2HR2A

Crystal structure of a tpr-like protein (ct2138) from chlorobium tepidum tls at 2.54 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
156
structure length
156
Chain Sequence
b'KPLKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAMEISHTMPPEEAFDHAGFDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAEAMPEFKKVVEMIEERKGETPGKERMMEVAIDRIAQLGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (NP_663012.1) from Chlorobium tepidum TLS at 2.54 A resolution
rcsb
source organism Chlorobium tepidum
molecule tags Unknown function
total genus 57
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12968 DUF3856 Domain of Unknown Function (DUF3856)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2hr2A00
3PE4A 4JA7A 2Y4UA 5KJMA 2FEZA 3ZHEB 3TG5A 2XGOA 2Q7FA 4BT8A 5LCWJ 3ASGA 4G1TA 4UI9J 3CK9A 4H7XA 3Q47B 5D0OD 4G25A 2PL2A 5HI7A 2XGMA 3ASHA 5CHEE 5LCWC 4XIFA 3UPVA 3MA5A 3CK7A 3RO3A 3ZGQA 4NRHB 2KC7A 5A6CA 1A17A 2HYZA 3OXGA 2C0LA 2WPVA 3CVPA 1YA0A 5D0QD 3CK8A 2ONDA 2UY1A 3U3WA 1TJCA 2C2LA 2XCBA 4GYWA 2FI7A 5AYWD 2YQ8A 3JYSA 4AY5A 4NQ0A 4WUYA 3LY8A 4XI0A 4J0UA 1QZ2A 3TAXA 5KJNA 4O6FA 2WQHA 2QFCA 2LNIA 3SZ7A 5FZQA 3AS5A 4U07A 1HZ4A 5G04J 3LYAA 3S7DA 2KCVA 3ULQA 4YVQC 3WXXA 2R5SA 2E2EA 4GZ5A 2XCCA 3NF1A 4RG9A 3LKUA 2VQ2A 2VGXB 3S7JA 2JLBA 4LEUA 3E4BA 3ZHEA 3RIBA 5CCMA 3LY9A 2MHKA 4AIFA 2PQNA 4BTBA 5JJ6A 3LCAA 4JA9A 5EX0A 5HQ8A 2YHCA 2LSUA 3GYZA 5ARGA 4A1SA 4CDRA 4IN3B 5EX3A 4XI9A 2KCLA 4N3CA 4YVOA 4N3AA 4GPKA 2KATA 2BUGA 5BW8C 2HO1A 4BTAA 3QWWA 1Y8MA 3FP3A 2PZIA 4JL0A 4WNEA 3URZA 2XGSA 3GZ2A 5BT1A 4Y6CA 5FZSA 1KT0A 4BT9A 3U4TA 4HOUA 2NC9A 2L6JA 4N3BA 4N2QA 4J8FA 3Q4AB 1KT1A 3QDNA 4WNGA 3ZFWA 2VSNA 4GA2A 4U0ZA 1W3BA 2VYIA 3CVQA 1IHGA 3CKCA 3Q49B 4CGWA 3ZPJA 3EDTB 4GZ3A 2KCKA 4F3VA 3LY7A 3CEQA 1HH8A 3QWPA 1WM5A 1IYGA 2V5FA 3KS2A 4G24A 4GA0A 3CV0A 4UQXA 5C1DA 2VGXA 3CKBA 5CCLA 1ELWA 4I2ZA 4W9RA 1NZNA 1XNFA 2AVPA 4GYOA 2GW1A 3VTYA 3BEEA 1PC2A 4JHRA 4AY6A 3CVNA 3MV3B 4I2WA 3GW4A 3OXLA 4J8EA 4ME2A 4J8DA 3AS8A 3RJVA 3VTXA 1B89A 4N2SA 5JJTA 3AS4A 4GYYA 4WNDA 4UQZA 4HOSA 3LPZA 2C0MA 1ZU2A 5FTPA 3PE3A 4G2VA 5ARFA 5FT9A 3QWVA 1E96B 4U0UA 4B94A 2LSVA 4I17A 2J9QA 3FWVA 1NA3A 1KLXA 2XEVA 3Q15A 2IFUA 4I9EA 5BNWA 3MKRA 5KJKA 4WNFA 4Y6WA 4U0SA 3KAEA 2DBAA 2PQRA 3OXFA 3RO2A 4EQFA 4UI9C 4G26A 1ZBPA 1WAO1 1NA0A 3FFLA 2VGYA 4HOTA 3CVLA 5DIZA 3ASFA 3MV2B 2P58C 4N5CA 5FJYA 3TG4A 1QQEA 4N39A 3K9IA 3R9AB 3ZN3A 4KYOB 4KBQA 4ABNA 2FO7A 3O48A 2FF4A 4RG6A 2OOEA 3SF4A 3QOUA 4U04A 2XPIA 4UQYA 4G23A 5JJ7A 4YNDA 2UY1B 3N71A 4GA1A 4CGVA 5M72A 3TGOA 5DBKA 5A7DB 4HORA 4H7YA 4HOQA 5EKQD 4AM9A 3UQ3A 4UI9K 3GZ1A 2Y4TA 3HYMB 3S7FA 1FCHA 3RU0A 3S7BA 5G05J 2HR2A 1OUVA 5KJLA 3Q5MA 4BWRA 3KD7A 2I6HA 3IEGA 5G04C 4GCOA 4APOA 1P5QA 2UWJG 3QKYA 4I9CA 3ESKA 5FZRA 3MEKA 1ELRA 3RKVA 2FBNA 4I1AA 5G05C 1HXIA 4GCNA 2VSYA 4GZ6A 2IF4A 3PDNA 3UUXA 3ASDA 4KXKB
chains in the Genus database with same CATH superfamily
2CFUA 3VLEA 2FEZA 1N4QA 3I5PA 3TG5A 2Q7FA 4BT8A 5LCWJ 1UG3A 4LNGA 3LVRE 4KT6B 3NOGD 3JUIA 3AG4E 5LX8A 4FHJA 3CVXA 3Q47B 5D0OD 2L0IA 4ACLA 4HI9A 2PL2A 1N4RA 5ENOD 3ZGQA 4J8SA 5A6CA 2KC7A 2VTBB 5AQAA 2C0LA 1JWFA 2ZGDA 3FUHA 3CVPA 3LXUX 5D0QD 2UY1A 2CFZA 3T5XA 2C2LA 4V3IA 2CHWA 3ABME 3HXCA 3R7RA 2MOWA 3ZNGA 2I2OA 3E34A 4G8LA 5AYWD 3JYSA 1RZ4A 3FTSA 1PY1A 3ZVVA 5KCMA 2AJAA 2OVBA 2IOLA 4CT0A 1OCRE 5KJNA 3ZYQA 3MX3A 2L9BA 4OVUA 3ML8A 1X5BA 2LNIA 4HXIA 2QYJA 4U07A 1HZ4A 2J49A 3PVLA 3QK0A 2J09A 4HS2A 1N4SA 2P2CP 3S7DA 2KCVA 3MZLB 4YVQC 3C5RA 4BX9A 4Q69A 2E2EA 3RRNB 3ZIMA 1MQSA 1D8DA 2VQ2A 3S7JA 3IKOB 2OEWA 3D9HA 4AIFA 5FWQA 3Q7FA 3LJ3A 2BKKB 3FUFA 4EECA 5CBNA 2F8YA 2BF0X 2LSUA 2IONA 3GYZA 4QQIA 3JQ1A 3T5VA 2AW6A 3D9IA 4N3AA 3SGHA 4D10C 3R9MA 2J8SD 3MJWA 2X6HA 4TUUA 4BTAA 3ISMC 3QWWA 5HKPA 2KZTA 2PZIA 5CRVA 3ULEG 3AG3E 4ILGA 3OAWA 1WY6A 3LDZA 3URZA 3AAAC 4EZJA 3ASNE 2DCPA 4F53A 4BT9A 3PZ3A 3U4TA 5EILA 4HOUA 2ZXWE 4WWPA 3ENEA 3QDNA 3ZFWA 4TUMA 2QC9A 4DX2A 3TXMA 3TWXA 1MYOA 3UX4A 2EQXA 3Q49B 4Q96A 2R03A 2V8SE 3CSFA 3OTNA 4BERA 3EHMA 3D9LA 3FULA 3CR3A 4B8CB 1D8EA 3MKQB 2WM9A 5AN8A 3VLDA 3LY7A 3ZRHA 2EIME 5ANLA 1GW6A 4GA0A 3TWRA 1VDYA 3ZEFA 3ZYKA 4A3VA 5C1DA 3CKBA 3UKRG 4F1SA 1ELWA 4I2ZA 5FQ4A 4DX6D 3C3QA 1QNFA 4ACKA 3FH5A 1HG2A 1XNFA 2AVPA 2GW1A 2WQ7A 1N4PA 1PC2A 3CVNA 4B93B 3OXLA 3NOCD 3APDA 1N9AA 4ME2A 4J8DA 3AS8A 1B89A 5EYLA 3JCKC 3Q9UC 3LJNA 3QAQA 3G2TA 1E8WA 4FHKA 4JPSA 5ITZF 2C0MA 1ZU2A 3AG2E 4G2VA 3L82A 3CHMA 1E96B 1MX2A 4U0UA 3SFXA 1HG5A 4JHJA 3FUMA 3UIPC 2PM7A 4DI3A 4OAUC 1SQMA 2XEVA 3PZ2A 4ATZD 2WQ6A 5KJKA 3X2QE 4WNFA 4KVMA 3HXEA 3Q78A 3BQOA 4Y6WA 2AXVA 4L7TA 2BTDA 2DYSE 4EQFA 1BU9A 1A5EA 5CMYA 2Y1LE 4OAVB 3EHQA 2HM8A 1H6KA 1QYMA 3EU5A 4P29A 4OVVA 3FH8A 4RSYA 3ZN3A 1UW4B 2FO7A 3O48A 1LF8A 4GZDA 2YINA 2P9NG 2M63A 4EPZA 2ETBA 3ABKE 3FU3A 3DSWA 2B0OE 1JUQA 2LAIA 4CCAA 3SBSA 1N11A 4J6IA 1EDUA 4MS6A 4JZYA 1TNZA 4URKA 5DBKA 3KEZA 4FC8A 1NI1A 3P2BA 4A3TA 4Q94A 2DYRE 1Y6IA 3ZU7B 2FULA 4GTSA 2GRLA 2J07A 5AARA 4GTTA 1V55E 5G05J 2HR2A 3Q5MA 3IEGA 4APOA 4KVOA 1H0AA 4DK5A 1INZA 3CHSA 5FZRA 3MEKA 3RKVA 2FBNA 4GZ6A 5T4YA 1SVXA 4LCTA 4ANWA 2Y4UA 5KJMA 3FHEA 3FUKA 1Z6TA 5EN5D 3B95A 1HX8A 3G2SA 2EIKE 2CHXA 3CK9A 3PRZA 3FTVA 4RQIA 5ENTD 3SBTB 2V5QC 1AP7A 4G25A 4BFRA 3L6AA 4XIFA 3UPVA 3SY2A 3OXGA 2P9KG 4C48B 4GTVA 2XZDG 3PZDA 2LXMA 1OXJA 2HE0A 1YA0A 2H6HA 4JXTA 4AOFA 1N0RA 1SA4A 4K5BA 1TJCA 1TNBA 3TWUA 3IHYA 2NXPA 1S0PA 2YQ8A 1JCQA 4FLHA 3EUVA 1IXVA 1K3ZD 4GTPA 3V30A 1OWLA 4O6FA 4G11A 2QFCA 3SZ7A 5BXUA 4ANXA 3EJNA 1UJKA 5BV1A 5G04J 4ZHBA 4GAAA 3FTUA 5BV0A 3LS8A 4BY6A 3T9KA 4RG9A 3ZKJA 3FTXA 4LEUA 4AXHA 3RIBA 4E6HA 3AU5A 4O1OA 3RK6A 1KZPA 5JJ6A 4JA9A 1UJJA 3IHVA 4JVSA 3HHMA 4LRZA 3UIOC 2WXPA 2YHCA 2R2LA 5FQ8A 3ASOE 4CDRA 2FO1E 5CECB 4XI9A 2VTBA 4N3CA 1X81A 3W9FA 2EILE 2KATA 3D9KA 1OCZE 1UN8A 2XPZA 2RKKA 3SHFA 5BW8C 1JWGA 3E37A 3D9JA 4HBDA 3V2OA 1SZAA 3FP3A 1IQUA 1Z3XA 4JL0A 1MJ0A 2IU1A 4ANVA 3TJPA 4R7LA 1YYHA 1ZB1A 4UWKA 2WXHA 3KEAA 2LUHA 2KM4A 2NC9A 2L6JA 2Y3AA 3FU0A 4CT4A 2A5UA 2P9LG 3J5QB 4LG6A 1W3BA 2VYIA 2YHEA 2P9SG 3FDHA 1NP7A 1UOHA 4AV7A 2KCKA 1OT8A 3FU6A 5B3SE 1OWMA 1TNUA 4F6RD 3ML9A 5CMWA 3APFA 2QZAA 1HH8A 1IYGA 3UT7A 1E8ZA 1Q2ZA 4G24A 4B8AA 4UQXA 1LD7A 5CCLA 1LD8A 3HIZA 3MCXA 1JPLA 2XZTG 1OWOA 2WMOA 2GRMA 3CVUA 1NZNA 1BD8A 3L13A 2EIJE 2X3MA 2XRYA 1E90A 2LO6A 4L9PA 4AY6A 2A4ZA 1O1RA 2XS1A 1SA5A 1N54A 4I2WA 4C9BB 4CEMA 4HVBA 4J8EA 3FEYA 3HXBA 3RJVA 2VSOE 4N2SA 3AS4A 4GYYA 4WNDA 4XEIG 4HOSA 3HXDA 2IOSA 3LPZA 5FTPA 3L17A 5ARFA 1N0QA 4ZFHA 5AIJA 3B7SA 4I17A 2J9QA 4U7EB 5BPPA 4I1OB 4EBAG 4G8KA 2F37A 3AG1E 1G3NB 1DCEA 2P9UG 4KMOA 4TXPA 3KAEA 3MKQA 5E76A 1S63A 4FADA 1O5MA 2DBAA 3OXFA 3RO2A 3B13A 4FLBA 1H6PA 4YDOA 4HLEA 1H19A 3G2WA 1EF1C 2RD0A 1ZBPA 1NA0A 1SZ9A 3FUJA 5KBAA 4HOTA 5FQ6A 1DVPA 3SO8A 5DIZA 4GTQA 3MV2B 2P58C 5FJYA 3TG4A 5G55A 1QQEA 4N39A 3L08A 4FP7A 1L5JA 1N94A 3CVWA 3GZSA 2YNQA 4RLYA 4PS7A 3DSUA 4ABNA 2XEHA 4O60A 4I6EA 4U8VD 2OOEA 2J4DA 3QOUA 4TV3A 1DC2A 4U04A 3U66A 1MX6A 2F0YA 3ZXSA 5FQ7A 3FTWA 4HI8A 2LXLA 4AVXA 5JJ7A 2IQCA 4YNDA 1EYHA 3TWWA 4H7YA 4HOQA 4AM9A 3W9GA 2EINE 1BI8B 4UI9K 3HYMB 1MX4A 4TXRA 2WXLA 3RU0A 4BETA 3S7BA 3C3OA 3FY4A 2QY7A 4PS3A 1OUVA 2AXZA 3TWSA 4BWRA 2I6HA 1E8XA 3Q79A 4PDXA 1TNOA 2X6KA 3QJZA 3TWVA 1ELRA 2DIWA 3PS6A 4C0MA 3JXJA 4XE0A 1AWCB 2VSYA 2IF4A 2I1KA 1JCSA 4E85A 5ENPD 3PREA 1MHQA 3EU9A 3PE4A 3ZHEB 3ASGA 4G1TA 4UI9J 3D9MA 5ANRA 3BG1B 5CHEE 4DLQA 3MA5A 4NRHB 2L6BA 4KZ0A 3B7BA 2HYZA 2WVIA 4NACA 2V4LA 4BEPA 3CSTA 2IJGX 5AJDA 2J4BA 3CK8A 1BLXB 2ONDA 3PNLB 3U3WA 4GMLA 4HRMB 2ILRA 3PZ1A 4BSXA 3S2AA 3IBEA 4GYWA 1BI7B 2DZOA 3LEWA 4GTRA 4K5CA 4NQ0A 2DZNA 4WUYA 3LY8A 4XI0A 2OEVA 2KXPC 3DSXA 4XKBA 4AP2A 4YDYA 3PH0C 2GRQB 1QZ2A 2PM6A 3TAXA 2V0PA 3V2XA 3MGBA 3AS5A 1D9SA 1TN6A 3L22A 3ULQA 4K03A 2RFAA 5EIBE 5T3RA 4XZ4A 2WXRA 2R5SA 4WAFA 2NSZA 3RRUA 3CHQA 4CDNA 3CVVA 3QARA 3SD5A 3C72A 2VGXB 1K1AA 2X6FA 2GRRB 2I1JA 3E4BA 4CYMD 3PNTB 2PQNA 4A1GA 4L1BA 4UWGA 4PH4B 1TN8A 1Z3YA 2H6FA 3O4ZA 3DEOA 2WXQA 3Q75A 1YCSB 5HQ8A 4A1SA 1BPOA 2R02A 2PNNA 4X8QA 2KCLA 4DLOA 4HRLA 4LNBA 4GPKA 3HVEB 2BUGA 3JUEA 1XGWA 4EHMA 4U8HA 4U8YD 2HO1A 3PEUB 1Y8MA 4MBGA 3APCA 3KSQA 4FU3A 3PUKA 4F1PA 3UI2A 2P9PG 2MYOA 4I6JA 2JEKA 5BT1A 3JXIA 4Y6CA 1H6OA 2V4HC 5FZSA 3DSSA 2VGEA 3KSLA 4N3BA 3NZSA 2MRIA 4UWLA 4N2QA 4J8FA 1KT1A 2P9IG 4WNGA 2VSNA 4GA2A 4J7WA 3DPDA 3TXNA 4U0ZA 3CVQA 1IHGA 2R59A 3FUIA 4CGWA 3ZPJA 5EYPF 4HQDA 1E7VA 4ANUA 1OWPA 2XHEA 4GZ3A 1H2TC 3DPYA 4DX7D 2B6CA 3MYVA 3QWPA 3FUEA 1N95A 3KS2A 3CV0A 4CDMA 3FEXA 4GTMA 3DXMG 4W9RA 1LTXA 5JMND 3I4GA 4N5QA 4GYOA 3BU8A 3VTYA 3BEEA 4LSZE 5EIDA 5HS0A 5JHBA 3BG0B 2JABA 4EBAA 3GW4A 4EZKA 3PZ4A 3D9OA 3AJIA 1H2UA 4C0EA 5JJTA 5KNHD 2QYUA 4I43A 4XKCA 5FIOA 3ZW3A 3PE3A 3UTMA 3TWTA 4YDWA 2ZU6B 1E8YA 3UXGA 4BX8A 1EPUA 5LFAA 1TNYA 5CRUA 2IO3C 1KLXA 2I9CA 3C98A 5D2MC 3Q15A 3SFYA 5D66A 4HRNA 3C3RA 4GPMA 5KNGA 2OV8A 4Z68A 3CHRA 5T8IA 4DI4A 1TYQG 3FU5A 2GROB 1HS6A 3IXEA 3F6QA 5HRYA 2X6IA 1WG0A 4U95D 4G26A 4M3OA 5B1BE 2BKGA 4NIKA 3V79K 4GMJA 2ETAA 3CVLA 3ASFA 4N5CA 4HNAD 3Q7AA 3CLJA 3B7TA 1S64A 3R9AB 4K5AB 1S70B 4BSZB 4JHKA 5AENA 4KBQA 5KWDA 2R17C 3T8MA 4RG6A 2XPYA 4DPRA 3SF4A 1IHBA 3SNXA 4OYSA 2XPIA 2H6IA 4UQYA 4RVBA 4G23A 3ZYMA 2UY1B 4DJAA 5ENQD 4GA1A 2WXMA 1U2VG 3TGOA 2WXGA 5IY5E 3QNKA 5A7DB 5B1AE 5AQ7A 1N52A 3D9PA 3ULYA 3UQ3A 2RFMA 4DX1A 1NL4A 1OY3D 3S7FA 4YDEA 3FTZA 1OCOE 4I1MA 3ONLA 3KD7A 1Z5SC 5G04C 4JEHA 4GCOA 5LP0A 5ENSD 5AQ9A 4I9CA 4BESA 4I1AA 1HXIA 2L0TB 3NQPA 1HU3A 4GCNA 4WWNA 4JEUA 3ZYLA 2WXFA 3I4RB 4TXQA 4PS8A 4GTOA 4JA7A 5E75A 2XGOA 2OVFA 3CHOA 1IKND 1MZCA 3FUDA 4UWHA 3HG0D 5CEAA 1FVHA 4H7XA 4A63B 2CG2A 2RG8A 2Y69E 2XQ0A 2H6GA 5HI7A 2XGMA 3ASHA 5LCWC 1HE8A 3CK7A 3E33A 3HXFA 3RO3A 4QFVA 4KZCA 1A17A 4JW1A 1QBQA 3B7RL 5G2NA 4GB9A 3Q73A 5AAOA 3DSVA 3ABLE 2WPVA 3L16A 3TWQA 2KZTB 3UT4A 2IEJA 2J08A 4LNUD 2DWZA 4L2LA 3DEPA 1HF8A 2XCBA 3LVQE 2FI7A 4ILHB 1HO8A 4AY5A 3SFZA 4ATGA 4WWOA 3U64A 4GU5A 4JC8A 3FH7A 4J0UA 5ENRD 2F8XK 4DRXE 4K0RA 3D9NA 2ETCA 4U96D 2X38A 1TR4A 2XS8A 2ZGGA 2WXOA 2WQHA 3DSTA 5FZQA 1WDYA 2VJ8A 1U3DA 3LYAA 4IULA 3E30A 3WXXA 1JCRA 4GZ5A 2XCCA 1TJFA 3NF1A 2R05A 3LKUA 4LUNU 2JLBA 2GGFA 3ZHEA 5CCMA 3LY9A 4FA6A 2MHKA 4BTBA 3CGHA 1U3CA 3LCAA 4EZLA 5AJLA 1OCCE 5EX0A 2GRPB 5ARGA 4IN3B 3UINC 5EX3A 4JD2G 3UM1A 2NYJA 4YVOA 4TRQA 4DX5D 3HDXA 1K1BA 1H2VC 4AJWA 5EDSA 2ZISA 3AU4A 5H7PA 4J8YA 4O1PA 3DWLG 3G2VA 3NAWA 4APFA 3CIAA 3P1UA 3SQVA 1FVFA 4WNEA 3TL5A 3I3NA 2XGSA 3GZ2A 3IV0A 2Y0BG 1KT0A 3DRAA 4FJYA 1E7UA 4LERA 3UM2A 1UN9A 3B7UX 1NFIE 3Q4AB 3HRAA 5FINA 3CKCA 3WG7E 3E32A 3EDTB 2CG3A 2XRZA 4F3VA 2X6JA 3NZUA 2XEEA 3J5PA 3VLFA 4M7CA 3CEQA 4CRWA 3R7QA 1WM5A 3CVYA 2V5FA 5AQBA 2VGXA 4B89A 1KZOA 4UWFA 5CEDB 2WB2A 5JA4D 5CBOA 1IQRA 5C2YA 4B0ZA 1RW2A 3UT8A 5A23A 4JHRA 3MV3B 3QC1A 3UKUG 2AWIA 3FUNA 3HVEA 3EIQC 1V54E 5BXOA 3L54A 3VTXA 4HLLA 5JHAA 2WMNA 2GRNB 4AEZC 3UM3A 4UQZA 1O1TA 3EHRA 5FT9A 1O1SA 3QWVA 4XX5A 4B94A 2LSVA 4I6GA 2WXIA 3V31A 5J90A 3FWVA 1DNPA 3CHPA 4NURA 1NA3A 2DVWA 2IFUA 4I9EA 3UM0A 3L9TA 5BNWA 3ONKA 3NB2A 4MLPA 1FPPA 3MKRA 3RRMB 3EIJA 1DCQA 2A5EA 4HFGA 4CZ2D 4ILIA 3ESLA 4MKTA 4U0SA 2WXNA 4L23A 1YMPA 2IO2C 3G2UA 2PQRA 3DXKG 4U63A 4GZCA 2ZIRA 3Q9NC 4UI9C 1TN7A 3BUAA 1K8KG 5CERB 3EHNA 1WAO1 3FFLA 5ENNA 2VGYA 1HFAA 3CQGB 3K9IA 4L2YA 2KBXA 4UUCA 4GMRA 4A55A 4KYOB 3SI5A 2LAHA 4PUCA 1SW6A 4FJZA 2FF4A 2IY0C 3UMVA 2WXKA 3QB2A 1PAQA 2AXUA 4FULA 4JB8P 4IRUA 1TEZA 4HB5A 2CHZA 3RSEG 3N71A 5LOZA 1FT1A 3ZXPA 4CGVA 5J08A 3RAUA 2XENA 5M72A 1KPSB 2OCCE 4HORA 3PUJA 5EKQD 3T8KA 1ELKA 3GZ1A 2Y4TA 1FT2A 1FCHA 4MRUA 3PEVB 2E0IA 3DBSA 3JQ0A 3NBNB 5KJLA 4IYPA 2BEDA 2VSXE 1P5QA 2UWJG 3QKYA 3FTYA 3ESKA 5BUZA 5G05C 3U9WA 4DUIA 3ZUVB 4F7AA 1OWNA 3PDNA 3UUXA 3ASDA 3D3MA 4KXKB 3CQCB 2WXJA
chains in the Genus database with same CATH topology
3PE4A 4LCTA 4ANWA 4JA7A 2Y4UA 2CFUA 5E75A 3VLEA 5KJMA 2FEZA 3I5PA 3TG5A 2XGOA 2Q7FA 3FHEA 3FUKA 3ZHEB 1Z6TA 2OVFA 4BT8A 1UG3A 3ASGA 1HX8A 3CHOA 3G2SA 2CHXA 3FUDA 4G1TA 3CK9A 4UI9J 4UWHA 3LVRE 4KT6B 3PRZA 3JUIA 3FTVA 1FVHA 3SBTB 4H7XA 3D9MA 5ANRA 2CG2A 2RG8A 4FHJA 3Q47B 5D0OD 2L0IA 4G25A 4ACLA 5LX8A 3CVXA 2PL2A 2XQ0A 3BG1B 4BFRA 5HI7A 2XGMA 3ASHA 5CHEE 3L6AA 4DLQA 1HE8A 4XIFA 5LCWC 3UPVA 3MA5A 3CK7A 3RO3A 3ZGQA 4J8SA 4NRHB 2KC7A 4KZ0A 5A6CA 4QFVA 2VTBB 4KZCA 1A17A 4JW1A 2HYZA 3B7RL 5G2NA 3OXGA 2WVIA 4NACA 2C0LA 4GB9A 2V4LA 1JWFA 3FUHA 3CSTA 3PZDA 2WPVA 2IJGX 5AJDA 2J4BA 3L16A 3CVPA 1YA0A 3LXUX 4JXTA 5D0QD 4AOFA 3CK8A 2KZTB 3UT4A 2ONDA 2UY1A 3PNLB 3U3WA 2CFZA 3T5XA 1TJCA 2C2LA 4GMLA 2ILRA 4V3IA 2CHWA 2J08A 4BSXA 3S2AA 3IBEA 4L2LA 3R7RA 2MOWA 1HF8A 3IHYA 2XCBA 4GYWA 3LVQE 2FI7A 2NXPA 4ILHB 1S0PA 1HO8A 2I2OA 5AYWD 2YQ8A 3JYSA 4AY5A 3SFZA 4ATGA 3FTSA 3LEWA 4NQ0A 4WWOA 3U64A 4WUYA 3LY8A 4GU5A 4FLHA 4XI0A 4JC8A 1PY1A 3ZVVA 4XKBA 3FH7A 5KCMA 4AP2A 4J0UA 3PH0C 4K0RA 3D9NA 2OVBA 2IOLA 1QZ2A 2PM6A 3TAXA 4CT0A 5KJNA 2X38A 1OWLA 2V0PA 4O6FA 3MX3A 4G11A 3ZYQA 2L9BA 4OVUA 3ML8A 2WXOA 1X5BA 2WQHA 2QFCA 2LNIA 3SZ7A 4HXIA 3MGBA 5FZQA 3AS5A 2VJ8A 4ANXA 4U07A 1HZ4A 3EJNA 1UJKA 2J49A 3L22A 3PVLA 3QK0A 2J09A 4HS2A 5G04J 5BV1A 1U3DA 3LYAA 3S7DA 4IULA 4GAAA 2KCVA 3FTUA 3ULQA 4K03A 3MZLB 4YVQC 5T3RA 4XZ4A 2WXRA 5BV0A 3WXXA 4BX9A 2R5SA 4WAFA 2NSZA 3LS8A 3CHQA 3RRUA 4BY6A 4CDNA 4Q69A 2E2EA 3RRNB 4GZ5A 2XCCA 3ZIMA 3QARA 3CVVA 1TJFA 3NF1A 3SD5A 1MQSA 4RG9A 3LKUA 2VGXB 2VQ2A 3S7JA 3IKOB 2X6FA 4LUNU 2JLBA 3FTXA 4LEUA 2I1JA 2GGFA 3E4BA 3ZHEA 4AXHA 3RIBA 4E6HA 5CCMA 3LY9A 3AU5A 4FA6A 2MHKA 3PNTB 3RK6A 2PQNA 4AIFA 4BTBA 3CGHA 1U3CA 5FWQA 5JJ6A 3LCAA 4JA9A 4L1BA 4PH4B 1UJJA 3IHVA 4UWGA 1Z3YA 5AJLA 4EZLA 4JVSA 3HHMA 3O4ZA 3LJ3A 2WXQA 4LRZA 3FUFA 4EECA 5EX0A 2WXPA 5HQ8A 2YHCA 2BF0X 2LSUA 2IONA 5FQ8A 3GYZA 5ARGA 4A1SA 4CDRA 3JQ1A 1BPOA 3PREA 2AW6A 4IN3B 5EX3A 3D9IA 3T5VA 4XI9A 2VTBA 2KCLA 4N3CA 4DLOA 4YVOA 4N3AA 4TRQA 3SGHA 4GPKA 2KATA 4D10C 3D9KA 3HVEB 3HDXA 2BUGA 1H2VC 1UN8A 2XPZA 3SHFA 4AJWA 5EDSA 5BW8C 3AU4A 1XGWA 1JWGA 3MJWA 4U8HA 2X6HA 4TUUA 2HO1A 3D9JA 3PEUB 4BTAA 3QWWA 1Y8MA 3APCA 3G2VA 1SZAA 3FP3A 2KZTA 4FU3A 1IQUA 4APFA 2PZIA 3PUKA 1Z3XA 4ILGA 3CIAA 3P1UA 3OAWA 1FVFA 1WY6A 4JL0A 2IU1A 4WNEA 4ANVA 3LDZA 3TL5A 3URZA 3I3NA 3TJPA 2XGSA 4I6JA 3GZ2A 2JEKA 3IV0A 5BT1A 4EZJA 4R7LA 4Y6CA 2DCPA 5FZSA 4F53A 1KT0A 4BT9A 3U4TA 4UWKA 2WXHA 4FJYA 4HOUA 1E7UA 4LERA 2KM4A 2NC9A 1UN9A 2L6JA 4N3BA 2Y3AA 2MRIA 3NZSA 4UWLA 4WWPA 3FU0A 4N2QA 4J8FA 3B7UX 3Q4AB 1KT1A 3ENEA 4CT4A 3QDNA 4WNGA 3ZFWA 2A5UA 2VSNA 3TXMA 4GA2A 3DPDA 3TXNA 4U0ZA 1W3BA 2VYIA 3CVQA 3UX4A 1IHGA 2R59A 2EQXA 3CKCA 3Q49B 3FUIA 2V8SE 4Q96A 3CSFA 2YHEA 4CGWA 3FDHA 3OTNA 3ZPJA 1E7VA 1NP7A 3EHMA 4ANUA 1OWPA 2XHEA 2CG3A 3D9LA 3EDTB 1H2TC 2KCKA 3FULA 4GZ3A 4AV7A 4F3VA 3FU6A 2XRZA 2X6JA 3CR3A 4B8CB 3NZUA 3MKQB 1OWMA 2WM9A 3ML9A 5CMWA 3VLDA 3APFA 3LY7A 3ZRHA 3VLFA 5ANLA 3CEQA 1HH8A 3MYVA 3QWPA 1GW6A 1WM5A 3R7QA 3UT7A 4CRWA 1IYGA 1E8ZA 3CVYA 2V5FA 3FUEA 3KS2A 4G24A 1VDYA 4GA0A 3CV0A 3ZEFA 3ZYKA 4A3VA 4B8AA 4CDMA 4UQXA 5C1DA 2VGXA 4B89A 3CKBA 5CCLA 4F1SA 1ELWA 3FEXA 4I2ZA 4UWFA 5FQ4A 3HIZA 2WB2A 3MCXA 1QNFA 1JPLA 4ACKA 1OWOA 2WMOA 4W9RA 3FH5A 2GRMA 1IQRA 3CVUA 1HG2A 1NZNA 5LCWJ 3I4GA 1XNFA 2AVPA 4GYOA 2GW1A 3L13A 5C2YA 2X3MA 4B0ZA 2XRYA 2WQ7A 1E90A 3VTYA 3BEEA 3UT8A 5A23A 1PC2A 4JHRA 2LO6A 4AY6A 3CVNA 3MV3B 4A1GA 3QC1A 2A4ZA 2AWIA 3FUNA 3HVEA 3BG0B 5JHBA 3EIQC 1N54A 4I2WA 4EBAA 4C9BB 3GW4A 3OXLA 4CEMA 3APDA 4EZKA 4HVBA 4J8EA 3D9OA 3FEYA 4ME2A 3L54A 4J8DA 3AS8A 3RJVA 3VTXA 1H2UA 4C0EA 1B89A 2VSOE 5JHAA 3JCKC 4N2SA 5JJTA 2WMNA 3AS4A 4GYYA 3QAQA 3G2TA 1E8WA 4I43A 4WNDA 4FHKA 4JPSA 4XKCA 4AEZC 4UQZA 3ZW3A 4HOSA 2IOSA 3LPZA 2C0MA 1ZU2A 5FTPA 3PE3A 4G2VA 3L17A 5ARFA 5FT9A 3CHMA 5AIJA 3QWVA 1E96B 3B7SA 4XX5A 4U0UA 4B94A 2LSVA 2ZU6B 1E8YA 4I17A 1HG5A 2J9QA 5BPPA 4JHJA 3FUMA 4I6GA 2WXIA 2PM7A 4I1OB 5J90A 3FWVA 1DNPA 4BX8A 3CHPA 1EPUA 4DI3A 5LFAA 4NURA 4EBAG 1NA3A 1SQMA 1KLXA 2I9CA 3C98A 2XEVA 3Q15A 2IFUA 4I9EA 5BNWA 3ONKA 4MLPA 3MKRA 3RRMB 3EIJA 2WQ6A 5KJKA 2OV8A 4WNFA 4KVMA 4HFGA 3CHRA 5T8IA 4PS8A 4Y6WA 4KMOA 2AXVA 4ILIA 4L7TA 3ESLA 4MKTA 4DI4A 3FU5A 4U0SA 3KAEA 3MKQA 1HS6A 2WXNA 4L23A 5E76A 4FADA 2DBAA 3G2UA 2PQRA 2BTDA 3OXFA 3RO2A 4EQFA 4U63A 4GZCA 3B13A 4FLBA 2X6IA 5CMYA 4UI9C 4HLEA 1H19A 4G26A 4M3OA 3G2WA 1EF1C 2RD0A 3EHNA 1ZBPA 2HM8A 1WAO1 1NA0A 3FFLA 1SZ9A 3FUJA 5ENNA 2VGYA 4HOTA 1HFAA 4GMJA 3CVLA 1DVPA 5FQ6A 1H6KA 5DIZA 3ASFA 3MV2B 2P58C 4N5CA 5FJYA 3TG4A 5G55A 1QQEA 3CQGB 4N39A 3K9IA 3CLJA 4P29A 3L08A 4OVVA 4L2YA 3B7TA 3FH8A 4FP7A 3R9AB 1L5JA 4RSYA 3ZN3A 3CVWA 4JHKA 4A55A 3GZSA 5AENA 2YNQA 4KYOB 1UW4B 2LAHA 4KBQA 4PS7A 3SI5A 4PUCA 4ABNA 2FO7A 3O48A 4FJZA 2FF4A 1LF8A 4GZDA 2YINA 4I6EA 3UMVA 2R17C 3T8MA 4RG6A 2WXKA 2M63A 2OOEA 2XPYA 3QB2A 4EPZA 4DPRA 3SF4A 1PAQA 2J4DA 3FU3A 3QOUA 4TV3A 4U04A 3SNXA 2AXUA 4FULA 3U66A 4IRUA 4OYSA 1TEZA 2XPIA 3ZXSA 5FQ7A 3FTWA 1JUQA 4UQYA 2LAIA 4RVBA 4AVXA 4G23A 4CCAA 2CHZA 2IQCA 4YNDA 3ZYMA 5JJ7A 1EYHA 2UY1B 3N71A 5LOZA 3SBSA 4DJAA 4J6IA 4GA1A 1EDUA 4MS6A 2WXMA 4CGVA 5J08A 5M72A 4JZYA 3TGOA 4URKA 2WXGA 5DBKA 3KEZA 3QNKA 4FC8A 5A7DB 4HORA 3PUJA 3P2BA 4H7YA 4HOQA 5EKQD 4A3TA 4AM9A 1N52A 1ELKA 3D9PA 3UQ3A 4Q94A 4UI9K 3GZ1A 2Y4TA 3HYMB 3S7FA 1Y6IA 1FCHA 4MRUA 2FULA 3FTZA 2WXLA 3PEVB 4I1MA 3RU0A 2GRLA 3S7BA 2J07A 2E0IA 3DBSA 3JQ0A 3FY4A 2QY7A 4PS3A 3ONLA 2HR2A 1OUVA 5G05J 5KJLA 2AXZA 4IYPA 3Q5MA 4BWRA 3KD7A 2I6HA 3IEGA 5G04C 4JEHA 2VSXE 4GCOA 4APOA 5LP0A 1E8XA 4PDXA 1P5QA 2X6KA 4KVOA 2UWJG 1H0AA 3QKYA 3QJZA 4DK5A 4I9CA 1INZA 3FTYA 3CHSA 3ESKA 5FZRA 3MEKA 1ELRA 2DIWA 3PS6A 2FBNA 4I1AA 3RKVA 5BUZA 5G05C 4C0MA 1HXIA 3U9WA 4XE0A 2L0TB 3NQPA 1HU3A 4GCNA 2VSYA 4WWNA 4GZ6A 4F7AA 4JEUA 2IF4A 1OWNA 3ZYLA 3PDNA 2WXFA 5T4YA 2I1KA 3UUXA 3ASDA 3D3MA 4KXKB 3CQCB 3I4RB 4E85A 2WXJA 1MHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PE4 A;  4JA7 A;  2Y4U A;  5KJM A;  2FEZ A;  3ZHE B;  3TG5 A;  2XGO A;  2Q7F A;  4BT8 A;  5LCW J;  3ASG A;  4G1T A;  4UI9 J;  3CK9 A;  4H7X A;  3Q47 B;  5D0O D;  4G25 A;  2PL2 A;  5HI7 A;  2XGM A;  3ASH A;  5CHE E;  5LCW C;  4XIF A;  3UPV A;  3MA5 A;  3CK7 A;  3RO3 A;  3ZGQ A;  4NRH B;  2KC7 A;  5A6C A;  1A17 A;  2HYZ A;  3OXG A;  2C0L A;  2WPV A;  3CVP A;  1YA0 A;  5D0Q D;  3CK8 A;  2OND A;  2UY1 A;  3U3W A;  1TJC A;  2C2L A;  2XCB A;  4GYW A;  2FI7 A;  5AYW D;  2YQ8 A;  3JYS A;  4AY5 A;  4NQ0 A;  4WUY A;  3LY8 A;  4XI0 A;  4J0U A;  1QZ2 A;  3TAX A;  5KJN A;  4O6F A;  2WQH A;  2QFC A;  2LNI A;  3SZ7 A;  5FZQ A;  3AS5 A;  4U07 A;  1HZ4 A;  5G04 J;  3LYA A;  3S7D A;  2KCV A;  3ULQ A;  4YVQ C;  3WXX A;  2R5S A;  2E2E A;  4GZ5 A;  2XCC A;  3NF1 A;  4RG9 A;  3LKU A;  2VQ2 A;  2VGX B;  3S7J A;  2JLB A;  4LEU A;  3E4B A;  3ZHE A;  3RIB A;  5CCM A;  3LY9 A;  2MHK A;  4AIF A;  2PQN A;  4BTB A;  5JJ6 A;  3LCA A;  4JA9 A;  5EX0 A;  5HQ8 A;  2YHC A;  2LSU A;  3GYZ A;  5ARG A;  4A1S A;  4CDR A;  4IN3 B;  5EX3 A;  4XI9 A;  2KCL A;  4N3C A;  4YVO A;  4N3A A;  4GPK A;  2KAT A;  2BUG A;  5BW8 C;  2HO1 A;  4BTA A;  3QWW A;  1Y8M A;  3FP3 A;  2PZI A;  4JL0 A;  4WNE A;  3URZ A;  2XGS A;  3GZ2 A;  5BT1 A;  4Y6C A;  5FZS A;  1KT0 A;  4BT9 A;  3U4T A;  4HOU A;  2NC9 A;  2L6J A;  4N3B A;  4N2Q A;  4J8F A;  3Q4A B;  1KT1 A;  3QDN A;  4WNG A;  3ZFW A;  2VSN A;  4GA2 A;  4U0Z A;  1W3B A;  2VYI A;  3CVQ A;  1IHG A;  3CKC A;  3Q49 B;  4CGW A;  3ZPJ A;  3EDT B;  4GZ3 A;  2KCK A;  4F3V A;  3LY7 A;  3CEQ A;  1HH8 A;  3QWP A;  1WM5 A;  1IYG A;  2V5F A;  3KS2 A;  4G24 A;  4GA0 A;  3CV0 A;  4UQX A;  5C1D A;  2VGX A;  3CKB A;  5CCL A;  1ELW A;  4I2Z A;  4W9R A;  1NZN A;  1XNF A;  2AVP A;  4GYO A;  2GW1 A;  3VTY A;  3BEE A;  1PC2 A;  4JHR A;  4AY6 A;  3CVN A;  3MV3 B;  4I2W A;  3GW4 A;  3OXL A;  4J8E A;  4ME2 A;  4J8D A;  3AS8 A;  3RJV A;  3VTX A;  1B89 A;  4N2S A;  5JJT A;  3AS4 A;  4GYY A;  4WND A;  4UQZ A;  4HOS A;  3LPZ A;  2C0M A;  1ZU2 A;  5FTP A;  3PE3 A;  4G2V A;  5ARF A;  5FT9 A;  3QWV A;  1E96 B;  4U0U A;  4B94 A;  2LSV A;  4I17 A;  2J9Q A;  3FWV A;  1NA3 A;  1KLX A;  2XEV A;  3Q15 A;  2IFU A;  4I9E A;  5BNW A;  3MKR A;  5KJK A;  4WNF A;  4Y6W A;  4U0S A;  3KAE A;  2DBA A;  2PQR A;  3OXF A;  3RO2 A;  4EQF A;  4UI9 C;  4G26 A;  1ZBP A;  1WAO 1;  1NA0 A;  3FFL A;  2VGY A;  4HOT A;  3CVL A;  5DIZ A;  3ASF A;  3MV2 B;  2P58 C;  4N5C A;  5FJY A;  3TG4 A;  1QQE A;  4N39 A;  3K9I A;  3R9A B;  3ZN3 A;  4KYO B;  4KBQ A;  4ABN A;  2FO7 A;  3O48 A;  2FF4 A;  4RG6 A;  2OOE A;  3SF4 A;  3QOU A;  4U04 A;  2XPI A;  4UQY A;  4G23 A;  5JJ7 A;  4YND A;  2UY1 B;  3N71 A;  4GA1 A;  4CGV A;  5M72 A;  3TGO A;  5DBK A;  5A7D B;  4HOR A;  4H7Y A;  4HOQ A;  5EKQ D;  4AM9 A;  3UQ3 A;  4UI9 K;  3GZ1 A;  2Y4T A;  3HYM B;  3S7F A;  1FCH A;  3RU0 A;  3S7B A;  5G05 J;  2HR2 A;  1OUV A;  5KJL A;  3Q5M A;  4BWR A;  3KD7 A;  2I6H A;  3IEG A;  5G04 C;  4GCO A;  4APO A;  1P5Q A;  2UWJ G;  3QKY A;  4I9C A;  3ESK A;  5FZR A;  3MEK A;  1ELR A;  3RKV A;  2FBN A;  4I1A A;  5G05 C;  1HXI A;  4GCN A;  2VSY A;  4GZ6 A;  2IF4 A;  3PDN A;  3UUX A;  3ASD A;  4KXK B; 
#chains in the Genus database with same CATH topology
 2CFU A;  3VLE A;  2FEZ A;  1N4Q A;  3I5P A;  3TG5 A;  2Q7F A;  4BT8 A;  5LCW J;  1UG3 A;  4LNG A;  3LVR E;  4KT6 B;  3NOG D;  3JUI A;  3AG4 E;  5LX8 A;  4FHJ A;  3CVX A;  3Q47 B;  5D0O D;  2L0I A;  4ACL A;  4HI9 A;  2PL2 A;  1N4R A;  5ENO D;  3ZGQ A;  4J8S A;  5A6C A;  2KC7 A;  2VTB B;  5AQA A;  2C0L A;  1JWF A;  2ZGD A;  3FUH A;  3CVP A;  3LXU X;  5D0Q D;  2UY1 A;  2CFZ A;  3T5X A;  2C2L A;  4V3I A;  2CHW A;  3ABM E;  3HXC A;  3R7R A;  2MOW A;  3ZNG A;  2I2O A;  3E34 A;  4G8L A;  5AYW D;  3JYS A;  1RZ4 A;  3FTS A;  1PY1 A;  3ZVV A;  5KCM A;  2AJA A;  2OVB A;  2IOL A;  4CT0 A;  1OCR E;  5KJN A;  3ZYQ A;  3MX3 A;  2L9B A;  4OVU A;  3ML8 A;  1X5B A;  2LNI A;  4HXI A;  2QYJ A;  4U07 A;  1HZ4 A;  2J49 A;  3PVL A;  3QK0 A;  2J09 A;  4HS2 A;  1N4S A;  2P2C P;  3S7D A;  2KCV A;  3MZL B;  4YVQ C;  3C5R A;  4BX9 A;  4Q69 A;  2E2E A;  3RRN B;  3ZIM A;  1MQS A;  1D8D A;  2VQ2 A;  3S7J A;  3IKO B;  2OEW A;  3D9H A;  4AIF A;  5FWQ A;  3Q7F A;  3LJ3 A;  2BKK B;  3FUF A;  4EEC A;  5CBN A;  2F8Y A;  2BF0 X;  2LSU A;  2ION A;  3GYZ A;  4QQI A;  3JQ1 A;  3T5V A;  2AW6 A;  3D9I A;  4N3A A;  3SGH A;  4D10 C;  3R9M A;  2J8S D;  3MJW A;  2X6H A;  4TUU A;  4BTA A;  3ISM C;  3QWW A;  5HKP A;  2KZT A;  2PZI A;  5CRV A;  3ULE G;  3AG3 E;  4ILG A;  3OAW A;  1WY6 A;  3LDZ A;  3URZ A;  3AAA C;  4EZJ A;  3ASN E;  2DCP A;  4F53 A;  4BT9 A;  3PZ3 A;  3U4T A;  5EIL A;  4HOU A;  2ZXW E;  4WWP A;  3ENE A;  3QDN A;  3ZFW A;  4TUM A;  2QC9 A;  4DX2 A;  3TXM A;  3TWX A;  1MYO A;  3UX4 A;  2EQX A;  3Q49 B;  4Q96 A;  2R03 A;  2V8S E;  3CSF A;  3OTN A;  4BER A;  3EHM A;  3D9L A;  3FUL A;  3CR3 A;  4B8C B;  1D8E A;  3MKQ B;  2WM9 A;  5AN8 A;  3VLD A;  3LY7 A;  3ZRH A;  2EIM E;  5ANL A;  1GW6 A;  4GA0 A;  3TWR A;  1VDY A;  3ZEF A;  3ZYK A;  4A3V A;  5C1D A;  3CKB A;  3UKR G;  4F1S A;  1ELW A;  4I2Z A;  5FQ4 A;  4DX6 D;  3C3Q A;  1QNF A;  4ACK A;  3FH5 A;  1HG2 A;  1XNF A;  2AVP A;  2GW1 A;  2WQ7 A;  1N4P A;  1PC2 A;  3CVN A;  4B93 B;  3OXL A;  3NOC D;  3APD A;  1N9A A;  4ME2 A;  4J8D A;  3AS8 A;  1B89 A;  5EYL A;  3JCK C;  3Q9U C;  3LJN A;  3QAQ A;  3G2T A;  1E8W A;  4FHK A;  4JPS A;  5ITZ F;  2C0M A;  1ZU2 A;  3AG2 E;  4G2V A;  3L82 A;  3CHM A;  1E96 B;  1MX2 A;  4U0U A;  3SFX A;  1HG5 A;  4JHJ A;  3FUM A;  3UIP C;  2PM7 A;  4DI3 A;  4OAU C;  1SQM A;  2XEV A;  3PZ2 A;  4ATZ D;  2WQ6 A;  5KJK A;  3X2Q E;  4WNF A;  4KVM A;  3HXE A;  3Q78 A;  3BQO A;  4Y6W A;  2AXV A;  4L7T A;  2BTD A;  2DYS E;  4EQF A;  1BU9 A;  1A5E A;  5CMY A;  2Y1L E;  4OAV B;  3EHQ A;  2HM8 A;  1H6K A;  1QYM A;  3EU5 A;  4P29 A;  4OVV A;  3FH8 A;  4RSY A;  3ZN3 A;  1UW4 B;  2FO7 A;  3O48 A;  1LF8 A;  4GZD A;  2YIN A;  2P9N G;  2M63 A;  4EPZ A;  2ETB A;  3ABK E;  3FU3 A;  3DSW A;  2B0O E;  1JUQ A;  2LAI A;  4CCA A;  3SBS A;  1N11 A;  4J6I A;  1EDU A;  4MS6 A;  4JZY A;  1TNZ A;  4URK A;  5DBK A;  3KEZ A;  4FC8 A;  1NI1 A;  3P2B A;  4A3T A;  4Q94 A;  2DYR E;  1Y6I A;  3ZU7 B;  2FUL A;  4GTS A;  2GRL A;  2J07 A;  5AAR A;  4GTT A;  1V55 E;  5G05 J;  2HR2 A;  3Q5M A;  3IEG A;  4APO A;  4KVO A;  1H0A A;  4DK5 A;  1INZ A;  3CHS A;  5FZR A;  3MEK A;  3RKV A;  2FBN A;  4GZ6 A;  5T4Y A;  1SVX A;  4LCT A;  4ANW A;  2Y4U A;  5KJM A;  3FHE A;  3FUK A;  1Z6T A;  5EN5 D;  3B95 A;  1HX8 A;  3G2S A;  2EIK E;  2CHX A;  3CK9 A;  3PRZ A;  3FTV A;  4RQI A;  5ENT D;  3SBT B;  2V5Q C;  1AP7 A;  4G25 A;  4BFR A;  3L6A A;  4XIF A;  3UPV A;  3SY2 A;  3OXG A;  2P9K G;  4C48 B;  4GTV A;  2XZD G;  3PZD A;  2LXM A;  1OXJ A;  2HE0 A;  1YA0 A;  2H6H A;  4JXT A;  4AOF A;  1N0R A;  1SA4 A;  4K5B A;  1TJC A;  1TNB A;  3TWU A;  3IHY A;  2NXP A;  1S0P A;  2YQ8 A;  1JCQ A;  4FLH A;  3EUV A;  1IXV A;  1K3Z D;  4GTP A;  3V30 A;  1OWL A;  4O6F A;  4G11 A;  2QFC A;  3SZ7 A;  5BXU A;  4ANX A;  3EJN A;  1UJK A;  5BV1 A;  5G04 J;  4ZHB A;  4GAA A;  3FTU A;  5BV0 A;  3LS8 A;  4BY6 A;  3T9K A;  4RG9 A;  3ZKJ A;  3FTX A;  4LEU A;  4AXH A;  3RIB A;  4E6H A;  3AU5 A;  4O1O A;  3RK6 A;  1KZP A;  5JJ6 A;  4JA9 A;  1UJJ A;  3IHV A;  4JVS A;  3HHM A;  4LRZ A;  3UIO C;  2WXP A;  2YHC A;  2R2L A;  5FQ8 A;  3ASO E;  4CDR A;  2FO1 E;  5CEC B;  4XI9 A;  2VTB A;  4N3C A;  1X81 A;  3W9F A;  2EIL E;  2KAT A;  3D9K A;  1OCZ E;  1UN8 A;  2XPZ A;  2RKK A;  3SHF A;  5BW8 C;  1JWG A;  3E37 A;  3D9J A;  4HBD A;  3V2O A;  1SZA A;  3FP3 A;  1IQU A;  1Z3X A;  4JL0 A;  1MJ0 A;  2IU1 A;  4ANV A;  3TJP A;  4R7L A;  1YYH A;  1ZB1 A;  4UWK A;  2WXH A;  3KEA A;  2LUH A;  2KM4 A;  2NC9 A;  2L6J A;  2Y3A A;  3FU0 A;  4CT4 A;  2A5U A;  2P9L G;  3J5Q B;  4LG6 A;  1W3B A;  2VYI A;  2YHE A;  2P9S G;  3FDH A;  1NP7 A;  1UOH A;  4AV7 A;  2KCK A;  1OT8 A;  3FU6 A;  5B3S E;  1OWM A;  1TNU A;  4F6R D;  3ML9 A;  5CMW A;  3APF A;  2QZA A;  1HH8 A;  1IYG A;  3UT7 A;  1E8Z A;  1Q2Z A;  4G24 A;  4B8A A;  4UQX A;  1LD7 A;  5CCL A;  1LD8 A;  3HIZ A;  3MCX A;  1JPL A;  2XZT G;  1OWO A;  2WMO A;  2GRM A;  3CVU A;  1NZN A;  1BD8 A;  3L13 A;  2EIJ E;  2X3M A;  2XRY A;  1E90 A;  2LO6 A;  4L9P A;  4AY6 A;  2A4Z A;  1O1R A;  2XS1 A;  1SA5 A;  1N54 A;  4I2W A;  4C9B B;  4CEM A;  4HVB A;  4J8E A;  3FEY A;  3HXB A;  3RJV A;  2VSO E;  4N2S A;  3AS4 A;  4GYY A;  4WND A;  4XEI G;  4HOS A;  3HXD A;  2IOS A;  3LPZ A;  5FTP A;  3L17 A;  5ARF A;  1N0Q A;  4ZFH A;  5AIJ A;  3B7S A;  4I17 A;  2J9Q A;  4U7E B;  5BPP A;  4I1O B;  4EBA G;  4G8K A;  2F37 A;  3AG1 E;  1G3N B;  1DCE A;  2P9U G;  4KMO A;  4TXP A;  3KAE A;  3MKQ A;  5E76 A;  1S63 A;  4FAD A;  1O5M A;  2DBA A;  3OXF A;  3RO2 A;  3B13 A;  4FLB A;  1H6P A;  4YDO A;  4HLE A;  1H19 A;  3G2W A;  1EF1 C;  2RD0 A;  1ZBP A;  1NA0 A;  1SZ9 A;  3FUJ A;  5KBA A;  4HOT A;  5FQ6 A;  1DVP A;  3SO8 A;  5DIZ A;  4GTQ A;  3MV2 B;  2P58 C;  5FJY A;  3TG4 A;  5G55 A;  1QQE A;  4N39 A;  3L08 A;  4FP7 A;  1L5J A;  1N94 A;  3CVW A;  3GZS A;  2YNQ A;  4RLY A;  4PS7 A;  3DSU A;  4ABN A;  2XEH A;  4O60 A;  4I6E A;  4U8V D;  2OOE A;  2J4D A;  3QOU A;  4TV3 A;  1DC2 A;  4U04 A;  3U66 A;  1MX6 A;  2F0Y A;  3ZXS A;  5FQ7 A;  3FTW A;  4HI8 A;  2LXL A;  4AVX A;  5JJ7 A;  2IQC A;  4YND A;  1EYH A;  3TWW A;  4H7Y A;  4HOQ A;  4AM9 A;  3W9G A;  2EIN E;  1BI8 B;  4UI9 K;  3HYM B;  1MX4 A;  4TXR A;  2WXL A;  3RU0 A;  4BET A;  3S7B A;  3C3O A;  3FY4 A;  2QY7 A;  4PS3 A;  1OUV A;  2AXZ A;  3TWS A;  4BWR A;  2I6H A;  1E8X A;  3Q79 A;  4PDX A;  1TNO A;  2X6K A;  3QJZ A;  3TWV A;  1ELR A;  2DIW A;  3PS6 A;  4C0M A;  3JXJ A;  4XE0 A;  1AWC B;  2VSY A;  2IF4 A;  2I1K A;  1JCS A;  4E85 A;  5ENP D;  3PRE A;  1MHQ A;  3EU9 A;  3PE4 A;  3ZHE B;  3ASG A;  4G1T A;  4UI9 J;  3D9M A;  5ANR A;  3BG1 B;  5CHE E;  4DLQ A;  3MA5 A;  4NRH B;  2L6B A;  4KZ0 A;  3B7B A;  2HYZ A;  2WVI A;  4NAC A;  2V4L A;  4BEP A;  3CST A;  2IJG X;  5AJD A;  2J4B A;  3CK8 A;  1BLX B;  2OND A;  3PNL B;  3U3W A;  4GML A;  4HRM B;  2ILR A;  3PZ1 A;  4BSX A;  3S2A A;  3IBE A;  4GYW A;  1BI7 B;  2DZO A;  3LEW A;  4GTR A;  4K5C A;  4NQ0 A;  2DZN A;  4WUY A;  3LY8 A;  4XI0 A;  2OEV A;  2KXP C;  3DSX A;  4XKB A;  4AP2 A;  4YDY A;  3PH0 C;  2GRQ B;  1QZ2 A;  2PM6 A;  3TAX A;  2V0P A;  3V2X A;  3MGB A;  3AS5 A;  1D9S A;  1TN6 A;  3L22 A;  3ULQ A;  4K03 A;  2RFA A;  5EIB E;  5T3R A;  4XZ4 A;  2WXR A;  2R5S A;  4WAF A;  2NSZ A;  3RRU A;  3CHQ A;  4CDN A;  3CVV A;  3QAR A;  3SD5 A;  3C72 A;  2VGX B;  1K1A A;  2X6F A;  2GRR B;  2I1J A;  3E4B A;  4CYM D;  3PNT B;  2PQN A;  4A1G A;  4L1B A;  4UWG A;  4PH4 B;  1TN8 A;  1Z3Y A;  2H6F A;  3O4Z A;  3DEO A;  2WXQ A;  3Q75 A;  1YCS B;  5HQ8 A;  4A1S A;  1BPO A;  2R02 A;  2PNN A;  4X8Q A;  2KCL A;  4DLO A;  4HRL A;  4LNB A;  4GPK A;  3HVE B;  2BUG A;  3JUE A;  1XGW A;  4EHM A;  4U8H A;  4U8Y D;  2HO1 A;  3PEU B;  1Y8M A;  4MBG A;  3APC A;  3KSQ A;  4FU3 A;  3PUK A;  4F1P A;  3UI2 A;  2P9P G;  2MYO A;  4I6J A;  2JEK A;  5BT1 A;  3JXI A;  4Y6C A;  1H6O A;  2V4H C;  5FZS A;  3DSS A;  2VGE A;  3KSL A;  4N3B A;  3NZS A;  2MRI A;  4UWL A;  4N2Q A;  4J8F A;  1KT1 A;  2P9I G;  4WNG A;  2VSN A;  4GA2 A;  4J7W A;  3DPD A;  3TXN A;  4U0Z A;  3CVQ A;  1IHG A;  2R59 A;  3FUI A;  4CGW A;  3ZPJ A;  5EYP F;  4HQD A;  1E7V A;  4ANU A;  1OWP A;  2XHE A;  4GZ3 A;  1H2T C;  3DPY A;  4DX7 D;  2B6C A;  3MYV A;  3QWP A;  3FUE A;  1N95 A;  3KS2 A;  3CV0 A;  4CDM A;  3FEX A;  4GTM A;  3DXM G;  4W9R A;  1LTX A;  5JMN D;  3I4G A;  4N5Q A;  4GYO A;  3BU8 A;  3VTY A;  3BEE A;  4LSZ E;  5EID A;  5HS0 A;  5JHB A;  3BG0 B;  2JAB A;  4EBA A;  3GW4 A;  4EZK A;  3PZ4 A;  3D9O A;  3AJI A;  1H2U A;  4C0E A;  5JJT A;  5KNH D;  2QYU A;  4I43 A;  4XKC A;  5FIO A;  3ZW3 A;  3PE3 A;  3UTM A;  3TWT A;  4YDW A;  2ZU6 B;  1E8Y A;  3UXG A;  4BX8 A;  1EPU A;  5LFA A;  1TNY A;  5CRU A;  2IO3 C;  1KLX A;  2I9C A;  3C98 A;  5D2M C;  3Q15 A;  3SFY A;  5D66 A;  4HRN A;  3C3R A;  4GPM A;  5KNG A;  2OV8 A;  4Z68 A;  3CHR A;  5T8I A;  4DI4 A;  1TYQ G;  3FU5 A;  2GRO B;  1HS6 A;  3IXE A;  3F6Q A;  5HRY A;  2X6I A;  1WG0 A;  4U95 D;  4G26 A;  4M3O A;  5B1B E;  2BKG A;  4NIK A;  3V79 K;  4GMJ A;  2ETA A;  3CVL A;  3ASF A;  4N5C A;  4HNA D;  3Q7A A;  3CLJ A;  3B7T A;  1S64 A;  3R9A B;  4K5A B;  1S70 B;  4BSZ B;  4JHK A;  5AEN A;  4KBQ A;  5KWD A;  2R17 C;  3T8M A;  4RG6 A;  2XPY A;  4DPR A;  3SF4 A;  1IHB A;  3SNX A;  4OYS A;  2XPI A;  2H6I A;  4UQY A;  4RVB A;  4G23 A;  3ZYM A;  2UY1 B;  4DJA A;  5ENQ D;  4GA1 A;  2WXM A;  1U2V G;  3TGO A;  2WXG A;  5IY5 E;  3QNK A;  5A7D B;  5B1A E;  5AQ7 A;  1N52 A;  3D9P A;  3ULY A;  3UQ3 A;  2RFM A;  4DX1 A;  1NL4 A;  1OY3 D;  3S7F A;  4YDE A;  3FTZ A;  1OCO E;  4I1M A;  3ONL A;  3KD7 A;  1Z5S C;  5G04 C;  4JEH A;  4GCO A;  5LP0 A;  5ENS D;  5AQ9 A;  4I9C A;  4BES A;  4I1A A;  1HXI A;  2L0T B;  3NQP A;  1HU3 A;  4GCN A;  4WWN A;  4JEU A;  3ZYL A;  2WXF A;  3I4R B;  4TXQ A;  4PS8 A;  4GTO A;  4JA7 A;  5E75 A;  2XGO A;  2OVF A;  3CHO A;  1IKN D;  1MZC A;  3FUD A;  4UWH A;  3HG0 D;  5CEA A;  1FVH A;  4H7X A;  4A63 B;  2CG2 A;  2RG8 A;  2Y69 E;  2XQ0 A;  2H6G A;  5HI7 A;  2XGM A;  3ASH A;  5LCW C;  1HE8 A;  3CK7 A;  3E33 A;  3HXF A;  3RO3 A;  4QFV A;  4KZC A;  1A17 A;  4JW1 A;  1QBQ A;  3B7R L;  5G2N A;  4GB9 A;  3Q73 A;  5AAO A;  3DSV A;  3ABL E;  2WPV A;  3L16 A;  3TWQ A;  2KZT B;  3UT4 A;  2IEJ A;  2J08 A;  4LNU D;  2DWZ A;  4L2L A;  3DEP A;  1HF8 A;  2XCB A;  3LVQ E;  2FI7 A;  4ILH B;  1HO8 A;  4AY5 A;  3SFZ A;  4ATG A;  4WWO A;  3U64 A;  4GU5 A;  4JC8 A;  3FH7 A;  4J0U A;  5ENR D;  2F8X K;  4DRX E;  4K0R A;  3D9N A;  2ETC A;  4U96 D;  2X38 A;  1TR4 A;  2XS8 A;  2ZGG A;  2WXO A;  2WQH A;  3DST A;  5FZQ A;  1WDY A;  2VJ8 A;  1U3D A;  3LYA A;  4IUL A;  3E30 A;  3WXX A;  1JCR A;  4GZ5 A;  2XCC A;  1TJF A;  3NF1 A;  2R05 A;  3LKU A;  4LUN U;  2JLB A;  2GGF A;  3ZHE A;  5CCM A;  3LY9 A;  4FA6 A;  2MHK A;  4BTB A;  3CGH A;  1U3C A;  3LCA A;  4EZL A;  5AJL A;  1OCC E;  5EX0 A;  2GRP B;  5ARG A;  4IN3 B;  3UIN C;  5EX3 A;  4JD2 G;  3UM1 A;  2NYJ A;  4YVO A;  4TRQ A;  4DX5 D;  3HDX A;  1K1B A;  1H2V C;  4AJW A;  5EDS A;  2ZIS A;  3AU4 A;  5H7P A;  4J8Y A;  4O1P A;  3DWL G;  3G2V A;  3NAW A;  4APF A;  3CIA A;  3P1U A;  3SQV A;  1FVF A;  4WNE A;  3TL5 A;  3I3N A;  2XGS A;  3GZ2 A;  3IV0 A;  2Y0B G;  1KT0 A;  3DRA A;  4FJY A;  1E7U A;  4LER A;  3UM2 A;  1UN9 A;  3B7U X;  1NFI E;  3Q4A B;  3HRA A;  5FIN A;  3CKC A;  3WG7 E;  3E32 A;  3EDT B;  2CG3 A;  2XRZ A;  4F3V A;  2X6J A;  3NZU A;  2XEE A;  3J5P A;  3VLF A;  4M7C A;  3CEQ A;  4CRW A;  3R7Q A;  1WM5 A;  3CVY A;  2V5F A;  5AQB A;  2VGX A;  4B89 A;  1KZO A;  4UWF A;  5CED B;  2WB2 A;  5JA4 D;  5CBO A;  1IQR A;  5C2Y A;  4B0Z A;  1RW2 A;  3UT8 A;  5A23 A;  4JHR A;  3MV3 B;  3QC1 A;  3UKU G;  2AWI A;  3FUN A;  3HVE A;  3EIQ C;  1V54 E;  5BXO A;  3L54 A;  3VTX A;  4HLL A;  5JHA A;  2WMN A;  2GRN B;  4AEZ C;  3UM3 A;  4UQZ A;  1O1T A;  3EHR A;  5FT9 A;  1O1S A;  3QWV A;  4XX5 A;  4B94 A;  2LSV A;  4I6G A;  2WXI A;  3V31 A;  5J90 A;  3FWV A;  1DNP A;  3CHP A;  4NUR A;  1NA3 A;  2DVW A;  2IFU A;  4I9E A;  3UM0 A;  3L9T A;  5BNW A;  3ONK A;  3NB2 A;  4MLP A;  1FPP A;  3MKR A;  3RRM B;  3EIJ A;  1DCQ A;  2A5E A;  4HFG A;  4CZ2 D;  4ILI A;  3ESL A;  4MKT A;  4U0S A;  2WXN A;  4L23 A;  1YMP A;  2IO2 C;  3G2U A;  2PQR A;  3DXK G;  4U63 A;  4GZC A;  2ZIR A;  3Q9N C;  4UI9 C;  1TN7 A;  3BUA A;  1K8K G;  5CER B;  3EHN A;  1WAO 1;  3FFL A;  5ENN A;  2VGY A;  1HFA A;  3CQG B;  3K9I A;  4L2Y A;  2KBX A;  4UUC A;  4GMR A;  4A55 A;  4KYO B;  3SI5 A;  2LAH A;  4PUC A;  1SW6 A;  4FJZ A;  2FF4 A;  2IY0 C;  3UMV A;  2WXK A;  3QB2 A;  1PAQ A;  2AXU A;  4FUL A;  4JB8 P;  4IRU A;  1TEZ A;  4HB5 A;  2CHZ A;  3RSE G;  3N71 A;  5LOZ A;  1FT1 A;  3ZXP A;  4CGV A;  5J08 A;  3RAU A;  2XEN A;  5M72 A;  1KPS B;  2OCC E;  4HOR A;  3PUJ A;  5EKQ D;  3T8K A;  1ELK A;  3GZ1 A;  2Y4T A;  1FT2 A;  1FCH A;  4MRU A;  3PEV B;  2E0I A;  3DBS A;  3JQ0 A;  3NBN B;  5KJL A;  4IYP A;  2BED A;  2VSX E;  1P5Q A;  2UWJ G;  3QKY A;  3FTY A;  3ESK A;  5BUZ A;  5G05 C;  3U9W A;  4DUI A;  3ZUV B;  4F7A A;  1OWN A;  3PDN A;  3UUX A;  3ASD A;  3D3M A;  4KXK B;  3CQC B;  2WXJ A; 
#chains in the Genus database with same CATH homology
 3PE4 A;  4LCT A;  4ANW A;  4JA7 A;  2Y4U A;  2CFU A;  5E75 A;  3VLE A;  5KJM A;  2FEZ A;  3I5P A;  3TG5 A;  2XGO A;  2Q7F A;  3FHE A;  3FUK A;  3ZHE B;  1Z6T A;  2OVF A;  4BT8 A;  1UG3 A;  3ASG A;  1HX8 A;  3CHO A;  3G2S A;  2CHX A;  3FUD A;  4G1T A;  3CK9 A;  4UI9 J;  4UWH A;  3LVR E;  4KT6 B;  3PRZ A;  3JUI A;  3FTV A;  1FVH A;  3SBT B;  4H7X A;  3D9M A;  5ANR A;  2CG2 A;  2RG8 A;  4FHJ A;  3Q47 B;  5D0O D;  2L0I A;  4G25 A;  4ACL A;  5LX8 A;  3CVX A;  2PL2 A;  2XQ0 A;  3BG1 B;  4BFR A;  5HI7 A;  2XGM A;  3ASH A;  5CHE E;  3L6A A;  4DLQ A;  1HE8 A;  4XIF A;  5LCW C;  3UPV A;  3MA5 A;  3CK7 A;  3RO3 A;  3ZGQ A;  4J8S A;  4NRH B;  2KC7 A;  4KZ0 A;  5A6C A;  4QFV A;  2VTB B;  4KZC A;  1A17 A;  4JW1 A;  2HYZ A;  3B7R L;  5G2N A;  3OXG A;  2WVI A;  4NAC A;  2C0L A;  4GB9 A;  2V4L A;  1JWF A;  3FUH A;  3CST A;  3PZD A;  2WPV A;  2IJG X;  5AJD A;  2J4B A;  3L16 A;  3CVP A;  1YA0 A;  3LXU X;  4JXT A;  5D0Q D;  4AOF A;  3CK8 A;  2KZT B;  3UT4 A;  2OND A;  2UY1 A;  3PNL B;  3U3W A;  2CFZ A;  3T5X A;  1TJC A;  2C2L A;  4GML A;  2ILR A;  4V3I A;  2CHW A;  2J08 A;  4BSX A;  3S2A A;  3IBE A;  4L2L A;  3R7R A;  2MOW A;  1HF8 A;  3IHY A;  2XCB A;  4GYW A;  3LVQ E;  2FI7 A;  2NXP A;  4ILH B;  1S0P A;  1HO8 A;  2I2O A;  5AYW D;  2YQ8 A;  3JYS A;  4AY5 A;  3SFZ A;  4ATG A;  3FTS A;  3LEW A;  4NQ0 A;  4WWO A;  3U64 A;  4WUY A;  3LY8 A;  4GU5 A;  4FLH A;  4XI0 A;  4JC8 A;  1PY1 A;  3ZVV A;  4XKB A;  3FH7 A;  5KCM A;  4AP2 A;  4J0U A;  3PH0 C;  4K0R A;  3D9N A;  2OVB A;  2IOL A;  1QZ2 A;  2PM6 A;  3TAX A;  4CT0 A;  5KJN A;  2X38 A;  1OWL A;  2V0P A;  4O6F A;  3MX3 A;  4G11 A;  3ZYQ A;  2L9B A;  4OVU A;  3ML8 A;  2WXO A;  1X5B A;  2WQH A;  2QFC A;  2LNI A;  3SZ7 A;  4HXI A;  3MGB A;  5FZQ A;  3AS5 A;  2VJ8 A;  4ANX A;  4U07 A;  1HZ4 A;  3EJN A;  1UJK A;  2J49 A;  3L22 A;  3PVL A;  3QK0 A;  2J09 A;  4HS2 A;  5G04 J;  5BV1 A;  1U3D A;  3LYA A;  3S7D A;  4IUL A;  4GAA A;  2KCV A;  3FTU A;  3ULQ A;  4K03 A;  3MZL B;  4YVQ C;  5T3R A;  4XZ4 A;  2WXR A;  5BV0 A;  3WXX A;  4BX9 A;  2R5S A;  4WAF A;  2NSZ A;  3LS8 A;  3CHQ A;  3RRU A;  4BY6 A;  4CDN A;  4Q69 A;  2E2E A;  3RRN B;  4GZ5 A;  2XCC A;  3ZIM A;  3QAR A;  3CVV A;  1TJF A;  3NF1 A;  3SD5 A;  1MQS A;  4RG9 A;  3LKU A;  2VGX B;  2VQ2 A;  3S7J A;  3IKO B;  2X6F A;  4LUN U;  2JLB A;  3FTX A;  4LEU A;  2I1J A;  2GGF A;  3E4B A;  3ZHE A;  4AXH A;  3RIB A;  4E6H A;  5CCM A;  3LY9 A;  3AU5 A;  4FA6 A;  2MHK A;  3PNT B;  3RK6 A;  2PQN A;  4AIF A;  4BTB A;  3CGH A;  1U3C A;  5FWQ A;  5JJ6 A;  3LCA A;  4JA9 A;  4L1B A;  4PH4 B;  1UJJ A;  3IHV A;  4UWG A;  1Z3Y A;  5AJL A;  4EZL A;  4JVS A;  3HHM A;  3O4Z A;  3LJ3 A;  2WXQ A;  4LRZ A;  3FUF A;  4EEC A;  5EX0 A;  2WXP A;  5HQ8 A;  2YHC A;  2BF0 X;  2LSU A;  2ION A;  5FQ8 A;  3GYZ A;  5ARG A;  4A1S A;  4CDR A;  3JQ1 A;  1BPO A;  3PRE A;  2AW6 A;  4IN3 B;  5EX3 A;  3D9I A;  3T5V A;  4XI9 A;  2VTB A;  2KCL A;  4N3C A;  4DLO A;  4YVO A;  4N3A A;  4TRQ A;  3SGH A;  4GPK A;  2KAT A;  4D10 C;  3D9K A;  3HVE B;  3HDX A;  2BUG A;  1H2V C;  1UN8 A;  2XPZ A;  3SHF A;  4AJW A;  5EDS A;  5BW8 C;  3AU4 A;  1XGW A;  1JWG A;  3MJW A;  4U8H A;  2X6H A;  4TUU A;  2HO1 A;  3D9J A;  3PEU B;  4BTA A;  3QWW A;  1Y8M A;  3APC A;  3G2V A;  1SZA A;  3FP3 A;  2KZT A;  4FU3 A;  1IQU A;  4APF A;  2PZI A;  3PUK A;  1Z3X A;  4ILG A;  3CIA A;  3P1U A;  3OAW A;  1FVF A;  1WY6 A;  4JL0 A;  2IU1 A;  4WNE A;  4ANV A;  3LDZ A;  3TL5 A;  3URZ A;  3I3N A;  3TJP A;  2XGS A;  4I6J A;  3GZ2 A;  2JEK A;  3IV0 A;  5BT1 A;  4EZJ A;  4R7L A;  4Y6C A;  2DCP A;  5FZS A;  4F53 A;  1KT0 A;  4BT9 A;  3U4T A;  4UWK A;  2WXH A;  4FJY A;  4HOU A;  1E7U A;  4LER A;  2KM4 A;  2NC9 A;  1UN9 A;  2L6J A;  4N3B A;  2Y3A A;  2MRI A;  3NZS A;  4UWL A;  4WWP A;  3FU0 A;  4N2Q A;  4J8F A;  3B7U X;  3Q4A B;  1KT1 A;  3ENE A;  4CT4 A;  3QDN A;  4WNG A;  3ZFW A;  2A5U A;  2VSN A;  3TXM A;  4GA2 A;  3DPD A;  3TXN A;  4U0Z A;  1W3B A;  2VYI A;  3CVQ A;  3UX4 A;  1IHG A;  2R59 A;  2EQX A;  3CKC A;  3Q49 B;  3FUI A;  2V8S E;  4Q96 A;  3CSF A;  2YHE A;  4CGW A;  3FDH A;  3OTN A;  3ZPJ A;  1E7V A;  1NP7 A;  3EHM A;  4ANU A;  1OWP A;  2XHE A;  2CG3 A;  3D9L A;  3EDT B;  1H2T C;  2KCK A;  3FUL A;  4GZ3 A;  4AV7 A;  4F3V A;  3FU6 A;  2XRZ A;  2X6J A;  3CR3 A;  4B8C B;  3NZU A;  3MKQ B;  1OWM A;  2WM9 A;  3ML9 A;  5CMW A;  3VLD A;  3APF A;  3LY7 A;  3ZRH A;  3VLF A;  5ANL A;  3CEQ A;  1HH8 A;  3MYV A;  3QWP A;  1GW6 A;  1WM5 A;  3R7Q A;  3UT7 A;  4CRW A;  1IYG A;  1E8Z A;  3CVY A;  2V5F A;  3FUE A;  3KS2 A;  4G24 A;  1VDY A;  4GA0 A;  3CV0 A;  3ZEF A;  3ZYK A;  4A3V A;  4B8A A;  4CDM A;  4UQX A;  5C1D A;  2VGX A;  4B89 A;  3CKB A;  5CCL A;  4F1S A;  1ELW A;  3FEX A;  4I2Z A;  4UWF A;  5FQ4 A;  3HIZ A;  2WB2 A;  3MCX A;  1QNF A;  1JPL A;  4ACK A;  1OWO A;  2WMO A;  4W9R A;  3FH5 A;  2GRM A;  1IQR A;  3CVU A;  1HG2 A;  1NZN A;  5LCW J;  3I4G A;  1XNF A;  2AVP A;  4GYO A;  2GW1 A;  3L13 A;  5C2Y A;  2X3M A;  4B0Z A;  2XRY A;  2WQ7 A;  1E90 A;  3VTY A;  3BEE A;  3UT8 A;  5A23 A;  1PC2 A;  4JHR A;  2LO6 A;  4AY6 A;  3CVN A;  3MV3 B;  4A1G A;  3QC1 A;  2A4Z A;  2AWI A;  3FUN A;  3HVE A;  3BG0 B;  5JHB A;  3EIQ C;  1N54 A;  4I2W A;  4EBA A;  4C9B B;  3GW4 A;  3OXL A;  4CEM A;  3APD A;  4EZK A;  4HVB A;  4J8E A;  3D9O A;  3FEY A;  4ME2 A;  3L54 A;  4J8D A;  3AS8 A;  3RJV A;  3VTX A;  1H2U A;  4C0E A;  1B89 A;  2VSO E;  5JHA A;  3JCK C;  4N2S A;  5JJT A;  2WMN A;  3AS4 A;  4GYY A;  3QAQ A;  3G2T A;  1E8W A;  4I43 A;  4WND A;  4FHK A;  4JPS A;  4XKC A;  4AEZ C;  4UQZ A;  3ZW3 A;  4HOS A;  2IOS A;  3LPZ A;  2C0M A;  1ZU2 A;  5FTP A;  3PE3 A;  4G2V A;  3L17 A;  5ARF A;  5FT9 A;  3CHM A;  5AIJ A;  3QWV A;  1E96 B;  3B7S A;  4XX5 A;  4U0U A;  4B94 A;  2LSV A;  2ZU6 B;  1E8Y A;  4I17 A;  1HG5 A;  2J9Q A;  5BPP A;  4JHJ A;  3FUM A;  4I6G A;  2WXI A;  2PM7 A;  4I1O B;  5J90 A;  3FWV A;  1DNP A;  4BX8 A;  3CHP A;  1EPU A;  4DI3 A;  5LFA A;  4NUR A;  4EBA G;  1NA3 A;  1SQM A;  1KLX A;  2I9C A;  3C98 A;  2XEV A;  3Q15 A;  2IFU A;  4I9E A;  5BNW A;  3ONK A;  4MLP A;  3MKR A;  3RRM B;  3EIJ A;  2WQ6 A;  5KJK A;  2OV8 A;  4WNF A;  4KVM A;  4HFG A;  3CHR A;  5T8I A;  4PS8 A;  4Y6W A;  4KMO A;  2AXV A;  4ILI A;  4L7T A;  3ESL A;  4MKT A;  4DI4 A;  3FU5 A;  4U0S A;  3KAE A;  3MKQ A;  1HS6 A;  2WXN A;  4L23 A;  5E76 A;  4FAD A;  2DBA A;  3G2U A;  2PQR A;  2BTD A;  3OXF A;  3RO2 A;  4EQF A;  4U63 A;  4GZC A;  3B13 A;  4FLB A;  2X6I A;  5CMY A;  4UI9 C;  4HLE A;  1H19 A;  4G26 A;  4M3O A;  3G2W A;  1EF1 C;  2RD0 A;  3EHN A;  1ZBP A;  2HM8 A;  1WAO 1;  1NA0 A;  3FFL A;  1SZ9 A;  3FUJ A;  5ENN A;  2VGY A;  4HOT A;  1HFA A;  4GMJ A;  3CVL A;  1DVP A;  5FQ6 A;  1H6K A;  5DIZ A;  3ASF A;  3MV2 B;  2P58 C;  4N5C A;  5FJY A;  3TG4 A;  5G55 A;  1QQE A;  3CQG B;  4N39 A;  3K9I A;  3CLJ A;  4P29 A;  3L08 A;  4OVV A;  4L2Y A;  3B7T A;  3FH8 A;  4FP7 A;  3R9A B;  1L5J A;  4RSY A;  3ZN3 A;  3CVW A;  4JHK A;  4A55 A;  3GZS A;  5AEN A;  2YNQ A;  4KYO B;  1UW4 B;  2LAH A;  4KBQ A;  4PS7 A;  3SI5 A;  4PUC A;  4ABN A;  2FO7 A;  3O48 A;  4FJZ A;  2FF4 A;  1LF8 A;  4GZD A;  2YIN A;  4I6E A;  3UMV A;  2R17 C;  3T8M A;  4RG6 A;  2WXK A;  2M63 A;  2OOE A;  2XPY A;  3QB2 A;  4EPZ A;  4DPR A;  3SF4 A;  1PAQ A;  2J4D A;  3FU3 A;  3QOU A;  4TV3 A;  4U04 A;  3SNX A;  2AXU A;  4FUL A;  3U66 A;  4IRU A;  4OYS A;  1TEZ A;  2XPI A;  3ZXS A;  5FQ7 A;  3FTW A;  1JUQ A;  4UQY A;  2LAI A;  4RVB A;  4AVX A;  4G23 A;  4CCA A;  2CHZ A;  2IQC A;  4YND A;  3ZYM A;  5JJ7 A;  1EYH A;  2UY1 B;  3N71 A;  5LOZ A;  3SBS A;  4DJA A;  4J6I A;  4GA1 A;  1EDU A;  4MS6 A;  2WXM A;  4CGV A;  5J08 A;  5M72 A;  4JZY A;  3TGO A;  4URK A;  2WXG A;  5DBK A;  3KEZ A;  3QNK A;  4FC8 A;  5A7D B;  4HOR A;  3PUJ A;  3P2B A;  4H7Y A;  4HOQ A;  5EKQ D;  4A3T A;  4AM9 A;  1N52 A;  1ELK A;  3D9P A;  3UQ3 A;  4Q94 A;  4UI9 K;  3GZ1 A;  2Y4T A;  3HYM B;  3S7F A;  1Y6I A;  1FCH A;  4MRU A;  2FUL A;  3FTZ A;  2WXL A;  3PEV B;  4I1M A;  3RU0 A;  2GRL A;  3S7B A;  2J07 A;  2E0I A;  3DBS A;  3JQ0 A;  3FY4 A;  2QY7 A;  4PS3 A;  3ONL A;  2HR2 A;  1OUV A;  5G05 J;  5KJL A;  2AXZ A;  4IYP A;  3Q5M A;  4BWR A;  3KD7 A;  2I6H A;  3IEG A;  5G04 C;  4JEH A;  2VSX E;  4GCO A;  4APO A;  5LP0 A;  1E8X A;  4PDX A;  1P5Q A;  2X6K A;  4KVO A;  2UWJ G;  1H0A A;  3QKY A;  3QJZ A;  4DK5 A;  4I9C A;  1INZ A;  3FTY A;  3CHS A;  3ESK A;  5FZR A;  3MEK A;  1ELR A;  2DIW A;  3PS6 A;  2FBN A;  4I1A A;  3RKV A;  5BUZ A;  5G05 C;  4C0M A;  1HXI A;  3U9W A;  4XE0 A;  2L0T B;  3NQP A;  1HU3 A;  4GCN A;  2VSY A;  4WWN A;  4GZ6 A;  4F7A A;  4JEU A;  2IF4 A;  1OWN A;  3ZYL A;  3PDN A;  2WXF A;  5T4Y A;  2I1K A;  3UUX A;  3ASD A;  3D3M A;  4KXK B;  3CQC B;  3I4R B;  4E85 A;  2WXJ A;  1MHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...