2HR2A

Crystal structure of a tpr-like protein (ct2138) from chlorobium tepidum tls at 2.54 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
156
structure length
156
Chain Sequence
b'KPLKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAMEISHTMPPEEAFDHAGFDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAEAMPEFKKVVEMIEERKGETPGKERMMEVAIDRIAQLGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
molecule tags Unknown function
source organism Chlorobium tepidum
publication title Crystal structure of hypothetical protein (NP_663012.1) from Chlorobium tepidum TLS at 2.54 A resolution
rcsb
total genus 57
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12968 DUF3856 Domain of Unknown Function (DUF3856)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2hr2A00
5JJ7A 4GCNA 4A1SA 3FWVA 3S7DA 1KT0A 4AY6A 4JHRA 2KCVA 3GZ2A 3ZFWA 5HQ8A 2PL2A 4XI9A 5G04J 4I2WA 3MV2B 3Q49B 4GZ3A 4HOSA 1WM5A 4WNEA 4G26A 2UY1B 2IFUA 3IEGA 1TJCA 3HYMB 2XPIA 3TG4A 2P58C 3AS5A 4UI9C 1A17A 3OXGA 3RIBA 3WXXA 1HH8A 3ZGQA 4I17A 4G23A 2KCLA 2XCBA 3Q15A 2FBNA 4UQXA 4N3BA 4YNDA 3RU0A 4AIFA 2XGMA 4J8FA 3S7BA 2JLBA 3RJVA 3FP3A 3LYAA 3AS4A 5KJNA 4U0SA 4J8DA 1HZ4A 2KCKA 2OOEA 4U0ZA 2J9QA 4G2VA 4I9EA 4W9RA 4YVOA 5FJYA 3S7FA 3UUXA 3VTXA 5FT9A 2GW1A 5JJTA 1E96B 4HOUA 2BUGA 3GW4A 4UQZA 3QDNA 4Y6CA 2NC9A 1NZNA 2LSVA 3AS8A 4UI9K 4LEUA 5D0QD 5EX3A 5EX0A 1ZBPA 3OXFA 4GA0A 2E2EA 3Q47B 5HI7A 1YA0A 4JA9A 4BTAA 2VSYA 3R9AB 3LY7A 4JL0A 3U4TA 4H7YA 4GYWA 4APOA 2WQHA 4ME2A 5CCMA 4RG6A 4EQFA 3K9IA 4O6FA 3GYZA 1ELWA 3EDTB 3JYSA 3CVLA 2UY1A 3QWPA 5FTPA 5BT1A 2Q7FA 5EKQD 3URZA 3ASDA 4J8EA 3LCAA 1IYGA 2R5SA 5CHEE 2Y4TA 5G04C 3ULQA 4F3VA 1W3BA 5A7DB 3KS2A 4G1TA 1Y8MA 3O48A 3CKCA 3CK7A 3ZN3A 2LNIA 4GCOA 4CGVA 4N39A 3ASHA 2VYIA 2VGXA 1ELRA 3KD7A 3RO2A 2VGXB 4G25A 1OUVA 4YVQC 3CVPA 4Y6WA 4XI0A 3ZHEB 4XIFA 3S7JA 3PE3A 5CCLA 1FCHA 2C0MA 2Y4UA 2FF4A 2UWJG 3LKUA 3MKRA 2ONDA 2XGOA 4I1AA 4N3CA 1NA0A 3SF4A 5LCWJ 2VQ2A 4I2ZA 4BT8A 4U0UA 4HORA 2KC7A 1IHGA 2XEVA 5KJKA 5C1DA 4U04A 2V5FA 5M72A 5D0OD 5DBKA 3RO3A 3UPVA 2VGYA 3QWVA 4N2QA 3TAXA 4J0UA 3KAEA 3QWWA 1KLXA 4H7XA 1ZU2A 2MHKA 2YQ8A 4GYOA 4HOQA 4U07A 5KJMA 4B94A 3TG5A 3PDNA 2C2LA 4G24A 1QQEA 3ESKA 3CK9A 3LY8A 2HO1A 1PC2A 2C0LA 2FI7A 2XGSA 4GZ5A 4IN3B 3CEQA 4UI9J 5G05C 4GA2A 3ZPJA 2HYZA 2PQRA 4GA1A 2IF4A 2L6JA 1KT1A 3Q4AB 4N5CA 3QKYA 3N71A 4KXKB 4CDRA 4KYOB 3Q5MA 2WPVA 5ARGA 5G05J 3CVNA 5BW8C 4CGWA 4N2SA 4GPKA 4BWRA 5AYWD 4AY5A 5KJLA 3MEKA 4KBQA 4WNDA 3U3WA 3E4BA 3CVQA 1NA3A 1P5QA 2AVPA 1QZ2A 2VSNA 4AM9A 2I6HA 1B89A 2DBAA 4ABNA 1WAO1 1XNFA 3BEEA 3LPZA 4I9CA 2QFCA 3CV0A 4RG9A 2PQNA 3NF1A 4JA7A 2FEZA 5FZQA 1HXIA 5FZRA 3LY9A 4BTBA 3ASGA 4GYYA 5ARFA 5JJ6A 3FFLA 4GZ6A 3ASFA 2XCCA 5DIZA 3QOUA 5FZSA 5BNWA 4NQ0A 2PZIA 5LCWC 2LSUA 4WNFA 3PE4A 3TGOA 3RKVA 4UQYA 3UQ3A 3CK8A 3VTYA 2FO7A 3ZHEA 4BT9A 2KATA 4HOTA 4WNGA 3MA5A 4WUYA 2HR2A 2YHCA 3GZ1A 3MV3B 3OXLA 3SZ7A 5A6CA 3CKBA 4NRHB 4N3AA
chains in the Genus database with same CATH superfamily
2WMOA 1IQUA 3CHOA 3RRUA 4EZKA 3HXEA 2KZTB 5HRYA 3RIBA 3KSLA 2IY0C 4UQXA 4I6JA 3LYAA 4B93B 3E34A 5CBOA 3QDNA 5HI7A 3R9AB 3U4TA 3UT7A 4GYWA 3EHQA 4LCTA 2WVIA 2IOLA 1W3BA 3DPDA 1HFAA 1Y8MA 2WB2A 5FIOA 1X81A 4KZ0A 4EHMA 2XRZA 1YMPA 3ASHA 3FTZA 3G2TA 3DRAA 4YDEA 3ZHEB 5CCLA 2P9LG 2Y4UA 2UWJG 2PM6A 4B8AA 3HIZA 5AJLA 5H7PA 2WXJA 3C3OA 2YQ8A 4B89A 3I4RB 4WWNA 5ENNA 3N71A 3CGHA 5ARGA 5KJLA 4A63B 4GMJA 3D9PA 4HLEA 2H6HA 2Y1LE 3CV0A 1HXIA 5ARFA 2XCCA 4BESA 3MKQB 4F1SA 1NL4A 4B0ZA 3ZNGA 1OCOE 3DSSA 3FWVA 4ANUA 4GZ3A 3FUJA 1OWMA 4HS2A 4I17A 1Y6IA 2XGMA 2JLBA 4FA6A 1E96B 4AV7A 4IYPA 4EQFA 3V79K 1O5MA 4U8VD 2WXRA 4BY6A 2E2EA 1YA0A 5CCMA 3PRZA 4XKCA 4O6FA 3GYZA 1JPLA 2CHXA 3VLEA 3PVLA 4MRUA 2MRIA 1HE8A 1Q2ZA 3ULQA 2WXFA 3LXUX 1LTXA 2GGFA 3CKCA 3EUVA 4N39A 3JXIA 4J6IA 4Y6WA 2QZAA 5BV0A 3PE3A 3CQGB 2FF4A 2IONA 4N3CA 2ONDA 3SHFA 3FH7A 1DNPA 3Q79A 3HXDA 3ZYKA 1V54E 5G55A 2FULA 3TG5A 1QQEA 5G05C 4UI9J 1AP7A 2WXIA 2DCPA 2XGSA 2YHEA 2R17C 4GTTA 4HLLA 3JUEA 4RLYA 3BG1B 2X6FA 2KXPC 4HRLA 3AU4A 2QFCA 3CVVA 4BSZB 4TRQA 4JD2G 1SVXA 1N94A 2DYSE 3MA5A 2QY7A 2HR2A 3OXLA 4NRHB 3DXKG 1BLXB 3Q73A 3TL5A 2KBXA 2WXGA 1LD7A 3DXMG 1HF8A 3NAWA 3U9WA 2FBNA 3CVUA 1PAQA 3RJVA 3FP3A 2ZGDA 5FQ7A 3RK6A 3RO3A 1BI8B 2B0OE 2ZXWE 4E85A 5A7DB 2LXLA 2J07A 3MJWA 1N0QA 2LAIA 3G2SA 4RG6A 3BQOA 2XENA 3CVLA 2UY1A 3CSFA 3TJPA 1DC2A 4GCOA 3FUDA 3ZYLA 2VGXB 3IV0A 4CDMA 2C0MA 4ANWA 1E8XA 2IOSA 3PZDA 2VTBB 1H2UA 1N0RA 3C72A 1E8ZA 5CECB 4U04A 3SI5A 2L0TB 3QWVA 2P9UG 3FUHA 2MHKA 4KVMA 5CEDB 4GTSA 3DSVA 1DCQA 4A1GA 1B89A 4R7LA 4RG9A 4EBAG 4JA7A 5BNWA 3KEZA 4BT9A 4UUCA 2OV8A 1KPSB 4N3AA 2J8SD 4BX8A 4PS7A 4HVBA 2CHWA 3ABKE 2V5QC 3IEGA 2M63A 1BD8A 3WXXA 5IY5E 1D8DA 4XZ4A 3PUKA 3WG7E 3FH8A 2L9BA 2XS8A 5FT9A 1KZPA 5CMWA 4UI9K 4LEUA 3OXFA 1UG3A 1O1SA 4ME2A 3KSQA 5KNGA 4HBDA 3BG0B 3QWPA 4K5CA 4K03A 5EKQD 3ZEFA 2Y4TA 2X38A 3JCKC 3CK7A 4FP7A 3LJNA 4CGVA 2IO2C 4G25A 3NZUA 4LRZA 4HRNA 2OCCE 3HHMA 2MYOA 4WAFA 1N4QA 5AIJA 2VQ2A 4L1BA 1D9SA 1BI7B 3FUFA 4WWOA 3TWQA 2A5UA 2GRNB 3TWSA 3T5XA 5B3SE 2CHZA 2DZOA 3FUEA 3Q9UC 1KLXA 4H7XA 3HXFA 3DSXA 3JQ0A 4A3VA 4L7TA 2J4BA 5KCMA 4CDRA 3KEAA 1HO8A 4FU3A 5J08A 2CFUA 3EIJA 4M3OA 3U3WA 4CDNA 3UT8A 5BXUA 4GU5A 4I9CA 1EYHA 3ASFA 3QOUA 3UI2A 4MS6A 1OWNA 1TR4A 1E90A 3G2UA 2X6IA 4JB8P 4ILHB 3SZ7A 3ZRHA 4U96D 2XPYA 2WXQA 4A1SA 3S7DA 2RKKA 1OCCE 2V4HC 4DX6D 4PH4B 3O4ZA 3DWLG 1MZCA 1MYOA 4I2WA 2H6IA 4MLPA 2BKKB 5KNHD 5EYLA 3L22A 2IFUA 4UI9C 3G2WA 4JVSA 2KCLA 3ZXSA 2F37A 4DJAA 4JEUA 1JCRA 4XKBA 4Q69A 3D9HA 4CT4A 4GPMA 2JEKA 1Z5SC 5JJTA 3GZSA 3I5PA 1UJJA 4APOA 3B13A 3JYSA 4MBGA 5G04C 4F3VA 4QFVA 4PDXA 4ANVA 5ANLA 2GRLA 3L13A 3UTMA 3RO2A 2B6CA 2XHEA 4XIFA 3LKUA 4I1AA 2H6FA 3FULA 3FTWA 4DI3A 1TNZA 1N9AA 3C3RA 3HVEA 4U8YD 2V5FA 5DBKA 2I1KA 4ZFHA 2WQ6A 4B94A 3DSWA 2FI7A 2AXUA 3ULYA 3Q4AB 2YNQA 4BEPA 4RSYA 3TWTA 4GPKA 3UMVA 4O60A 2DBAA 1WAO1 5ANRA 3CSTA 4WWPA 2DZNA 3ASOE 5FZSA 2LSUA 1UW4B 3TXMA 4BERA 4HB5A 4GMLA 4ACLA 3UQ3A 1RW2A 3UM1A 4WNGA 4WUYA 3ASNE 1KT0A 3Q75A 2BF0X 4Q94A 4QQIA 3LDZA 4XE0A 2CG3A 3FEYA 5G04J 4ANXA 1UN9A 3I3NA 5E76A 4LUNU 4UWHA 4I6GA 5CMYA 1MX4A 3G2VA 3Q15A 4E6HA 3S7BA 2DYRE 3D9KA 2J9QA 1IKND 1H2TC 3CVXA 4UWFA 2LAHA 3MZLB 2VJ8A 5ENQD 5FWQA 4IRUA 3URZA 3ONLA 5CHEE 4J8SA 1JWFA 2VGXA 3ZYQA 1U3CA 1OY3D 1S64A 3S7JA 1FCHA 1QYMA 3ABLE 1JUQA 4XEIG 4HQDA 2WXPA 3B7TA 2XZDG 3QWWA 2MOWA 1YCSB 4G24A 4FC8A 4I6EA 3CK9A 2HYZA 2PQRA 5T8IA 4HFGA 3QKYA 4TV3A 5BW8C 1HG5A 4AY5A 2WXLA 1NA3A 1QZ2A 3L08A 1XNFA 3QAQA 5FZRA 5T3RA 4HRMB 3ZW3A 1FT1A 3DBSA 2I1JA 2R03A 1FPPA 2YHCA 4LSZE 2PNNA 1TEZA 4KZCA 1TNBA 4IULA 3VLFA 2NYJA 3Q49B 2P9IG 4Z68A 3SY2A 2GRQB 4DPRA 1A17A 4TUUA 1MX6A 4YDYA 4D10C 3PEVB 4YVOA 5KBAA 4PUCA 2WQ7A 1IHBA 2BUGA 3ZHEA 4OYSA 4Y6CA 3DPYA 3I4GA 4JL0A 3ZIMA 4H7YA 4LNUD 5EYPF 3HVEB 2EINE 2J09A 4CEMA 3PZ2A 1OUVA 3CVPA 1U3DA 5A23A 2V0PA 2KC7A 2J08A 5KWDA 2WXOA 4F1PA 3RRMB 3UXGA 4GYOA 4ACKA 4DRXE 4FULA 3T9KA 1PC2A 4HNAD 3E32A 4DI4A 3EHMA 1LF8A 1N4PA 3APFA 1E8WA 1EPUA 3NF1A 1G3NB 5D66A 4GZ6A 4URKA 3UM0A 3CK8A 2GROB 3ESLA 2AXVA 1FVFA 2X3MA 1WM5A 1SA5A 3V2OA 1V55E 3T8MA 2BEDA 3IHVA 5LFAA 3JQ1A 2V8SE 2KCKA 4W9RA 4I9EA 3UKUG 4EPZA 2NSZA 1Z3YA 2X6HA 3ULEG 3ZVVA 2I9CA 3R7RA 4JA9A 2JABA 3AG2E 5FTPA 1ELWA 4FLBA 3LVQE 4JHJA 3PZ3A 3KS2A 4OAVB 3PNTB 3TWRA 2V4LA 5FQ4A 3DEPA 3UKRG 2BKGA 2KM4A 4HORA 3SFXA 1FT2A 2DVWA 1IQRA 4N2QA 2VGYA 5BUZA 4FLHA 3KAEA 3MYVA 3LS8A 3ML9A 4JW1A 4HI8A 2IF4A 4N5CA 5ENPD 1SA4A 3FY4A 3S2AA 3V30A 2Y69E 1JWGA 3T8KA 4FJZA 5FINA 2PQNA 4U63A 5JJ6A 3FFLA 3EHNA 2QC9A 1SQMA 2J4DA 4M7CA 3AJIA 3NBNB 5D2MC 3DEOA 2XS1A 3GZ2A 3JXJA 3MV2B 1L5JA 4CZ2D 4TXPA 3MCXA 2UY1B 3ZGQA 1TJFA 3FTUA 1SZ9A 3C5RA 1HZ4A 2OOEA 2R59A 4U7EB 2YINA 4HOUA 5D0QD 1HU3A 5CBNA 5CRUA 4BTAA 4RVBA 4FJYA 3LJ3A 3QNKA 3D9OA 2Q7FA 3QK0A 3FU3A 1UN8A 4U8HA 4BFRA 4A3TA 1HG2A 2PM7A 5EN5D 4EZJA 1EDUA 3B7UX 5C1DA 3FU6A 5M72A 3PREA 3X2QE 2WXKA 1MHQA 1BU9A 1SW6A 3IKOB 1YYHA 3V2XA 4GZDA 3LY8A 2EIME 4IN3B 3CEQA 3ZPJA 2GRMA 2NXPA 1TN6A 3EJNA 4BWRA 3L82A 3PS6A 4KBQA 5EIDA 1VDYA 4EECA 3ABME 3LPZA 2HE0A 3B7SA 5FZQA 2FEZA 1BPOA 3J5QB 5DIZA 1DVPA 3D9LA 3U66A 3PE4A 2AJAA 1RZ4A 1H6KA 4AOFA 2XEEA 3TWXA 3D9NA 4J7WA 1WY6A 3APCA 3QARA 1O1RA 2IO3C 4XI9A 1K1AA 4WNEA 3L17A 3TG4A 3AS5A 3OXGA 4AVXA 4KMOA 3IBEA 2P2CP 3RU0A 4AIFA 4J8FA 5FQ6A 3UM2A 2R2LA 4YDWA 4G8KA 3LY7A 4K5BA 2CG2A 5BT1A 1XGWA 1TYQG 1S0PA 3L16A 3HXCA 4GB9A 4G1TA 2ZU6B 2LNIA 1NP7A 2R05A 2ILRA 3RAUA 3MX3A 2EQXA 3ZXPA 5JMND 2XGOA 2WXNA 1NA0A 5LCWJ 4I2ZA 5CRVA 1IHGA 4F7AA 5D0OD 5EIBE 4OAUC 3PDNA 2C0LA 2J49A 4GA1A 3CVNA 4DX2A 4OVVA 4CYMD 1U2VG 4LG6A 2XQ0A 2P9PG 2X6KA 1UOHA 3FUMA 3RKVA 3MV3B 5EILA 4DX7D 4GCNA 3R9MA 1MX2A 4AY6A 3ZU7B 3PZ4A 3ZFWA 4BSXA 5B1BE 5ENRD 4FHJA 5JA4D 1TJCA 3U64A 1GW6A 1N4RA 4J8DA 3ZYMA 1JCSA 5LX8A 2X6JA 4F53A 3B7RL 3CHPA 4DX1A 2AXZA 3LCAA 3PNLB 1H0AA 2P9SG 4LNBA 4GTOA 3ZN3A 1DCEA 1WDYA 2HM8A 3AG4E 3HRAA 2DIWA 4NURA 3RRNB 1N95A 3AAAC 3SF4A 3CHQA 3UT4A 4BT8A 3SBSA 2VGEA 1KZOA 4UWLA 3OAWA 2ETBA 3QB2A 1X5BA 2RFAA 4PS3A 4DUIA 2C2LA 3ESKA 4GZCA 2QYUA 4J8YA 5LOZA 4UWKA 3HDXA 3UIPC 4K0RA 3NQPA 3UM3A 3TWWA 3FUKA 5B1AE 4CRWA 4I43A 3CR3A 3IHYA 3VLDA 1IXVA 1OCZE 3FUNA 4NQ0A 1OWOA 2VSXE 2FO7A 3L9TA 2F0YA 3AU5A 3D3MA 3QC1A 2EIKE 5JJ7A 3C98A 3ONKA 3CVYA 3J5PA 5HQ8A 4HOSA 2KZTA 3SFYA 1HH8A 3FU0A 2OEWA 2EILE 3EU5A 1NI1A 3UX4A 4OVUA 5EX0A 3AS8A 4GA0A 4C0MA 2VSYA 1MQSA 1O1TA 2WQHA 3SO8A 3B7BA 3PEUB 3HG0D 4P29A 3APDA 3SNXA 4KVOA 3KD7A 2VYIA 5AQ9A 5JHAA 3C3QA 5J90A 4TUMA 4FHKA 1TN8A 2R02A 3D9JA 4XI0A 4A55A 3JUIA 1E8YA 4DLOA 4U0UA 3E37A 2XEVA 3LEWA 2QYJA 3UPVA 3NOCD 4JPSA 5JHBA 4X8QA 2WXMA 1ELKA 2RG8A 5AENA 3ZKJA 4LERA 4APFA 1JCQA 2L6JA 5KJKA 4KXKB 4ATGA 3OTNA 4ZHBA 1FVHA 4C0EA 1P5QA 5AAOA 1N4SA 2XZTG 1H19A 3BUAA 3PUJA 4BTBA 3FTVA 5LCWC 4WNFA 3TGOA 4AP2A 5LP0A 4ATZD 2OVFA 4JXTA 4AXHA 4ILIA 4GMRA 3W9FA 3DSUA 3CHRA 4HXIA 2A5EA 2A4ZA 3HYMB 1QNFA 2P58C 1HS6A 3T5VA 1TNYA 3LVRE 4G23A 1S63A 5HKPA 4AJWA 5CEAA 3AS4A 2ZISA 2GW1A 3ISMC 2RFMA 4KT6B 3Q78A 3UUXA 1ZBPA 3Q47B 3ZUVB 3K9IA 3FH5A 2L6BA 4ILGA 4JZYA 4JEHA 3L6AA 3CHMA 3D9MA 2H6GA 2LXMA 3CVWA 3Q7AA 1H6PA 3B95A 1OCRE 3EIQC 4B8CB 3FTYA 3P1UA 4AEZC 3AG1E 1NFIE 2HO1A 4G11A 4V3IA 4GA2A 4C9BB 5EDSA 3V31A 5G2NA 4HI9A 4CGWA 4N2SA 2VTBA 3Q9NC 3FHEA 3ENEA 3CHSA 2F8YA 1LD8A 3BEEA 3RSEG 4GYYA 3R7QA 2OVBA 4C48B 3CIAA 3VTYA 2WXHA 4HOTA 4GAAA 3CKBA 1MJ0A 4XX5A 2KCVA 3FTSA 1K1BA 4PS8A 1S70B 2RD0A 1Z3XA 1D8EA 3PZ1A 1QBQA 5AQBA 4MKTA 3FDHA 5ENSD 1H6OA 2GRRB 3QJZA 3P2BA 5C2YA 2LSVA 4K5AB 1OT8A 3FEXA 3SQVA 4CCAA 2BTDA 3EDTB 4J8EA 1IYGA 2R5SA 4EZLA 1UJKA 3O48A 3UIOC 2XEHA 4DLQA 2AWIA 1HX8A 2ZGGA 5CERB 5AN8A 4FADA 3TAXA 4J0UA 1H2VC 4O1OA 1ZU2A 3FUIA 4HOQA 4G8LA 1PY1A 4JHKA 5AARA 3MGBA 1EF1C 2ZIRA 1KT1A 1TN7A 5AJDA 2XRYA 2WPVA 5G05J 1N11A 5AYWD 2ETCA 3CVQA 2EIJE 4BX9A 4DX5D 5AQAA 3SBTB 3ASGA 3DSTA 1ZB1A 5BV1A 2VSOE 1A5EA 3MKQA 4UWGA 2AW6A 3GZ1A 5E75A 4G26A 4NACA 5T4YA 2XPIA 3IXEA 4TXRA 2XCBA 4U95D 1E7VA 3Q7FA 2Y0BG 2E0IA 4U0SA 4U0ZA 5HS0A 4G2VA 3VTXA 4UQZA 5ENOD 5EX3A 1AWCB 3ASDA 3NZSA 4Q96A 2P9KG 2ETAA 2IJGX 5ITZF 1ELRA 4YVQC 1OWLA 4TXQA 3FTXA 5FQ8A 3D9IA 1OXJA 4BETA 2OEVA 4EBAA 3SD5A 2Y3AA 3TWVA 5KJMA 4U07A 3HXBA 4RQIA 2P9NG 4GZ5A 5BPPA 4N5QA 4GTVA 2FO1E 3Q5MA 3E4BA 2VSNA 1N52A 4F6RD 2I2OA 1K3ZD 2GRPB 2PZIA 4GTMA 2KATA 3E33A 4I1MA 4JHRA 4NIKA 3PH0C 3TXNA 2PL2A 3SGHA 1OWPA 1K8KG 5ENTD 4YNDA 4N3BA 3TWUA 5KJNA 3CQCB 3S7FA 5FJYA 4LNGA 3GW4A 2NC9A 1NZNA 4AM9A 3FU5A 2LUHA 1TNOA 3NOGD 3ML8A 2LO6A 2WMNA 3UINC 1SZAA 1E7UA 3AG3E 4CT0A 2IQCA 3CLJA 3NB2A 4L2LA 4I1OB 4YDOA 4O1PA 4GTQA 1TNUA 2DWZA 4GTPA 4L9PA 3MKRA 3F6QA 2WM9A 3EU9A 3L54A 1WG0A 3SFZA 1INZA 4GTRA 4DK5A 2XPZA 2IEJA 4KYOB 2CFZA 4L2YA 3MEKA 4WNDA 2AVPA 2I6HA 1Z6TA 4ABNA 3BU8A 3LY9A 1N54A 2L0IA 4L23A 2IU1A 4UQYA 3E30A 4JC8A 3W9GA 5AQ7A 5BXOA 5A6CA 2F8XK 3EHRA
chains in the Genus database with same CATH topology
4A1SA 2WMOA 3S7DA 3GZ2A 4ILIA 1IQUA 4PH4B 3O4ZA 4I2WA 3MV2B 1L5JA 3CHOA 4MLPA 3CHRA 4HXIA 3MCXA 2UY1B 2A4ZA 3RRUA 3L22A 2IFUA 4EZKA 3HYMB 1QNFA 2P58C 2KZTB 1HS6A 3G2WA 4UI9C 3RIBA 3T5VA 3LVRE 4JVSA 3ZGQA 1TJFA 4G23A 2KCLA 3FTUA 3ZXSA 4UQXA 4DJAA 4I6JA 4JEUA 4AJWA 1SZ9A 4XKBA 4Q69A 3LYAA 3AS4A 1HZ4A 2OOEA 2R59A 4CT4A 1IYGA 2YINA 2JEKA 2GW1A 5JJTA 4HOUA 3QDNA 4KT6B 5D0QD 1HU3A 3GZSA 5HI7A 3UUXA 1ZBPA 4BTAA 4RVBA 3Q47B 4FJYA 3LJ3A 3QNKA 3R9AB 3I5PA 3U4TA 1UJJA 4GYWA 3UT7A 4APOA 3D9OA 3K9IA 3B13A 3JYSA 3FH5A 2Q7FA 4ILGA 4LCTA 3VLEA 3QK0A 2WVIA 3FU3A 4JZYA 2IOLA 4JEHA 5G04C 4F3VA 1W3BA 4QFVA 3DPDA 1UN8A 3CHMA 3L6AA 1HFAA 4PDXA 1Y8MA 3D9MA 4U8HA 4ANVA 5ANLA 2WB2A 2GRLA 4BFRA 4A3TA 1HG2A 3CVWA 3L13A 4KZ0A 2XRZA 3ASHA 3FTZA 3RO2A 2PM7A 3G2TA 2XHEA 3ZHEB 4XIFA 5CCLA 2Y4UA 3LKUA 4I1AA 2UWJG 2PM6A 3FULA 3FTWA 4DI3A 4EZJA 3EIQC 4B8CB 3FTYA 1EDUA 3B7UX 5C1DA 3HVEA 4B8AA 3FU6A 2V5FA 3HIZA 5M72A 3PREA 5AJLA 5DBKA 2WXKA 2WXJA 2I1KA 1MHQA 2YQ8A 4B89A 3I4RB 3P1UA 4WWNA 4AEZC 2WQ6A 4B94A 3IKOB 4GZDA 3LY8A 2HO1A 4IN3B 2FI7A 4G11A 4V3IA 2AXUA 3CEQA 4GA2A 3ZPJA 2GRMA 2NXPA 3Q4AB 5ENNA 4C9BB 5EDSA 5G2NA 3EJNA 3N71A 2YNQA 4CGWA 3CGHA 5ARGA 4N2SA 2VTBA 4RSYA 4GPKA 4BWRA 5KJLA 3PS6A 4KBQA 3UMVA 3FHEA 3ENEA 3CHSA 4GMJA 1VDYA 3D9PA 2DBAA 4EECA 1WAO1 4HLEA 3BEEA 3LPZA 3CV0A 3B7SA 5ANRA 5FZQA 2FEZA 3CSTA 1HXIA 1BPOA 4WWPA 4GYYA 5ARFA 2XCCA 5DIZA 5FZSA 3R7QA 2OVBA 1DVPA 3D9LA 3U66A 2LSUA 3MKQB 3PE4A 4F1SA 1UW4B 1H6KA 3TXMA 4AOFA 3CIAA 4GMLA 4ACLA 3UQ3A 3VTYA 2WXHA 4HOTA 4B0ZA 4WNGA 3D9NA 4GAAA 4WUYA 1WY6A 3CKBA 3FWVA 1KT0A 4XX5A 2KCVA 3APCA 2BF0X 4Q94A 4ANUA 3LDZA 3QARA 4XE0A 2CG3A 3FTSA 3FEYA 4XI9A 5G04J 4ANXA 4GZ3A 4PS8A 3FUJA 1UN9A 3L17A 1OWMA 4WNEA 3I3NA 5E76A 4LUNU 4UWHA 4I6GA 2RD0A 3TG4A 1Z3XA 3AS5A 3OXGA 5CMYA 4HS2A 4AVXA 4MKTA 4I17A 4KMOA 1Y6IA 3G2VA 3Q15A 3IBEA 4AIFA 3RU0A 4E6HA 2XGMA 4J8FA 3S7BA 5FQ6A 3FDHA 2JLBA 3D9KA 2J9QA 1H2TC 3CVXA 3QJZA 3P2BA 4FA6A 1E96B 4AV7A 4IYPA 4UWFA 5C2YA 4EQFA 2LSVA 2LAHA 2WXRA 3MZLB 2E2EA 2VJ8A 3FEXA 1YA0A 4BY6A 5FWQA 3LY7A 5CCMA 3PRZA 2CG2A 4O6FA 3GYZA 4XKCA 2BTDA 3EDTB 4CCAA 5BT1A 1XGWA 4IRUA 3URZA 1JPLA 4J8EA 1S0PA 2CHXA 3PVLA 4MRUA 3L16A 2MRIA 2R5SA 1HE8A 3ONLA 5CHEE 3ULQA 4J8SA 2WXFA 4EZLA 3LXUX 1UJKA 4G1TA 1JWFA 4GB9A 3O48A 2GGFA 3CKCA 2ZU6B 2LNIA 1NP7A 5A6CA 4DLQA 2AWIA 4N39A 2VGXA 2ILRA 4J6IA 3ZYQA 3MX3A 1HX8A 2EQXA 4Y6WA 1U3CA 5BV0A 3S7JA 3PE3A 3CQGB 1FCHA 2FF4A 2IONA 1JUQA 2ONDA 2XGOA 4N3CA 3SHFA 2WXNA 1NA0A 1DNPA 3FH7A 4I2ZA 5LCWJ 1IHGA 2WXPA 4F7AA 3B7TA 3ZYKA 4FADA 5D0OD 3TAXA 4J0UA 5G55A 3QWWA 1H2VC 1ZU2A 3FUIA 4HOQA 2MOWA 1PY1A 2FULA 4JHKA 3PDNA 3TG5A 4G24A 1QQEA 4FC8A 4I6EA 3MGBA 3CK9A 1EF1C 5G05C 2C0LA 4UI9J 2WXIA 2DCPA 2XGSA 2J49A 2YHEA 2R17C 2HYZA 2PQRA 4GA1A 5T8IA 1KT1A 4HFGA 3QKYA 5AJDA 4TV3A 2XRYA 5BW8C 2WPVA 5G05J 1HG5A 3CVNA 5AYWD 4AY5A 2WXLA 4OVVA 3BG1B 3CVQA 1NA3A 1QZ2A 3L08A 2X6FA 4BX9A 1XNFA 3AU4A 3QAQA 2QFCA 3CVVA 3SBTB 5FZRA 3ASGA 2XQ0A 5T3RA 5CMWA 4TRQA 2X6KA 3ZW3A 3FUMA 5BV1A 2VSOE 3MKQA 3DBSA 3RKVA 4UWGA 2I1JA 3MA5A 2AW6A 2QY7A 2HR2A 2YHCA 3GZ1A 3MV3B 3OXLA 5E75A 1TEZA 4NRHB 4KZCA 4GCNA 3TL5A 4AY6A 3ZFWA 4IULA 4BSXA 2WXGA 3VLFA 3Q49B 4G26A 4FHJA 4NACA 5T4YA 1HF8A 1TJCA 2XPIA 4DPRA 1A17A 4TUUA 3U64A 2XCBA 4D10C 3PEVB 1GW6A 2FBNA 3U9WA 3CVUA 1E7VA 1PAQA 3RJVA 3FP3A 5FQ7A 2E0IA 4U0SA 4J8DA 4U0ZA 3RK6A 4YVOA 3RO3A 4G2VA 3ZYMA 5LX8A 3VTXA 2X6JA 4PUCA 2WQ7A 2BUGA 4UQZA 3ZHEA 4OYSA 4Y6CA 5EX3A 4E85A 4F53A 5A7DB 3I4GA 3B7RL 3CHPA 2J07A 3MJWA 4JL0A 3ZIMA 4H7YA 2LAIA 3G2SA 4AXHA 4RG6A 3TJPA 3CVLA 2UY1A 3CSFA 3HVEB 3ASDA 2AXZA 3LCAA 2J09A 3PNLB 1H0AA 4CEMA 3NZSA 4Q96A 3ZN3A 4GCOA 2IJGX 3FUDA 2HM8A 3ZYLA 1ELRA 2VGXB 4YVQC 1OUVA 3IV0A 3CVPA 2DIWA 4NURA 3RRNB 4CDMA 1OWLA 1U3DA 5A23A 2C0MA 4ANWA 1E8XA 2IOSA 3PZDA 2VTBB 1H2UA 3SF4A 3CHQA 3UT4A 4BT8A 2V0PA 3SBSA 2KC7A 3FTXA 5FQ8A 3D9IA 2J08A 1E8ZA 4UWLA 3OAWA 4U04A 3QB2A 2WXOA 3SI5A 1X5BA 2L0TB 3QWVA 4EBAA 3SD5A 4PS3A 2Y3AA 3RRMB 3FUHA 2MHKA 5KJMA 4GYOA 4U07A 4ACKA 4KVMA 2C2LA 4FULA 3ESKA 4GZCA 1PC2A 4GZ5A 4DI4A 5BPPA 5LOZA 4UWKA 3HDXA 3EHMA 1LF8A 4K0RA 3NQPA 3Q5MA 3E4BA 3APFA 1E8WA 2VSNA 3FUKA 4A1GA 4CRWA 1N52A 1B89A 2I2OA 4R7LA 4I43A 3CR3A 1EPUA 4RG9A 4EBAG 3NF1A 3IHYA 4JA7A 3VLDA 4GZ6A 4URKA 3FUNA 5BNWA 4NQ0A 2PZIA 1OWOA 3KEZA 4BT9A 2VSXE 3CK8A 2FO7A 2KATA 3AU5A 3D3MA 3QC1A 4I1MA 2OV8A 4N3AA 5JJ7A 3C98A 3ONKA 3CVYA 3ESLA 4JHRA 4BX8A 3PH0C 4PS7A 3TXNA 2AXVA 5HQ8A 2PL2A 1FVFA 4HVBA 2X3MA 4HOSA 1WM5A 2CHWA 3IEGA 2KZTA 3SGHA 2M63A 1OWPA 3T8MA 3WXXA 1HH8A 4XZ4A 4YNDA 3FU0A 3IHVA 3PUKA 4N3BA 5LFAA 3JQ1A 3FH8A 2V8SE 5KJNA 2L9BA 3CQCB 2KCKA 4W9RA 4I9EA 3S7FA 5FJYA 5FT9A 3UX4A 3GW4A 4OVUA 4EPZA 2NC9A 1NZNA 1Z3YA 2NSZA 3AS8A 2X6HA 4LEUA 4UI9K 5EX0A 4AM9A 3OXFA 4GA0A 3ZVVA 2I9CA 3FU5A 4JA9A 3R7RA 2VSYA 1UG3A 4C0MA 1MQSA 2WQHA 4ME2A 5FTPA 1ELWA 3ML8A 3BG0B 3PEUB 3QWPA 4FLBA 2LO6A 4K03A 5EKQD 2WMNA 3ZEFA 4P29A 1SZAA 1E7UA 3APDA 3LVQE 2Y4TA 4CT0A 4JHJA 2IQCA 2X38A 3KS2A 4KVOA 3SNXA 3JCKC 3CLJA 3CK7A 3PNTB 4FP7A 4L2LA 4I1OB 4CGVA 3KD7A 2VYIA 5JHAA 2V4LA 5J90A 4G25A 3NZUA 4FHKA 5FQ4A 3D9JA 4XI0A 4LRZA 3JUIA 3MKRA 3HHMA 4A55A 4WAFA 2WM9A 2KM4A 1E8YA 4DLOA 5AIJA 2VQ2A 4L1BA 4HORA 4U0UA 3FUFA 4WWOA 2XEVA 3LEWA 2A5UA 3T5XA 1IQRA 3UPVA 4N2QA 2VGYA 2CHZA 4JPSA 3FUEA 5BUZA 4FLHA 3KAEA 3MYVA 5JHBA 1KLXA 4H7XA 2WXMA 3L54A 1ELKA 2RG8A 3JQ0A 3LS8A 5AENA 4A3VA 3SFZA 3ML9A 4L7TA 4JW1A 1INZA 4LERA 2J4BA 4APFA 2IF4A 2L6JA 4N5CA 5KCMA 4CDRA 4KXKB 4DK5A 2XPZA 4KYOB 5KJKA 2CFZA 4ATGA 1HO8A 3FY4A 3OTNA 4FU3A 3S2AA 1FVHA 2CFUA 4L2YA 5J08A 3MEKA 3EIJA 4M3OA 4WNDA 1JWGA 3U3WA 4C0EA 1P5QA 2AVPA 4FJZA 2I6HA 4CDNA 1Z6TA 3UT8A 4ABNA 4GU5A 1H19A 3PUJA 4I9CA 4BTBA 1EYHA 2PQNA 3FTVA 3LY9A 4U63A 1N54A 3FFLA 5JJ6A 3ASFA 2L0IA 3EHNA 4L23A 2IU1A 3QOUA 5LCWC 4WNFA 3TGOA 1SQMA 4AP2A 4UQYA 5LP0A 4MS6A 1OWNA 4JC8A 1E90A 2OVFA 3G2UA 2X6IA 2J4DA 4JXTA 4ILHB 3SZ7A 3ZRHA 2XPYA 2WXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJ7 A;  4GCN A;  4A1S A;  3FWV A;  3S7D A;  1KT0 A;  4AY6 A;  4JHR A;  2KCV A;  3GZ2 A;  3ZFW A;  5HQ8 A;  2PL2 A;  4XI9 A;  5G04 J;  4I2W A;  3MV2 B;  3Q49 B;  4GZ3 A;  4HOS A;  1WM5 A;  4WNE A;  4G26 A;  2UY1 B;  2IFU A;  3IEG A;  1TJC A;  3HYM B;  2XPI A;  3TG4 A;  2P58 C;  3AS5 A;  4UI9 C;  1A17 A;  3OXG A;  3RIB A;  3WXX A;  1HH8 A;  3ZGQ A;  4I17 A;  4G23 A;  2KCL A;  2XCB A;  3Q15 A;  2FBN A;  4UQX A;  4N3B A;  4YND A;  3RU0 A;  4AIF A;  2XGM A;  4J8F A;  3S7B A;  2JLB A;  3RJV A;  3FP3 A;  3LYA A;  3AS4 A;  5KJN A;  4U0S A;  4J8D A;  1HZ4 A;  2KCK A;  2OOE A;  4U0Z A;  2J9Q A;  4G2V A;  4I9E A;  4W9R A;  4YVO A;  5FJY A;  3S7F A;  3UUX A;  3VTX A;  5FT9 A;  2GW1 A;  5JJT A;  1E96 B;  4HOU A;  2BUG A;  3GW4 A;  4UQZ A;  3QDN A;  4Y6C A;  2NC9 A;  1NZN A;  2LSV A;  3AS8 A;  4UI9 K;  4LEU A;  5D0Q D;  5EX3 A;  5EX0 A;  1ZBP A;  3OXF A;  4GA0 A;  2E2E A;  3Q47 B;  5HI7 A;  1YA0 A;  4JA9 A;  4BTA A;  2VSY A;  3R9A B;  3LY7 A;  4JL0 A;  3U4T A;  4H7Y A;  4GYW A;  4APO A;  2WQH A;  4ME2 A;  5CCM A;  4RG6 A;  4EQF A;  3K9I A;  4O6F A;  3GYZ A;  1ELW A;  3EDT B;  3JYS A;  3CVL A;  2UY1 A;  3QWP A;  5FTP A;  5BT1 A;  2Q7F A;  5EKQ D;  3URZ A;  3ASD A;  4J8E A;  3LCA A;  1IYG A;  2R5S A;  5CHE E;  2Y4T A;  5G04 C;  3ULQ A;  4F3V A;  1W3B A;  5A7D B;  3KS2 A;  4G1T A;  1Y8M A;  3O48 A;  3CKC A;  3CK7 A;  3ZN3 A;  2LNI A;  4GCO A;  4CGV A;  4N39 A;  3ASH A;  2VYI A;  2VGX A;  1ELR A;  3KD7 A;  3RO2 A;  2VGX B;  4G25 A;  1OUV A;  4YVQ C;  3CVP A;  4Y6W A;  4XI0 A;  3ZHE B;  4XIF A;  3S7J A;  3PE3 A;  5CCL A;  1FCH A;  2C0M A;  2Y4U A;  2FF4 A;  2UWJ G;  3LKU A;  3MKR A;  2OND A;  2XGO A;  4I1A A;  4N3C A;  1NA0 A;  3SF4 A;  5LCW J;  2VQ2 A;  4I2Z A;  4BT8 A;  4U0U A;  4HOR A;  2KC7 A;  1IHG A;  2XEV A;  5KJK A;  5C1D A;  4U04 A;  2V5F A;  5M72 A;  5D0O D;  5DBK A;  3RO3 A;  3UPV A;  2VGY A;  3QWV A;  4N2Q A;  3TAX A;  4J0U A;  3KAE A;  3QWW A;  1KLX A;  4H7X A;  1ZU2 A;  2MHK A;  2YQ8 A;  4GYO A;  4HOQ A;  4U07 A;  5KJM A;  4B94 A;  3TG5 A;  3PDN A;  2C2L A;  4G24 A;  1QQE A;  3ESK A;  3CK9 A;  3LY8 A;  2HO1 A;  1PC2 A;  2C0L A;  2FI7 A;  2XGS A;  4GZ5 A;  4IN3 B;  3CEQ A;  4UI9 J;  5G05 C;  4GA2 A;  3ZPJ A;  2HYZ A;  2PQR A;  4GA1 A;  2IF4 A;  2L6J A;  1KT1 A;  3Q4A B;  4N5C A;  3QKY A;  3N71 A;  4KXK B;  4CDR A;  4KYO B;  3Q5M A;  2WPV A;  5ARG A;  5G05 J;  3CVN A;  5BW8 C;  4CGW A;  4N2S A;  4GPK A;  4BWR A;  5AYW D;  4AY5 A;  5KJL A;  3MEK A;  4KBQ A;  4WND A;  3U3W A;  3E4B A;  3CVQ A;  1NA3 A;  1P5Q A;  2AVP A;  1QZ2 A;  2VSN A;  4AM9 A;  2I6H A;  1B89 A;  2DBA A;  4ABN A;  1WAO 1;  1XNF A;  3BEE A;  3LPZ A;  4I9C A;  2QFC A;  3CV0 A;  4RG9 A;  2PQN A;  3NF1 A;  4JA7 A;  2FEZ A;  5FZQ A;  1HXI A;  5FZR A;  3LY9 A;  4BTB A;  3ASG A;  4GYY A;  5ARF A;  5JJ6 A;  3FFL A;  4GZ6 A;  3ASF A;  2XCC A;  5DIZ A;  3QOU A;  5FZS A;  5BNW A;  4NQ0 A;  2PZI A;  5LCW C;  2LSU A;  4WNF A;  3PE4 A;  3TGO A;  3RKV A;  4UQY A;  3UQ3 A;  3CK8 A;  3VTY A;  2FO7 A;  3ZHE A;  4BT9 A;  2KAT A;  4HOT A;  4WNG A;  3MA5 A;  4WUY A;  2HR2 A;  2YHC A;  3GZ1 A;  3MV3 B;  3OXL A;  3SZ7 A;  5A6C A;  3CKB A;  4NRH B;  4N3A A; 
#chains in the Genus database with same CATH topology
 2WMO A;  1IQU A;  3CHO A;  3RRU A;  4EZK A;  3HXE A;  2KZT B;  5HRY A;  3RIB A;  3KSL A;  2IY0 C;  4UQX A;  4I6J A;  3LYA A;  4B93 B;  3E34 A;  5CBO A;  3QDN A;  5HI7 A;  3R9A B;  3U4T A;  3UT7 A;  4GYW A;  3EHQ A;  4LCT A;  2WVI A;  2IOL A;  1W3B A;  3DPD A;  1HFA A;  1Y8M A;  2WB2 A;  5FIO A;  1X81 A;  4KZ0 A;  4EHM A;  2XRZ A;  1YMP A;  3ASH A;  3FTZ A;  3G2T A;  3DRA A;  4YDE A;  3ZHE B;  5CCL A;  2P9L G;  2Y4U A;  2UWJ G;  2PM6 A;  4B8A A;  3HIZ A;  5AJL A;  5H7P A;  2WXJ A;  3C3O A;  2YQ8 A;  4B89 A;  3I4R B;  4WWN A;  5ENN A;  3N71 A;  3CGH A;  5ARG A;  5KJL A;  4A63 B;  4GMJ A;  3D9P A;  4HLE A;  2H6H A;  2Y1L E;  3CV0 A;  1HXI A;  5ARF A;  2XCC A;  4BES A;  3MKQ B;  4F1S A;  1NL4 A;  4B0Z A;  3ZNG A;  1OCO E;  3DSS A;  3FWV A;  4ANU A;  4GZ3 A;  3FUJ A;  1OWM A;  4HS2 A;  4I17 A;  1Y6I A;  2XGM A;  2JLB A;  4FA6 A;  1E96 B;  4AV7 A;  4IYP A;  4EQF A;  3V79 K;  1O5M A;  4U8V D;  2WXR A;  4BY6 A;  2E2E A;  1YA0 A;  5CCM A;  3PRZ A;  4XKC A;  4O6F A;  3GYZ A;  1JPL A;  2CHX A;  3VLE A;  3PVL A;  4MRU A;  2MRI A;  1HE8 A;  1Q2Z A;  3ULQ A;  2WXF A;  3LXU X;  1LTX A;  2GGF A;  3CKC A;  3EUV A;  4N39 A;  3JXI A;  4J6I A;  4Y6W A;  2QZA A;  5BV0 A;  3PE3 A;  3CQG B;  2FF4 A;  2ION A;  4N3C A;  2OND A;  3SHF A;  3FH7 A;  1DNP A;  3Q79 A;  3HXD A;  3ZYK A;  1V54 E;  5G55 A;  2FUL A;  3TG5 A;  1QQE A;  5G05 C;  4UI9 J;  1AP7 A;  2WXI A;  2DCP A;  2XGS A;  2YHE A;  2R17 C;  4GTT A;  4HLL A;  3JUE A;  4RLY A;  3BG1 B;  2X6F A;  2KXP C;  4HRL A;  3AU4 A;  2QFC A;  3CVV A;  4BSZ B;  4TRQ A;  4JD2 G;  1SVX A;  1N94 A;  2DYS E;  3MA5 A;  2QY7 A;  2HR2 A;  3OXL A;  4NRH B;  3DXK G;  1BLX B;  3Q73 A;  3TL5 A;  2KBX A;  2WXG A;  1LD7 A;  3DXM G;  1HF8 A;  3NAW A;  3U9W A;  2FBN A;  3CVU A;  1PAQ A;  3RJV A;  3FP3 A;  2ZGD A;  5FQ7 A;  3RK6 A;  3RO3 A;  1BI8 B;  2B0O E;  2ZXW E;  4E85 A;  5A7D B;  2LXL A;  2J07 A;  3MJW A;  1N0Q A;  2LAI A;  3G2S A;  4RG6 A;  3BQO A;  2XEN A;  3CVL A;  2UY1 A;  3CSF A;  3TJP A;  1DC2 A;  4GCO A;  3FUD A;  3ZYL A;  2VGX B;  3IV0 A;  4CDM A;  2C0M A;  4ANW A;  1E8X A;  2IOS A;  3PZD A;  2VTB B;  1H2U A;  1N0R A;  3C72 A;  1E8Z A;  5CEC B;  4U04 A;  3SI5 A;  2L0T B;  3QWV A;  2P9U G;  3FUH A;  2MHK A;  4KVM A;  5CED B;  4GTS A;  3DSV A;  1DCQ A;  4A1G A;  1B89 A;  4R7L A;  4RG9 A;  4EBA G;  4JA7 A;  5BNW A;  3KEZ A;  4BT9 A;  4UUC A;  2OV8 A;  1KPS B;  4N3A A;  2J8S D;  4BX8 A;  4PS7 A;  4HVB A;  2CHW A;  3ABK E;  2V5Q C;  3IEG A;  2M63 A;  1BD8 A;  3WXX A;  5IY5 E;  1D8D A;  4XZ4 A;  3PUK A;  3WG7 E;  3FH8 A;  2L9B A;  2XS8 A;  5FT9 A;  1KZP A;  5CMW A;  4UI9 K;  4LEU A;  3OXF A;  1UG3 A;  1O1S A;  4ME2 A;  3KSQ A;  5KNG A;  4HBD A;  3BG0 B;  3QWP A;  4K5C A;  4K03 A;  5EKQ D;  3ZEF A;  2Y4T A;  2X38 A;  3JCK C;  3CK7 A;  4FP7 A;  3LJN A;  4CGV A;  2IO2 C;  4G25 A;  3NZU A;  4LRZ A;  4HRN A;  2OCC E;  3HHM A;  2MYO A;  4WAF A;  1N4Q A;  5AIJ A;  2VQ2 A;  4L1B A;  1D9S A;  1BI7 B;  3FUF A;  4WWO A;  3TWQ A;  2A5U A;  2GRN B;  3TWS A;  3T5X A;  5B3S E;  2CHZ A;  2DZO A;  3FUE A;  3Q9U C;  1KLX A;  4H7X A;  3HXF A;  3DSX A;  3JQ0 A;  4A3V A;  4L7T A;  2J4B A;  5KCM A;  4CDR A;  3KEA A;  1HO8 A;  4FU3 A;  5J08 A;  2CFU A;  3EIJ A;  4M3O A;  3U3W A;  4CDN A;  3UT8 A;  5BXU A;  4GU5 A;  4I9C A;  1EYH A;  3ASF A;  3QOU A;  3UI2 A;  4MS6 A;  1OWN A;  1TR4 A;  1E90 A;  3G2U A;  2X6I A;  4JB8 P;  4ILH B;  3SZ7 A;  3ZRH A;  4U96 D;  2XPY A;  2WXQ A;  4A1S A;  3S7D A;  2RKK A;  1OCC E;  2V4H C;  4DX6 D;  4PH4 B;  3O4Z A;  3DWL G;  1MZC A;  1MYO A;  4I2W A;  2H6I A;  4MLP A;  2BKK B;  5KNH D;  5EYL A;  3L22 A;  2IFU A;  4UI9 C;  3G2W A;  4JVS A;  2KCL A;  3ZXS A;  2F37 A;  4DJA A;  4JEU A;  1JCR A;  4XKB A;  4Q69 A;  3D9H A;  4CT4 A;  4GPM A;  2JEK A;  1Z5S C;  5JJT A;  3GZS A;  3I5P A;  1UJJ A;  4APO A;  3B13 A;  3JYS A;  4MBG A;  5G04 C;  4F3V A;  4QFV A;  4PDX A;  4ANV A;  5ANL A;  2GRL A;  3L13 A;  3UTM A;  3RO2 A;  2B6C A;  2XHE A;  4XIF A;  3LKU A;  4I1A A;  2H6F A;  3FUL A;  3FTW A;  4DI3 A;  1TNZ A;  1N9A A;  3C3R A;  3HVE A;  4U8Y D;  2V5F A;  5DBK A;  2I1K A;  4ZFH A;  2WQ6 A;  4B94 A;  3DSW A;  2FI7 A;  2AXU A;  3ULY A;  3Q4A B;  2YNQ A;  4BEP A;  4RSY A;  3TWT A;  4GPK A;  3UMV A;  4O60 A;  2DBA A;  1WAO 1;  5ANR A;  3CST A;  4WWP A;  2DZN A;  3ASO E;  5FZS A;  2LSU A;  1UW4 B;  3TXM A;  4BER A;  4HB5 A;  4GML A;  4ACL A;  3UQ3 A;  1RW2 A;  3UM1 A;  4WNG A;  4WUY A;  3ASN E;  1KT0 A;  3Q75 A;  2BF0 X;  4Q94 A;  4QQI A;  3LDZ A;  4XE0 A;  2CG3 A;  3FEY A;  5G04 J;  4ANX A;  1UN9 A;  3I3N A;  5E76 A;  4LUN U;  4UWH A;  4I6G A;  5CMY A;  1MX4 A;  3G2V A;  3Q15 A;  4E6H A;  3S7B A;  2DYR E;  3D9K A;  2J9Q A;  1IKN D;  1H2T C;  3CVX A;  4UWF A;  2LAH A;  3MZL B;  2VJ8 A;  5ENQ D;  5FWQ A;  4IRU A;  3URZ A;  3ONL A;  5CHE E;  4J8S A;  1JWF A;  2VGX A;  3ZYQ A;  1U3C A;  1OY3 D;  1S64 A;  3S7J A;  1FCH A;  1QYM A;  3ABL E;  1JUQ A;  4XEI G;  4HQD A;  2WXP A;  3B7T A;  2XZD G;  3QWW A;  2MOW A;  1YCS B;  4G24 A;  4FC8 A;  4I6E A;  3CK9 A;  2HYZ A;  2PQR A;  5T8I A;  4HFG A;  3QKY A;  4TV3 A;  5BW8 C;  1HG5 A;  4AY5 A;  2WXL A;  1NA3 A;  1QZ2 A;  3L08 A;  1XNF A;  3QAQ A;  5FZR A;  5T3R A;  4HRM B;  3ZW3 A;  1FT1 A;  3DBS A;  2I1J A;  2R03 A;  1FPP A;  2YHC A;  4LSZ E;  2PNN A;  1TEZ A;  4KZC A;  1TNB A;  4IUL A;  3VLF A;  2NYJ A;  3Q49 B;  2P9I G;  4Z68 A;  3SY2 A;  2GRQ B;  4DPR A;  1A17 A;  4TUU A;  1MX6 A;  4YDY A;  4D10 C;  3PEV B;  4YVO A;  5KBA A;  4PUC A;  2WQ7 A;  1IHB A;  2BUG A;  3ZHE A;  4OYS A;  4Y6C A;  3DPY A;  3I4G A;  4JL0 A;  3ZIM A;  4H7Y A;  4LNU D;  5EYP F;  3HVE B;  2EIN E;  2J09 A;  4CEM A;  3PZ2 A;  1OUV A;  3CVP A;  1U3D A;  5A23 A;  2V0P A;  2KC7 A;  2J08 A;  5KWD A;  2WXO A;  4F1P A;  3RRM B;  3UXG A;  4GYO A;  4ACK A;  4DRX E;  4FUL A;  3T9K A;  1PC2 A;  4HNA D;  3E32 A;  4DI4 A;  3EHM A;  1LF8 A;  1N4P A;  3APF A;  1E8W A;  1EPU A;  3NF1 A;  1G3N B;  5D66 A;  4GZ6 A;  4URK A;  3UM0 A;  3CK8 A;  2GRO B;  3ESL A;  2AXV A;  1FVF A;  2X3M A;  1WM5 A;  1SA5 A;  3V2O A;  1V55 E;  3T8M A;  2BED A;  3IHV A;  5LFA A;  3JQ1 A;  2V8S E;  2KCK A;  4W9R A;  4I9E A;  3UKU G;  4EPZ A;  2NSZ A;  1Z3Y A;  2X6H A;  3ULE G;  3ZVV A;  2I9C A;  3R7R A;  4JA9 A;  2JAB A;  3AG2 E;  5FTP A;  1ELW A;  4FLB A;  3LVQ E;  4JHJ A;  3PZ3 A;  3KS2 A;  4OAV B;  3PNT B;  3TWR A;  2V4L A;  5FQ4 A;  3DEP A;  3UKR G;  2BKG A;  2KM4 A;  4HOR A;  3SFX A;  1FT2 A;  2DVW A;  1IQR A;  4N2Q A;  2VGY A;  5BUZ A;  4FLH A;  3KAE A;  3MYV A;  3LS8 A;  3ML9 A;  4JW1 A;  4HI8 A;  2IF4 A;  4N5C A;  5ENP D;  1SA4 A;  3FY4 A;  3S2A A;  3V30 A;  2Y69 E;  1JWG A;  3T8K A;  4FJZ A;  5FIN A;  2PQN A;  4U63 A;  5JJ6 A;  3FFL A;  3EHN A;  2QC9 A;  1SQM A;  2J4D A;  4M7C A;  3AJI A;  3NBN B;  5D2M C;  3DEO A;  2XS1 A;  3GZ2 A;  3JXJ A;  3MV2 B;  1L5J A;  4CZ2 D;  4TXP A;  3MCX A;  2UY1 B;  3ZGQ A;  1TJF A;  3FTU A;  1SZ9 A;  3C5R A;  1HZ4 A;  2OOE A;  2R59 A;  4U7E B;  2YIN A;  4HOU A;  5D0Q D;  1HU3 A;  5CBN A;  5CRU A;  4BTA A;  4RVB A;  4FJY A;  3LJ3 A;  3QNK A;  3D9O A;  2Q7F A;  3QK0 A;  3FU3 A;  1UN8 A;  4U8H A;  4BFR A;  4A3T A;  1HG2 A;  2PM7 A;  5EN5 D;  4EZJ A;  1EDU A;  3B7U X;  5C1D A;  3FU6 A;  5M72 A;  3PRE A;  3X2Q E;  2WXK A;  1MHQ A;  1BU9 A;  1SW6 A;  3IKO B;  1YYH A;  3V2X A;  4GZD A;  3LY8 A;  2EIM E;  4IN3 B;  3CEQ A;  3ZPJ A;  2GRM A;  2NXP A;  1TN6 A;  3EJN A;  4BWR A;  3L82 A;  3PS6 A;  4KBQ A;  5EID A;  1VDY A;  4EEC A;  3ABM E;  3LPZ A;  2HE0 A;  3B7S A;  5FZQ A;  2FEZ A;  1BPO A;  3J5Q B;  5DIZ A;  1DVP A;  3D9L A;  3U66 A;  3PE4 A;  2AJA A;  1RZ4 A;  1H6K A;  4AOF A;  2XEE A;  3TWX A;  3D9N A;  4J7W A;  1WY6 A;  3APC A;  3QAR A;  1O1R A;  2IO3 C;  4XI9 A;  1K1A A;  4WNE A;  3L17 A;  3TG4 A;  3AS5 A;  3OXG A;  4AVX A;  4KMO A;  3IBE A;  2P2C P;  3RU0 A;  4AIF A;  4J8F A;  5FQ6 A;  3UM2 A;  2R2L A;  4YDW A;  4G8K A;  3LY7 A;  4K5B A;  2CG2 A;  5BT1 A;  1XGW A;  1TYQ G;  1S0P A;  3L16 A;  3HXC A;  4GB9 A;  4G1T A;  2ZU6 B;  2LNI A;  1NP7 A;  2R05 A;  2ILR A;  3RAU A;  3MX3 A;  2EQX A;  3ZXP A;  5JMN D;  2XGO A;  2WXN A;  1NA0 A;  5LCW J;  4I2Z A;  5CRV A;  1IHG A;  4F7A A;  5D0O D;  5EIB E;  4OAU C;  3PDN A;  2C0L A;  2J49 A;  4GA1 A;  3CVN A;  4DX2 A;  4OVV A;  4CYM D;  1U2V G;  4LG6 A;  2XQ0 A;  2P9P G;  2X6K A;  1UOH A;  3FUM A;  3RKV A;  3MV3 B;  5EIL A;  4DX7 D;  4GCN A;  3R9M A;  1MX2 A;  4AY6 A;  3ZU7 B;  3PZ4 A;  3ZFW A;  4BSX A;  5B1B E;  5ENR D;  4FHJ A;  5JA4 D;  1TJC A;  3U64 A;  1GW6 A;  1N4R A;  4J8D A;  3ZYM A;  1JCS A;  5LX8 A;  2X6J A;  4F53 A;  3B7R L;  3CHP A;  4DX1 A;  2AXZ A;  3LCA A;  3PNL B;  1H0A A;  2P9S G;  4LNB A;  4GTO A;  3ZN3 A;  1DCE A;  1WDY A;  2HM8 A;  3AG4 E;  3HRA A;  2DIW A;  4NUR A;  3RRN B;  1N95 A;  3AAA C;  3SF4 A;  3CHQ A;  3UT4 A;  4BT8 A;  3SBS A;  2VGE A;  1KZO A;  4UWL A;  3OAW A;  2ETB A;  3QB2 A;  1X5B A;  2RFA A;  4PS3 A;  4DUI A;  2C2L A;  3ESK A;  4GZC A;  2QYU A;  4J8Y A;  5LOZ A;  4UWK A;  3HDX A;  3UIP C;  4K0R A;  3NQP A;  3UM3 A;  3TWW A;  3FUK A;  5B1A E;  4CRW A;  4I43 A;  3CR3 A;  3IHY A;  3VLD A;  1IXV A;  1OCZ E;  3FUN A;  4NQ0 A;  1OWO A;  2VSX E;  2FO7 A;  3L9T A;  2F0Y A;  3AU5 A;  3D3M A;  3QC1 A;  2EIK E;  5JJ7 A;  3C98 A;  3ONK A;  3CVY A;  3J5P A;  5HQ8 A;  4HOS A;  2KZT A;  3SFY A;  1HH8 A;  3FU0 A;  2OEW A;  2EIL E;  3EU5 A;  1NI1 A;  3UX4 A;  4OVU A;  5EX0 A;  3AS8 A;  4GA0 A;  4C0M A;  2VSY A;  1MQS A;  1O1T A;  2WQH A;  3SO8 A;  3B7B A;  3PEU B;  3HG0 D;  4P29 A;  3APD A;  3SNX A;  4KVO A;  3KD7 A;  2VYI A;  5AQ9 A;  5JHA A;  3C3Q A;  5J90 A;  4TUM A;  4FHK A;  1TN8 A;  2R02 A;  3D9J A;  4XI0 A;  4A55 A;  3JUI A;  1E8Y A;  4DLO A;  4U0U A;  3E37 A;  2XEV A;  3LEW A;  2QYJ A;  3UPV A;  3NOC D;  4JPS A;  5JHB A;  4X8Q A;  2WXM A;  1ELK A;  2RG8 A;  5AEN A;  3ZKJ A;  4LER A;  4APF A;  1JCQ A;  2L6J A;  5KJK A;  4KXK B;  4ATG A;  3OTN A;  4ZHB A;  1FVH A;  4C0E A;  1P5Q A;  5AAO A;  1N4S A;  2XZT G;  1H19 A;  3BUA A;  3PUJ A;  4BTB A;  3FTV A;  5LCW C;  4WNF A;  3TGO A;  4AP2 A;  5LP0 A;  4ATZ D;  2OVF A;  4JXT A;  4AXH A;  4ILI A;  4GMR A;  3W9F A;  3DSU A;  3CHR A;  4HXI A;  2A5E A;  2A4Z A;  3HYM B;  1QNF A;  2P58 C;  1HS6 A;  3T5V A;  1TNY A;  3LVR E;  4G23 A;  1S63 A;  5HKP A;  4AJW A;  5CEA A;  3AS4 A;  2ZIS A;  2GW1 A;  3ISM C;  2RFM A;  4KT6 B;  3Q78 A;  3UUX A;  1ZBP A;  3Q47 B;  3ZUV B;  3K9I A;  3FH5 A;  2L6B A;  4ILG A;  4JZY A;  4JEH A;  3L6A A;  3CHM A;  3D9M A;  2H6G A;  2LXM A;  3CVW A;  3Q7A A;  1H6P A;  3B95 A;  1OCR E;  3EIQ C;  4B8C B;  3FTY A;  3P1U A;  4AEZ C;  3AG1 E;  1NFI E;  2HO1 A;  4G11 A;  4V3I A;  4GA2 A;  4C9B B;  5EDS A;  3V31 A;  5G2N A;  4HI9 A;  4CGW A;  4N2S A;  2VTB A;  3Q9N C;  3FHE A;  3ENE A;  3CHS A;  2F8Y A;  1LD8 A;  3BEE A;  3RSE G;  4GYY A;  3R7Q A;  2OVB A;  4C48 B;  3CIA A;  3VTY A;  2WXH A;  4HOT A;  4GAA A;  3CKB A;  1MJ0 A;  4XX5 A;  2KCV A;  3FTS A;  1K1B A;  4PS8 A;  1S70 B;  2RD0 A;  1Z3X A;  1D8E A;  3PZ1 A;  1QBQ A;  5AQB A;  4MKT A;  3FDH A;  5ENS D;  1H6O A;  2GRR B;  3QJZ A;  3P2B A;  5C2Y A;  2LSV A;  4K5A B;  1OT8 A;  3FEX A;  3SQV A;  4CCA A;  2BTD A;  3EDT B;  4J8E A;  1IYG A;  2R5S A;  4EZL A;  1UJK A;  3O48 A;  3UIO C;  2XEH A;  4DLQ A;  2AWI A;  1HX8 A;  2ZGG A;  5CER B;  5AN8 A;  4FAD A;  3TAX A;  4J0U A;  1H2V C;  4O1O A;  1ZU2 A;  3FUI A;  4HOQ A;  4G8L A;  1PY1 A;  4JHK A;  5AAR A;  3MGB A;  1EF1 C;  2ZIR A;  1KT1 A;  1TN7 A;  5AJD A;  2XRY A;  2WPV A;  5G05 J;  1N11 A;  5AYW D;  2ETC A;  3CVQ A;  2EIJ E;  4BX9 A;  4DX5 D;  5AQA A;  3SBT B;  3ASG A;  3DST A;  1ZB1 A;  5BV1 A;  2VSO E;  1A5E A;  3MKQ A;  4UWG A;  2AW6 A;  3GZ1 A;  5E75 A;  4G26 A;  4NAC A;  5T4Y A;  2XPI A;  3IXE A;  4TXR A;  2XCB A;  4U95 D;  1E7V A;  3Q7F A;  2Y0B G;  2E0I A;  4U0S A;  4U0Z A;  5HS0 A;  4G2V A;  3VTX A;  4UQZ A;  5ENO D;  5EX3 A;  1AWC B;  3ASD A;  3NZS A;  4Q96 A;  2P9K G;  2ETA A;  2IJG X;  5ITZ F;  1ELR A;  4YVQ C;  1OWL A;  4TXQ A;  3FTX A;  5FQ8 A;  3D9I A;  1OXJ A;  4BET A;  2OEV A;  4EBA A;  3SD5 A;  2Y3A A;  3TWV A;  5KJM A;  4U07 A;  3HXB A;  4RQI A;  2P9N G;  4GZ5 A;  5BPP A;  4N5Q A;  4GTV A;  2FO1 E;  3Q5M A;  3E4B A;  2VSN A;  1N52 A;  4F6R D;  2I2O A;  1K3Z D;  2GRP B;  2PZI A;  4GTM A;  2KAT A;  3E33 A;  4I1M A;  4JHR A;  4NIK A;  3PH0 C;  3TXN A;  2PL2 A;  3SGH A;  1OWP A;  1K8K G;  5ENT D;  4YND A;  4N3B A;  3TWU A;  5KJN A;  3CQC B;  3S7F A;  5FJY A;  4LNG A;  3GW4 A;  2NC9 A;  1NZN A;  4AM9 A;  3FU5 A;  2LUH A;  1TNO A;  3NOG D;  3ML8 A;  2LO6 A;  2WMN A;  3UIN C;  1SZA A;  1E7U A;  3AG3 E;  4CT0 A;  2IQC A;  3CLJ A;  3NB2 A;  4L2L A;  4I1O B;  4YDO A;  4O1P A;  4GTQ A;  1TNU A;  2DWZ A;  4GTP A;  4L9P A;  3MKR A;  3F6Q A;  2WM9 A;  3EU9 A;  3L54 A;  1WG0 A;  3SFZ A;  1INZ A;  4GTR A;  4DK5 A;  2XPZ A;  2IEJ A;  4KYO B;  2CFZ A;  4L2Y A;  3MEK A;  4WND A;  2AVP A;  2I6H A;  1Z6T A;  4ABN A;  3BU8 A;  3LY9 A;  1N54 A;  2L0I A;  4L23 A;  2IU1 A;  4UQY A;  3E30 A;  4JC8 A;  3W9G A;  5AQ7 A;  5BXO A;  5A6C A;  2F8X K;  3EHR A; 
#chains in the Genus database with same CATH homology
 4A1S A;  2WMO A;  3S7D A;  3GZ2 A;  4ILI A;  1IQU A;  4PH4 B;  3O4Z A;  4I2W A;  3MV2 B;  1L5J A;  3CHO A;  4MLP A;  3CHR A;  4HXI A;  3MCX A;  2UY1 B;  2A4Z A;  3RRU A;  3L22 A;  2IFU A;  4EZK A;  3HYM B;  1QNF A;  2P58 C;  2KZT B;  1HS6 A;  3G2W A;  4UI9 C;  3RIB A;  3T5V A;  3LVR E;  4JVS A;  3ZGQ A;  1TJF A;  4G23 A;  2KCL A;  3FTU A;  3ZXS A;  4UQX A;  4DJA A;  4I6J A;  4JEU A;  4AJW A;  1SZ9 A;  4XKB A;  4Q69 A;  3LYA A;  3AS4 A;  1HZ4 A;  2OOE A;  2R59 A;  4CT4 A;  1IYG A;  2YIN A;  2JEK A;  2GW1 A;  5JJT A;  4HOU A;  3QDN A;  4KT6 B;  5D0Q D;  1HU3 A;  3GZS A;  5HI7 A;  3UUX A;  1ZBP A;  4BTA A;  4RVB A;  3Q47 B;  4FJY A;  3LJ3 A;  3QNK A;  3R9A B;  3I5P A;  3U4T A;  1UJJ A;  4GYW A;  3UT7 A;  4APO A;  3D9O A;  3K9I A;  3B13 A;  3JYS A;  3FH5 A;  2Q7F A;  4ILG A;  4LCT A;  3VLE A;  3QK0 A;  2WVI A;  3FU3 A;  4JZY A;  2IOL A;  4JEH A;  5G04 C;  4F3V A;  1W3B A;  4QFV A;  3DPD A;  1UN8 A;  3CHM A;  3L6A A;  1HFA A;  4PDX A;  1Y8M A;  3D9M A;  4U8H A;  4ANV A;  5ANL A;  2WB2 A;  2GRL A;  4BFR A;  4A3T A;  1HG2 A;  3CVW A;  3L13 A;  4KZ0 A;  2XRZ A;  3ASH A;  3FTZ A;  3RO2 A;  2PM7 A;  3G2T A;  2XHE A;  3ZHE B;  4XIF A;  5CCL A;  2Y4U A;  3LKU A;  4I1A A;  2UWJ G;  2PM6 A;  3FUL A;  3FTW A;  4DI3 A;  4EZJ A;  3EIQ C;  4B8C B;  3FTY A;  1EDU A;  3B7U X;  5C1D A;  3HVE A;  4B8A A;  3FU6 A;  2V5F A;  3HIZ A;  5M72 A;  3PRE A;  5AJL A;  5DBK A;  2WXK A;  2WXJ A;  2I1K A;  1MHQ A;  2YQ8 A;  4B89 A;  3I4R B;  3P1U A;  4WWN A;  4AEZ C;  2WQ6 A;  4B94 A;  3IKO B;  4GZD A;  3LY8 A;  2HO1 A;  4IN3 B;  2FI7 A;  4G11 A;  4V3I A;  2AXU A;  3CEQ A;  4GA2 A;  3ZPJ A;  2GRM A;  2NXP A;  3Q4A B;  5ENN A;  4C9B B;  5EDS A;  5G2N A;  3EJN A;  3N71 A;  2YNQ A;  4CGW A;  3CGH A;  5ARG A;  4N2S A;  2VTB A;  4RSY A;  4GPK A;  4BWR A;  5KJL A;  3PS6 A;  4KBQ A;  3UMV A;  3FHE A;  3ENE A;  3CHS A;  4GMJ A;  1VDY A;  3D9P A;  2DBA A;  4EEC A;  1WAO 1;  4HLE A;  3BEE A;  3LPZ A;  3CV0 A;  3B7S A;  5ANR A;  5FZQ A;  2FEZ A;  3CST A;  1HXI A;  1BPO A;  4WWP A;  4GYY A;  5ARF A;  2XCC A;  5DIZ A;  5FZS A;  3R7Q A;  2OVB A;  1DVP A;  3D9L A;  3U66 A;  2LSU A;  3MKQ B;  3PE4 A;  4F1S A;  1UW4 B;  1H6K A;  3TXM A;  4AOF A;  3CIA A;  4GML A;  4ACL A;  3UQ3 A;  3VTY A;  2WXH A;  4HOT A;  4B0Z A;  4WNG A;  3D9N A;  4GAA A;  4WUY A;  1WY6 A;  3CKB A;  3FWV A;  1KT0 A;  4XX5 A;  2KCV A;  3APC A;  2BF0 X;  4Q94 A;  4ANU A;  3LDZ A;  3QAR A;  4XE0 A;  2CG3 A;  3FTS A;  3FEY A;  4XI9 A;  5G04 J;  4ANX A;  4GZ3 A;  4PS8 A;  3FUJ A;  1UN9 A;  3L17 A;  1OWM A;  4WNE A;  3I3N A;  5E76 A;  4LUN U;  4UWH A;  4I6G A;  2RD0 A;  3TG4 A;  1Z3X A;  3AS5 A;  3OXG A;  5CMY A;  4HS2 A;  4AVX A;  4MKT A;  4I17 A;  4KMO A;  1Y6I A;  3G2V A;  3Q15 A;  3IBE A;  4AIF A;  3RU0 A;  4E6H A;  2XGM A;  4J8F A;  3S7B A;  5FQ6 A;  3FDH A;  2JLB A;  3D9K A;  2J9Q A;  1H2T C;  3CVX A;  3QJZ A;  3P2B A;  4FA6 A;  1E96 B;  4AV7 A;  4IYP A;  4UWF A;  5C2Y A;  4EQF A;  2LSV A;  2LAH A;  2WXR A;  3MZL B;  2E2E A;  2VJ8 A;  3FEX A;  1YA0 A;  4BY6 A;  5FWQ A;  3LY7 A;  5CCM A;  3PRZ A;  2CG2 A;  4O6F A;  3GYZ A;  4XKC A;  2BTD A;  3EDT B;  4CCA A;  5BT1 A;  1XGW A;  4IRU A;  3URZ A;  1JPL A;  4J8E A;  1S0P A;  2CHX A;  3PVL A;  4MRU A;  3L16 A;  2MRI A;  2R5S A;  1HE8 A;  3ONL A;  5CHE E;  3ULQ A;  4J8S A;  2WXF A;  4EZL A;  3LXU X;  1UJK A;  4G1T A;  1JWF A;  4GB9 A;  3O48 A;  2GGF A;  3CKC A;  2ZU6 B;  2LNI A;  1NP7 A;  5A6C A;  4DLQ A;  2AWI A;  4N39 A;  2VGX A;  2ILR A;  4J6I A;  3ZYQ A;  3MX3 A;  1HX8 A;  2EQX A;  4Y6W A;  1U3C A;  5BV0 A;  3S7J A;  3PE3 A;  3CQG B;  1FCH A;  2FF4 A;  2ION A;  1JUQ A;  2OND A;  2XGO A;  4N3C A;  3SHF A;  2WXN A;  1NA0 A;  1DNP A;  3FH7 A;  4I2Z A;  5LCW J;  1IHG A;  2WXP A;  4F7A A;  3B7T A;  3ZYK A;  4FAD A;  5D0O D;  3TAX A;  4J0U A;  5G55 A;  3QWW A;  1H2V C;  1ZU2 A;  3FUI A;  4HOQ A;  2MOW A;  1PY1 A;  2FUL A;  4JHK A;  3PDN A;  3TG5 A;  4G24 A;  1QQE A;  4FC8 A;  4I6E A;  3MGB A;  3CK9 A;  1EF1 C;  5G05 C;  2C0L A;  4UI9 J;  2WXI A;  2DCP A;  2XGS A;  2J49 A;  2YHE A;  2R17 C;  2HYZ A;  2PQR A;  4GA1 A;  5T8I A;  1KT1 A;  4HFG A;  3QKY A;  5AJD A;  4TV3 A;  2XRY A;  5BW8 C;  2WPV A;  5G05 J;  1HG5 A;  3CVN A;  5AYW D;  4AY5 A;  2WXL A;  4OVV A;  3BG1 B;  3CVQ A;  1NA3 A;  1QZ2 A;  3L08 A;  2X6F A;  4BX9 A;  1XNF A;  3AU4 A;  3QAQ A;  2QFC A;  3CVV A;  3SBT B;  5FZR A;  3ASG A;  2XQ0 A;  5T3R A;  5CMW A;  4TRQ A;  2X6K A;  3ZW3 A;  3FUM A;  5BV1 A;  2VSO E;  3MKQ A;  3DBS A;  3RKV A;  4UWG A;  2I1J A;  3MA5 A;  2AW6 A;  2QY7 A;  2HR2 A;  2YHC A;  3GZ1 A;  3MV3 B;  3OXL A;  5E75 A;  1TEZ A;  4NRH B;  4KZC A;  4GCN A;  3TL5 A;  4AY6 A;  3ZFW A;  4IUL A;  4BSX A;  2WXG A;  3VLF A;  3Q49 B;  4G26 A;  4FHJ A;  4NAC A;  5T4Y A;  1HF8 A;  1TJC A;  2XPI A;  4DPR A;  1A17 A;  4TUU A;  3U64 A;  2XCB A;  4D10 C;  3PEV B;  1GW6 A;  2FBN A;  3U9W A;  3CVU A;  1E7V A;  1PAQ A;  3RJV A;  3FP3 A;  5FQ7 A;  2E0I A;  4U0S A;  4J8D A;  4U0Z A;  3RK6 A;  4YVO A;  3RO3 A;  4G2V A;  3ZYM A;  5LX8 A;  3VTX A;  2X6J A;  4PUC A;  2WQ7 A;  2BUG A;  4UQZ A;  3ZHE A;  4OYS A;  4Y6C A;  5EX3 A;  4E85 A;  4F53 A;  5A7D B;  3I4G A;  3B7R L;  3CHP A;  2J07 A;  3MJW A;  4JL0 A;  3ZIM A;  4H7Y A;  2LAI A;  3G2S A;  4AXH A;  4RG6 A;  3TJP A;  3CVL A;  2UY1 A;  3CSF A;  3HVE B;  3ASD A;  2AXZ A;  3LCA A;  2J09 A;  3PNL B;  1H0A A;  4CEM A;  3NZS A;  4Q96 A;  3ZN3 A;  4GCO A;  2IJG X;  3FUD A;  2HM8 A;  3ZYL A;  1ELR A;  2VGX B;  4YVQ C;  1OUV A;  3IV0 A;  3CVP A;  2DIW A;  4NUR A;  3RRN B;  4CDM A;  1OWL A;  1U3D A;  5A23 A;  2C0M A;  4ANW A;  1E8X A;  2IOS A;  3PZD A;  2VTB B;  1H2U A;  3SF4 A;  3CHQ A;  3UT4 A;  4BT8 A;  2V0P A;  3SBS A;  2KC7 A;  3FTX A;  5FQ8 A;  3D9I A;  2J08 A;  1E8Z A;  4UWL A;  3OAW A;  4U04 A;  3QB2 A;  2WXO A;  3SI5 A;  1X5B A;  2L0T B;  3QWV A;  4EBA A;  3SD5 A;  4PS3 A;  2Y3A A;  3RRM B;  3FUH A;  2MHK A;  5KJM A;  4GYO A;  4U07 A;  4ACK A;  4KVM A;  2C2L A;  4FUL A;  3ESK A;  4GZC A;  1PC2 A;  4GZ5 A;  4DI4 A;  5BPP A;  5LOZ A;  4UWK A;  3HDX A;  3EHM A;  1LF8 A;  4K0R A;  3NQP A;  3Q5M A;  3E4B A;  3APF A;  1E8W A;  2VSN A;  3FUK A;  4A1G A;  4CRW A;  1N52 A;  1B89 A;  2I2O A;  4R7L A;  4I43 A;  3CR3 A;  1EPU A;  4RG9 A;  4EBA G;  3NF1 A;  3IHY A;  4JA7 A;  3VLD A;  4GZ6 A;  4URK A;  3FUN A;  5BNW A;  4NQ0 A;  2PZI A;  1OWO A;  3KEZ A;  4BT9 A;  2VSX E;  3CK8 A;  2FO7 A;  2KAT A;  3AU5 A;  3D3M A;  3QC1 A;  4I1M A;  2OV8 A;  4N3A A;  5JJ7 A;  3C98 A;  3ONK A;  3CVY A;  3ESL A;  4JHR A;  4BX8 A;  3PH0 C;  4PS7 A;  3TXN A;  2AXV A;  5HQ8 A;  2PL2 A;  1FVF A;  4HVB A;  2X3M A;  4HOS A;  1WM5 A;  2CHW A;  3IEG A;  2KZT A;  3SGH A;  2M63 A;  1OWP A;  3T8M A;  3WXX A;  1HH8 A;  4XZ4 A;  4YND A;  3FU0 A;  3IHV A;  3PUK A;  4N3B A;  5LFA A;  3JQ1 A;  3FH8 A;  2V8S E;  5KJN A;  2L9B A;  3CQC B;  2KCK A;  4W9R A;  4I9E A;  3S7F A;  5FJY A;  5FT9 A;  3UX4 A;  3GW4 A;  4OVU A;  4EPZ A;  2NC9 A;  1NZN A;  1Z3Y A;  2NSZ A;  3AS8 A;  2X6H A;  4LEU A;  4UI9 K;  5EX0 A;  4AM9 A;  3OXF A;  4GA0 A;  3ZVV A;  2I9C A;  3FU5 A;  4JA9 A;  3R7R A;  2VSY A;  1UG3 A;  4C0M A;  1MQS A;  2WQH A;  4ME2 A;  5FTP A;  1ELW A;  3ML8 A;  3BG0 B;  3PEU B;  3QWP A;  4FLB A;  2LO6 A;  4K03 A;  5EKQ D;  2WMN A;  3ZEF A;  4P29 A;  1SZA A;  1E7U A;  3APD A;  3LVQ E;  2Y4T A;  4CT0 A;  4JHJ A;  2IQC A;  2X38 A;  3KS2 A;  4KVO A;  3SNX A;  3JCK C;  3CLJ A;  3CK7 A;  3PNT B;  4FP7 A;  4L2L A;  4I1O B;  4CGV A;  3KD7 A;  2VYI A;  5JHA A;  2V4L A;  5J90 A;  4G25 A;  3NZU A;  4FHK A;  5FQ4 A;  3D9J A;  4XI0 A;  4LRZ A;  3JUI A;  3MKR A;  3HHM A;  4A55 A;  4WAF A;  2WM9 A;  2KM4 A;  1E8Y A;  4DLO A;  5AIJ A;  2VQ2 A;  4L1B A;  4HOR A;  4U0U A;  3FUF A;  4WWO A;  2XEV A;  3LEW A;  2A5U A;  3T5X A;  1IQR A;  3UPV A;  4N2Q A;  2VGY A;  2CHZ A;  4JPS A;  3FUE A;  5BUZ A;  4FLH A;  3KAE A;  3MYV A;  5JHB A;  1KLX A;  4H7X A;  2WXM A;  3L54 A;  1ELK A;  2RG8 A;  3JQ0 A;  3LS8 A;  5AEN A;  4A3V A;  3SFZ A;  3ML9 A;  4L7T A;  4JW1 A;  1INZ A;  4LER A;  2J4B A;  4APF A;  2IF4 A;  2L6J A;  4N5C A;  5KCM A;  4CDR A;  4KXK B;  4DK5 A;  2XPZ A;  4KYO B;  5KJK A;  2CFZ A;  4ATG A;  1HO8 A;  3FY4 A;  3OTN A;  4FU3 A;  3S2A A;  1FVH A;  2CFU A;  4L2Y A;  5J08 A;  3MEK A;  3EIJ A;  4M3O A;  4WND A;  1JWG A;  3U3W A;  4C0E A;  1P5Q A;  2AVP A;  4FJZ A;  2I6H A;  4CDN A;  1Z6T A;  3UT8 A;  4ABN A;  4GU5 A;  1H19 A;  3PUJ A;  4I9C A;  4BTB A;  1EYH A;  2PQN A;  3FTV A;  3LY9 A;  4U63 A;  1N54 A;  3FFL A;  5JJ6 A;  3ASF A;  2L0I A;  3EHN A;  4L23 A;  2IU1 A;  3QOU A;  5LCW C;  4WNF A;  3TGO A;  1SQM A;  4AP2 A;  4UQY A;  5LP0 A;  4MS6 A;  1OWN A;  4JC8 A;  1E90 A;  2OVF A;  3G2U A;  2X6I A;  2J4D A;  4JXT A;  4ILH B;  3SZ7 A;  3ZRH A;  2XPY A;  2WXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...