2HR2A

Crystal structure of a tpr-like protein (ct2138) from chlorobium tepidum tls at 2.54 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
156
structure length
156
Chain Sequence
KPLKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAMEISHTMPPEEAFDHAGFDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAEAMPEFKKVVEMIEERKGETPGKERMMEVAIDRIAQLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (NP_663012.1) from Chlorobium tepidum TLS at 2.54 A resolution
rcsb
source organism Chlorobium tepidum
molecule tags Unknown function
total genus 57
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12968 DUF3856 Domain of Unknown Function (DUF3856)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2hr2A00
4BT8A 5CCMA 1NA0A 5FZRA 3TAXA 4BTAA 4N5CA 4GYWA 5FJYA 4J8EA 5KJNA 4WUYA 4YVQC 4KYOB 3CV0A 4LEUA 4JA7A 3ZHEB 4UQXA 5JJTA 4UI9C 5AYWD 5CCLA 5KJMA 2HR2A 3Q15A 2BUGA 2YQ8A 3VTXA 3LY9A 3GZ2A 1WAO1 4I9CA 4KXKB 1KT0A 3CVNA 3HYMB 3ZGQA 3QWWA 3ASGA 4GZ3A 3Q5MA 4APOA 3ZHEA 3UUXA 1QQEA 3MKRA 3LKUA 4BT9A 4F3VA 1QZ2A 5DIZA 2WQHA 2Y4UA 4U0UA 5G04C 3CVQA 5EKQD 4JA9A 3GYZA 4CGWA 1HH8A 3ASFA 4GYYA 3LY8A 4GA1A 4UQYA 1ZU2A 4GA2A 4J8DA 2XEVA 2FBNA 2HO1A 3IEGA 2QFCA 1YA0A 5CHEE 3PE3A 4AIFA 4I17A 3U3WA 2V5FA 2LSVA 2PQNA 3NF1A 2NC9A 3SZ7A 4G2VA 5LCWC 4U0SA 3TG5A 3GZ1A 4GYOA 5BW8C 4W9RA 4XI0A 3Q47B 2FI7A 3WXXA 4G25A 3ESKA 4CGVA 2E2EA 2XGMA 2XCBA 2VSYA 2J9QA 3UPVA 3S7DA 3E4BA 5JJ7A 4RG6A 3QKYA 3OXGA 3CKCA 1KT1A 5FTPA 3GW4A 4Y6WA 3CK8A 4O6FA 3S7BA 4J8FA 2VQ2A 4G24A 4HOUA 4NQ0A 5HQ8A 5A7DB 3MEKA 4AM9A 2IF4A 3AS4A 3RO2A 5G04J 2PZIA 2KCKA 5KJLA 5D0QD 1ELRA 5D0OD 4I2ZA 4WNGA 5ARGA 1NZNA 2VGYA 3RO3A 2KC7A 3PDNA 2Q7FA 1TJCA 4G23A 5JJ6A 3TGOA 2FF4A 5EX3A 5LCWJ 2FEZA 1WM5A 2XCCA 2P58C 3AS5A 3K9IA 3ASHA 3MV2B 2JLBA 4I9EA 3QDNA 1Y8MA 3FP3A 2FO7A 3OXFA 3KS2A 4I1AA 3JYSA 3FFLA 2PL2A 3N71A 2MHKA 4UQZA 2HYZA 3AS8A 4A1SA 3FWVA 4GCOA 3CEQA 1ELWA 1P5QA 1XNFA 1HZ4A 4GZ6A 5G05C 4IN3B 4BWRA 3LYAA 4HORA 4N39A 2UY1B 5FZQA 3OXLA 4U07A 2LNIA 4N3BA 2XPIA 3CKBA 3Q4AB 4ABNA 3KAEA 3S7FA 4GZ5A 5A6CA 4Y6CA 5HI7A 5M72A 4G1TA 5BT1A 4HOTA 5DBKA 3RIBA 2VGXB 3CK7A 3ULQA 3LCAA 1E96B 1A17A 4WNDA 2UY1A 3ZFWA 2L6JA 3UQ3A 3SF4A 1IYGA 3RJVA 4I2WA 3ZN3A 1OUVA 3MA5A 3S7JA 3ASDA 5FT9A 3Q49B 2I6HA 2OOEA 2VGXA 1NA3A 3QWVA 3CK9A 3CVPA 4U0ZA 4JL0A 4JHRA 3U4TA 4AY6A 3URZA 4CDRA 1FCHA 4N2QA 2VYIA 2XGOA 4B94A 3LY7A 3BEEA 3R9AB 5G05J 1W3BA 2GW1A 1KLXA 3EDTB 2KATA 1HXIA 3MV3B 4XIFA 3PE4A 5EX0A 2UWJG 3TG4A 2C2LA 2C0LA 4WNFA 4WNEA 4EQFA 3RU0A 4H7YA 5C1DA 1IHGA 2C0MA 3VTYA 4KBQA 4N2SA 3RKVA 4BTBA 1ZBPA 2DBAA 3QOUA 3CVLA 4RG9A 2XGSA 2VSNA 3QWPA 2KCLA 2YHCA 4XI9A 3ZPJA 2LSUA 5ARFA 4HOSA 2PQRA 4N3CA 4GA0A 2KCVA 4AY5A 2ONDA 4GCNA 5FZSA 4GPKA 2R5SA 4HOQA 4ME2A 1B89A 4NRHB 4YNDA 4H7XA 4U04A 1PC2A 4UI9K 5BNWA 3O48A 4G26A 2IFUA 5KJKA 2AVPA 4N3AA 4UI9J 2WPVA 4J0UA 3LPZA 4YVOA 2Y4TA 3KD7A
chains in the Genus database with same CATH superfamily
4CZ2D 1A5EA 1E7UA 3G2WA 2NXPA 2HM8A 4PS8A 4G11A 1DCEA 4JEHA 4BTAA 2WXPA 5ANLA 4J8EA 5AJLA 3FU6A 3G2UA 2L0IA 4JA7A 3ZHEB 5ENPD 2GRRB 2FO1E 3NBNB 2EINE 1MZCA 3Q15A 3E32A 4DX2A 2YQ8A 4B8AA 3LY9A 3TXNA 3B7RL 4B93B 1JCSA 2LAIA 4JXTA 4KXKB 3IHVA 4HBDA 3HYMB 2ZIRA 4K5CA 3ZGQA 4GZ3A 3Q5MA 4APOA 3W9FA 3ZHEA 3UX4A 5ENTD 1QQEA 3LKUA 5AENA 5CMYA 3FU5A 4JPSA 4APFA 1N4SA 3CVQA 5EKQD 4JA9A 1NL4A 3ASNE 3GYZA 3JCKC 3FTVA 4HI8A 2FBNA 3E37A 3IEGA 2QFCA 5CHEE 2QY7A 1JCRA 2LSVA 2PQNA 3TWRA 1MX2A 2YHEA 5EILA 4GYOA 4W9RA 1D8EA 3UT4A 4RLYA 4AV7A 3ESKA 3T8MA 4URKA 5T4YA 2RG8A 1KZOA 2DVWA 4M3OA 4TUUA 2EIKE 3E4BA 4F53A 4RG6A 5E75A 3D9LA 2R03A 3CHOA 4CRWA 4GTMA 2WXFA 2CHZA 3KEZA 2R02A 3CK8A 3BU8A 1E8WA 4EBAG 4HRMB 1LF8A 3C3RA 3L22A 1DCQA 5FWQA 2B6CA 3P1UA 4J8YA 1H2TC 2ZU6B 4BY6A 1OCCE 3LJNA 2WXNA 1E8YA 4HOUA 5HQ8A 4B89A 3MEKA 3CVYA 4C0EA 2IF4A 1IXVA 2PZIA 5KJLA 3CSFA 1ELRA 2ZISA 5D0OD 4I2ZA 3EHMA 1O1RA 2WXHA 2P9PG 5ARGA 1NZNA 1QYMA 3V79K 4HS2A 2GRNB 5AARA 4DLOA 2WQ6A 1Z3YA 1TJCA 4G23A 1N4PA 3RRMB 5ENQD 3UM0A 2FF4A 3SFZA 3PEVB 1ELKA 3JQ1A 1DC2A 3L6AA 2XCCA 3CHPA 2P58C 5LFAA 3K9IA 5G2NA 5ANRA 4HI9A 4I9EA 3QDNA 2QZAA 1Y8MA 1H2VC 3DXMG 3NOCD 3CSTA 2XRZA 3QB2A 2XRYA 3L08A 1H6KA 2MHKA 3FY4A 3UM2A 3D9NA 3CEQA 3HG0D 2A4ZA 3DBSA 3Q78A 4HORA 3PZ1A 3HXFA 4L23A 2EIJE 4JC8A 3I3NA 4U07A 3UMVA 2LNIA 3CVXA 2XPIA 3CKBA 4ABNA 4DRXE 4GTRA 3CHRA 2BKGA 1SW6A 2JABA 4G1TA 4U8YD 5BT1A 5DBKA 3V30A 2VGXB 5FQ6A 1EPUA 3LCAA 4L9PA 4WNDA 5CRVA 3UQ3A 3SF4A 3I4RB 4O1PA 1BU9A 1IYGA 3FTSA 3HRAA 4I2WA 4ANXA 5CERB 2R17C 1MQSA 1TNZA 3LVRE 2CHWA 3LXUX 3MKQB 4NURA 2LXLA 1TYQG 2VGXA 1NA3A 4A3TA 3FH5A 3ULYA 4GMRA 2I1JA 1BI8B 4E85A 4CDRA 3FEYA 3TXMA 2XPZA 4YDOA 4HFGA 4EZJA 2VYIA 3D9IA 3LJ3A 3D9PA 4LCTA 4B94A 5CEDB 1W3BA 3MKQA 1KLXA 3D9KA 1X81A 3ZW3A 1U3DA 2IU1A 4H7YA 2X6KA 1IHGA 3VTYA 4KBQA 4I6GA 3DSWA 3IKOB 3PRZA 4PDXA 3FTXA 3CVLA 4IYPA 4RG9A 4AP2A 4BEPA 4LERA 3MX3A 4WWPA 3CIAA 2KCLA 5EIDA 4XI9A 1N0RA 2AW6A 4HOSA 2PQRA 2LAHA 1U2VG 4AY5A 5T3RA 2XHEA 2R5SA 3SQVA 5JMND 4EZKA 4YDYA 1RZ4A 4ANWA 4QQIA 1TEZA 1HG5A 5J08A 3MGBA 5G55A 3NZSA 4OVUA 5KNHD 1OCOE 1N95A 5E76A 3T5VA 2P2CP 2P9KG 4ZFHA 3UT7A 3FUEA 1S0PA 3RRUA 4UI9J 4AXHA 4J0UA 1OT8A 2BEDA 2F0YA 4YVOA 1INZA 3PZ3A 3Q9NC 3UI2A 3G2TA 3FTUA 3KD7A 1DVPA 4BSZB 4C0MA 2VJ8A 4GU5A 5CCMA 2P9SG 3GZSA 3L16A 1NA0A 2AJAA 3DSXA 3FULA 3L17A 4O1OA 3ABLE 4LUNU 3SO8A 2WXOA 4EHMA 3J5QB 5FJYA 4WUYA 3MZLB 1TNOA 4PH4B 1SVXA 1N9AA 3CV0A 5JJTA 1N11A 1HF8A 1UW4B 1VDYA 2HR2A 2X6HA 2OVBA 2ZGGA 3AU4A 4BX9A 3U66A 3KEAA 3GZ2A 3RK6A 3CVNA 5CBOA 3VLDA 3ZRHA 1KZPA 3ZKJA 2J08A 2WQ7A 4F3VA 3UM3A 1QZ2A 2H6HA 2AXVA 4HRLA 4CCAA 4U0UA 2GRPB 3R9MA 3PZ4A 3AG1E 5CEAA 4CGWA 2XZDG 3SBTB 1OWOA 3LY8A 4A55A 4UQYA 1ZU2A 5AQBA 1N94A 4DLQA 4J8DA 2HO1A 4FJYA 2OCCE 3UKRG 1IKND 4I17A 1H6PA 5EDSA 1FVFA 2V0PA 1XGWA 3NF1A 2XPYA 1SA5A 2NC9A 4G2VA 4U0SA 3TG5A 4AVXA 4DUIA 4XI0A 2EIME 3Q47B 1Z6TA 3ZIMA 1NP7A 3EHNA 4NACA 5KBAA 3ZEFA 3FTZA 3S7DA 5B3SE 1D8DA 1QBQA 3UM1A 3QKYA 1SZAA 1S64A 3JUIA 4HLEA 5HKPA 1JWGA 2CFUA 1N4RA 3GW4A 3R7RA 4LNBA 4Y6WA 4PS3A 5AIJA 1LTXA 3L13A 4WAFA 1WDYA 3TWWA 2VQ2A 4B8CB 1TNYA 1L5JA 2FULA 4AM9A 1OWMA 3AS4A 3NQPA 3UTMA 4OVVA 4UWKA 1HU3A 4WNGA 2MRIA 4BFRA 2WVIA 3J5PA 3LEWA 2RFAA 4OYSA 4A3VA 4FLBA 1IHBA 2AXZA 1K1BA 3PDNA 1N0QA 2Q7FA 2ZXWE 5JJ6A 3TGOA 2J09A 5EX3A 4IRUA 2FEZA 2XENA 3UINC 3DEPA 4FLHA 3ASHA 3MV2B 2PNNA 1UG3A 4XE0A 4V3IA 4U8VD 4ANUA 2QYUA 4KVOA 3B7UX 2PL2A 4TXPA 3N71A 4EZLA 1UN9A 1PY1A 1UJKA 3C3OA 3AS8A 4A1SA 4GCOA 4CT0A 4JHKA 1ELWA 1XNFA 2IO3C 3APCA 1FPPA 1HE8A 3KSLA 4ATGA 5G05C 4XEIG 4BWRA 4HLLA 2GGFA 3LYAA 5EIBE 1OWLA 2J8SD 4PS7A 4E6HA 2J07A 2BF0X 1D9SA 4I43A 3PZDA 3ABME 3C5RA 3Q4AB 1GW6A 3B7BA 4GMJA 3O4ZA 1HS6A 4Y6CA 2RKKA 2F8XK 4X8QA 1LD7A 4GTTA 3ULQA 4DK5A 4L7TA 5CRUA 3G2SA 3ZYKA 2L6JA 3BQOA 4UWLA 5AJDA 4R7LA 2V4HC 5H7PA 1EDUA 3MA5A 2Y1LE 4F1PA 2OEVA 3ASDA 2IO2C 3Q49B 3ZUVB 5B1AE 2WXQA 3QWVA 3CK9A 4JL0A 4JHRA 4AY6A 4LRZA 1YMPA 4N2QA 3Q73A 3CR3A 4FHKA 2VSXE 3LY7A 5G05J 3PUKA 5KWDA 4OAVB 5CECB 3ML9A 2WXIA 1HXIA 4XIFA 1O1SA 5EX0A 4BETA 3TG4A 4DI4A 2CG3A 4WNEA 3APDA 1BPOA 4K03A 3EUVA 4F1SA 2NSZA 4ZHBA 4N2SA 1JWFA 2GRQB 3DXKG 2X6IA 5LOZA 3RKVA 3DSVA 4ATZD 1IQRA 4A1GA 2XGSA 3AU5A 1YCSB 4GAAA 2VSNA 3QWPA 1EF1C 3NOGD 3G2VA 4HVBA 3FUMA 3ZPJA 2LSUA 3ABKE 2WM9A 4G8KA 3ASOE 5BPPA 1Q2ZA 2KCVA 1DNPA 2IEJA 2ONDA 4EPZA 4KZ0A 4RSYA 2LXMA 2WMNA 5KCMA 2P9IG 1U3CA 3T8KA 4HOQA 1S70B 1TJFA 4TUMA 3X2QE 4KMOA 3JQ0A 3F6QA 3APFA 3HVEB 5BNWA 4P29A 3O48A 4CDMA 2IFUA 5KJKA 4U95D 3IBEA 3E30A 2WPVA 3LPZA 2YNQA 3ESLA 3QARA 3V2OA 3L9TA 4BT8A 2M63A 3FTYA 2J4BA 2X6FA 3HVEA 5FZRA 3EHQA 2KXPC 4I1MA 4N5CA 3Q75A 4YVQC 2ETCA 1K3ZD 3FUJA 2DCPA 4LEUA 1FT2A 4UI9C 5AYWD 2OEWA 5ITZF 5CCLA 5KJMA 3QC1A 2R2LA 3JXIA 1H19A 1PAQA 4UWFA 4FHJA 3ZNGA 3ULEG 2BUGA 1BLXB 4I9CA 3I5PA 5ENOD 2X6JA 2X38A 3SY2A 4ILIA 4DX1A 2KM4A 3FUDA 4ILGA 3MKRA 1RW2A 4BERA 2DIWA 3ONLA 4XZ4A 1WG0A 2A5EA 2P9NG 5CMWA 4Q69A 1HH8A 3ASFA 3BG1B 4N5QA 2OV8A 2P9LG 2VTBB 1OCRE 1HFAA 4FP7A 4AIFA 4BX8A 3U3WA 1YYHA 3SZ7A 5BW8C 1BD8A 5BUZA 1JPLA 3FDHA 2B0OE 1TR4A 3CGHA 2VTBA 1HG2A 2VSYA 1LD8A 4HB5A 4HXIA 5JJ7A 1N4QA 1H0AA 2V8SE 4JD2G 2IONA 4LG6A 5FTPA 2J4DA 3CVWA 3SGHA 4Q94A 3EJNA 3AG2E 4O6FA 1UN8A 3S7BA 4J8FA 4GB9A 4DX5D 3DPYA 3EU5A 1E7VA 3ZYQA 3Q7AA 4TXRA 2XEHA 5A7DB 4XX5A 4AEZC 3B7TA 5JA4D 2RFMA 3CQCB 4J8SA 5KNGA 3FUFA 4JVSA 3ISMC 4J6IA 3FUHA 3RRNB 1MYOA 4AOFA 3ENEA 2Y3AA 2ILRA 5AQ7A 3TWUA 1S63A 1N54A 4L2LA 1MX4A 2LUHA 3FU3A 2RD0A 2MYOA 3AS5A 2JLBA 3QJZA 4CEMA 3Q79A 3FP3A 2FO7A 3OXFA 3KS2A 4I1AA 3CVUA 3FFLA 2HYZA 2WXKA 3FH8A 4L2YA 4B0ZA 2Y0BG 4DI3A 4GZ6A 3EIQC 4CDNA 5BV0A 2L9BA 3TL5A 4WWOA 4I6EA 2VGEA 5FZQA 4TRQA 3OXLA 2H6IA 4GZDA 1Z3XA 1KPSB 3HXDA 3D3MA 3EIJA 5BXUA 4WWNA 4MS6A 3IHYA 5A6CA 4LNUD 4ILHB 5HI7A 5M72A 3DRAA 1MJ0A 3ZYMA 4NIKA 5JHAA 3ZFWA 5EYPF 4GTSA 3SFXA 1FVHA 5CBNA 3C3QA 3SI5A 4LNGA 3IV0A 3ZN3A 2KZTB 3SD5A 1QNFA 2WXGA 4BESA 3DPDA 3ZXSA 5BV1A 5LP0A 3TJPA 5FT9A 3PS6A 2OOEA 1H6OA 4CYMD 4U0ZA 4U96D 3SBSA 5C2YA 3E33A 3TWQA 4C48B 3DSSA 3ML8A 3DEOA 2X3MA 2I1KA 1V54E 2R05A 1TN8A 2KZTA 3R9AB 1AWCB 3EDTB 3MV3B 3PE4A 2UWJG 3HXEA 3D9JA 2AWIA 4WNFA 3LDZA 1ZB1A 3PVLA 4KT6B 3KSQA 4Q96A 4BTBA 3QOUA 2DBAA 4A63B 3LVQE 4DJAA 2GROB 1OWPA 2VSOE 4U63A 3UT8A 3R7QA 3CQGB 5D2MC 4KVMA 3FTWA 1K8KG 5ARFA 1JUQA 4U8HA 3T5XA 4N3CA 2F8YA 1NFIE 4DPRA 1TNBA 1SA4A 4GCNA 3D9OA 3JUEA 4MKTA 1FT1A 4XKCA 4ME2A 3QAQA 1B89A 4RVBA 4CT4A 1UJJA 1OXJA 1G3NB 3C72A 3DWLG 1TN7A 1IQUA 4AJWA 4H7XA 3TWXA 4U04A 4UI9K 3TWSA 2XEEA 4KZCA 4GTQA 3FUNA 2DYRE 4N3AA 2DYSE 5ENNA 3Q7FA 2E0IA 2XZTG 2Y4TA 4F6RD 5D66A 3VLFA 3W9GA 3L54A 2JEKA 4FC8A 4XKBA 3TAXA 2WXMA 3QNKA 2YINA 4GYWA 2ZGDA 3SNXA 5KJNA 4KYOB 3V31A 4HNAD 4U7EB 5AQAA 4UQXA 3PEUB 3PUJA 3ONKA 2I2OA 3CHSA 3NAWA 5BXOA 3VTXA 5AQ9A 4JEUA 2IOLA 1WAO1 3NZUA 1KT0A 4I6JA 4GTPA 1HX8A 3QWWA 3ASGA 3FU0A 2EQXA 2XS8A 5EN5D 3DSTA 3UUXA 4QFVA 1V55E 4BT9A 2L0TB 5IY5E 5DIZA 4K0RA 4IULA 2WQHA 2Y4UA 5G04C 2QC9A 5HS0A 2IOSA 2QYJA 3U64A 4GYYA 1UOHA 4FADA 4GA1A 4GA2A 2XEVA 1YA0A 3PE3A 2EILE 1E8ZA 2V5FA 4O60A 4GPMA 4FA6A 1SZ9A 5LCWC 3IXEA 3TWVA 3GZ1A 2FI7A 3WXXA 3AG3E 2IQCA 4G25A 2Y69E 1SQMA 2E2EA 4CGVA 1K1AA 2XGMA 3CLJA 5FINA 3ZVVA 2XCBA 5J90A 3QK0A 2J9QA 3UPVA 1X5BA 3AJIA 3U9WA 2WXRA 4DX7D 4RQIA 3PZ2A 3OXGA 3RAUA 3CKCA 1KT1A 1Z5SC 4I1OB 4GTOA 5FQ8A 5HRYA 3S2AA 3MCXA 3PH0C 1H2UA 2PM6A 1MX6A 3FUIA 4G24A 4NQ0A 2P9UG 2PM7A 3BG0B 3RO2A 5G04J 1E8XA 1O5MA 2KCKA 4EBAA 3B95A 5D0QD 3D9HA 2OVFA 1WY6A 4MRUA 1Y6IA 2VGYA 3RO3A 4Z68A 3C98A 2XQ0A 2KC7A 4UWGA 3MYVA 3HIZA 2V4LA 2IJGX 2IY0C 5LCWJ 3OTNA 5EYLA 4F7AA 3UIOC 1WM5A 2GRMA 2XS1A 3HXBA 2GRLA 3RSEG 3AAAC 4HRNA 3UIPC 5AN8A 2DWZA 4MLPA 3JYSA 2WB2A 4L1BA 3AG4E 4UQZA 5AAOA 4K5AB 2WMOA 3SFYA 3FWVA 4JB8P 1P5QA 4D10C 3CVVA 1HZ4A 4GMLA 4IN3B 4N39A 3WG7E 2KBXA 3EU9A 2H6FA 1OWNA 2UY1B 3HXCA 3OAWA 3HHMA 3ZYLA 2MOWA 2L6BA 2I9CA 2V5QC 3NB2A 4N3BA 4EECA 2BKKB 3P2BA 3KAEA 3S7FA 4GZ5A 5ENRD 3UXGA 4M7CA 4JHJA 3T9KA 4HOTA 1TN6A 3RIBA 4GZCA 4TXQA 3B13A 3CK7A 1E96B 3B7SA 1A17A 2UY1A 1EYHA 4MBGA 3BUAA 4FULA 2NYJA 4JZYA 3Q9UC 3RJVA 1O1TA 1OUVA 4ANVA 3FUKA 3S7JA 2I6HA 3V2XA 2AXUA 5LX8A 1E90A 3CVPA 4FJZA 4J7WA 3U4TA 3URZA 3I4GA 1FCHA 3HDXA 5FQ4A 4LSZE 2XGOA 2DZOA 3BEEA 2CHXA 3DSUA 4UUCA 4YDEA 5ENSD 3UKUG 4G8LA 2GW1A 3MJWA 3CHMA 1MHQA 1BI7B 2KATA 1JCQA 2HE0A 3PREA 5JHBA 3ZXPA 5B1BE 2C2LA 3LS8A 2C0LA 4EQFA 3FH7A 3RU0A 4TV3A 2LO6A 2CG2A 5C1DA 2C0MA 4PUCA 2J49A 4ACKA 4UWHA 2WXJA 1ZBPA 3L82A 3CHQA 1AP7A 4C9BB 5FQ7A 2R59A 1NI1A 2DZNA 3PNLB 4BSXA 2H6GA 2YHCA 1TNUA 3E34A 3D9MA 5T8IA 3TWTA 4OAUC 1N52A 4GA0A 4K5BA 3JXJA 4HQDA 4DX6D 3VLEA 5FZSA 4GPKA 2F37A 1OY3D 4YDWA 3PNTB 3FEXA 4NRHB 3EHRA 1HO8A 2ETAA 4YNDA 1PC2A 3ZU7B 4G26A 3FHEA 4GTVA 2WXLA 4ACLA 2ETBA 2BTDA 4FU3A 2AVPA 5FIOA 5A23A 2CFZA 4JW1A 2A5UA 3SHFA 1OCZE
chains in the Genus database with same CATH topology
1DVPA 4BT8A 4C0MA 2VJ8A 2M63A 4GU5A 3FTYA 3VLFA 5CCMA 2J4BA 3GZSA 2X6FA 1E7UA 3HVEA 3L16A 3G2WA 2NXPA 3L54A 2JEKA 2HM8A 4FC8A 4PS8A 4XKBA 1NA0A 5FZRA 3TAXA 2WXMA 3FULA 3L17A 4G11A 4LUNU 3QNKA 4JEHA 4I1MA 4BTAA 2WXOA 2WXPA 2YINA 4GYWA 4N5CA 5ANLA 5FJYA 4J8EA 3SNXA 4WUYA 5AJLA 5KJNA 3MZLB 3FU6A 4PH4B 4YVQC 4KYOB 3FUJA 3CV0A 2DCPA 3G2UA 2L0IA 4JA7A 4LEUA 3ZHEB 4UQXA 3PEUB 3PUJA 3ONKA 5JJTA 4UI9C 5AYWD 1HF8A 5CCLA 2I2OA 1UW4B 1VDYA 2HR2A 2X6HA 3CHSA 3QC1A 2OVBA 5KJMA 3Q15A 3AU4A 3U66A 4BX9A 1H19A 1PAQA 4UWFA 4FHJA 2BUGA 2YQ8A 3VTXA 4B8AA 4JEUA 2IOLA 3LY9A 3TXNA 3B7RL 3GZ2A 1WAO1 4I9CA 3NZUA 3I5PA 3RK6A 2LAIA 4JXTA 4KXKB 1KT0A 2X6JA 3CVNA 3IHVA 2X38A 3VLDA 4ILIA 3HYMB 4I6JA 3ZRHA 1HX8A 2KM4A 3QWWA 3ZGQA 3ASGA 3FU0A 2EQXA 3Q5MA 4GZ3A 4APOA 2J08A 3ZHEA 3UX4A 3FUDA 4ILGA 3UUXA 1QQEA 3MKRA 4QFVA 2WQ7A 3LKUA 2DIWA 3ONLA 4BT9A 2L0TB 4XZ4A 5CMYA 4F3VA 5AENA 3FU5A 1QZ2A 5DIZA 2AXVA 4K0RA 4IULA 2WQHA 4JPSA 2Y4UA 4CCAA 4APFA 4U0UA 5G04C 5CMWA 3CVQA 5EKQD 2IOSA 4JA9A 4Q69A 3GYZA 4CGWA 3U64A 3SBTB 1HH8A 3ASFA 3BG1B 4GYYA 1OWOA 3JCKC 3LY8A 4A55A 4FADA 4GA1A 4UQYA 3FTVA 2OV8A 1ZU2A 2VTBB 4GA2A 4DLQA 4J8DA 2XEVA 2FBNA 2HO1A 3IEGA 2QFCA 4FJYA 1HFAA 1YA0A 4FP7A 2QY7A 3PE3A 5CHEE 4AIFA 4I17A 4BX8A 3U3WA 1E8ZA 2V5FA 2LSVA 2PQNA 5EDSA 1FVFA 2V0PA 1XGWA 3NF1A 2XPYA 4FA6A 2NC9A 1SZ9A 3SZ7A 2YHEA 4G2VA 5LCWC 4U0SA 3TG5A 3GZ1A 4GYOA 5BW8C 4AVXA 4W9RA 4XI0A 5BUZA 3UT4A 3Q47B 1Z6TA 2FI7A 3WXXA 2IQCA 4G25A 4AV7A 3ESKA 1JPLA 3ZIMA 1SQMA 2E2EA 1NP7A 3T8MA 3FDHA 4CGVA 4URKA 5T4YA 2RG8A 2XGMA 3CGHA 3CLJA 3EHNA 1HG2A 2XCBA 4NACA 2VSYA 3ZVVA 3QK0A 5J90A 2VTBA 2J9QA 4HXIA 4M3OA 3ZEFA 4TUUA 3UPVA 3FTZA 3S7DA 3E4BA 4F53A 1X5BA 5JJ7A 1H0AA 4RG6A 2V8SE 3U9WA 3QKYA 2WXRA 5E75A 1SZAA 3D9LA 2IONA 3CHOA 4CRWA 3OXGA 3JUIA 2WXFA 2CHZA 3CKCA 1KT1A 4HLEA 5FTPA 1JWGA 3KEZA 2CFUA 3GW4A 4I1OB 5FQ8A 3R7RA 4Y6WA 4PS3A 3CK8A 5AIJA 2J4DA 3CVWA 3SGHA 1E8WA 4Q94A 5C1DA 4EBAG 3S2AA 1LF8A 3EJNA 3MCXA 3PH0C 4O6FA 1UN8A 1H2UA 3S7BA 3L22A 3L13A 4J8FA 4WAFA 4GB9A 5FWQA 2PM6A 3ZYQA 1E7VA 3P1UA 1H2TC 2ZU6B 4BY6A 2VQ2A 2WXNA 1E8YA 3FUIA 4B8CB 4G24A 4HOUA 4NQ0A 5HQ8A 5A7DB 4B89A 3MEKA 4XX5A 1L5JA 3CVYA 2FULA 2PM7A 4AM9A 4C0EA 1OWMA 2IF4A 3AS4A 3BG0B 4AEZC 3B7TA 3NQPA 3RO2A 5G04J 1E8XA 2KCKA 2PZIA 3CQCB 4OVVA 4EBAA 5KJLA 3CSFA 4UWKA 5D0QD 1ELRA 1HU3A 2OVFA 1WY6A 5D0OD 4I2ZA 3EHMA 2MRIA 4J8SA 4WNGA 4BFRA 4MRUA 3FUFA 2WVIA 2WXHA 4JVSA 1Y6IA 5ARGA 4J6IA 3FUHA 1NZNA 2VGYA 3RRNB 3RO3A 4HS2A 4AOFA 3C98A 2XQ0A 3ENEA 3LEWA 4OYSA 4A3VA 4FLBA 4DLOA 2KC7A 2WQ6A 4UWGA 2Y3AA 1Z3YA 2AXZA 3PDNA 2ILRA 2Q7FA 1TJCA 3MYVA 4G23A 3HIZA 5JJ6A 2V4LA 3RRMB 2IJGX 1N54A 3TGOA 4L2LA 2FF4A 2J09A 3SFZA 5EX3A 5LCWJ 3PEVB 4IRUA 1ELKA 3JQ1A 3OTNA 4F7AA 2FEZA 3L6AA 1WM5A 2GRMA 4FLHA 3FU3A 2XCCA 2RD0A 3CHPA 2P58C 3AS5A 5LFAA 3K9IA 2GRLA 3ASHA 3MV2B 5G2NA 5ANRA 2JLBA 1UG3A 4I9EA 3QDNA 4XE0A 3QJZA 4CEMA 1Y8MA 3FP3A 4V3IA 4ANUA 2FO7A 1H2VC 3OXFA 4MLPA 3CSTA 2XRZA 3KS2A 4I1AA 3JYSA 2WB2A 3QB2A 4KVOA 3CVUA 3FFLA 3B7UX 2XRYA 2PL2A 3L08A 1H6KA 3N71A 4EZLA 2MHKA 3FY4A 4L1BA 1UN9A 1PY1A 1UJKA 4UQZA 2HYZA 2WXKA 3FH8A 3D9NA 3AS8A 2WMOA 4L2YA 4A1SA 3FWVA 4GCOA 4CT0A 4JHKA 3CEQA 1ELWA 1P5QA 4D10C 3CVVA 4B0ZA 1XNFA 1HZ4A 3APCA 4DI3A 4GMLA 1HE8A 4GZ6A 2A4ZA 5G05C 4IN3B 4ATGA 3EIQC 3DBSA 4BWRA 2GGFA 3LYAA 4HORA 4N39A 1OWLA 4CDNA 4PS7A 4E6HA 2J07A 5BV0A 2L9BA 2BF0X 3TL5A 1OWNA 4L23A 2UY1B 4WWOA 4I43A 3OAWA 3PZDA 4I6EA 3HHMA 4JC8A 5FZQA 4TRQA 3I3NA 3OXLA 4U07A 3ZYLA 2MOWA 4TV3A 3RU0A 3UMVA 2LNIA 4GZDA 2I9CA 4N3BA 1Z3XA 4EECA 3CVXA 2XPIA 3CKBA 3Q4AB 3P2BA 1GW6A 4ABNA 3D3MA 3KAEA 4GMJA 3S7FA 3EIJA 3O4ZA 4GZ5A 4MS6A 4WWNA 3CHRA 3IHYA 5A6CA 1HS6A 4ILHB 4Y6CA 5HI7A 5M72A 4JHJA 4G1TA 5BT1A 4HOTA 5DBKA 3RIBA 4GZCA 3ZYMA 3B13A 2VGXB 3CK7A 5FQ6A 1EPUA 5JHAA 3ULQA 4DK5A 3LCAA 1E96B 3B7SA 1A17A 4L7TA 2UY1A 4WNDA 3G2SA 3ZFWA 3ZYKA 1EYHA 2L6JA 4FULA 3UQ3A 4UWLA 3SF4A 3I4RB 1FVHA 4JZYA 5AJDA 1IYGA 3RJVA 3FTSA 4R7LA 3SI5A 4I2WA 4ANXA 3IV0A 3ZN3A 1OUVA 2R17C 1EDUA 2KZTB 3MA5A 3SD5A 4ANVA 3FUKA 3S7JA 1MQSA 3ASDA 1QNFA 2WXGA 3DPDA 3ZXSA 3LVRE 2CHWA 3LXUX 3TJPA 5BV1A 5FT9A 3Q49B 5LP0A 3MKQB 3PS6A 4NURA 2I6HA 2OOEA 2VGXA 1NA3A 2WXQA 4A3TA 3QWVA 2AXUA 3FH5A 3CK9A 5LX8A 1E90A 3CVPA 4FJZA 4U0ZA 4JL0A 3SBSA 4JHRA 2I1JA 5C2YA 3U4TA 4AY6A 3URZA 4LRZA 4E85A 3I4GA 4CDRA 3FEYA 1FCHA 3TXMA 3ML8A 3HDXA 2XPZA 5FQ4A 4N2QA 2X3MA 4HFGA 3CR3A 4EZJA 2I1KA 2VYIA 3D9IA 3D9PA 3LJ3A 4FHKA 2XGOA 4LCTA 2VSXE 2KZTA 4B94A 3BEEA 2CHXA 3LY7A 3R9AB 5G05J 3PUKA 1W3BA 2GW1A 3MJWA 3MKQA 1KLXA 3CHMA 3ML9A 1MHQA 2WXIA 2KATA 1HXIA 3EDTB 3MV3B 4XIFA 3PE4A 5EX0A 2UWJG 3PREA 3TG4A 4DI4A 5JHBA 3D9JA 3D9KA 2C2LA 3LS8A 2AWIA 2C0LA 4WNFA 3ZW3A 3LDZA 2CG3A 4WNEA 4EQFA 3FH7A 2LO6A 1U3DA 2IU1A 3APDA 2CG2A 3PVLA 4H7YA 2X6KA 1BPOA 1IHGA 2C0MA 2J49A 4KT6B 4PUCA 4K03A 3VTYA 4ACKA 4F1SA 2NSZA 4KBQA 4I6GA 1JWFA 4UWHA 4N2SA 2WXJA 3IKOB 4Q96A 3PRZA 2X6IA 5LOZA 3RKVA 4PDXA 4BTBA 1ZBPA 2DBAA 3QOUA 3CHQA 3FTXA 3LVQE 3CVLA 4C9BB 4IYPA 4DJAA 4RG9A 5FQ7A 2R59A 1IQRA 4A1GA 2XGSA 4AP2A 1OWPA 3AU5A 3PNLB 4GAAA 2VSNA 3QWPA 4BSXA 4LERA 3MX3A 4WWPA 1EF1C 2VSOE 4U63A 3CIAA 2KCLA 3UT8A 3G2VA 2YHCA 3R7QA 3CQGB 4XI9A 3D9MA 4HVBA 5T8IA 4KVMA 3FUMA 3ZPJA 3FTWA 2AW6A 2LSUA 5ARFA 1JUQA 4U8HA 2WM9A 2PQRA 3T5XA 4N3CA 4HOSA 1N52A 4GA0A 5BPPA 2LAHA 4DPRA 2KCVA 4AY5A 1DNPA 4EPZA 2ONDA 4KZ0A 4GCNA 4RSYA 5T3RA 2XHEA 3VLEA 5FZSA 4GPKA 2R5SA 3D9OA 2WMNA 5KCMA 4MKTA 4XKCA 1U3CA 4EZKA 4HOQA 4ME2A 3QAQA 4ANWA 1B89A 1TJFA 4RVBA 4CT4A 1UJJA 1TEZA 1HG5A 4KMOA 3PNTB 3JQ0A 3FEXA 4NRHB 5J08A 1IQUA 4AJWA 1HO8A 3MGBA 5G55A 3NZSA 4OVUA 3APFA 3HVEB 4YNDA 5E76A 3T5VA 4H7XA 4U04A 1PC2A 4UI9K 5BNWA 4P29A 3O48A 3UT7A 4G26A 4KZCA 4CDMA 3FUEA 3FHEA 1S0PA 3FUNA 2IFUA 2WXLA 4ACLA 3RRUA 5KJKA 4FU3A 2BTDA 3IBEA 2AVPA 4N3AA 4UI9J 5A23A 2CFZA 4JW1A 5ENNA 2WPVA 4AXHA 4J0UA 3LPZA 2YNQA 2E0IA 2A5UA 4YVOA 1INZA 3ESLA 3G2TA 3SHFA 3QARA 2Y4TA 3FTUA 3KD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BT8 A;  5CCM A;  1NA0 A;  5FZR A;  3TAX A;  4BTA A;  4N5C A;  4GYW A;  5FJY A;  4J8E A;  5KJN A;  4WUY A;  4YVQ C;  4KYO B;  3CV0 A;  4LEU A;  4JA7 A;  3ZHE B;  4UQX A;  5JJT A;  4UI9 C;  5AYW D;  5CCL A;  5KJM A;  2HR2 A;  3Q15 A;  2BUG A;  2YQ8 A;  3VTX A;  3LY9 A;  3GZ2 A;  1WAO 1;  4I9C A;  4KXK B;  1KT0 A;  3CVN A;  3HYM B;  3ZGQ A;  3QWW A;  3ASG A;  4GZ3 A;  3Q5M A;  4APO A;  3ZHE A;  3UUX A;  1QQE A;  3MKR A;  3LKU A;  4BT9 A;  4F3V A;  1QZ2 A;  5DIZ A;  2WQH A;  2Y4U A;  4U0U A;  5G04 C;  3CVQ A;  5EKQ D;  4JA9 A;  3GYZ A;  4CGW A;  1HH8 A;  3ASF A;  4GYY A;  3LY8 A;  4GA1 A;  4UQY A;  1ZU2 A;  4GA2 A;  4J8D A;  2XEV A;  2FBN A;  2HO1 A;  3IEG A;  2QFC A;  1YA0 A;  5CHE E;  3PE3 A;  4AIF A;  4I17 A;  3U3W A;  2V5F A;  2LSV A;  2PQN A;  3NF1 A;  2NC9 A;  3SZ7 A;  4G2V A;  5LCW C;  4U0S A;  3TG5 A;  3GZ1 A;  4GYO A;  5BW8 C;  4W9R A;  4XI0 A;  3Q47 B;  2FI7 A;  3WXX A;  4G25 A;  3ESK A;  4CGV A;  2E2E A;  2XGM A;  2XCB A;  2VSY A;  2J9Q A;  3UPV A;  3S7D A;  3E4B A;  5JJ7 A;  4RG6 A;  3QKY A;  3OXG A;  3CKC A;  1KT1 A;  5FTP A;  3GW4 A;  4Y6W A;  3CK8 A;  4O6F A;  3S7B A;  4J8F A;  2VQ2 A;  4G24 A;  4HOU A;  4NQ0 A;  5HQ8 A;  5A7D B;  3MEK A;  4AM9 A;  2IF4 A;  3AS4 A;  3RO2 A;  5G04 J;  2PZI A;  2KCK A;  5KJL A;  5D0Q D;  1ELR A;  5D0O D;  4I2Z A;  4WNG A;  5ARG A;  1NZN A;  2VGY A;  3RO3 A;  2KC7 A;  3PDN A;  2Q7F A;  1TJC A;  4G23 A;  5JJ6 A;  3TGO A;  2FF4 A;  5EX3 A;  5LCW J;  2FEZ A;  1WM5 A;  2XCC A;  2P58 C;  3AS5 A;  3K9I A;  3ASH A;  3MV2 B;  2JLB A;  4I9E A;  3QDN A;  1Y8M A;  3FP3 A;  2FO7 A;  3OXF A;  3KS2 A;  4I1A A;  3JYS A;  3FFL A;  2PL2 A;  3N71 A;  2MHK A;  4UQZ A;  2HYZ A;  3AS8 A;  4A1S A;  3FWV A;  4GCO A;  3CEQ A;  1ELW A;  1P5Q A;  1XNF A;  1HZ4 A;  4GZ6 A;  5G05 C;  4IN3 B;  4BWR A;  3LYA A;  4HOR A;  4N39 A;  2UY1 B;  5FZQ A;  3OXL A;  4U07 A;  2LNI A;  4N3B A;  2XPI A;  3CKB A;  3Q4A B;  4ABN A;  3KAE A;  3S7F A;  4GZ5 A;  5A6C A;  4Y6C A;  5HI7 A;  5M72 A;  4G1T A;  5BT1 A;  4HOT A;  5DBK A;  3RIB A;  2VGX B;  3CK7 A;  3ULQ A;  3LCA A;  1E96 B;  1A17 A;  4WND A;  2UY1 A;  3ZFW A;  2L6J A;  3UQ3 A;  3SF4 A;  1IYG A;  3RJV A;  4I2W A;  3ZN3 A;  1OUV A;  3MA5 A;  3S7J A;  3ASD A;  5FT9 A;  3Q49 B;  2I6H A;  2OOE A;  2VGX A;  1NA3 A;  3QWV A;  3CK9 A;  3CVP A;  4U0Z A;  4JL0 A;  4JHR A;  3U4T A;  4AY6 A;  3URZ A;  4CDR A;  1FCH A;  4N2Q A;  2VYI A;  2XGO A;  4B94 A;  3LY7 A;  3BEE A;  3R9A B;  5G05 J;  1W3B A;  2GW1 A;  1KLX A;  3EDT B;  2KAT A;  1HXI A;  3MV3 B;  4XIF A;  3PE4 A;  5EX0 A;  2UWJ G;  3TG4 A;  2C2L A;  2C0L A;  4WNF A;  4WNE A;  4EQF A;  3RU0 A;  4H7Y A;  5C1D A;  1IHG A;  2C0M A;  3VTY A;  4KBQ A;  4N2S A;  3RKV A;  4BTB A;  1ZBP A;  2DBA A;  3QOU A;  3CVL A;  4RG9 A;  2XGS A;  2VSN A;  3QWP A;  2KCL A;  2YHC A;  4XI9 A;  3ZPJ A;  2LSU A;  5ARF A;  4HOS A;  2PQR A;  4N3C A;  4GA0 A;  2KCV A;  4AY5 A;  2OND A;  4GCN A;  5FZS A;  4GPK A;  2R5S A;  4HOQ A;  4ME2 A;  1B89 A;  4NRH B;  4YND A;  4H7X A;  4U04 A;  1PC2 A;  4UI9 K;  5BNW A;  3O48 A;  4G26 A;  2IFU A;  5KJK A;  2AVP A;  4N3A A;  4UI9 J;  2WPV A;  4J0U A;  3LPZ A;  4YVO A;  2Y4T A;  3KD7 A; 
#chains in the Genus database with same CATH topology
 4CZ2 D;  1A5E A;  1E7U A;  3G2W A;  2NXP A;  2HM8 A;  4PS8 A;  4G11 A;  1DCE A;  4JEH A;  4BTA A;  2WXP A;  5ANL A;  4J8E A;  5AJL A;  3FU6 A;  3G2U A;  2L0I A;  4JA7 A;  3ZHE B;  5ENP D;  2GRR B;  2FO1 E;  3NBN B;  2EIN E;  1MZC A;  3Q15 A;  3E32 A;  4DX2 A;  2YQ8 A;  4B8A A;  3LY9 A;  3TXN A;  3B7R L;  4B93 B;  1JCS A;  2LAI A;  4JXT A;  4KXK B;  3IHV A;  4HBD A;  3HYM B;  2ZIR A;  4K5C A;  3ZGQ A;  4GZ3 A;  3Q5M A;  4APO A;  3W9F A;  3ZHE A;  3UX4 A;  5ENT D;  1QQE A;  3LKU A;  5AEN A;  5CMY A;  3FU5 A;  4JPS A;  4APF A;  1N4S A;  3CVQ A;  5EKQ D;  4JA9 A;  1NL4 A;  3ASN E;  3GYZ A;  3JCK C;  3FTV A;  4HI8 A;  2FBN A;  3E37 A;  3IEG A;  2QFC A;  5CHE E;  2QY7 A;  1JCR A;  2LSV A;  2PQN A;  3TWR A;  1MX2 A;  2YHE A;  5EIL A;  4GYO A;  4W9R A;  1D8E A;  3UT4 A;  4RLY A;  4AV7 A;  3ESK A;  3T8M A;  4URK A;  5T4Y A;  2RG8 A;  1KZO A;  2DVW A;  4M3O A;  4TUU A;  2EIK E;  3E4B A;  4F53 A;  4RG6 A;  5E75 A;  3D9L A;  2R03 A;  3CHO A;  4CRW A;  4GTM A;  2WXF A;  2CHZ A;  3KEZ A;  2R02 A;  3CK8 A;  3BU8 A;  1E8W A;  4EBA G;  4HRM B;  1LF8 A;  3C3R A;  3L22 A;  1DCQ A;  5FWQ A;  2B6C A;  3P1U A;  4J8Y A;  1H2T C;  2ZU6 B;  4BY6 A;  1OCC E;  3LJN A;  2WXN A;  1E8Y A;  4HOU A;  5HQ8 A;  4B89 A;  3MEK A;  3CVY A;  4C0E A;  2IF4 A;  1IXV A;  2PZI A;  5KJL A;  3CSF A;  1ELR A;  2ZIS A;  5D0O D;  4I2Z A;  3EHM A;  1O1R A;  2WXH A;  2P9P G;  5ARG A;  1NZN A;  1QYM A;  3V79 K;  4HS2 A;  2GRN B;  5AAR A;  4DLO A;  2WQ6 A;  1Z3Y A;  1TJC A;  4G23 A;  1N4P A;  3RRM B;  5ENQ D;  3UM0 A;  2FF4 A;  3SFZ A;  3PEV B;  1ELK A;  3JQ1 A;  1DC2 A;  3L6A A;  2XCC A;  3CHP A;  2P58 C;  5LFA A;  3K9I A;  5G2N A;  5ANR A;  4HI9 A;  4I9E A;  3QDN A;  2QZA A;  1Y8M A;  1H2V C;  3DXM G;  3NOC D;  3CST A;  2XRZ A;  3QB2 A;  2XRY A;  3L08 A;  1H6K A;  2MHK A;  3FY4 A;  3UM2 A;  3D9N A;  3CEQ A;  3HG0 D;  2A4Z A;  3DBS A;  3Q78 A;  4HOR A;  3PZ1 A;  3HXF A;  4L23 A;  2EIJ E;  4JC8 A;  3I3N A;  4U07 A;  3UMV A;  2LNI A;  3CVX A;  2XPI A;  3CKB A;  4ABN A;  4DRX E;  4GTR A;  3CHR A;  2BKG A;  1SW6 A;  2JAB A;  4G1T A;  4U8Y D;  5BT1 A;  5DBK A;  3V30 A;  2VGX B;  5FQ6 A;  1EPU A;  3LCA A;  4L9P A;  4WND A;  5CRV A;  3UQ3 A;  3SF4 A;  3I4R B;  4O1P A;  1BU9 A;  1IYG A;  3FTS A;  3HRA A;  4I2W A;  4ANX A;  5CER B;  2R17 C;  1MQS A;  1TNZ A;  3LVR E;  2CHW A;  3LXU X;  3MKQ B;  4NUR A;  2LXL A;  1TYQ G;  2VGX A;  1NA3 A;  4A3T A;  3FH5 A;  3ULY A;  4GMR A;  2I1J A;  1BI8 B;  4E85 A;  4CDR A;  3FEY A;  3TXM A;  2XPZ A;  4YDO A;  4HFG A;  4EZJ A;  2VYI A;  3D9I A;  3LJ3 A;  3D9P A;  4LCT A;  4B94 A;  5CED B;  1W3B A;  3MKQ A;  1KLX A;  3D9K A;  1X81 A;  3ZW3 A;  1U3D A;  2IU1 A;  4H7Y A;  2X6K A;  1IHG A;  3VTY A;  4KBQ A;  4I6G A;  3DSW A;  3IKO B;  3PRZ A;  4PDX A;  3FTX A;  3CVL A;  4IYP A;  4RG9 A;  4AP2 A;  4BEP A;  4LER A;  3MX3 A;  4WWP A;  3CIA A;  2KCL A;  5EID A;  4XI9 A;  1N0R A;  2AW6 A;  4HOS A;  2PQR A;  2LAH A;  1U2V G;  4AY5 A;  5T3R A;  2XHE A;  2R5S A;  3SQV A;  5JMN D;  4EZK A;  4YDY A;  1RZ4 A;  4ANW A;  4QQI A;  1TEZ A;  1HG5 A;  5J08 A;  3MGB A;  5G55 A;  3NZS A;  4OVU A;  5KNH D;  1OCO E;  1N95 A;  5E76 A;  3T5V A;  2P2C P;  2P9K G;  4ZFH A;  3UT7 A;  3FUE A;  1S0P A;  3RRU A;  4UI9 J;  4AXH A;  4J0U A;  1OT8 A;  2BED A;  2F0Y A;  4YVO A;  1INZ A;  3PZ3 A;  3Q9N C;  3UI2 A;  3G2T A;  3FTU A;  3KD7 A;  1DVP A;  4BSZ B;  4C0M A;  2VJ8 A;  4GU5 A;  5CCM A;  2P9S G;  3GZS A;  3L16 A;  1NA0 A;  2AJA A;  3DSX A;  3FUL A;  3L17 A;  4O1O A;  3ABL E;  4LUN U;  3SO8 A;  2WXO A;  4EHM A;  3J5Q B;  5FJY A;  4WUY A;  3MZL B;  1TNO A;  4PH4 B;  1SVX A;  1N9A A;  3CV0 A;  5JJT A;  1N11 A;  1HF8 A;  1UW4 B;  1VDY A;  2HR2 A;  2X6H A;  2OVB A;  2ZGG A;  3AU4 A;  4BX9 A;  3U66 A;  3KEA A;  3GZ2 A;  3RK6 A;  3CVN A;  5CBO A;  3VLD A;  3ZRH A;  1KZP A;  3ZKJ A;  2J08 A;  2WQ7 A;  4F3V A;  3UM3 A;  1QZ2 A;  2H6H A;  2AXV A;  4HRL A;  4CCA A;  4U0U A;  2GRP B;  3R9M A;  3PZ4 A;  3AG1 E;  5CEA A;  4CGW A;  2XZD G;  3SBT B;  1OWO A;  3LY8 A;  4A55 A;  4UQY A;  1ZU2 A;  5AQB A;  1N94 A;  4DLQ A;  4J8D A;  2HO1 A;  4FJY A;  2OCC E;  3UKR G;  1IKN D;  4I17 A;  1H6P A;  5EDS A;  1FVF A;  2V0P A;  1XGW A;  3NF1 A;  2XPY A;  1SA5 A;  2NC9 A;  4G2V A;  4U0S A;  3TG5 A;  4AVX A;  4DUI A;  4XI0 A;  2EIM E;  3Q47 B;  1Z6T A;  3ZIM A;  1NP7 A;  3EHN A;  4NAC A;  5KBA A;  3ZEF A;  3FTZ A;  3S7D A;  5B3S E;  1D8D A;  1QBQ A;  3UM1 A;  3QKY A;  1SZA A;  1S64 A;  3JUI A;  4HLE A;  5HKP A;  1JWG A;  2CFU A;  1N4R A;  3GW4 A;  3R7R A;  4LNB A;  4Y6W A;  4PS3 A;  5AIJ A;  1LTX A;  3L13 A;  4WAF A;  1WDY A;  3TWW A;  2VQ2 A;  4B8C B;  1TNY A;  1L5J A;  2FUL A;  4AM9 A;  1OWM A;  3AS4 A;  3NQP A;  3UTM A;  4OVV A;  4UWK A;  1HU3 A;  4WNG A;  2MRI A;  4BFR A;  2WVI A;  3J5P A;  3LEW A;  2RFA A;  4OYS A;  4A3V A;  4FLB A;  1IHB A;  2AXZ A;  1K1B A;  3PDN A;  1N0Q A;  2Q7F A;  2ZXW E;  5JJ6 A;  3TGO A;  2J09 A;  5EX3 A;  4IRU A;  2FEZ A;  2XEN A;  3UIN C;  3DEP A;  4FLH A;  3ASH A;  3MV2 B;  2PNN A;  1UG3 A;  4XE0 A;  4V3I A;  4U8V D;  4ANU A;  2QYU A;  4KVO A;  3B7U X;  2PL2 A;  4TXP A;  3N71 A;  4EZL A;  1UN9 A;  1PY1 A;  1UJK A;  3C3O A;  3AS8 A;  4A1S A;  4GCO A;  4CT0 A;  4JHK A;  1ELW A;  1XNF A;  2IO3 C;  3APC A;  1FPP A;  1HE8 A;  3KSL A;  4ATG A;  5G05 C;  4XEI G;  4BWR A;  4HLL A;  2GGF A;  3LYA A;  5EIB E;  1OWL A;  2J8S D;  4PS7 A;  4E6H A;  2J07 A;  2BF0 X;  1D9S A;  4I43 A;  3PZD A;  3ABM E;  3C5R A;  3Q4A B;  1GW6 A;  3B7B A;  4GMJ A;  3O4Z A;  1HS6 A;  4Y6C A;  2RKK A;  2F8X K;  4X8Q A;  1LD7 A;  4GTT A;  3ULQ A;  4DK5 A;  4L7T A;  5CRU A;  3G2S A;  3ZYK A;  2L6J A;  3BQO A;  4UWL A;  5AJD A;  4R7L A;  2V4H C;  5H7P A;  1EDU A;  3MA5 A;  2Y1L E;  4F1P A;  2OEV A;  3ASD A;  2IO2 C;  3Q49 B;  3ZUV B;  5B1A E;  2WXQ A;  3QWV A;  3CK9 A;  4JL0 A;  4JHR A;  4AY6 A;  4LRZ A;  1YMP A;  4N2Q A;  3Q73 A;  3CR3 A;  4FHK A;  2VSX E;  3LY7 A;  5G05 J;  3PUK A;  5KWD A;  4OAV B;  5CEC B;  3ML9 A;  2WXI A;  1HXI A;  4XIF A;  1O1S A;  5EX0 A;  4BET A;  3TG4 A;  4DI4 A;  2CG3 A;  4WNE A;  3APD A;  1BPO A;  4K03 A;  3EUV A;  4F1S A;  2NSZ A;  4ZHB A;  4N2S A;  1JWF A;  2GRQ B;  3DXK G;  2X6I A;  5LOZ A;  3RKV A;  3DSV A;  4ATZ D;  1IQR A;  4A1G A;  2XGS A;  3AU5 A;  1YCS B;  4GAA A;  2VSN A;  3QWP A;  1EF1 C;  3NOG D;  3G2V A;  4HVB A;  3FUM A;  3ZPJ A;  2LSU A;  3ABK E;  2WM9 A;  4G8K A;  3ASO E;  5BPP A;  1Q2Z A;  2KCV A;  1DNP A;  2IEJ A;  2OND A;  4EPZ A;  4KZ0 A;  4RSY A;  2LXM A;  2WMN A;  5KCM A;  2P9I G;  1U3C A;  3T8K A;  4HOQ A;  1S70 B;  1TJF A;  4TUM A;  3X2Q E;  4KMO A;  3JQ0 A;  3F6Q A;  3APF A;  3HVE B;  5BNW A;  4P29 A;  3O48 A;  4CDM A;  2IFU A;  5KJK A;  4U95 D;  3IBE A;  3E30 A;  2WPV A;  3LPZ A;  2YNQ A;  3ESL A;  3QAR A;  3V2O A;  3L9T A;  4BT8 A;  2M63 A;  3FTY A;  2J4B A;  2X6F A;  3HVE A;  5FZR A;  3EHQ A;  2KXP C;  4I1M A;  4N5C A;  3Q75 A;  4YVQ C;  2ETC A;  1K3Z D;  3FUJ A;  2DCP A;  4LEU A;  1FT2 A;  4UI9 C;  5AYW D;  2OEW A;  5ITZ F;  5CCL A;  5KJM A;  3QC1 A;  2R2L A;  3JXI A;  1H19 A;  1PAQ A;  4UWF A;  4FHJ A;  3ZNG A;  3ULE G;  2BUG A;  1BLX B;  4I9C A;  3I5P A;  5ENO D;  2X6J A;  2X38 A;  3SY2 A;  4ILI A;  4DX1 A;  2KM4 A;  3FUD A;  4ILG A;  3MKR A;  1RW2 A;  4BER A;  2DIW A;  3ONL A;  4XZ4 A;  1WG0 A;  2A5E A;  2P9N G;  5CMW A;  4Q69 A;  1HH8 A;  3ASF A;  3BG1 B;  4N5Q A;  2OV8 A;  2P9L G;  2VTB B;  1OCR E;  1HFA A;  4FP7 A;  4AIF A;  4BX8 A;  3U3W A;  1YYH A;  3SZ7 A;  5BW8 C;  1BD8 A;  5BUZ A;  1JPL A;  3FDH A;  2B0O E;  1TR4 A;  3CGH A;  2VTB A;  1HG2 A;  2VSY A;  1LD8 A;  4HB5 A;  4HXI A;  5JJ7 A;  1N4Q A;  1H0A A;  2V8S E;  4JD2 G;  2ION A;  4LG6 A;  5FTP A;  2J4D A;  3CVW A;  3SGH A;  4Q94 A;  3EJN A;  3AG2 E;  4O6F A;  1UN8 A;  3S7B A;  4J8F A;  4GB9 A;  4DX5 D;  3DPY A;  3EU5 A;  1E7V A;  3ZYQ A;  3Q7A A;  4TXR A;  2XEH A;  5A7D B;  4XX5 A;  4AEZ C;  3B7T A;  5JA4 D;  2RFM A;  3CQC B;  4J8S A;  5KNG A;  3FUF A;  4JVS A;  3ISM C;  4J6I A;  3FUH A;  3RRN B;  1MYO A;  4AOF A;  3ENE A;  2Y3A A;  2ILR A;  5AQ7 A;  3TWU A;  1S63 A;  1N54 A;  4L2L A;  1MX4 A;  2LUH A;  3FU3 A;  2RD0 A;  2MYO A;  3AS5 A;  2JLB A;  3QJZ A;  4CEM A;  3Q79 A;  3FP3 A;  2FO7 A;  3OXF A;  3KS2 A;  4I1A A;  3CVU A;  3FFL A;  2HYZ A;  2WXK A;  3FH8 A;  4L2Y A;  4B0Z A;  2Y0B G;  4DI3 A;  4GZ6 A;  3EIQ C;  4CDN A;  5BV0 A;  2L9B A;  3TL5 A;  4WWO A;  4I6E A;  2VGE A;  5FZQ A;  4TRQ A;  3OXL A;  2H6I A;  4GZD A;  1Z3X A;  1KPS B;  3HXD A;  3D3M A;  3EIJ A;  5BXU A;  4WWN A;  4MS6 A;  3IHY A;  5A6C A;  4LNU D;  4ILH B;  5HI7 A;  5M72 A;  3DRA A;  1MJ0 A;  3ZYM A;  4NIK A;  5JHA A;  3ZFW A;  5EYP F;  4GTS A;  3SFX A;  1FVH A;  5CBN A;  3C3Q A;  3SI5 A;  4LNG A;  3IV0 A;  3ZN3 A;  2KZT B;  3SD5 A;  1QNF A;  2WXG A;  4BES A;  3DPD A;  3ZXS A;  5BV1 A;  5LP0 A;  3TJP A;  5FT9 A;  3PS6 A;  2OOE A;  1H6O A;  4CYM D;  4U0Z A;  4U96 D;  3SBS A;  5C2Y A;  3E33 A;  3TWQ A;  4C48 B;  3DSS A;  3ML8 A;  3DEO A;  2X3M A;  2I1K A;  1V54 E;  2R05 A;  1TN8 A;  2KZT A;  3R9A B;  1AWC B;  3EDT B;  3MV3 B;  3PE4 A;  2UWJ G;  3HXE A;  3D9J A;  2AWI A;  4WNF A;  3LDZ A;  1ZB1 A;  3PVL A;  4KT6 B;  3KSQ A;  4Q96 A;  4BTB A;  3QOU A;  2DBA A;  4A63 B;  3LVQ E;  4DJA A;  2GRO B;  1OWP A;  2VSO E;  4U63 A;  3UT8 A;  3R7Q A;  3CQG B;  5D2M C;  4KVM A;  3FTW A;  1K8K G;  5ARF A;  1JUQ A;  4U8H A;  3T5X A;  4N3C A;  2F8Y A;  1NFI E;  4DPR A;  1TNB A;  1SA4 A;  4GCN A;  3D9O A;  3JUE A;  4MKT A;  1FT1 A;  4XKC A;  4ME2 A;  3QAQ A;  1B89 A;  4RVB A;  4CT4 A;  1UJJ A;  1OXJ A;  1G3N B;  3C72 A;  3DWL G;  1TN7 A;  1IQU A;  4AJW A;  4H7X A;  3TWX A;  4U04 A;  4UI9 K;  3TWS A;  2XEE A;  4KZC A;  4GTQ A;  3FUN A;  2DYR E;  4N3A A;  2DYS E;  5ENN A;  3Q7F A;  2E0I A;  2XZT G;  2Y4T A;  4F6R D;  5D66 A;  3VLF A;  3W9G A;  3L54 A;  2JEK A;  4FC8 A;  4XKB A;  3TAX A;  2WXM A;  3QNK A;  2YIN A;  4GYW A;  2ZGD A;  3SNX A;  5KJN A;  4KYO B;  3V31 A;  4HNA D;  4U7E B;  5AQA A;  4UQX A;  3PEU B;  3PUJ A;  3ONK A;  2I2O A;  3CHS A;  3NAW A;  5BXO A;  3VTX A;  5AQ9 A;  4JEU A;  2IOL A;  1WAO 1;  3NZU A;  1KT0 A;  4I6J A;  4GTP A;  1HX8 A;  3QWW A;  3ASG A;  3FU0 A;  2EQX A;  2XS8 A;  5EN5 D;  3DST A;  3UUX A;  4QFV A;  1V55 E;  4BT9 A;  2L0T B;  5IY5 E;  5DIZ A;  4K0R A;  4IUL A;  2WQH A;  2Y4U A;  5G04 C;  2QC9 A;  5HS0 A;  2IOS A;  2QYJ A;  3U64 A;  4GYY A;  1UOH A;  4FAD A;  4GA1 A;  4GA2 A;  2XEV A;  1YA0 A;  3PE3 A;  2EIL E;  1E8Z A;  2V5F A;  4O60 A;  4GPM A;  4FA6 A;  1SZ9 A;  5LCW C;  3IXE A;  3TWV A;  3GZ1 A;  2FI7 A;  3WXX A;  3AG3 E;  2IQC A;  4G25 A;  2Y69 E;  1SQM A;  2E2E A;  4CGV A;  1K1A A;  2XGM A;  3CLJ A;  5FIN A;  3ZVV A;  2XCB A;  5J90 A;  3QK0 A;  2J9Q A;  3UPV A;  1X5B A;  3AJI A;  3U9W A;  2WXR A;  4DX7 D;  4RQI A;  3PZ2 A;  3OXG A;  3RAU A;  3CKC A;  1KT1 A;  1Z5S C;  4I1O B;  4GTO A;  5FQ8 A;  5HRY A;  3S2A A;  3MCX A;  3PH0 C;  1H2U A;  2PM6 A;  1MX6 A;  3FUI A;  4G24 A;  4NQ0 A;  2P9U G;  2PM7 A;  3BG0 B;  3RO2 A;  5G04 J;  1E8X A;  1O5M A;  2KCK A;  4EBA A;  3B95 A;  5D0Q D;  3D9H A;  2OVF A;  1WY6 A;  4MRU A;  1Y6I A;  2VGY A;  3RO3 A;  4Z68 A;  3C98 A;  2XQ0 A;  2KC7 A;  4UWG A;  3MYV A;  3HIZ A;  2V4L A;  2IJG X;  2IY0 C;  5LCW J;  3OTN A;  5EYL A;  4F7A A;  3UIO C;  1WM5 A;  2GRM A;  2XS1 A;  3HXB A;  2GRL A;  3RSE G;  3AAA C;  4HRN A;  3UIP C;  5AN8 A;  2DWZ A;  4MLP A;  3JYS A;  2WB2 A;  4L1B A;  3AG4 E;  4UQZ A;  5AAO A;  4K5A B;  2WMO A;  3SFY A;  3FWV A;  4JB8 P;  1P5Q A;  4D10 C;  3CVV A;  1HZ4 A;  4GML A;  4IN3 B;  4N39 A;  3WG7 E;  2KBX A;  3EU9 A;  2H6F A;  1OWN A;  2UY1 B;  3HXC A;  3OAW A;  3HHM A;  3ZYL A;  2MOW A;  2L6B A;  2I9C A;  2V5Q C;  3NB2 A;  4N3B A;  4EEC A;  2BKK B;  3P2B A;  3KAE A;  3S7F A;  4GZ5 A;  5ENR D;  3UXG A;  4M7C A;  4JHJ A;  3T9K A;  4HOT A;  1TN6 A;  3RIB A;  4GZC A;  4TXQ A;  3B13 A;  3CK7 A;  1E96 B;  3B7S A;  1A17 A;  2UY1 A;  1EYH A;  4MBG A;  3BUA A;  4FUL A;  2NYJ A;  4JZY A;  3Q9U C;  3RJV A;  1O1T A;  1OUV A;  4ANV A;  3FUK A;  3S7J A;  2I6H A;  3V2X A;  2AXU A;  5LX8 A;  1E90 A;  3CVP A;  4FJZ A;  4J7W A;  3U4T A;  3URZ A;  3I4G A;  1FCH A;  3HDX A;  5FQ4 A;  4LSZ E;  2XGO A;  2DZO A;  3BEE A;  2CHX A;  3DSU A;  4UUC A;  4YDE A;  5ENS D;  3UKU G;  4G8L A;  2GW1 A;  3MJW A;  3CHM A;  1MHQ A;  1BI7 B;  2KAT A;  1JCQ A;  2HE0 A;  3PRE A;  5JHB A;  3ZXP A;  5B1B E;  2C2L A;  3LS8 A;  2C0L A;  4EQF A;  3FH7 A;  3RU0 A;  4TV3 A;  2LO6 A;  2CG2 A;  5C1D A;  2C0M A;  4PUC A;  2J49 A;  4ACK A;  4UWH A;  2WXJ A;  1ZBP A;  3L82 A;  3CHQ A;  1AP7 A;  4C9B B;  5FQ7 A;  2R59 A;  1NI1 A;  2DZN A;  3PNL B;  4BSX A;  2H6G A;  2YHC A;  1TNU A;  3E34 A;  3D9M A;  5T8I A;  3TWT A;  4OAU C;  1N52 A;  4GA0 A;  4K5B A;  3JXJ A;  4HQD A;  4DX6 D;  3VLE A;  5FZS A;  4GPK A;  2F37 A;  1OY3 D;  4YDW A;  3PNT B;  3FEX A;  4NRH B;  3EHR A;  1HO8 A;  2ETA A;  4YND A;  1PC2 A;  3ZU7 B;  4G26 A;  3FHE A;  4GTV A;  2WXL A;  4ACL A;  2ETB A;  2BTD A;  4FU3 A;  2AVP A;  5FIO A;  5A23 A;  2CFZ A;  4JW1 A;  2A5U A;  3SHF A;  1OCZ E; 
#chains in the Genus database with same CATH homology
 1DVP A;  4BT8 A;  4C0M A;  2VJ8 A;  2M63 A;  4GU5 A;  3FTY A;  3VLF A;  5CCM A;  2J4B A;  3GZS A;  2X6F A;  1E7U A;  3HVE A;  3L16 A;  3G2W A;  2NXP A;  3L54 A;  2JEK A;  2HM8 A;  4FC8 A;  4PS8 A;  4XKB A;  1NA0 A;  5FZR A;  3TAX A;  2WXM A;  3FUL A;  3L17 A;  4G11 A;  4LUN U;  3QNK A;  4JEH A;  4I1M A;  4BTA A;  2WXO A;  2WXP A;  2YIN A;  4GYW A;  4N5C A;  5ANL A;  5FJY A;  4J8E A;  3SNX A;  4WUY A;  5AJL A;  5KJN A;  3MZL B;  3FU6 A;  4PH4 B;  4YVQ C;  4KYO B;  3FUJ A;  3CV0 A;  2DCP A;  3G2U A;  2L0I A;  4JA7 A;  4LEU A;  3ZHE B;  4UQX A;  3PEU B;  3PUJ A;  3ONK A;  5JJT A;  4UI9 C;  5AYW D;  1HF8 A;  5CCL A;  2I2O A;  1UW4 B;  1VDY A;  2HR2 A;  2X6H A;  3CHS A;  3QC1 A;  2OVB A;  5KJM A;  3Q15 A;  3AU4 A;  3U66 A;  4BX9 A;  1H19 A;  1PAQ A;  4UWF A;  4FHJ A;  2BUG A;  2YQ8 A;  3VTX A;  4B8A A;  4JEU A;  2IOL A;  3LY9 A;  3TXN A;  3B7R L;  3GZ2 A;  1WAO 1;  4I9C A;  3NZU A;  3I5P A;  3RK6 A;  2LAI A;  4JXT A;  4KXK B;  1KT0 A;  2X6J A;  3CVN A;  3IHV A;  2X38 A;  3VLD A;  4ILI A;  3HYM B;  4I6J A;  3ZRH A;  1HX8 A;  2KM4 A;  3QWW A;  3ZGQ A;  3ASG A;  3FU0 A;  2EQX A;  3Q5M A;  4GZ3 A;  4APO A;  2J08 A;  3ZHE A;  3UX4 A;  3FUD A;  4ILG A;  3UUX A;  1QQE A;  3MKR A;  4QFV A;  2WQ7 A;  3LKU A;  2DIW A;  3ONL A;  4BT9 A;  2L0T B;  4XZ4 A;  5CMY A;  4F3V A;  5AEN A;  3FU5 A;  1QZ2 A;  5DIZ A;  2AXV A;  4K0R A;  4IUL A;  2WQH A;  4JPS A;  2Y4U A;  4CCA A;  4APF A;  4U0U A;  5G04 C;  5CMW A;  3CVQ A;  5EKQ D;  2IOS A;  4JA9 A;  4Q69 A;  3GYZ A;  4CGW A;  3U64 A;  3SBT B;  1HH8 A;  3ASF A;  3BG1 B;  4GYY A;  1OWO A;  3JCK C;  3LY8 A;  4A55 A;  4FAD A;  4GA1 A;  4UQY A;  3FTV A;  2OV8 A;  1ZU2 A;  2VTB B;  4GA2 A;  4DLQ A;  4J8D A;  2XEV A;  2FBN A;  2HO1 A;  3IEG A;  2QFC A;  4FJY A;  1HFA A;  1YA0 A;  4FP7 A;  2QY7 A;  3PE3 A;  5CHE E;  4AIF A;  4I17 A;  4BX8 A;  3U3W A;  1E8Z A;  2V5F A;  2LSV A;  2PQN A;  5EDS A;  1FVF A;  2V0P A;  1XGW A;  3NF1 A;  2XPY A;  4FA6 A;  2NC9 A;  1SZ9 A;  3SZ7 A;  2YHE A;  4G2V A;  5LCW C;  4U0S A;  3TG5 A;  3GZ1 A;  4GYO A;  5BW8 C;  4AVX A;  4W9R A;  4XI0 A;  5BUZ A;  3UT4 A;  3Q47 B;  1Z6T A;  2FI7 A;  3WXX A;  2IQC A;  4G25 A;  4AV7 A;  3ESK A;  1JPL A;  3ZIM A;  1SQM A;  2E2E A;  1NP7 A;  3T8M A;  3FDH A;  4CGV A;  4URK A;  5T4Y A;  2RG8 A;  2XGM A;  3CGH A;  3CLJ A;  3EHN A;  1HG2 A;  2XCB A;  4NAC A;  2VSY A;  3ZVV A;  3QK0 A;  5J90 A;  2VTB A;  2J9Q A;  4HXI A;  4M3O A;  3ZEF A;  4TUU A;  3UPV A;  3FTZ A;  3S7D A;  3E4B A;  4F53 A;  1X5B A;  5JJ7 A;  1H0A A;  4RG6 A;  2V8S E;  3U9W A;  3QKY A;  2WXR A;  5E75 A;  1SZA A;  3D9L A;  2ION A;  3CHO A;  4CRW A;  3OXG A;  3JUI A;  2WXF A;  2CHZ A;  3CKC A;  1KT1 A;  4HLE A;  5FTP A;  1JWG A;  3KEZ A;  2CFU A;  3GW4 A;  4I1O B;  5FQ8 A;  3R7R A;  4Y6W A;  4PS3 A;  3CK8 A;  5AIJ A;  2J4D A;  3CVW A;  3SGH A;  1E8W A;  4Q94 A;  5C1D A;  4EBA G;  3S2A A;  1LF8 A;  3EJN A;  3MCX A;  3PH0 C;  4O6F A;  1UN8 A;  1H2U A;  3S7B A;  3L22 A;  3L13 A;  4J8F A;  4WAF A;  4GB9 A;  5FWQ A;  2PM6 A;  3ZYQ A;  1E7V A;  3P1U A;  1H2T C;  2ZU6 B;  4BY6 A;  2VQ2 A;  2WXN A;  1E8Y A;  3FUI A;  4B8C B;  4G24 A;  4HOU A;  4NQ0 A;  5HQ8 A;  5A7D B;  4B89 A;  3MEK A;  4XX5 A;  1L5J A;  3CVY A;  2FUL A;  2PM7 A;  4AM9 A;  4C0E A;  1OWM A;  2IF4 A;  3AS4 A;  3BG0 B;  4AEZ C;  3B7T A;  3NQP A;  3RO2 A;  5G04 J;  1E8X A;  2KCK A;  2PZI A;  3CQC B;  4OVV A;  4EBA A;  5KJL A;  3CSF A;  4UWK A;  5D0Q D;  1ELR A;  1HU3 A;  2OVF A;  1WY6 A;  5D0O D;  4I2Z A;  3EHM A;  2MRI A;  4J8S A;  4WNG A;  4BFR A;  4MRU A;  3FUF A;  2WVI A;  2WXH A;  4JVS A;  1Y6I A;  5ARG A;  4J6I A;  3FUH A;  1NZN A;  2VGY A;  3RRN B;  3RO3 A;  4HS2 A;  4AOF A;  3C98 A;  2XQ0 A;  3ENE A;  3LEW A;  4OYS A;  4A3V A;  4FLB A;  4DLO A;  2KC7 A;  2WQ6 A;  4UWG A;  2Y3A A;  1Z3Y A;  2AXZ A;  3PDN A;  2ILR A;  2Q7F A;  1TJC A;  3MYV A;  4G23 A;  3HIZ A;  5JJ6 A;  2V4L A;  3RRM B;  2IJG X;  1N54 A;  3TGO A;  4L2L A;  2FF4 A;  2J09 A;  3SFZ A;  5EX3 A;  5LCW J;  3PEV B;  4IRU A;  1ELK A;  3JQ1 A;  3OTN A;  4F7A A;  2FEZ A;  3L6A A;  1WM5 A;  2GRM A;  4FLH A;  3FU3 A;  2XCC A;  2RD0 A;  3CHP A;  2P58 C;  3AS5 A;  5LFA A;  3K9I A;  2GRL A;  3ASH A;  3MV2 B;  5G2N A;  5ANR A;  2JLB A;  1UG3 A;  4I9E A;  3QDN A;  4XE0 A;  3QJZ A;  4CEM A;  1Y8M A;  3FP3 A;  4V3I A;  4ANU A;  2FO7 A;  1H2V C;  3OXF A;  4MLP A;  3CST A;  2XRZ A;  3KS2 A;  4I1A A;  3JYS A;  2WB2 A;  3QB2 A;  4KVO A;  3CVU A;  3FFL A;  3B7U X;  2XRY A;  2PL2 A;  3L08 A;  1H6K A;  3N71 A;  4EZL A;  2MHK A;  3FY4 A;  4L1B A;  1UN9 A;  1PY1 A;  1UJK A;  4UQZ A;  2HYZ A;  2WXK A;  3FH8 A;  3D9N A;  3AS8 A;  2WMO A;  4L2Y A;  4A1S A;  3FWV A;  4GCO A;  4CT0 A;  4JHK A;  3CEQ A;  1ELW A;  1P5Q A;  4D10 C;  3CVV A;  4B0Z A;  1XNF A;  1HZ4 A;  3APC A;  4DI3 A;  4GML A;  1HE8 A;  4GZ6 A;  2A4Z A;  5G05 C;  4IN3 B;  4ATG A;  3EIQ C;  3DBS A;  4BWR A;  2GGF A;  3LYA A;  4HOR A;  4N39 A;  1OWL A;  4CDN A;  4PS7 A;  4E6H A;  2J07 A;  5BV0 A;  2L9B A;  2BF0 X;  3TL5 A;  1OWN A;  4L23 A;  2UY1 B;  4WWO A;  4I43 A;  3OAW A;  3PZD A;  4I6E A;  3HHM A;  4JC8 A;  5FZQ A;  4TRQ A;  3I3N A;  3OXL A;  4U07 A;  3ZYL A;  2MOW A;  4TV3 A;  3RU0 A;  3UMV A;  2LNI A;  4GZD A;  2I9C A;  4N3B A;  1Z3X A;  4EEC A;  3CVX A;  2XPI A;  3CKB A;  3Q4A B;  3P2B A;  1GW6 A;  4ABN A;  3D3M A;  3KAE A;  4GMJ A;  3S7F A;  3EIJ A;  3O4Z A;  4GZ5 A;  4MS6 A;  4WWN A;  3CHR A;  3IHY A;  5A6C A;  1HS6 A;  4ILH B;  4Y6C A;  5HI7 A;  5M72 A;  4JHJ A;  4G1T A;  5BT1 A;  4HOT A;  5DBK A;  3RIB A;  4GZC A;  3ZYM A;  3B13 A;  2VGX B;  3CK7 A;  5FQ6 A;  1EPU A;  5JHA A;  3ULQ A;  4DK5 A;  3LCA A;  1E96 B;  3B7S A;  1A17 A;  4L7T A;  2UY1 A;  4WND A;  3G2S A;  3ZFW A;  3ZYK A;  1EYH A;  2L6J A;  4FUL A;  3UQ3 A;  4UWL A;  3SF4 A;  3I4R B;  1FVH A;  4JZY A;  5AJD A;  1IYG A;  3RJV A;  3FTS A;  4R7L A;  3SI5 A;  4I2W A;  4ANX A;  3IV0 A;  3ZN3 A;  1OUV A;  2R17 C;  1EDU A;  2KZT B;  3MA5 A;  3SD5 A;  4ANV A;  3FUK A;  3S7J A;  1MQS A;  3ASD A;  1QNF A;  2WXG A;  3DPD A;  3ZXS A;  3LVR E;  2CHW A;  3LXU X;  3TJP A;  5BV1 A;  5FT9 A;  3Q49 B;  5LP0 A;  3MKQ B;  3PS6 A;  4NUR A;  2I6H A;  2OOE A;  2VGX A;  1NA3 A;  2WXQ A;  4A3T A;  3QWV A;  2AXU A;  3FH5 A;  3CK9 A;  5LX8 A;  1E90 A;  3CVP A;  4FJZ A;  4U0Z A;  4JL0 A;  3SBS A;  4JHR A;  2I1J A;  5C2Y A;  3U4T A;  4AY6 A;  3URZ A;  4LRZ A;  4E85 A;  3I4G A;  4CDR A;  3FEY A;  1FCH A;  3TXM A;  3ML8 A;  3HDX A;  2XPZ A;  5FQ4 A;  4N2Q A;  2X3M A;  4HFG A;  3CR3 A;  4EZJ A;  2I1K A;  2VYI A;  3D9I A;  3D9P A;  3LJ3 A;  4FHK A;  2XGO A;  4LCT A;  2VSX E;  2KZT A;  4B94 A;  3BEE A;  2CHX A;  3LY7 A;  3R9A B;  5G05 J;  3PUK A;  1W3B A;  2GW1 A;  3MJW A;  3MKQ A;  1KLX A;  3CHM A;  3ML9 A;  1MHQ A;  2WXI A;  2KAT A;  1HXI A;  3EDT B;  3MV3 B;  4XIF A;  3PE4 A;  5EX0 A;  2UWJ G;  3PRE A;  3TG4 A;  4DI4 A;  5JHB A;  3D9J A;  3D9K A;  2C2L A;  3LS8 A;  2AWI A;  2C0L A;  4WNF A;  3ZW3 A;  3LDZ A;  2CG3 A;  4WNE A;  4EQF A;  3FH7 A;  2LO6 A;  1U3D A;  2IU1 A;  3APD A;  2CG2 A;  3PVL A;  4H7Y A;  2X6K A;  1BPO A;  1IHG A;  2C0M A;  2J49 A;  4KT6 B;  4PUC A;  4K03 A;  3VTY A;  4ACK A;  4F1S A;  2NSZ A;  4KBQ A;  4I6G A;  1JWF A;  4UWH A;  4N2S A;  2WXJ A;  3IKO B;  4Q96 A;  3PRZ A;  2X6I A;  5LOZ A;  3RKV A;  4PDX A;  4BTB A;  1ZBP A;  2DBA A;  3QOU A;  3CHQ A;  3FTX A;  3LVQ E;  3CVL A;  4C9B B;  4IYP A;  4DJA A;  4RG9 A;  5FQ7 A;  2R59 A;  1IQR A;  4A1G A;  2XGS A;  4AP2 A;  1OWP A;  3AU5 A;  3PNL B;  4GAA A;  2VSN A;  3QWP A;  4BSX A;  4LER A;  3MX3 A;  4WWP A;  1EF1 C;  2VSO E;  4U63 A;  3CIA A;  2KCL A;  3UT8 A;  3G2V A;  2YHC A;  3R7Q A;  3CQG B;  4XI9 A;  3D9M A;  4HVB A;  5T8I A;  4KVM A;  3FUM A;  3ZPJ A;  3FTW A;  2AW6 A;  2LSU A;  5ARF A;  1JUQ A;  4U8H A;  2WM9 A;  2PQR A;  3T5X A;  4N3C A;  4HOS A;  1N52 A;  4GA0 A;  5BPP A;  2LAH A;  4DPR A;  2KCV A;  4AY5 A;  1DNP A;  4EPZ A;  2OND A;  4KZ0 A;  4GCN A;  4RSY A;  5T3R A;  2XHE A;  3VLE A;  5FZS A;  4GPK A;  2R5S A;  3D9O A;  2WMN A;  5KCM A;  4MKT A;  4XKC A;  1U3C A;  4EZK A;  4HOQ A;  4ME2 A;  3QAQ A;  4ANW A;  1B89 A;  1TJF A;  4RVB A;  4CT4 A;  1UJJ A;  1TEZ A;  1HG5 A;  4KMO A;  3PNT B;  3JQ0 A;  3FEX A;  4NRH B;  5J08 A;  1IQU A;  4AJW A;  1HO8 A;  3MGB A;  5G55 A;  3NZS A;  4OVU A;  3APF A;  3HVE B;  4YND A;  5E76 A;  3T5V A;  4H7X A;  4U04 A;  1PC2 A;  4UI9 K;  5BNW A;  4P29 A;  3O48 A;  3UT7 A;  4G26 A;  4KZC A;  4CDM A;  3FUE A;  3FHE A;  1S0P A;  3FUN A;  2IFU A;  2WXL A;  4ACL A;  3RRU A;  5KJK A;  4FU3 A;  2BTD A;  3IBE A;  2AVP A;  4N3A A;  4UI9 J;  5A23 A;  2CFZ A;  4JW1 A;  5ENN A;  2WPV A;  4AXH A;  4J0U A;  3LPZ A;  2YNQ A;  2E0I A;  2A5U A;  4YVO A;  1INZ A;  3ESL A;  3G2T A;  3SHF A;  3QAR A;  2Y4T A;  3FTU A;  3KD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...