8 D;  3OS0 A;  2ESW A;  4M7A B;  1UFF A;  3C95 A;  3MO8 A;  2QI2 A;  2L3P A;  3G6E A;  2CH4 W;  5LJ3 h;  2JN0 A;  1BB9 A;  4OMQ A;  1K76 A;  2P4T A;  3FJ5 A;  2HD0 A;  3CCL Q;  1R8O B;  4LDV A;  2XID A;  4M7D A;  1JJ2 S;  2D1X A;  3VV0 A;  3EG3 A;  1WHH A;  1YN8 A;  3N5B B;  2RQV A;  2QTX A;  2FPD A;  1NLP C;  2J6O A;  4D6W A;  2EWN A;  2IVW A;  1NYG A;  2V1Q A;  4ORZ A;  2JXB A;  5IH2 A;  3I35 A;  1TH7 A;  5CKB A;  4A54 A;  2GFU A;  4XU2 A;  2RQR A;  4XQ3 A;  4OF1 A;  4TVR A;  4Z88 A;  1K73 C;  4LNP A;  2RI2 A;  4E7L A;  4FM4 B;  2LVM A;  3X24 B;  3EGX B;  2VKN A;  1RAA B;  4OGC A;  1K73 U;  2KNB B;  1N8R C;  1AWJ A;  1YJN Q;  2HDA A;  1TU0 B;  2ED1 A;  3NPF A;  1HK9 A;  1YJN T;  2E3I A;  1QCN A;  3OW2 A;  2ZPB B;  5GAN g;  5GAN 2;  2DJZ A;  3VU3 C;  4E2F B;  4J5Y A;  4M75 C;  3QDR B;  3QKJ A;  5KYX A;  4HCZ A;  5LJ3 f;  3JCM Q;  2HKQ B;  1PRL C;  2XU8 A;  1E7O A;  1WX6 A;  1WFW A;  4E7K A;  2H8H A;  1AVZ C;  1NYF A;  1WJR A;  3E9G A;  3QWX X;  5IAY A;  3M56 A;  3ZEH A;  1FYN A;  1OI1 A;  2VUB A;  4E7H A;  3RES A;  4ZTJ A;  3SWN B;  4C8Q B;  1G5V A;  3BFM A;  1PHT A;  1RAH B;  3SD4 A;  2PUO B;  2E64 A;  2RHI A;  4BAC A;  4XU1 A;  1U8R A;  2KE9 A;  3URG A;  1Q86 C;  3E2U A;  5DLO A;  4ZTF A;  5A0L A;  1FMV A;  1Y96 B;  3OYE A;  4MZM A;  2RPN A;  2GGR A;  5KYN A;  2LRQ A;  1KJW A;  2BUD A;  2CKK A;  4JS4 A;  1M27 C;  1NPR A;  4J9C A;  3MEV A;  4X34 A;  1WHL A;  4C0D B;  3TSZ A;  2X4W A;  2VVK A;  2EQU A;  2KT8 A;  3RKW A;  4J9G A;  4C8Q D;  3CCE A;  2AKL A;  4M77 E;  1HD3 A;  2DEU A;  4JLI A;  1TUC A;  5LJ3 g;  1WI7 A;  4JJC A;  1K9A A;  1IZ6 A;  3H0I A;  2D9T A;  1WQW A;  2XDD A;  4RTT A;  4VUB A;  2DMO A;  4MZT A;  9ATC B;  4M78 E;  3GOX A;  2X3X D;  4CC3 A;  1W2B A;  1M90 R;  2ZCF B;  2X3W D;  2XI9 A;  3JCM P;  3MCA B;  1M4Z A;  4GLM A;  4LD6 A;  2DBK A;  3KFV A;  1Y07 A;  4EMK A;  1OU9 A;  2J06 A;  2CT4 A;  4MDW A;  5ECA A;  1K9M C;  1H92 A;  1BKB A;  2LQN A;  1UEC A;  1NEB A;  3TU4 K;  3CME A;  2DA9 A;  1SRL A;  4AFQ C;  4EMH A;  1K8A C;  4PJO F;  3OYC A;  3CCV Q;  1K9M U;  3QYH B;  3CCV T;  3SFM A;  2HKN A;  2LP5 A;  4PLL A;  3LX7 A;  2DD5 A;  1WQ7 A;  2DYI A;  3EH1 A;  4OMF B;  1TG0 A;  4JZ3 A;  3I55 Q;  1QVG S;  3CCE Q;  4MMK A;  3I55 T;  2O4X A;  3CCE T;  4PL6 A;  4N4I A;  4M7A A;  4KGZ B;  1VQ8 A;  3CBP A;  1PNJ A;  2EW3 A;  2AK5 A;  3I5R A;  3OW2 P;  2EYQ A;  5LJ5 h;  3IQL A;  1ZSZ C;  2KYB A;  1FX7 A;  3TEE A;  1KQS S;  2V8K A;  4JS5 A;  1H3H A;  2ZGW A;  1PSF A;  3GLX A;  3VS2 A;  1TUD A;  4DBF A;  3RNJ A;  2LC4 A;  3L2V A;  2P0P A;  1XOV A;  3BW1 A;  1X2Q A;  1CKB A;  4PJN A;  2V8I A;  2RI5 A;  1JJ2 A;  4BE0 A;  1Q7Y R;  2Z0W A;  2DIG A;  3CC2 Q;  4C92 C;  3CC2 T;  2LJ0 A;  1OU8 A;  2O01 E;  1AT1 B;  5J39 A;  3RMQ A;  2LCC A;  5A2Q E;  3EGU A;  1T3S A;  2IG0 A;  4AFZ C;  3V7R A;  5D6X A;  1QW1 A;  2PQW A;  1VQ4 Q;  1VQ4 T;  1OYX A;  3EGX A;  5GAN d;  1VQ8 Q;  3NGP A;  2VV5 A;  1VQ8 T;  4FSX A;  1VQM Q;  1VQM T;  3UT1 A;  4B9W A;  2XD0 A;  2Y4X A;  4M75 F;  3H41 A;  2CUB A;  2ABL A;  2CYZ B;  2E4H A;  5GJV B;  3EG9 B;  4A63 B;  5HKC A;  3MEU A;  1O75 A;  3I56 A;  4J9F A;  1Q82 R;  5L23 A;  5GAO n;  3CCQ Q;  2K3X A;  2BTT A;  5LJ5 f;  3CCQ T;  1YBY A;  5GJW B;  2D0N A;  1JXM A;  3VKI A;  3BE3 A;  4RKU E;  1WXT A;  3UWN A;  2MMP A;  1XTD A;  3VUB A;  3FIF A;  4M7D E;  2QQB A;  2BE9 B;  1BCM A;  2CZ0 B;  1W2B P;  2WAC A;  3QSU A;  5FU6 B;  1TTH B;  4XTX A;  2JTF A;  3SWN A;  1U06 A;  1VQ5 Q;  3QO3 A;  3PFS A;  4C8Q A;  1VQ5 T;  4PFZ A;  2X4X A;  1NJI R;  2A28 A;  5KE3 A;  1PKT A;  3CPW P;  3OYK A;  4A4G A;  4AFS C;  2MCN A;  1GBR A;  5C6S A;  3A98 A;  2O2O A;  1SSF A;  2COY A;  3OYY A;  3VS3 A;  1Y96 A;  3OMG A;  1C1A A;  3PVL A;  4IUQ A;  5I21 A;  2CP5 A;  1IHW A;  2MPX C;  5GAO q;  1QWF A;  3CC7 A;  3M59 A;  2DEQ A;  3P8B B;  1NLO C;  1GRI A;  3X20 B;  1N27 A;  3OY9 A;  2ZAE A;  2LQK A;  2OJ2 A;  1ZLM A;  2HQE A;  2JOY A;  3F70 A;  5LJ5 g;  2DX1 A;  4EPC A;  3OYM A;  1BI1 A;  3J7A F;  3GNF B;  5KE2 A;  2DM1 A;  3LWH A;  2CH4 A;  1VQ7 A;  4QQG A;  1IHV A;  4PJO G;  3QJY A;  4Z89 A;  4BD3 A;  5EG2 A;  2ROL A;  1QVF S;  3GP8 A;  3H6Z A;  3SEM A;  2YUO A;  1G8X A;  1JJ2 P;  1R0B G;  4M7D D;  3SHW A;  1YHQ A;  3OS2 A;  5GAN j;  3SDZ A;  4J9H A;  4KUD K;  2J6K A;  2MWP A;  1QP3 A;  3REA B;  2DKG A;  3BY7 A;  3CCM A;  4LDU A;  3CCR A;  2DL5 A;  2FZG B;  2NUZ A;  3V8K A;  4HCC A;  2VXF A;  2MOX A;  5GAN 8;  1MHN A;  3G7Z A;  1YIJ A;  1BIA A;  4FT4 A;  4GLK A;  1TSF A;  5KYY B;  1ZBX A;  3VYH B;  1Y7X A;  2NYS A;  4F7U F;  2LCL A;  2C0I A;  1OX8 A;  2QQR A;  3ZBD A;  4M77 C;  2QAS A;  2KRM A;  1K1Z A;  3CMA A;  2OTL A;  2E3H A;  1UEB A;  1YI2 A;  1YNZ A;  1WZO A;  4LDY A;  3G71 A;  2OTJ Q;  1BI3 A;  1GFD A;  2OTJ T;  3JSC A;  1ZUU A;  4M78 C;  3ZL7 C;  1AD5 A;  2I2L A;  2PTK A;  5LJ3 e;  1K0X A;  4PFP A;  3FRN A;  2R5M A;  4E47 A;  4OMO A;  1BBZ A;  4J6W A;  1H3Z A;  2QQ9 A;  3PMT A;  3L2R A;  4C92 F;  4RG8 A;  3CCU Q;  4D8D A;  3CCU T;  1YJW A;  3LGL A;  1B34 B;  2QA4 Q;  1M3B A;  1MGQ A;  1KSW A;  2QA4 T;  2DK3 A;  2MF2 A;  3CCR T;  1KIK A;  5GAM h;  1CSK A;  1VQO Q;  1EX4 A;  4M75 G;  1VQO T;  2COW A;  4NS5 A;  5A0G A;  1ZA2 B;  2D0Q B;  2CUD A;  4RUG A;  1N9S A;  2E12 A;  1TUG B;  4MML A;  1OZ3 A;  2ROT A;  3CMA Q;  2DXU A;  3EAE A;  2OTL Q;  3CMA T;  2RM4 A;  4JJD A;  2BE7 D;  2OTL T;  2QEX A;  1M8V A;  1YI2 Q;  2DL3 A;  5CR2 A;  1YI2 T;  1ZUY A;  4Z02 A;  4C0G A;  1YJ9 A;  2K2M A;  2HQH A;  1UB4 A;  1NG2 A;  3M0P A;  1VQL A;  4AFU C;  2B86 A;  5AYF A;  3HKS A;  3EG9 A;  3WVD B;  4JZ4 A;  4CC4 B;  4DBR A;  2ZPG B;  1TXQ A;  2CZ6 B;  2VB6 A;  2RMO A;  2L3Q A;  1UHC A;  2XHC A;  5AT1 B;  4M7A E;  2R57 A;  5GAO m;  5GMK m;  3MET A;  4L59 A;  2LX7 A;  2G6F X;  4KGV B;  1PM3 A;  1AWW A;  1NBE B;  2QG9 B;  1X75 C;  1OEB A;  1W1F A;  4OB3 B;  4UC4 A;  1Y71 A;  3MEW A;  1S72 A;  3OA6 A;  2L2P A;  4QVC A;  3VRZ A;  2CP2 A;  3I5S A;  1Q81 C;  3RMS A;  4XTY A;  2M0Y A;  2KT1 A;  4HVV A;  1PKS A;  3EFO B;  4FW1 A;  5GAM f;  1RLQ C;  4RCC A;  4DBQ A;  1GCQ A;  1OV3 A;  2YT6 A;  3CXC A;  1Q81 U;  1UGP B;  2SRC A;  1SRM A;  4E7Z A;  4E7S A;  1MNE A;  3X26 B;  3MP6 A;  1M3C A;  4HVW A;  3PE0 A;  1I4K 1;  3OYA A;  1VA7 A;  3L42 A;  3QPH A;  2YLC A;  4C0Z A;  3INZ A;  3JB9 H;  1EZZ B;  3M54 A;  1ZX6 A;  2VYT A;  3OYI A;  1N8R R;  1JU5 C;  1XJW B;  2QQA A;  5D6W A;  4M7D C;  1QWE A;  2AZV A;  2LMJ A;  1XQH A;  1EFN A;  2DTO A;  1MMD A;  4M7A D;  1E6G A;  2FB7 A;  2DXT A;  4OB0 B;  1X6G A;  4F7U G;  2FL7 A;  1PSE A;  2DO3 A;  4JRK A;  5FU7 B;  3OQ5 A;  2M0O A;  2HEQ A;  3UF4 A;  4RTZ A;  2NLU A;  1YIT Q;  4L5G A;  1YIT T;  4GBQ A;  2PVD B;  4AG2 C;  1LVK A;  1N5Z A;  3R6O A;  4NL2 A;  5GAM g;  2DER A;  1ABQ A;  3A8M B;  3G6E Q;  3G6E T;  4M77 F;  2I0N A;  2O31 A;  3LW5 E;  5KYY A;  3E9F A;  3JB9 D;  3JV3 A;  1WJQ A;  3PGG A;  4C8Q E;  2A08 A;  3DLM A;  1LJO A;  2FZC B;  1TOV A;  4C92 G;  4RTY A;  1VYV A;  2JTM A;  4IUV A;  1Q86 R;  4M78 F;  2GF7 A;  2YUN A;  3KBG A;  4XAX B;  5KCO A;  3JCM h;  4BI4 A;  2HCK A;  1IO6 A;  2E10 A;  1VYT A;  5GAN 6;  2DJQ A;  3JRZ A;  4ATO A;  3M0T A;  3CC4 A;  5LJ5 e;  2KQW A;  3PT9 A;  1X01 A;  3JB9 I;  3O5Z A;  3DB4 A;  4IIM A;  4KGX B;  2IPO B;  3H0F A;  2M9U A;  5I22 A;  3QZ9 B;  2LNH B;  2GTJ A;  2HBW A;  4J7I A;  2PUK B;  1SG5 A;  3QWY A;  3VUZ A;  3UPU A;  2EYY A;  1VQ6 A;  2RQT A;  2LJ1 A;  2Y4Y A;  1B34 A;  3S6W A;  2JNG A;  3BDU A;  2YRC A;  4XTV A;  3SB2 A;  3JCM b;  1UJY A;  2EGA A;  2FRY A;  2R5A A;  1IB8 A;  2A0F B;  1UHF A;  2QQS A;  1QP2 A;  4PKC C;  3CXC P;  4RTX A;  2JZ2 A;  1YCY A;  4D8K A;  1WA7 A;  1UUE A;  4DEX A;  2YXY A;  3NTH A;  3JCM V;  1HSQ A;  1E6H A;  3M0R A;  4LE9 A;  5IHI A;  5FWB A;  1K8A R;  2DFU A;  1U1T A;  3VS6 A;  2V26 A;  3VJP A;  2LDM A;  2F5K A;  3QHS A;  5GAN 7;  1KHI A;  2EJ9 A;  4FSS A;  1KFZ A;  4R0K A;  2E70 A;  3JCM f;  1RAF B;  1X2K A;  2E6N A;  4F17 A;  2XK0 A;  4Y28 E;  1LNX A;  2RHU A;  1ZQ1 A;  1BCO A;  5CCA A;  2YRD A;  2DNU A;  2KSS A;  2RH2 A;  4P5N A;  2L89 A;  3GNG A;  2DIL A;  2EJF A;  1WHJ A;  2RD1 A;  4BI3 A;  3CPW A;  5FRN A;  1KQ2 A;  2HNI A;  4EMK C;  1VQN A;  4Z8A A;  5IHK A;  4DBH A;  2CRE A;  1I07 A;  4IUT A;  4F14 A;  5I2S A;  1QVF P;  2VGM A;  3CBM A;  2KRN A;  2HZY A;  4BY6 B;  3L2Q A;  4HVU A;  3A1P A;  1X69 A;  4BE2 A;  4X1V A;  3EFO A;  1F1B B;  2BIV A;  1QMC A;  4JPB W;  4M77 B;  2KMT A;  5GAO p;  2NUP B;  2WSE E;  4FW2 A;  1A0N B;  3E1S A;  2K9G A;  3EHR A;  3VS7 A;  2DE0 X;  2DPP B;  5CKE A;  5CO7 A;  4M7A C;  4QQD A;  4CC2 A;  5KYW B;  8AT1 B;  2FPF A;  2LNV A;  3QDF A;  4RTW A;  1M90 C;  4M7D F;  1R77 A;  2E1H A;  4J9B A;  2L5Q A;  3JCM W;  2AHJ B;  2WSC E;  2NUT B;  3LH0 A;  1VUB A;  2DTI A;  2V8J A;  1M90 U;  3CD6 A;  3ULR B;  3CME Q;  4M77 G;  4ZGE B;  2GTO A;  2HBP A;  3CME T;  5CK9 A;  4RMO A;  2RA2 A;  2KAF A;  4JRI A;  3V8L A;  1WXB A;  2CGH A;  4PK4 A;  2KEA A;  4Q5W A;  3ZFJ A;  2K5L A;  4AG1 C;  1FMW A;  3HTR A;  4HCB A;  3HRU A;  2RJE A;  4M78 G;  3OYL A;  1D09 B;  1V1C A;  1PD1 A;  4ZNX A;  3U23 A;  1W4S A;  2J6F A;  1RLP C;  4A4E A;  3TRE A;  1D1B A;  3J81 E;  2O9V A;  4NOY A;  4J9E A;  4B9X A;  4E7J A;  4V2S A;  1RAC B;  2DIQ A;  3RR6 A;  3OS1 A;  4JLG A;  4J6X A;  4HCK A;  3JCM X;  5EC7 A;  2C06 A;  3V7S A;  2YSQ A;  3JAM E;  3EH2 A;  4JJN K;  1JQQ A;  1M1K C;  2RO0 A;  3C0C A;  2DBM A;  3RKX A;  1ABO A;  1IRX A;  5IXF A;  3L2Z A;  1WDX A;  1M1K U;  3NTK A;  3WXM B;  1Q7Y U;  1LCK A;  3OYG A;  1Y0M A;  3M0Q A;  2DET A;  4X9C A;  2FZK B;  1FWZ A;  3UA7 A;  1SEM A;  2K7A A;  1DJ7 B;  4OB2 B;  2LTO A;  2X4J A;  3NMZ C;  2BKD N;  2QK0 A;  5CKF A;  1G2B A;  1KC8 C;  3OB9 A;  3SWN C;  2HAX A;  4PJJ A;  4PJO B;  4C8Q C;  5GAM e;  1WXU A;  2MIO A;  3VS4 A;  2CP0 A;  6AT1 B;  1KC8 U;  2W0Z A;  4QKU A;  1VQ9 A;  1ZHI A;  2OAW A;  5GAN 5;  3I56 Q;  5LJ3 d;  4HXJ A;  3MJX A;  3I56 T;  2LQ8 A;  2FYK A;  4PJM A;  5FWC A;  4PLI A;  1WNL A;  1JO8 A;  1X6B A;  4KH1 B;  4C0D C;  1HJD A;  4C5G A;  3OS5 A;  3QJ6 A;  2K4Y A;  1SF9 A;  2FRW A;  2MYS A;  3S3O A;  3PNW C;  1M30 A;  4PJO D;  1AOJ A;  3X25 B;  1VOM A;  1PCX A;  1Z9Q A;  1LPL A;  4OML A;  2CZ1 B;  2EBP A;  3H0H A;  1YFN A;  1I8F A;  2M51 A;  1B7T A;  1XNI A;  4Y91 A;  1UGR B;  2NWM A;  5GMK i;  1NPP A;  2XDP A;  1JBM A;  2ZPI B;  1WJS A;  1X43 A;  2ATC B;  1NJI C;  1KD1 R;  5HK0 A;  1BK2 A;  5GMK j;  5DM7 R;  2DTH A;  2JVV A;  2COZ A;  1NJI U;  2JS0 A;  1VQ9 Q;  1VQ9 T;  1UJ0 A;  2A3L A;  2EIF A;  1PD0 A;  2F2V A;  3LGF A;  3A5Z B;  5J3B A;  3CC7 Q;  2DL7 A;  2KVQ G;  3CC7 T;  1CKA A;  1ACM B;  1VYU A;  4M7D G;  1FMK A;  1RAG B;  1SPK A;  3M0S A;  1N6A A;  4LDX A;  4BUG A;  2RHX A;  4OP0 A;  3OW2 S;  2DD4 A;  4IUU A;  2J7I A;  5IXB A;  2KR3 A;  1Q95 G;  2P84 A;  4M77 A;  3VS1 A;  2E6Z A;  2NUP A;  4M7A F;  4M75 B;  7AT1 B;  3HFO A;  1QVG A;  2C0T A;  1VQ7 Q;  2LCS A;  1T0H A;  3FLG A;  1VQ7 T;  2VAS A;  2M16 A;  1D0Y A;  1AEY A;  1WYX A;  2RQU A;  5KYW A;  2IIM A;  2L0A A;  1KQS A;  1YHQ Q;  4HA8 A;  2GNC A;  2X9H A;  2H3E B;  4LUD A;  4LN2 A;  1YHQ T;  1BI2 A;  4MDX A;  2NUT A;  1HYO A;  2V1R A;  2CP7 A;  1QQJ A;  4YTL A;  3CCM Q;  3CCR Q;  4J7F A;  3CCM T;  1D3B B;  1Z9Z A;  1WGS A;  3JB9 F;  3G1J A;  1YIJ Q;  1ZUK A;  2QYZ A;  4OMM A;  4KBM B;  1YIJ T;  3EHQ A;  2HMA A;  5CKH A;  5LJ3 j;  3OMC A;  4JRP A;  4KUL A;  4L6V 5;  1P92 A;  3DLL A;  2RHZ A;  5DLQ E;  3HSB A;  3M9Q A;  1ZA1 B;  5HY6 A;  3QYG B;  1M9S A;  3RKY A;  3G71 Q;  4LXC A;  4IIO A;  2OAU A;  3G71 T;  3CCS A;  3QII A;  1I1J A;  2BZ8 A;  5KH6 A;  2YUP A;  1Q81 R;  1I0C A;  5DY9 A;  2DYB A;  5GAN h;  3H9N A;  2QTV A;  4E7I A;  1B07 A;  3J80 E;  4BDZ A;  4XTU A;  4J8O A;  1VIF A;  1RAB B;  1TS9 A;  2EYW A;  3FJP A;  2PZ1 A;  3JCM e;  1YJW Q;  1TWB A;  4N0A A;  4O6J A;  1YJW T;  2YLB A;  2KY9 A;  1IRE B;  1W2B S;  3PIO A;  2EQM A;  2RF0 A;  4MZP A;  4DQ2 A;  4QQ6 A;  1RUW A;  3CCL A;  1MMG A;  5I2M A;  2OX7 A;  3HPW A;  3VS0 A;  5GAN 4;  4PJL A;  5CQY A;  2QDY B;  4GY5 A;  1WHM A;  2E5Q A;  2DXC A;  1OX9 A;  3P8D A;  2EJG A;  3X28 B;  4C8Q F;  3T9N A;  4LUE A;  4KT0 E;  2RN8 A;  2QEX Q;  5CVI A;  5FU6 C;  2QEX T;  2KXD A;  3E19 A;  3UDC A;  1YJ9 Q;  4PJO A;  1YJ9 T;  2CZ7 B;  1SHF A;  3GBQ A;  3OYJ A;  1VQL Q;  1JXO A;  2LQW A;  3LWI A;  4F7U B;  1GCQ C;  1VQL T;  2KI7 A;  4RG2 A;  2KRO A;  1AWO A;  1OOT A;  2G3R A;  2EQJ A;  2KBT A;  3PTA A;  2YUQ A;  4N4G A;  1S1N A;  2O9S A;  1K73 R;  3OYH A;  5LJ5 d;  3M55 A;  4WTO B;  2E5K A;  2MAM A;  1ZSZ B;  4EMG A;  1M2O A;  1QVG P;  1I5L A;  5GAN f;  2K6D A;  1YJN A;  4PFO A;  2X51 A;  1YWO A;  1QCF A;  1C0M A;  3S3M A;  2JW4 A;  2ED0 A;  5GMK l;  4PNO A;  5GAO l;  1AHJ B;  2EKH A;  2FPE A;  3CCL T;  4OB1 B;  2RHY A;  1KK7 A;  1S72 Q;  1S72 T;  3HRT A;  4C92 B;  1KQS P;  3QXE B;  3A8H B;  1M8M A;  1NZ9 A;  2DL8 A;  3D7S B;  1K4U S;  2H3J A;  1QVF A;  1Y57 A;  4FIB A;  4C5H A;  4J9D A;  1OPK A;  2CP3 A;  2CDT A;  3PVQ A;  2R58 A;  4A4K A;  2E65 A;  2LJ3 A;  1D0Z A;  2K79 A;  4M7A G;  1BU1 A;  4M4Z A;  2HSE B;  2EYZ A;  3HHT B;  3NHN A;  2F2X A;  5D6Y A;  3LLR A;  1ZSG A;  2J05 A;  1BYM A;  4XTW A;  1QCO A;  4R56 A;  1ZBJ A;  4IUP A;  5D7U A;  1FXX A;  4C92 D;  2A37 A;  4WCI A;  1MMA A;  4NL3 A;  2DLP A;  3LH5 A;  3HP9 A;  3FDR A;  1UE9 A;  4ME7 A;  5FLX E;  5M9O A;  4ELZ C;  3BDL A;  2RK2 A;  2JUF A;  4M75 A;  3MHX A;  5J26 A;  2EFI A;  3JB9 G;  1N8R U;  2FHD A;  4BI8 B;  3NFC A;  1J3T A;  2K5I A;  4RCB A;  2CSI A;  1T0J A;  3UA6 A;  3OYF A;  8ATC B;  1WHK A;  3EFS A;  2KXC A;  2XMF A;  4FYV B;  2AKK A;  3RDV A;  2GQV A;  3CBO A;  1I81 A;  2K3Y A;  3CEY A;  2YHT A;  1H64 1;  2L3R A;  1D3B A;  1GL5 A;  1U5S A;  4QVD A;  4AT1 B;  1M1G A;  2HL5 C;  5LJ5 j;  4CC7 A;  3EG1 A;  3A8L B;  1G83 A;  1BIB A;  1MV3 A;  1MND A;  1GFC A;  5CKD A;  2FVU A;  4FT2 A;  4QVZ A;  1K9M R;  2VGN A;  1UGV A;  3C4S A;  4KH0 B;  1GXI E;  1OQK A;  2KDS A;  2PVG B;  1VQK A;  3CC4 Q;  2FG0 A;  1C6V X;  4CI0 C;  3CC4 T;  3CCV A;  3L2U A;  1Q86 U;  1AZG B;  3RIR A;  3DKM A;  1RI9 A;  3MPU B;  2PU9 B;  3OYN A;  1NM7 A;  2M1H A;  3I55 A;  4Y92 A;  2M02 A;  4C8Q G;  1WLP B;  2GQI A;  3HFN A;  1VQ6 Q;  1VQ6 T;  2VXE A;  3PMI A;  3JCM J;  2JJ9 A;  1IGU A;  1KG1 A;  1WHG A;  2FO0 A;  2RJD A;  3GPL A;  2ZPF B;  1G3W A;  4IKF A;  2PVO B;  2X35 A;  5CAI A;  4A4H A;  1WPY A;  3R6N A;  5IHN A;  2KRS A;  4A53 A;  4EDU A;  3PIP A;  1AWX A;  3CC2 A;  4ESR A;  3KXT A;  1VQK Q;  1G3T A;  1VQK T;  1M2V B;  4OMN A;  1N9R A;  1PG5 B;  1NE8 A;  1D1A A;  4F7U A;  2DXB A;  1OZ2 A;  3HRS A;  5HK3 A;  1QLY A;  1UTI A;  3H8Z A;  2WSF E;  1K8A U;  4JUV A;  5I11 A;  4FYW B;  4M78 B;  1VQ4 A;  2ENM A;  1ZSZ A;  2D8H A;  2ECZ A;  1RI0 A;  3JCM g;  3EFR A;  3OBW A;  1JRI A;  4HT8 A;  5FW9 A;  2FEI A;  3EGD B;  2E41 A;  1VQM A;  4DEY A;  1SSH A;  5CIU A;  1UDL A;  1G3S A;  4M77 D;  4QT7 A;  3M0U A;  1PWT A;  1VQN Q;  5IN1 A;  3C94 A;  5CQX A;  1VQN T;  4FCY A;  1MV0 B;  3TVT A;  4DOV A;  2QXF A;  4C92 A;  5GAM d;  3CCQ A;  1WIE A;  3JCM c;  2EPD A;  1LOJ A;  4M78 D;  1BI0 A;  1M1K R;  4F04 B;  3OYB A;  2DAQ A;  3UAT A;  3O8V A;  5FU7 C;  2YRV A;  3OBY A;  5C0M A;  5IT9 E;  4BE1 A;  4C0F A;  2DRK A;  2EAY A;  4AMC A;  1OPL A;  2D8J A;  3G4S A;  1V29 B;  4O5V A;  1RAE B;  2RJF A;  1YP5 A;  1VQP A;  2F69 A;  1VQ5 A;  4ZN1 A;  2EVR A;  3NTI A;  2BZX A;  4F16 A;  4BDY A;  4ZGJ B;  2L3S A;  4FL6 A;  1KC8 R;  1JB0 E;  4PJO E;  1X6O A;  3FB9 A;  3M4G A;  1Q7Y C;  2EYX A;  3CD6 Q;  2CS7 A;  3CD6 T;  1QVP A;  3QBY A;  4FU6 A;  3RBB B;  2GCX A;  2A36 A;  2QGF B;  2ZPH B;  2KGT A;  2D6F A;  4N4H A;  2DVE A;  2P4R A;  3MKD A;  2CT3 A;  3M58 A;  2OI3 A;  3EG0 A;  3TQ7 P;  1QKW A;  3EG2 A;  4QW2 A;  2GBQ A;  2YDL A;  1B3Q A;  1U3O A;  4JRQ A;  3CCJ A;  3AHU A;  4E6R A;  2EGE A;  3A8G B;  4OGE A;  3M57 A;  2P0Q A;  3M4Y A;  4C5I A;  1X27 A;  4WF2 A;  3G4S Q;  2EGC A;  4RTV A;  5KYU B;  3GIB A;  3G4S T;  1VQP Q;  3MP8 A;  3CXC S;  4ELY C;  1VQP T;  2W10 A;  3Q1J A;  3V8J A;  1W70 A;  1VIE A;  3ASK A;  3VS5 A;  1Q82 C;  3A8O B;  4BB7 A;  2XDB A;  3RER A;  5LL6 S;  2SEM A;  3THK A;  2ZZD A;  1Q82 U;  2DF6 A;  1PRM C;  1UGQ B;  1MUZ A;  3FC3 A;  2CSQ A;  4ANJ A;  2F2W A;  4KRT A;  4A4F A;  5GAN e;  4M7D B;  4K11 A;  2BZY A;  2DZC A;  2JMC A;  2XIC A;  5GMK e;  1KQ1 A;  2K57 A;  2L8D A;  4HKE A;  5GAM j;  2EKO A;  3QG1 A;  1JEG A;  3RUX A;  3CQT A;  5FRO A;  5HCK A;  4EIK A;  3OSS C;  2OTJ A;  2RB6 A;  2MK5 A;  4M75 E;  2RNA A;  3CCJ Q;  4B6M A;  3OYD A;  3CCJ T;  3L2W A;  1GBQ A;  1UGS B;  3GF5 A;  4X9D A;  2JTE A;  2JS2 A;  3JB9 J;  4J83 A;  2EQI A;  3ER0 A;  1IXD A;  1OUL A;  2AIR B;  3P8H A;  3CCU A;  1UG1 A;  3KUF A;  4JDS A;  1YCS B;  2JM8 A;  2QA4 A;  2RK1 A;  4ZGD B;  2HQX A;  3L1A A;  4BY6 C;  4KUI A;  1M5Q 1;  1VQO A;  1GCP A;  1M2V A;  3C12 A;  3AT1 B;  3JCM d;  2GFA A;  2MI6 A;  3MP1 A;  2K5F A;  5FRM A;  1R0C B;  2LX9 A;  4FYX B;  4FYY B;  5KYX B;  1PC0 A;  4M78 A;  4OVA A;  1IGQ A;  3HL8 A;  1EIF A;  4DA4 A;  2AZS A;  2A7Y A;  2QAZ A;  2P0K A;  1K0S A;  5KCH A;  2B8A A;  3DB3 A;  3EGD A;  1KD1 C;  4R55 A;  1HXD A;  1D1C A;  4J6Y A;  1YWP A;  3MEA A;  2JT4 A;  2YWW A;  4M75 D;  2K3B A;  2F5T X;  1KD1 U;  3VRY A;  1SHG A;  3I9Q A;  2LT4 A;  4II1 A;  2LZ6 B;  2KYM A;  2RI3 A;  3M5A A;  1D0X A;  5GAO r;  3ME9 A;  2DVJ A;  5A0D A;  4HT9 A;  2QDL A;  2DZ9 A;  2JMA A;  4DOW A;  2HSP A;  2F1L A;  4ZN3 A;  3OSV A;  3WVE B;  4JJB A;  2JM9 A;  2AT1 B;  4XU3 A;  3VYG A;  3QZ5 B;  2XKO C;  2CP6 A;  1AZE A;  4OMP A;  3M53 A;  5GMK h;  1O9S A;  3V7C A;  1RL2 A;  2ZPE B;  3REB B;  4XK8 E;  3CPF A;  1M3A A;  2Y90 A;  2LT1 A;  1RAD B;  2O88 A;  2MWO A;  4F7U E;  2QGG A;  4XU0 A;  4J9I A;  3QUI A;  4LD9 K;  4CRI A;  4RTU A;  4LDW A; 
#chains in the Genus database with same CATH homology
 3LH0 A;  3EFS A;  1VUB A;  2DTI A;  4N0A C;  4PJO G;  3QJY A;  2V8J A;  1M90 U;  3CD6 A;  4BD3 A;  2GQV A;  2RJC A;  5EG2 A;  1QVF S;  1M1F A;  5GAN 3;  3GP8 A;  3FEO A;  3CBO A;  3H6Z A;  4M77 G;  4ZGE B;  2HBP A;  3CME T;  1I81 A;  2EQK A;  5CK9 A;  4RMO A;  2RA2 A;  2KAF A;  1G3Y A;  3CPW S;  2K3Y A;  3CEY A;  4JRI A;  3V8L A;  2CGH A;  4EMK B;  2YHT A;  1H64 1;  2L3R A;  1KHC A;  4Q5W A;  4M7D D;  1D3B A;  1YHQ A;  3ZFJ A;  2K5L A;  3LYI A;  3OS2 A;  4C5E A;  5GAN j;  2X4Y A;  3SDZ A;  4HCB A;  4KUD K;  2VC8 A;  4QVD A;  1M1G A;  2MWP A;  3HRU A;  1QP3 A;  3TCJ A;  3CCS T;  2RJE A;  5L8R E;  5LJ5 j;  2DKG A;  3BY7 A;  4M78 G;  4LDU A;  4IUR A;  3A8L B;  3OYL A;  3CCR A;  3CCM A;  1BIB A;  3V8K A;  4HCC A;  4C92 E;  2VXF A;  5GAN 8;  1W4S A;  1U1S A;  1MHN A;  3G7Z A;  5CKD A;  2FVU A;  1YIJ A;  1BIA A;  4FT2 A;  2K2V A;  4FT4 A;  4GLK A;  4PJO C;  4QVZ A;  1ZBX A;  4A4E A;  3TRE A;  3VYH B;  3S3N A;  1Y7X A;  2KK4 A;  1YIT A;  2VGN A;  4F7U F;  3J81 E;  2LCL A;  2QQR A;  3ZBD A;  4M77 C;  2O4X B;  3C4S A;  4NOY A;  2XG8 D;  4XTZ A;  1GXI E;  2KDS A;  2PVG B;  4B9X A;  3OS0 A;  4M7A B;  1VQK A;  4E7J A;  4V2S A;  4CI0 C;  2DIQ A;  3OS1 A;  3C95 A;  5GAO n;  3CMA A;  3CC4 T;  3MO8 A;  4JLG A;  3L2U A;  2QI2 A;  3CCV A;  1Q86 U;  3RIR A;  2OTL A;  3DKM A;  4J6X A;  3G6E A;  3JCM X;  1UEB A;  5LJ3 h;  2JN0 A;  1YI2 A;  2C06 A;  4LDY A;  3G71 A;  3V7S A;  1BI3 A;  2PU9 B;  3JAM E;  3OYN A;  2OTJ T;  3JSC A;  2P4T A;  2HD0 A;  2M1H A;  4M78 C;  1R8O B;  3I55 A;  2I2L A;  5LJ3 e;  4JJN K;  1M1K C;  2RO0 A;  4LDV A;  2XID A;  4M7D A;  1JJ2 S;  4C8Q G;  3VV0 A;  3FRN A;  3RKX A;  3N5B B;  3HFN A;  2R5M A;  4ATO A;  4E47 A;  2QTX A;  2VXE A;  1VQ6 T;  3L2Z A;  3PMI A;  3JCM J;  1M1K U;  3NTK A;  4J6W A;  3WXM B;  2QQ9 A;  1Q7Y U;  1H3Z A;  1KG1 A;  4D6W A;  3PMT A;  3L2R A;  2EWN A;  2IVW A;  4C92 F;  3OYG A;  4RG8 A;  2RJD A;  3GPL A;  2ZPF B;  3CCU T;  1G3W A;  4IKF A;  2PVO B;  2X35 A;  4X9C A;  5CAI A;  1TH7 A;  1YJW A;  3LGL A;  1B34 B;  1FWZ A;  4A4H A;  1MGQ A;  2QA4 T;  1DJ7 B;  5CKB A;  4A54 A;  1WPY A;  2GFU A;  2DK3 A;  2MF2 A;  4OB2 B;  3CCR T;  2LTO A;  2X4J A;  5GAM h;  4XU2 A;  4XQ3 A;  2BKD N;  5CKF A;  4OF1 A;  4M75 G;  1VQO T;  1KC8 C;  4NS5 A;  3OB9 A;  4TVR A;  5A0G A;  3SWN C;  4A53 A;  1K73 C;  2HAX A;  4PJO B;  2D0Q B;  4LDW A;  4C8Q C;  2RI2 A;  4EDU A;  3PIP A;  1N9S A;  2E12 A;  5GAM e;  4MML A;  3CC2 A;  4E7L A;  1OZ3 A;  3KXT A;  4FM4 B;  2LVM A;  3X24 B;  1G3T A;  1VQK T;  1KC8 U;  1VQ9 A;  1ZHI A;  4OGC A;  1K73 U;  5GAN 5;  1N9R A;  2DXU A;  3EAE A;  1N8R C;  3CMA T;  1NE8 A;  2RM4 A;  4F7U A;  2DXB A;  2OTL T;  1OZ2 A;  5LJ3 d;  2QEX A;  3HRS A;  1M8V A;  3I56 T;  1HK9 A;  5CR2 A;  1YI2 T;  2LQ8 A;  5HK3 A;  1YJN T;  4Z02 A;  2FYK A;  3OW2 A;  4C0G A;  3H8Z A;  2ZPB B;  1YJ9 A;  2WSF E;  1K8A U;  4JUV A;  4PLI A;  1WNL A;  1UB4 A;  5GAN g;  5GAN 2;  4M78 B;  2DJZ A;  1VQL A;  1VQ4 A;  4C0D C;  3VU3 C;  4J5Y A;  1RI0 A;  3OS5 A;  3QJ6 A;  4M75 C;  3QDR B;  5AYF A;  4C5G A;  2K4Y A;  3QKJ A;  3HKS A;  3JCM g;  3EFR A;  3OBW A;  1JRI A;  3WVD B;  4HT8 A;  3S3O A;  3PNW C;  3S3M A;  2ZPG B;  1VQM A;  2E41 A;  4HCZ A;  4PJO D;  5LJ3 f;  3X25 B;  2CZ6 B;  5CIU A;  3JCM Q;  1G3S A;  2XHC A;  2CZ1 B;  4M77 D;  1I8F A;  4M7A E;  2R57 A;  2XU8 A;  4Y91 A;  1XNI A;  5GMK m;  1UGR B;  5GMK e;  5GAO m;  4E7K A;  3MET A;  4L59 A;  1WJR A;  3E9G A;  5IN1 A;  5IAY A;  3C94 A;  3M56 A;  5CQX A;  1VQN T;  3ZEH A;  1NPP A;  5GMK i;  2XDP A;  1JBM A;  2ZPI B;  4DOV A;  1OI1 A;  2QXF A;  4C92 A;  1WJS A;  5GAM d;  1X75 C;  3CCQ A;  1NJI C;  2VUB A;  4E7H A;  5HK0 A;  4OB3 B;  3JCM c;  5GMK j;  4M78 D;  1LOJ A;  2DTH A;  3RES A;  4UC4 A;  1BI0 A;  3SWN B;  5DM7 R;  4ZTJ A;  1Y71 A;  2JVV A;  3MEW A;  4C8Q B;  1S72 A;  3OYB A;  1G5V A;  3BFM A;  3OA6 A;  2DAQ A;  4QVC A;  3SD4 A;  1Q81 C;  3RMS A;  2PUO B;  2E64 A;  2RHI A;  4XTY A;  3O8V A;  4BAC A;  4XU1 A;  5FU7 C;  1NJI U;  2YRV A;  3OBY A;  5C0M A;  5IT9 E;  1U8R A;  4BE1 A;  4C0F A;  3URG A;  1Q86 C;  2EAY A;  1VQ9 T;  5DLO A;  2A3L A;  2EIF A;  3LGF A;  5J3B A;  4RCC A;  3A5Z B;  5GAM f;  2KVQ G;  3CC7 T;  4ZTF A;  3G4S A;  3CXC A;  4M7D G;  5A0L A;  1V29 B;  1Q81 U;  4O5V A;  1UGP B;  2RJF A;  1VQP A;  1N6A A;  4LDX A;  4BUG A;  1Y96 B;  3OYE A;  2F69 A;  2RHX A;  4MZM A;  4OP0 A;  4ZN1 A;  2DD4 A;  4IUU A;  3NTI A;  3OW2 S;  2LRQ A;  1VQ5 A;  2BUD A;  3X26 B;  2CKK A;  3MP6 A;  4JS4 A;  1NPR A;  4BDY A;  1I4K 1;  4ZGJ B;  3MEV A;  4M77 A;  4X34 A;  3OYA A;  2E6Z A;  3L42 A;  3QPH A;  4C0D B;  4M7A F;  2X4W A;  4M75 B;  2YLC A;  2EQU A;  3HFO A;  4FL6 A;  1JB0 E;  3INZ A;  3RKW A;  4C0Z A;  1QVG A;  4PJO E;  1X6O A;  3FLG A;  3JB9 H;  1VQ7 T;  3FB9 A;  4C8Q D;  3M4G A;  3CCE A;  1Q7Y C;  2M16 A;  4M77 E;  2CS7 A;  3CD6 T;  1QVP A;  4JLI A;  3QBY A;  5LJ3 g;  3M54 A;  4FU6 A;  2VYT A;  3OYI A;  2GCX A;  2QQA A;  2ZPH B;  5D6W A;  2D6F A;  4M7D C;  1IZ6 A;  4N4H A;  2D9T A;  1WQW A;  2DVE A;  3M58 A;  2XDD A;  1KQS A;  2DTO A;  1XQH A;  4HA8 A;  1YHQ T;  4M7A D;  1BI2 A;  4VUB A;  4MDX A;  2FB7 A;  3CCQ T;  4MZT A;  4M78 E;  3GOX A;  2DXT A;  4OB0 B;  4QW2 A;  4YTL A;  1W2B A;  2ZCF B;  2XI9 A;  4J7F A;  3CCM T;  4F7U G;  3JCM P;  2FL7 A;  3MCA B;  1D3B B;  1M4Z A;  1WGS A;  4JRQ A;  1PSE A;  4LD6 A;  2DO3 A;  3JB9 F;  4JRK A;  5FU7 B;  3CCJ A;  1Y07 A;  3OQ5 A;  2M0O A;  4EMK A;  3AHU A;  4KBM B;  4MDW A;  1YIJ T;  3A8G B;  2NLU A;  4OGE A;  1K9M C;  3M57 A;  2P0Q A;  4L5G A;  3CC4 A;  1BKB A;  3M4Y A;  1YIT T;  5CKH A;  4C5I A;  2PVD B;  4WF2 A;  3OMC A;  5LJ3 j;  3TU4 K;  4JRP A;  3CME A;  4KUL A;  3GIB A;  3G4S T;  3R6O A;  3MP8 A;  4L6V 5;  1P92 A;  3CXC S;  4NL2 A;  4ELY C;  5GAM g;  2RHZ A;  5DLQ E;  4EMH A;  3DLL A;  1VQP T;  3M9Q A;  4PJO F;  1K8A C;  3OYC A;  3HSB A;  3Q1J A;  1K9M U;  3QYH B;  5HY6 A;  3V8J A;  3CCV T;  3A8M B;  1VIE A;  3ASK A;  3SFM A;  3QYG B;  1M9S A;  4M77 F;  4PLL A;  3A8O B;  3G6E T;  3RKY A;  1Q82 C;  4BB7 A;  3LX7 A;  2XDB A;  2DD5 A;  3RER A;  1WQ7 A;  2OAU A;  3LW5 E;  4OMF B;  3E9F A;  5LL6 S;  3G71 T;  3JB9 D;  3CCS A;  1WJQ A;  3PGG A;  3QII A;  4C8Q E;  1QVG S;  2ZZD A;  4MMK A;  3I55 T;  3DLM A;  1LJO A;  2O4X A;  5KH6 A;  3CCE T;  4PL6 A;  4N4I A;  1Q82 U;  4M7A A;  5DY9 A;  5GAN h;  4E7I A;  4C92 G;  1VQ8 A;  3CBP A;  2JTM A;  1UGQ B;  3J80 E;  4IUV A;  3FC3 A;  4M78 F;  2GF7 A;  2EYQ A;  5LJ5 h;  3KBG A;  4XAX B;  5KCO A;  4BDZ A;  1KQS S;  4XTU A;  3JCM h;  4BI4 A;  5GAN e;  4A4F A;  4M7D B;  5GAN 6;  2E10 A;  2DZC A;  4J8O A;  1FX7 A;  1VIF A;  1KQ1 A;  2K57 A;  2L8D A;  2XIC A;  3JRZ A;  2V8K A;  4HKE A;  3TEE A;  2EKO A;  3QG1 A;  5GAM j;  3FJP A;  2ZGW A;  5LJ5 e;  4JS5 A;  1PSF A;  2KQW A;  3GLX A;  3PT9 A;  3RUX A;  3JCM e;  1X01 A;  3JB9 I;  3DB4 A;  4N0A A;  5FRO A;  4O6J A;  2LC4 A;  3L2V A;  2P0P A;  2YLB A;  1YJW T;  1XOV A;  3OSS C;  2KY9 A;  3BW1 A;  2RB6 A;  1IRE B;  4M75 E;  1W2B S;  3PIO A;  2OTJ A;  2EQM A;  2M9U A;  3QZ9 B;  4MZP A;  4DQ2 A;  2V8I A;  4QQ6 A;  3CCL A;  2RI5 A;  5I2M A;  3OYD A;  1JJ2 A;  3CCJ T;  4J7I A;  3HPW A;  3L2W A;  4BE0 A;  2PUK B;  2DIG A;  3VUZ A;  4C92 C;  5GAN 4;  1UGS B;  3CC2 T;  3GF5 A;  4X9D A;  5CQY A;  2QDY B;  3UPU A;  4GY5 A;  2O01 E;  2E5Q A;  3JB9 J;  1VQ6 A;  4J83 A;  2DXC A;  5J39 A;  3RMQ A;  3P8D A;  3ER0 A;  2EJG A;  1B34 A;  2Y4Y A;  3X28 B;  3S6W A;  4C8Q F;  3T9N A;  2JNG A;  3BDU A;  4XTV A;  2LCC A;  5A2Q E;  4KT0 E;  3SB2 A;  3JCM b;  3P8H A;  3CCU A;  5CVI A;  5FU6 C;  2QEX T;  3KUF A;  4JDS A;  3E19 A;  3UDC A;  2IG0 A;  3V7R A;  4PJO A;  5D6X A;  1YJ9 T;  1QW1 A;  2CZ7 B;  2R5A A;  2QA4 A;  2PQW A;  2RK1 A;  3OYJ A;  3LWI A;  4F7U B;  1VQL T;  1VQ4 T;  4RG2 A;  4ZGD B;  2HQX A;  2QQS A;  1OYX A;  3L1A A;  4BY6 C;  4KUI A;  1M5Q 1;  1QP2 A;  5GAN d;  1VQO A;  3PTA A;  2G3R A;  2EQJ A;  2VV5 A;  4PKC C;  1VQ8 T;  4FSX A;  4N4G A;  3C12 A;  2JZ2 A;  1YCY A;  3OYH A;  5LJ5 d;  3M55 A;  1VQM T;  3UT1 A;  4B9W A;  2XD0 A;  3JCM d;  2GFA A;  2MAM A;  2Y4X A;  3NTH A;  2MI6 A;  3JCM V;  3MP1 A;  2K5F A;  5FRM A;  4M75 F;  2LX9 A;  2CYZ B;  4EMG A;  5HKC A;  4M78 A;  3MEU A;  4OVA A;  1U1T A;  1O75 A;  3HL8 A;  3I56 A;  1I5L A;  5GAN f;  1EIF A;  1YJN A;  4DA4 A;  3VJP A;  2A7Y A;  2LDM A;  2F5K A;  2P0K A;  3QHS A;  2K3X A;  1KHI A;  5GAN 7;  5KCH A;  2EJ9 A;  2B8A A;  5GMK l;  4PNO A;  5LJ5 f;  3DB3 A;  1YBY A;  1AHJ B;  5GAO l;  2E70 A;  4R55 A;  3JCM f;  1KD1 C;  1HXD A;  3CCL T;  4OB1 B;  2E6N A;  2XK0 A;  4J6Y A;  4Y28 E;  2RHY A;  3MEA A;  3VKI A;  4RKU E;  1LNX A;  2RHU A;  1ZQ1 A;  1S72 T;  3HRT A;  4C92 B;  4M75 D;  5CCA A;  3UWN A;  3QXE B;  2F5T X;  2MMP A;  1NZ9 A;  1XTD A;  3A8H B;  1KD1 U;  2LT4 A;  2H3J A;  1QVF A;  3VUB A;  3FIF A;  4M7D E;  2QQB A;  4FIB A;  2KSS A;  2RH2 A;  4C5H A;  4II1 A;  2L89 A;  4P5N A;  3GNG A;  2CZ0 B;  3QSU A;  2WAC A;  2EJF A;  2RI3 A;  4A4K A;  2R58 A;  2RD1 A;  2E65 A;  3M5A A;  4BI3 A;  5FU6 B;  3CPW A;  5FRN A;  1KQ2 A;  5GAO r;  4M7A G;  4XTX A;  2HNI A;  3ME9 A;  4EMK C;  1VQN A;  2JTF A;  5A0D A;  3SWN A;  3QO3 A;  3PFS A;  4HT9 A;  2DZ9 A;  4C8Q A;  1VQ5 T;  4IUT A;  4DOW A;  4ZN3 A;  2X4X A;  3HHT B;  5I2S A;  3OSV A;  5D6Y A;  2VGM A;  3WVE B;  3CBM A;  3LLR A;  1BYM A;  4BY6 B;  3L2Q A;  5KE3 A;  4XU3 A;  4XTW A;  4R56 A;  4BE2 A;  3OYK A;  4A4G A;  4IUP A;  3VYG A;  3QZ5 B;  5C6S A;  2BIV A;  1FXX A;  2XKO C;  4C92 D;  4M77 B;  1SSF A;  2KMT A;  5GAO p;  4NL3 A;  2WSE E;  3M53 A;  3OYY A;  1Y96 A;  3OMG A;  5I21 A;  5GMK h;  4IUQ A;  3HP9 A;  1O9S A;  3FDR A;  5FLX E;  4ME7 A;  5M9O A;  3E1S A;  5GAO q;  3V7C A;  4ELZ C;  3BDL A;  1RL2 A;  3CC7 A;  2RK2 A;  2ZPE B;  2JUF A;  2DPP B;  3M59 A;  2DEQ A;  5CKE A;  5CO7 A;  4XK8 E;  3CPF A;  4M7A C;  3P8B B;  3MHX A;  4M75 A;  3X20 B;  1N27 A;  2Y90 A;  5J26 A;  2EFI A;  2LT1 A;  4QQD A;  3OY9 A;  2LNV A;  2LQK A;  3JB9 G;  1N8R U;  2FHD A;  4BI8 B;  2MWO A;  4F7U E;  2HQE A;  1M90 C;  3NFC A;  4M7D F;  4XU0 A;  2E1H A;  2JOY A;  2K5I A;  3F70 A;  5LJ5 g;  4RCB A;  4EPC A;  3OYM A;  3QUI A;  1BI1 A;  3J7A F;  2L5Q A;  4LD9 K;  3GNF B;  3JCM W;  5KE2 A;  4CRI A;  3LWH A;  1VQ7 A;  2AHJ B;  4QQG A;  2WSC E;  3OYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...