2HR2A

Crystal structure of a tpr-like protein (ct2138) from chlorobium tepidum tls at 2.54 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
156
structure length
156
Chain Sequence
KPLKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAMEISHTMPPEEAFDHAGFDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAEAMPEFKKVVEMIEERKGETPGKERMMEVAIDRIAQLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (NP_663012.1) from Chlorobium tepidum TLS at 2.54 A resolution
rcsb
source organism Chlorobium tepidum
molecule tags Unknown function
molecule keywords Hypothetical protein
total genus 57
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12968 DUF3856 Domain of Unknown Function (DUF3856)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2hr2A00
2XEVA 2PQRA 3ASHA 2FBNA 5G05J 5G05C 5CCLA 3CK9A 2HYZA 3OXGA 1KT1A 4ME2A 3MEKA 1OUVA 5FZQA 3RU0A 4I2WA 2AVPA 3ULQA 3O48A 4U0UA 2E2EA 4ABNA 3Q4AB 3ASGA 1ZBPA 1YA0A 4Y6CA 3FP3A 3U3WA 4GA1A 4G26A 3BEEA 2YQ8A 3ASDA 4Y6WA 4APOA 3RJVA 2DBAA 3ASFA 2GW1A 2HR2A 3NF1A 3TG4A 5KJMA 3CK8A 5D0QD 4AY6A 4GYOA 1IYGA 3CVPA 2KCLA 1P5QA 4N39A 1Y8MA 4I9EA 4N2QA 4CDRA 5HQ8A 2JLBA 3HYMB 4UQYA 3ZHEB 2LSVA 4GZ3A 2R5SA 3GZ1A 4GCNA 1TJCA 2C0MA 2NC9A 4GYYA 4U04A 1FCHA 2FEZA 3S7FA 4H7XA 4AIFA 1XNFA 4UQZA 4J8DA 3JYSA 3GW4A 1ELRA 4NRHB 4U0SA 1ELWA 3S7DA 4CGVA 1E96B 2IF4A 3K9IA 3ESKA 1HH8A 3MV2B 2XGSA 2V5FA 4N3BA 3PDNA 4JHRA 4YNDA 5JJTA 1NA0A 1QZ2A 5JJ6A 1QQEA 4GZ6A 4I1AA 4I2ZA 3ZN3A 2XGOA 4KXKB 2LSUA 4RG6A 1HZ4A 4WNGA 3RIBA 4HOQA 3QKYA 4AM9A 3KD7A 3FFLA 3CVLA 5LCWC 4EQFA 2PQNA 3S7BA 5LCWJ 4JL0A 5M72A 4GPKA 4G1TA 3UQ3A 3UPVA 2ONDA 3WXXA 3LCAA 5KJLA 4N2SA 1IHGA 1W3BA 4YVQC 3QWWA 2QFCA 2BUGA 2FO7A 3QOUA 4KYOB 2PL2A 3CVNA 3CVQA 3LY9A 3QDNA 4N5CA 5C1DA 3U4TA 4J8EA 2HO1A 2WQHA 4LEUA 5HI7A 3SZ7A 2KCVA 2VGYA 4G23A 4N3AA 4WNEA 3S7JA 2L6JA 2YHCA 3LPZA 3KS2A 3LYAA 2C0LA 5EX0A 3RKVA 2J9QA 5ARFA 5CCMA 3CKCA 4J0UA 3ZGQA 2UY1A 2VYIA 4A1SA 3AS4A 3QWVA 4RG9A 1NZNA 1WAO1 2Q7FA 2XCCA 3Q15A 5JJ7A 2LNIA 4GA2A 4W9RA 5DBKA 3LY8A 5KJNA 3VTYA 2FF4A 3MV3B 4HOUA 5FJYA 2KATA 4H7YA 2KC7A 4GA0A 3MA5A 4BWRA 4HOSA 2XPIA 5FTPA 2XGMA 3URZA 4BTAA 5ARGA 4XI0A 2WPVA 1PC2A 3ZPJA 3CV0A 3GZ2A 3LY7A 4UI9K 5FZRA 3TGOA 4HORA 4HOTA 1A17A 2VQ2A 3CK7A 4KBQA 3QWPA 5BW8C 5DIZA 2IFUA 3FWVA 2FI7A 3KAEA 2I6HA 4U0ZA 3Q47B 3SF4A 2VSNA 3Q5MA 4GCOA 5AYWD 5FZSA 5G04J 5G04C 4GYWA 4WUYA 3Q49B 4BTBA 4N3CA 3RO2A 3CEQA 4NQ0A 3AS5A 3MKRA 4JA9A 2UY1B 5FT9A 4IN3B 3RO3A 3OXFA 2VGXB 3N71A 1NA3A 3ZHEA 4B94A 5D0OD 4XI9A 4G25A 3R9AB 3VTXA 4BT9A 3UUXA 2XCBA 4GZ5A 4UI9J 4UI9C 4J8FA 4WNFA 5BT1A 2VSYA 5KJKA 4WNDA 3EDTB 3TAXA 5BNWA 4CGWA 2C2LA 1KLXA 3CKBA 5EX3A 1ZU2A 5EKQD 3LKUA 4YVOA 4I9CA 3ZFWA 4U07A 4AY5A 4F3VA 2UWJG 5CHEE 2P58C 4BT8A 3PE4A 1B89A 4G2VA 2MHKA 1WM5A 3E4BA 4O6FA 2PZIA 3IEGA 2OOEA 3AS8A 3PE3A 1KT0A 2VGXA 2Y4UA 3OXLA 1HXIA 4I17A 2Y4TA 4UQXA 4XIFA 2KCKA 5A7DB 5A6CA 3GYZA 4G24A 3TG5A 4JA7A
chains in the Genus database with same CATH superfamily
5EDSA 2WXFA 5EYLA 3CK9A 4F53A 1RZ4A 5FZQA 1N4QA 2ZISA 2Y1LE 3QJZA 3RJVA 5KJMA 3T8MA 3PS6A 3L82A 4U8VD 3TWXA 3D9NA 3S7FA 2B6CA 3ZNGA 2R59A 2BEDA 4HVBA 3ZYLA 3EUVA 1DCEA 2ZGDA 3PRZA 3FUNA 1TN8A 3CVQA 4J8EA 4DX6D 1JUQA 3FH7A 2QYJA 2H6HA 5KNHD 5AARA 5EIDA 2J4DA 1DCQA 4F1SA 5KJNA 2XPIA 5BV0A 5A23A 3KAEA 5CERB 3FU0A 4CRWA 1DC2A 3AS5A 2X6IA 5EYPF 4GMJA 4N5QA 2DZNA 3R9AB 5B1AE 1H2TC 3UUXA 4ANWA 3EU9A 4K5CA 5BT1A 4J8FA 3ONLA 2XHEA 2I2OA 3IHVA 1KT0A 3APFA 3J5QB 2P9UG 4L1BA 4XZ4A 4FADA 1UJKA 3PZDA 5AN8A 3Q4AB 3TWUA 4GA1A 3G2TA 4HRNA 3UXGA 4M7CA 1UJJA 4HBDA 3VLFA 4N2QA 1H6PA 2R02A 1BI7B 1KZPA 3S7DA 3AG1E 4GTTA 4YDOA 2AW6A 1QQEA 2OVBA 4HS2A 3QKYA 4JL0A 3ABKE 4XX5A 4KMOA 5BXUA 3E32A 2AXZA 1U2VG 3ISMC 4C0MA 2EQXA 2EIME 1OWOA 1VDYA 2CHWA 1WAO1 2CHZA 2IONA 1X81A 4HOSA 5J08A 1E8ZA 1EF1C 5FTPA 2IOLA 3FY4A 1WDYA 4LUNU 3AU4A 4FU3A 4O1OA 1NP7A 4KBQA 1FT2A 4UWLA 5BUZA 3F6QA 5AYWD 4JXTA 4GZCA 3IHYA 4NURA 3PZ2A 4Q69A 3QB2A 4U95D 1N4SA 3UM1A 4GZ5A 2RFMA 1TNYA 3V79K 2PM7A 2XRYA 1TJFA 1OT8A 5AQ7A 2WM9A 3UI2A 1N95A 5AQ9A 3DSWA 3UM2A 3CSTA 1N52A 3BUAA 3ZYQA 4ME2A 3MEKA 3U66A 3O48A 3FUDA 2L9BA 3SFZA 4LRZA 5T8IA 4WWNA 3HXDA 3CVYA 3D3MA 1P5QA 4N39A 3SI5A 2XPYA 3G2UA 3SNXA 4DJAA 3HYMB 3I4RB 5LFAA 4JZYA 4M3OA 4J8DA 1ELRA 3R9MA 4CGVA 5ENSD 4EECA 3TXNA 1HH8A 4APFA 3CVLA 2VTBA 4DLQA 3UPVA 1TNOA 5KJLA 4AEZC 4E6HA 1EPUA 1HO8A 3QARA 3SZ7A 3AAAC 4G23A 4WNEA 4BFRA 2H6FA 5KCMA 4UWHA 3PUKA 2XCCA 3CHQA 3FH5A 5ENNA 1RW2A 5ARGA 4L9PA 2CG2A 2KZTA 4U63A 3G2VA 3EHRA 3L16A 1H6OA 2XZDG 3CEQA 1OY3D 3RO3A 4IN3B 4ANUA 3V2OA 2BTDA 4R7LA 3FEXA 2X38A 2VSYA 1HG2A 2BF0X 1Z3YA 4F3VA 3LS8A 1WM5A 4O6FA 3UX4A 3NOGD 3DBSA 4TXRA 3SQVA 4L23A 1V54E 4I6EA 4JEHA 3EHQA 3OXGA 1KT1A 5CRUA 3QC1A 3FUFA 3FU3A 4L2YA 1TNZA 4UWFA 3UIPC 2JLBA 4U04A 4A3TA 3EU5A 3DEPA 3GW4A 1KPSB 3ESKA 3TWRA 4N3BA 3PDNA 4I6JA 4KXKB 1UN8A 1MYOA 4BESA 2PQNA 4GPMA 4LG6A 4L2LA 5AQBA 3ML8A 4ANVA 3UTMA 2F0YA 2ZXWE 3KS2A 1SW6A 4GAAA 2J9QA 5ARFA 3DPYA 4CYMD 3QWVA 1YYHA 3VTYA 4GA0A 3ZPJA 2R05A 3UT4A 3CK7A 3C3OA 4KZCA 3JQ1A 2UY1B 4A3VA 2R2LA 2AWIA 4WNDA 5LOZA 3ZFWA 4AOFA 1MZCA 5E75A 3DSSA 2MHKA 3L17A 4G8KA 2GGFA 1O5MA 1FVHA 4U8YD 4KT6B 1OWMA 2J49A 2AXVA 2WXOA 3ZXPA 3PZ3A 5G05C 2HYZA 4GTPA 3JQ0A 5JHBA 3U64A 3HDXA 3U3WA 1NFIE 2DBAA 3L9TA 2DIWA 2WVIA 4I9EA 3HG0D 3ZHEB 4NACA 4K5AB 2FEZA 4H7XA 3QK0A 1E96B 3C5RA 3NBNB 3RK6A 3ZN3A 2WXNA 4DPRA 4ILHB 1FT1A 4PH4B 3E33A 3SD5A 2QFCA 4OVVA 4TXPA 4GU5A 4ATZD 2P9LG 3LPZA 3SFYA 2L0TB 3DPDA 3AJIA 5CCMA 4A1SA 1K3ZD 4RG9A 2Q7FA 3Q7FA 2MRIA 3MV3B 4ACKA 3CV0A 4FP7A 3FUEA 3TGOA 4BETA 1G3NB 4TXQA 3B7UX 4GTMA 4DI4A 3AG3E 4TUMA 4XI9A 4Q96A 4U8HA 4BT9A 1IHBA 2V4LA 3V31A 3JUIA 3KEAA 4JEUA 2MYOA 2BKGA 2UWJG 5CHEE 4G2VA 3ZRHA 3KSQA 1EYHA 5CMYA 3ABME 1PAQA 1MHQA 2VGXA 3NAWA 3FULA 2A5UA 3HXEA 2XEVA 4I43A 3SO8A 3FUMA 3Q7AA 3FP3A 4EZJA 1NL4A 4J7WA 4FJYA 1XGWA 3EHNA 4JB8P 1H0AA 4CDRA 1O1TA 5HQ8A 4UQYA 2LSVA 4GYYA 3APDA 2NC9A 1XNFA 2XEHA 1TR4A 4PS8A 1V55E 1INZA 3MV2B 3DRAA 3G2SA 3HXFA 4GZ6A 1D8EA 3P1UA 2X6JA 3KD7A 3C3RA 5FQ7A 3UQ3A 4LERA 2ONDA 1UN9A 3B7SA 3DSTA 3JUEA 1W3BA 2FO7A 5B3SE 4CDNA 1HG5A 1E7UA 4BSXA 2QY7A 3RRNB 2C0LA 5AAOA 3ULEG 1Z3XA 3QNKA 1MJ0A 3I5PA 2GRNB 3X2QE 3MA5A 2WXRA 4XI0A 2WXQA 3BG0B 3HHMA 4HOTA 2GRLA 3TWVA 4GMLA 3Q5MA 1ZB1A 4B8CB 4GYWA 3B7TA 1SA4A 2J07A 3CVUA 2OV8A 2VGXB 1D8DA 2GROB 2QZAA 4AP2A 4HLEA 4DUIA 5KWDA 2P9NG 3CHRA 5FQ8A 3SY2A 4K03A 1B89A 2B0OE 2WB2A 4A63B 4EBAA 4I17A 1BD8A 2WXMA 2MOWA 3D9PA 3PVLA 2FBNA 3UINC 1HU3A 3HIZA 3RU0A 3L13A 4G8LA 1ZBPA 1JCSA 4G26A 5EIBE 3ASFA 3CK8A 4GYOA 1TN6A 3E30A 5AJLA 2GRMA 3LDZA 2EILE 1LTXA 3SHFA 5AQAA 1ELWA 3FU5A 1QZ2A 2J08A 4HOQA 5FQ4A 1E8WA 4GTVA 5FWQA 1IHGA 3UM3A 1GW6A 3DEOA 2PL2A 3PEVB 4JHJA 4V3IA 3U4TA 3L54A 3B7BA 3DSVA 4MRUA 3ZGQA 1E7VA 5JJ7A 5CBOA 2A5EA 2ILRA 1K8KG 5BW8C 3NB2A 4EPZA 2AXUA 3Q47B 2VSNA 4BTBA 2WXIA 4JA9A 2E0IA 5D0OD 3FH8A 4BX9A 4HFGA 1ZU2A 3VLEA 4MS6A 2EIJE 3CHOA 3CQCB 3E4BA 3CIAA 2PZIA 2OOEA 2KCKA 1PY1A 4JA7A 3D9OA 1L5JA 1OWLA 4GB9A 3D9JA 4U0UA 4AV7A 4C48B 5FQ6A 3RRUA 4Y6WA 2WQ6A 3TG4A 5G55A 4EBAG 2LUHA 3FHEA 3PNLB 5CBNA 1NA0A 2QC9A 2H6IA 2GRPB 2IO2C 4I2ZA 2GRQB 4DX5D 4UWGA 2A4ZA 2F37A 3FFLA 3AU5A 3UM0A 1IKND 4MKTA 2BUGA 3QOUA 5HI7A 2HO1A 4LEUA 3IKOB 2GRRB 5EX0A 3I3NA 3TWTA 1MX4A 4J0UA 2UY1A 1TYQG 2Y69E 3HVEB 5CMWA 1QNFA 3FTXA 2IQCA 4OVUA 4H7YA 3W9GA 3DXKG 3LY7A 4TV3A 3MZLB 2ETBA 3ZUVB 5ITZF 4Q94A 3FTUA 2XS8A 4N3CA 4U96D 1K1BA 4WNFA 3EDTB 3T5VA 5EKQD 1QYMA 4BT8A 1H2VC 2X6KA 3IEGA 1LD7A 4HB5A 1JWGA 5A6CA 3Q9NC 1S63A 1X5BA 4EZKA 4GTOA 4ABNA 3JXIA 3FUJA 1MX2A 3ASDA 2V5QC 3P2BA 5T3RA 4XE0A 3UT8A 2I9CA 1HFAA 3GZ1A 1TJCA 3FUHA 3JYSA 2ETAA 3LJ3A 3D9LA 3CGHA 1UG3A 4DLOA 2LAIA 5M72A 1OWNA 3ENEA 1OWPA 3LCAA 2P9KG 3MX3A 3DXMG 4FLHA 2DYSE 4KVMA 4ACLA 3LY9A 3MYVA 4B93B 4HLLA 3CKCA 5AENA 4LSZE 3NQPA 4W9RA 1LD8A 2KATA 2KC7A 1SA5A 3PREA 3Q9UC 4GMRA 2FI7A 3NOCD 2JEKA 4GCOA 5G04J 2IEJA 3NZUA 4GTQA 3ZHEA 3N71A 5H7PA 3FEYA 3ABLE 4AY5A 2I1JA 4U07A 2X6HA 4WWOA 1D9SA 3OXLA 5ENTD 2Y4UA 4FHJA 5AIJA 3GYZA 4CZ2D 2PQRA 3LVRE 1UOHA 3ULYA 4P29A 3FTZA 2NXPA 2E2EA 2YHEA 2LXLA 1TNUA 1SQMA 2KBXA 3FTSA 2L0IA 1E8YA 2KCLA 1Y8MA 5HS0A 4QFVA 2VTBB 4BERA 4LCTA 1E90A 1JCRA 4UQZA 3B95A 4U0SA 2EIKE 3FUKA 4BSZB 3UKRG 5JMND 1BLXB 2P2CP 3D9IA 4AM9A 1N94A 3EIJA 5EILA 3S7BA 4GPKA 4G1TA 3FTYA 4ILIA 4K5BA 4GTSA 2X3MA 3CVNA 3QDNA 4TRQA 4NIKA 4N3AA 5ENRD 2IO3C 5CEDB 4UUCA 3ZEFA 2VYIA 2Y0BG 3FDHA 5CEAA 5E76A 5ENPD 3URZA 2DCPA 4C0EA 4UI9K 3TJPA 2WQ7A 2VSXE 3MKQB 1OCOE 5DIZA 3FWVA 3V30A 3JCKC 3SF4A 5G04C 4WUYA 3ML9A 3Q49B 1Y6IA 3RO2A 3IXEA 3BU8A 4B89A 1ELKA 3OTNA 3VTXA 1WY6A 5KJKA 2C2LA 1TN7A 3U9WA 3E37A 4IULA 1N11A 2X6FA 3SBSA 5HRYA 4ANXA 5CECB 3IV0A 3APCA 5BPPA 3FUIA 2WXKA 4BX8A 4FULA 3EJNA 3KSLA 3T5XA 4JC8A 3PEUB 2FO1E 4FHKA 3L6AA 1U3DA 4GZ3A 4GCNA 4KVOA 2J09A 1OCRE 3B13A 3ESLA 4BY6A 3E34A 2F8XK 2CFZA 2V5FA 1EDUA 2LAHA 5JJ6A 2I1KA 5LCWJ 3VLDA 1WG0A 4YVQC 3DSXA 3QAQA 2YNQA 4KYOB 4ATGA 2PM6A 1FPPA 3S7JA 1IQUA 3V2XA 3LYAA 4WWPA 3RKVA 4YDWA 4X8QA 3Q15A 2P9IG 4BWRA 5BV1A 2WPVA 2ZIRA 1O1SA 3GZ2A 4PS7A 2OEVA 4HORA 4A1GA 2VQ2A 2IFUA 4LNGA 4NQ0A 4DX7D 2V0PA 3OXFA 3Q73A 3BG1B 5BNWA 4F6RD 1KLXA 2OEWA 2P58C 1N4RA 3ZYMA 3PE3A 1HXIA 4UQXA 4XIFA 2WMNA 1OUVA 3KEZA 3SFXA 3CHSA 3CHPA 3PZ4A 2KZTB 4LNBA 1N54A 4JVSA 4LNUD 3DSUA 3ZU7B 4DI3A 2NSZA 3HVEA 4XEIG 1MQSA 2R5SA 1N9AA 2C0MA 5G2NA 3B7RL 4DX2A 5FINA 4Z68A 4I1AA 4WNGA 3ZXSA 5LCWC 1Q2ZA 2YINA 4F1PA 3PUJA 1H19A 2P9SG 4HNAD 3ZIMA 2LXMA 4DK5A 2L6JA 2J4BA 3ASOE 3T8KA 4GA2A 3MGBA 3LJNA 1BPOA 5FJYA 4BTAA 4URKA 4PUCA 1DNPA 2WXLA 2XENA 3QWPA 1U3CA 3C3QA 5LP0A 3UIOC 4IYPA 1MX6A 1NA3A 2CFUA 3FTWA 2JABA 5AJDA 2XCBA 2XS1A 4CGWA 4RSYA 4I9CA 1K1AA 5ANLA 3PE4A 2WMOA 3HRAA 3FU6A 2LO6A 1IQRA 4AVXA 3EHMA 2HM8A 5T4YA 3AG4E 2IJGX 5CCLA 4AJWA 4K0RA 2IU1A 4I2WA 3Q79A 4A55A 2WXHA 3ASGA 2M63A 3BEEA 4APOA 3C98A 5D66A 2RKKA 2GW1A 5D0QD 1IYGA 1QBQA 3JXJA 3CSFA 2KXPC 3OAWA 4NRHB 3S2AA 4OAVB 2IF4A 4JD2G 4BEPA 3AG2E 2XGSA 1HS6A 4YNDA 2OVFA 2OCCE 4RG6A 3RIBA 2ETCA 5LX8A 4N2SA 3QWWA 1A5EA 4HXIA 2IY0C 2VGYA 4DRXE 1AP7A 1JWFA 2R03A 3D9MA 3CR3A 3L08A 2NYJA 3AS4A 3I4GA 1NZNA 2RD0A 2KM4A 4GTRA 3UT7A 4CCAA 4WAFA 1HE8A 4HRLA 4RVBA 3RSEG 3C72A 4AIFA 1AWCB 2AJAA 1OXJA 4I6GA 1BU9A 4FA6A 3ZKJA 5CRVA 1H6KA 5EX3A 1JCQA 2Y4TA 4TUUA 3TXMA 1S64A 2XEEA 3ASHA 5G05J 5HKPA 5ANRA 3ONKA 4I1OB 3HXBA 1IXVA 2RFAA 4O60A 4QQIA 2PNNA 3LEWA 4OAUC 3CVVA 1TEZA 3EIQC 1S70B 2WXGA 3CVXA 4E85A 5EN5D 4GZDA 4JHKA 3PZ1A 4YDEA 3T9KA 2XGOA 2LSUA 3G2WA 4EQFA 4IRUA 3WXXA 1JPLA 3CLJA 5C1DA 1Z6TA 1NI1A 2YHCA 1TNBA 4EZLA 1HX8A 4UWKA 2BKKB 4YDYA 3Q78A 2FF4A 4HOUA 1H2UA 2DWZA 3D9HA 1PC2A 4FLBA 2RG8A 5FZRA 2CG3A 1HF8A 1UW4B 2I6HA 2P9PG 1FVFA 4U0ZA 2J8SD 1N0QA 3MKRA 4PDXA 1BI8B 4OYSA 4MBGA 4UI9C 2VSOE 2HE0A 4I1MA 3ZYKA 5B1BE 4HI9A 2DYRE 4CDMA 2IOSA 5ENQD 2XRZA 1SVXA 4ZFHA 3NZSA 1O1RA 4Y6CA 4XKBA 5KNGA 2V8SE 3LVQE 4U7EB 3NF1A 4B8AA 3CVPA 4G11A 3DWLG 1FCHA 3MCXA 3RRMB 5FIOA 1E8XA 5BXOA 4O1PA 1OCCE 2QYUA 3UMVA 4CEMA 1HZ4A 2FULA 5JA4D 1N4PA 2EINE 5IY5E 3GZSA 1OCZE 2WQHA 2KCVA 4F7AA 1N0RA 1S0PA 4XKCA 3R7RA 4FC8A 4RQIA 1LF8A 5D2MC 3ZW3A 3IBEA 5DBKA 2H6GA 4MLPA 2XGMA 2XQ0A 3R7QA 1A17A 4D10C 5JJTA 4G25A 4B0ZA 4CT0A 4UI9J 2F8YA 3TAXA 2CHXA 4ZHBA 3CKBA 3LKUA 5C2YA 3UKUG 3PNTB 4PS3A 1SZ9A 3AS8A 1SZAA 1YMPA 4G24A 3TG5A 3TWWA 2VJ8A 3Q75A 4RLYA 2V4HC 4J8SA 2AVPA 3TWQA 1YA0A 3W9FA 2YQ8A 5ENOD 2HR2A 4HQDA 3MKQA 4J6IA 4AY6A 4HRMB 3ZVVA 4CT4A 2VGEA 5JHAA 2R17C 4JW1A 3J5PA 3K9IA 4J8YA 2DVWA 4JHRA 3D9KA 3PH0C 3TL5A 3HXCA 4AXHA 3SGHA 3CVWA 2XPZA 1YCSB 3RAUA 4N5CA 2DZOA 4C9BB 2WXPA 4KZ0A 3FTVA 4ILGA 3CQGB 3CHMA 4EHMA 2LNIA 2L6BA 3LY8A 3MJWA 1DVPA 3ULQA 3BQOA 1KZOA 4DX1A 5FZSA 5FT9A 4B94A 2ZGGA 3L22A 4HI8A 3WG7E 5KBAA 3SBTB 4L7TA 4JPSA 4YVOA 3LXUX 1Z5SC 5J90A 3O4ZA 2ZU6B 2Y3AA 3ASNE 5A7DB 3TWSA 2XZTG 4FJZA 2WXJA
chains in the Genus database with same CATH topology
5EDSA 3EHMA 2HM8A 5T4YA 2WXFA 1X5BA 2IJGX 5G05C 4AJWA 4K0RA 5CCLA 3CK9A 2HYZA 4EZKA 4F53A 3JQ0A 2IU1A 5FZQA 4I2WA 3U64A 5JHBA 4A55A 2WXHA 4ABNA 3ASGA 3FUJA 3HDXA 3QJZA 2M63A 3U3WA 3BEEA 3ASDA 4APOA 3C98A 3RJVA 3P2BA 5T3RA 2DBAA 2GW1A 5KJMA 4XE0A 2DIWA 5D0QD 1IYGA 3UT8A 2WVIA 3CSFA 4I9EA 3T8MA 3PS6A 2I9CA 3ZHEB 4NACA 1HFAA 3GZ1A 1TJCA 3OAWA 3D9NA 3FUHA 2FEZA 3S7FA 4H7XA 4NRHB 3JYSA 3QK0A 3S2AA 1E96B 2IF4A 2R59A 2XGSA 1HS6A 3LJ3A 4YNDA 4HVBA 2OVFA 3D9LA 3ZYLA 3CGHA 1UG3A 3RK6A 4DLOA 3ZN3A 4RG6A 2WXNA 3RIBA 3PRZA 3FUNA 4DPRA 2LAIA 5LX8A 4ILHB 1OWNA 4PH4B 3ENEA 5M72A 1OWPA 4N2SA 3LCAA 3MX3A 3SD5A 4FLHA 3QWWA 2QFCA 4HXIA 4OVVA 4KVMA 4ACLA 3CVQA 3LY9A 4J8EA 4GU5A 2VGYA 1JUQA 3MYVA 3FH7A 3LPZA 2L0TB 3DPDA 1JWFA 5CCMA 3CKCA 3CR3A 2J4DA 3D9MA 3L08A 4A1SA 5AENA 3AS4A 3I4GA 4RG9A 1NZNA 2Q7FA 3NQPA 4F1SA 4W9RA 5KJNA 2RD0A 2KM4A 2MRIA 3MV3B 2KATA 2KC7A 3UT7A 3PREA 2XPIA 4ACKA 4CCAA 5BV0A 3CV0A 4FP7A 4WAFA 3FUEA 5A23A 3TGOA 1HE8A 3KAEA 2FI7A 2JEKA 4GCOA 4RVBA 3B7UX 3FU0A 5G04J 4CRWA 3NZUA 4DI4A 4AIFA 3AS5A 2X6IA 3ZHEA 3N71A 4GMJA 4XI9A 4Q96A 4U8HA 3R9AB 4I6GA 1H2TC 4BT9A 3UUXA 3FEYA 4ANWA 5BT1A 2V4LA 4FA6A 4J8FA 3JUIA 1H6KA 3ONLA 4JEUA 5EX3A 4AY5A 2I1JA 4U07A 2X6HA 2UWJG 5CHEE 4G2VA 3ZRHA 4WWOA 1EYHA 2XHEA 5CMYA 2I2OA 3IHVA 1PAQA 1KT0A 1MHQA 2VGXA 2Y4UA 3OXLA 4FHJA 2Y4TA 4TUUA 3APFA 5AIJA 3TXMA 3GYZA 4L1BA 3FULA 2A5UA 4XZ4A 4FADA 2XEVA 2PQRA 3ASHA 4I43A 5G05J 3LVRE 1UJKA 3PZDA 5ANRA 4P29A 3ONKA 3FTZA 3FUMA 2NXPA 2E2EA 4I1OB 3Q4AB 2YHEA 3FP3A 1SQMA 4EZJA 4GA1A 3G2TA 3FTSA 4FJYA 2L0IA 1XGWA 3EHNA 1UJJA 1E8YA 3LEWA 2KCLA 1H0AA 3CVVA 3VLFA 1Y8MA 4N2QA 4CDRA 1TEZA 3EIQC 4QFVA 2VTBB 5HQ8A 4UQYA 2LSVA 4LCTA 1E90A 4GYYA 3APDA 2NC9A 2WXGA 3CVXA 4E85A 4GZDA 1XNFA 4UQZA 3S7DA 4JHKA 4PS8A 4U0SA 1INZA 3MV2B 3G2SA 3FUKA 2AW6A 1QQEA 4GZ6A 3P1UA 2OVBA 2XGOA 2LSUA 4AVXA 2X6JA 3G2WA 3D9IA 4HS2A 3QKYA 4AM9A 3KD7A 4EQFA 3EIJA 3S7BA 4GPKA 4JL0A 5FQ7A 4G1TA 4IRUA 4LERA 3FTYA 2ONDA 4XX5A 3UQ3A 1JPLA 1UN9A 3B7SA 4KMOA 3WXXA 1W3BA 4ILIA 2FO7A 2AXZA 2X3MA 3CLJA 3CVNA 3QDNA 4TRQA 4CDNA 5C1DA 1Z6TA 4C0MA 2EQXA 1HG5A 1E7UA 4N3AA 4BSXA 2QY7A 2YHCA 3RRNB 2C0LA 1OWOA 3ZEFA 1Z3XA 4EZLA 1HX8A 3QNKA 2VYIA 1VDYA 2CHWA 4UWKA 1WAO1 2CHZA 2IONA 3FDHA 3I5PA 5E76A 2FF4A 4HOUA 4HOSA 5J08A 1E8ZA 3MA5A 1EF1C 1H2UA 2WXRA 5FTPA 3URZA 2DCPA 2IOLA 3FY4A 4XI0A 1PC2A 2WXQA 3BG0B 4FLBA 4LUNU 4UI9K 3TJPA 3HHMA 2RG8A 3AU4A 4FU3A 5FZRA 2WQ7A 4HOTA 2CG3A 2VSXE 1HF8A 3MKQB 1NP7A 2GRLA 4GMLA 4KBQA 5DIZA 3FWVA 1UW4B 2I6HA 3JCKC 1FVFA 4U0ZA 3Q5MA 3SF4A 4B8CB 4UWLA 5BUZA 5AYWD 5G04C 4GYWA 4JXTA 3ML9A 3B7TA 3Q49B 4GZCA 1Y6IA 4WUYA 3RO2A 2J07A 3IHYA 3MKRA 4PDXA 3CVUA 2OV8A 4NURA 2VGXB 4OYSA 4B89A 1ELKA 4Q69A 3OTNA 3VTXA 4AP2A 4HLEA 3QB2A 4GZ5A 1WY6A 4UI9C 5KJKA 2C2LA 3CHRA 2VSOE 5FQ8A 2PM7A 4I1MA 4K03A 1B89A 2XRYA 3U9WA 1TJFA 2WB2A 4IULA 2WM9A 2X6FA 3ZYKA 4EBAA 4I17A 3SBSA 2WXMA 3CSTA 3D9PA 2MOWA 1N52A 4CDMA 3PVLA 2FBNA 2IOSA 4ANXA 3ZYQA 1HU3A 3IV0A 4ME2A 3MEKA 3U66A 3APCA 3HIZA 3RU0A 5BPPA 2XRZA 3O48A 3NZSA 3FUDA 2L9BA 3L13A 3SFZA 4LRZA 1ZBPA 4Y6CA 3FUIA 4XKBA 5T8IA 4G26A 4WWNA 2WXKA 4BX8A 2V8SE 3LVQE 4FULA 3ASFA 3EJNA 3NF1A 4B8AA 3CVYA 3CK8A 4C0EA 3D3MA 4GYOA 3CVPA 1P5QA 4N39A 5AJLA 2GRMA 3T5XA 4JC8A 4G11A 3PEUB 3LDZA 3SI5A 4FHKA 2XPYA 3G2UA 3L6AA 3SNXA 1U3DA 3HYMB 4DJAA 4GZ3A 3I4RB 3SHFA 4GCNA 4JZYA 4M3OA 4KVOA 5LFAA 2J09A 3B13A 1FCHA 3ESLA 3MCXA 4BY6A 4J8DA 3RRMB 1ELRA 4CGVA 1ELWA 1E8XA 4EECA 3TXNA 1HH8A 2CFZA 2V5FA 3FU5A 1EDUA 2LAHA 1QZ2A 5JJ6A 2I1KA 2J08A 3UMVA 4CEMA 1HZ4A 4APFA 4HOQA 5LCWJ 5FQ4A 3CVLA 2VTBA 3VLDA 1E8WA 4DLQA 3UPVA 5FWQA 5KJLA 2FULA 1IHGA 4YVQC 4AEZC 1GW6A 3QAQA 4E6HA 2YNQA 4KYOB 2PL2A 4ATGA 3GZSA 3PEVB 1EPUA 1HO8A 2PM6A 4JHJA 3QARA 4V3IA 2WQHA 3L54A 3U4TA 3SZ7A 2KCVA 4F7AA 4G23A 4WNEA 1S0PA 3S7JA 1IQUA 4XKCA 3LYAA 4WWPA 3RKVA 3R7RA 4MRUA 4FC8A 4BFRA 1LF8A 5KCMA 4UWHA 3ZGQA 3ZW3A 3PUKA 1E7VA 3IBEA 3Q15A 2XCCA 5JJ7A 5DBKA 3CHQA 4BWRA 3FH5A 5ENNA 2ILRA 4MLPA 2XGMA 2XQ0A 5ARGA 5BV1A 2WPVA 2CG2A 3GZ2A 4PS7A 2KZTA 4U63A 3R7QA 4HORA 1A17A 4A1GA 2VQ2A 5BW8C 2IFUA 3G2VA 2AXUA 4EPZA 3Q47B 2VSNA 3L16A 4BTBA 2WXIA 4D10C 3CEQA 4NQ0A 4JA9A 3RO3A 5JJTA 4IN3B 4ANUA 2V0PA 3OXFA 2E0IA 5D0OD 4G25A 2BTDA 4R7LA 3FH8A 3FEXA 4B0ZA 4CT0A 3BG1B 4UI9J 2X38A 2VSYA 4BX9A 4HFGA 3TAXA 2CHXA 5BNWA 3CKBA 1KLXA 1HG2A 1ZU2A 2BF0X 1Z3YA 3LKUA 5C2YA 3VLEA 4F3VA 4MS6A 2P58C 3CHOA 3CQCB 3PNTB 3E4BA 1WM5A 3LS8A 4O6FA 4PS3A 3UX4A 1SZ9A 3DBSA 3CIAA 2PZIA 2OOEA 3ZYMA 3AS8A 3PE3A 1HXIA 4UQXA 4XIFA 2KCKA 1SZAA 4L23A 4G24A 3TG5A 1PY1A 4JA7A 2VJ8A 2WMNA 4I6EA 4JEHA 3OXGA 1KT1A 3D9OA 1L5JA 1OUVA 1OWLA 4J8SA 2AVPA 4GB9A 3D9JA 3KEZA 4U0UA 3CHSA 3CHPA 4AV7A 2KZTB 5FQ6A 1YA0A 1N54A 3QC1A 3RRUA 3FUFA 4JVSA 2YQ8A 3FU3A 4Y6WA 2WQ6A 3TG4A 2HR2A 4DI3A 3MKQA 5G55A 4J6IA 4EBAG 2NSZA 3HVEA 4L2YA 3ZVVA 4AY6A 4UWFA 1MQSA 3FHEA 4CT4A 3PNLB 5JHAA 2R17C 2JLBA 2R5SA 4U04A 2C0MA 4JW1A 4A3TA 3GW4A 5G2NA 3B7RL 3K9IA 3ESKA 4N3BA 3PDNA 4JHRA 3D9KA 1NA0A 3PH0C 4I6JA 3TL5A 4I1AA 4I2ZA 4KXKB 1UN8A 4WNGA 4UWGA 2A4ZA 4AXHA 3ZXSA 3FFLA 5LCWC 2PQNA 2YINA 3AU5A 3SGHA 3CVWA 2XPZA 4L2LA 3PUJA 4MKTA 1H19A 3ML8A 2BUGA 3QOUA 4N5CA 3ZIMA 5HI7A 2HO1A 4LEUA 4ANVA 4C9BB 4DK5A 2WXPA 4KZ0A 3FTVA 3IKOB 4ILGA 2L6JA 2J4BA 3KS2A 5EX0A 3CQGB 4GAAA 2J9QA 5ARFA 3I3NA 3CHMA 4J0UA 2UY1A 3QWVA 3HVEB 5CMWA 2LNIA 4GA2A 1QNFA 3LY8A 3MGBA 3VTYA 3MJWA 3FTXA 1BPOA 2IQCA 4OVUA 4H7YA 5FJYA 4GA0A 4BTAA 4URKA 1DVPA 4PUCA 3ZPJA 1DNPA 3LY7A 2WXLA 4TV3A 3UT4A 3CK7A 3MZLB 3QWPA 1U3CA 3ULQA 5LP0A 4Q94A 5FZSA 3FTUA 4KZCA 3JQ1A 4N3CA 4IYPA 5FT9A 2UY1B 4B94A 1NA3A 2CFUA 4A3VA 3L22A 3FTWA 2AWIA 3SBTB 4L7TA 5AJDA 4JPSA 2XCBA 4WNFA 4WNDA 3EDTB 4CGWA 3T5VA 4RSYA 5LOZA 3ZFWA 5EKQD 4AOFA 4YVOA 4I9CA 5E75A 3LXUX 5ANLA 4BT8A 1H2VC 3PE4A 2MHKA 5J90A 3O4ZA 2GGFA 2WMOA 2X6KA 3L17A 1FVHA 3FU6A 3IEGA 1OWMA 2J49A 2LO6A 4KT6B 2ZU6B 2Y3AA 5A7DB 1IQRA 1JWGA 5A6CA 2AXVA 4FJZA 2WXJA 2WXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEV A;  2PQR A;  3ASH A;  2FBN A;  5G05 J;  5G05 C;  5CCL A;  3CK9 A;  2HYZ A;  3OXG A;  1KT1 A;  4ME2 A;  3MEK A;  1OUV A;  5FZQ A;  3RU0 A;  4I2W A;  2AVP A;  3ULQ A;  3O48 A;  4U0U A;  2E2E A;  4ABN A;  3Q4A B;  3ASG A;  1ZBP A;  1YA0 A;  4Y6C A;  3FP3 A;  3U3W A;  4GA1 A;  4G26 A;  3BEE A;  2YQ8 A;  3ASD A;  4Y6W A;  4APO A;  3RJV A;  2DBA A;  3ASF A;  2GW1 A;  2HR2 A;  3NF1 A;  3TG4 A;  5KJM A;  3CK8 A;  5D0Q D;  4AY6 A;  4GYO A;  1IYG A;  3CVP A;  2KCL A;  1P5Q A;  4N39 A;  1Y8M A;  4I9E A;  4N2Q A;  4CDR A;  5HQ8 A;  2JLB A;  3HYM B;  4UQY A;  3ZHE B;  2LSV A;  4GZ3 A;  2R5S A;  3GZ1 A;  4GCN A;  1TJC A;  2C0M A;  2NC9 A;  4GYY A;  4U04 A;  1FCH A;  2FEZ A;  3S7F A;  4H7X A;  4AIF A;  1XNF A;  4UQZ A;  4J8D A;  3JYS A;  3GW4 A;  1ELR A;  4NRH B;  4U0S A;  1ELW A;  3S7D A;  4CGV A;  1E96 B;  2IF4 A;  3K9I A;  3ESK A;  1HH8 A;  3MV2 B;  2XGS A;  2V5F A;  4N3B A;  3PDN A;  4JHR A;  4YND A;  5JJT A;  1NA0 A;  1QZ2 A;  5JJ6 A;  1QQE A;  4GZ6 A;  4I1A A;  4I2Z A;  3ZN3 A;  2XGO A;  4KXK B;  2LSU A;  4RG6 A;  1HZ4 A;  4WNG A;  3RIB A;  4HOQ A;  3QKY A;  4AM9 A;  3KD7 A;  3FFL A;  3CVL A;  5LCW C;  4EQF A;  2PQN A;  3S7B A;  5LCW J;  4JL0 A;  5M72 A;  4GPK A;  4G1T A;  3UQ3 A;  3UPV A;  2OND A;  3WXX A;  3LCA A;  5KJL A;  4N2S A;  1IHG A;  1W3B A;  4YVQ C;  3QWW A;  2QFC A;  2BUG A;  2FO7 A;  3QOU A;  4KYO B;  2PL2 A;  3CVN A;  3CVQ A;  3LY9 A;  3QDN A;  4N5C A;  5C1D A;  3U4T A;  4J8E A;  2HO1 A;  2WQH A;  4LEU A;  5HI7 A;  3SZ7 A;  2KCV A;  2VGY A;  4G23 A;  4N3A A;  4WNE A;  3S7J A;  2L6J A;  2YHC A;  3LPZ A;  3KS2 A;  3LYA A;  2C0L A;  5EX0 A;  3RKV A;  2J9Q A;  5ARF A;  5CCM A;  3CKC A;  4J0U A;  3ZGQ A;  2UY1 A;  2VYI A;  4A1S A;  3AS4 A;  3QWV A;  4RG9 A;  1NZN A;  1WAO 1;  2Q7F A;  2XCC A;  3Q15 A;  5JJ7 A;  2LNI A;  4GA2 A;  4W9R A;  5DBK A;  3LY8 A;  5KJN A;  3VTY A;  2FF4 A;  3MV3 B;  4HOU A;  5FJY A;  2KAT A;  4H7Y A;  2KC7 A;  4GA0 A;  3MA5 A;  4BWR A;  4HOS A;  2XPI A;  5FTP A;  2XGM A;  3URZ A;  4BTA A;  5ARG A;  4XI0 A;  2WPV A;  1PC2 A;  3ZPJ A;  3CV0 A;  3GZ2 A;  3LY7 A;  4UI9 K;  5FZR A;  3TGO A;  4HOR A;  4HOT A;  1A17 A;  2VQ2 A;  3CK7 A;  4KBQ A;  3QWP A;  5BW8 C;  5DIZ A;  2IFU A;  3FWV A;  2FI7 A;  3KAE A;  2I6H A;  4U0Z A;  3Q47 B;  3SF4 A;  2VSN A;  3Q5M A;  4GCO A;  5AYW D;  5FZS A;  5G04 J;  5G04 C;  4GYW A;  4WUY A;  3Q49 B;  4BTB A;  4N3C A;  3RO2 A;  3CEQ A;  4NQ0 A;  3AS5 A;  3MKR A;  4JA9 A;  2UY1 B;  5FT9 A;  4IN3 B;  3RO3 A;  3OXF A;  2VGX B;  3N71 A;  1NA3 A;  3ZHE A;  4B94 A;  5D0O D;  4XI9 A;  4G25 A;  3R9A B;  3VTX A;  4BT9 A;  3UUX A;  2XCB A;  4GZ5 A;  4UI9 J;  4UI9 C;  4J8F A;  4WNF A;  5BT1 A;  2VSY A;  5KJK A;  4WND A;  3EDT B;  3TAX A;  5BNW A;  4CGW A;  2C2L A;  1KLX A;  3CKB A;  5EX3 A;  1ZU2 A;  5EKQ D;  3LKU A;  4YVO A;  4I9C A;  3ZFW A;  4U07 A;  4AY5 A;  4F3V A;  2UWJ G;  5CHE E;  2P58 C;  4BT8 A;  3PE4 A;  1B89 A;  4G2V A;  2MHK A;  1WM5 A;  3E4B A;  4O6F A;  2PZI A;  3IEG A;  2OOE A;  3AS8 A;  3PE3 A;  1KT0 A;  2VGX A;  2Y4U A;  3OXL A;  1HXI A;  4I17 A;  2Y4T A;  4UQX A;  4XIF A;  2KCK A;  5A7D B;  5A6C A;  3GYZ A;  4G24 A;  3TG5 A;  4JA7 A; 
#chains in the Genus database with same CATH topology
 5EDS A;  2WXF A;  5EYL A;  3CK9 A;  4F53 A;  1RZ4 A;  5FZQ A;  1N4Q A;  2ZIS A;  2Y1L E;  3QJZ A;  3RJV A;  5KJM A;  3T8M A;  3PS6 A;  3L82 A;  4U8V D;  3TWX A;  3D9N A;  3S7F A;  2B6C A;  3ZNG A;  2R59 A;  2BED A;  4HVB A;  3ZYL A;  3EUV A;  1DCE A;  2ZGD A;  3PRZ A;  3FUN A;  1TN8 A;  3CVQ A;  4J8E A;  4DX6 D;  1JUQ A;  3FH7 A;  2QYJ A;  2H6H A;  5KNH D;  5AAR A;  5EID A;  2J4D A;  1DCQ A;  4F1S A;  5KJN A;  2XPI A;  5BV0 A;  5A23 A;  3KAE A;  5CER B;  3FU0 A;  4CRW A;  1DC2 A;  3AS5 A;  2X6I A;  5EYP F;  4GMJ A;  4N5Q A;  2DZN A;  3R9A B;  5B1A E;  1H2T C;  3UUX A;  4ANW A;  3EU9 A;  4K5C A;  5BT1 A;  4J8F A;  3ONL A;  2XHE A;  2I2O A;  3IHV A;  1KT0 A;  3APF A;  3J5Q B;  2P9U G;  4L1B A;  4XZ4 A;  4FAD A;  1UJK A;  3PZD A;  5AN8 A;  3Q4A B;  3TWU A;  4GA1 A;  3G2T A;  4HRN A;  3UXG A;  4M7C A;  1UJJ A;  4HBD A;  3VLF A;  4N2Q A;  1H6P A;  2R02 A;  1BI7 B;  1KZP A;  3S7D A;  3AG1 E;  4GTT A;  4YDO A;  2AW6 A;  1QQE A;  2OVB A;  4HS2 A;  3QKY A;  4JL0 A;  3ABK E;  4XX5 A;  4KMO A;  5BXU A;  3E32 A;  2AXZ A;  1U2V G;  3ISM C;  4C0M A;  2EQX A;  2EIM E;  1OWO A;  1VDY A;  2CHW A;  1WAO 1;  2CHZ A;  2ION A;  1X81 A;  4HOS A;  5J08 A;  1E8Z A;  1EF1 C;  5FTP A;  2IOL A;  3FY4 A;  1WDY A;  4LUN U;  3AU4 A;  4FU3 A;  4O1O A;  1NP7 A;  4KBQ A;  1FT2 A;  4UWL A;  5BUZ A;  3F6Q A;  5AYW D;  4JXT A;  4GZC A;  3IHY A;  4NUR A;  3PZ2 A;  4Q69 A;  3QB2 A;  4U95 D;  1N4S A;  3UM1 A;  4GZ5 A;  2RFM A;  1TNY A;  3V79 K;  2PM7 A;  2XRY A;  1TJF A;  1OT8 A;  5AQ7 A;  2WM9 A;  3UI2 A;  1N95 A;  5AQ9 A;  3DSW A;  3UM2 A;  3CST A;  1N52 A;  3BUA A;  3ZYQ A;  4ME2 A;  3MEK A;  3U66 A;  3O48 A;  3FUD A;  2L9B A;  3SFZ A;  4LRZ A;  5T8I A;  4WWN A;  3HXD A;  3CVY A;  3D3M A;  1P5Q A;  4N39 A;  3SI5 A;  2XPY A;  3G2U A;  3SNX A;  4DJA A;  3HYM B;  3I4R B;  5LFA A;  4JZY A;  4M3O A;  4J8D A;  1ELR A;  3R9M A;  4CGV A;  5ENS D;  4EEC A;  3TXN A;  1HH8 A;  4APF A;  3CVL A;  2VTB A;  4DLQ A;  3UPV A;  1TNO A;  5KJL A;  4AEZ C;  4E6H A;  1EPU A;  1HO8 A;  3QAR A;  3SZ7 A;  3AAA C;  4G23 A;  4WNE A;  4BFR A;  2H6F A;  5KCM A;  4UWH A;  3PUK A;  2XCC A;  3CHQ A;  3FH5 A;  5ENN A;  1RW2 A;  5ARG A;  4L9P A;  2CG2 A;  2KZT A;  4U63 A;  3G2V A;  3EHR A;  3L16 A;  1H6O A;  2XZD G;  3CEQ A;  1OY3 D;  3RO3 A;  4IN3 B;  4ANU A;  3V2O A;  2BTD A;  4R7L A;  3FEX A;  2X38 A;  2VSY A;  1HG2 A;  2BF0 X;  1Z3Y A;  4F3V A;  3LS8 A;  1WM5 A;  4O6F A;  3UX4 A;  3NOG D;  3DBS A;  4TXR A;  3SQV A;  4L23 A;  1V54 E;  4I6E A;  4JEH A;  3EHQ A;  3OXG A;  1KT1 A;  5CRU A;  3QC1 A;  3FUF A;  3FU3 A;  4L2Y A;  1TNZ A;  4UWF A;  3UIP C;  2JLB A;  4U04 A;  4A3T A;  3EU5 A;  3DEP A;  3GW4 A;  1KPS B;  3ESK A;  3TWR A;  4N3B A;  3PDN A;  4I6J A;  4KXK B;  1UN8 A;  1MYO A;  4BES A;  2PQN A;  4GPM A;  4LG6 A;  4L2L A;  5AQB A;  3ML8 A;  4ANV A;  3UTM A;  2F0Y A;  2ZXW E;  3KS2 A;  1SW6 A;  4GAA A;  2J9Q A;  5ARF A;  3DPY A;  4CYM D;  3QWV A;  1YYH A;  3VTY A;  4GA0 A;  3ZPJ A;  2R05 A;  3UT4 A;  3CK7 A;  3C3O A;  4KZC A;  3JQ1 A;  2UY1 B;  4A3V A;  2R2L A;  2AWI A;  4WND A;  5LOZ A;  3ZFW A;  4AOF A;  1MZC A;  5E75 A;  3DSS A;  2MHK A;  3L17 A;  4G8K A;  2GGF A;  1O5M A;  1FVH A;  4U8Y D;  4KT6 B;  1OWM A;  2J49 A;  2AXV A;  2WXO A;  3ZXP A;  3PZ3 A;  5G05 C;  2HYZ A;  4GTP A;  3JQ0 A;  5JHB A;  3U64 A;  3HDX A;  3U3W A;  1NFI E;  2DBA A;  3L9T A;  2DIW A;  2WVI A;  4I9E A;  3HG0 D;  3ZHE B;  4NAC A;  4K5A B;  2FEZ A;  4H7X A;  3QK0 A;  1E96 B;  3C5R A;  3NBN B;  3RK6 A;  3ZN3 A;  2WXN A;  4DPR A;  4ILH B;  1FT1 A;  4PH4 B;  3E33 A;  3SD5 A;  2QFC A;  4OVV A;  4TXP A;  4GU5 A;  4ATZ D;  2P9L G;  3LPZ A;  3SFY A;  2L0T B;  3DPD A;  3AJI A;  5CCM A;  4A1S A;  1K3Z D;  4RG9 A;  2Q7F A;  3Q7F A;  2MRI A;  3MV3 B;  4ACK A;  3CV0 A;  4FP7 A;  3FUE A;  3TGO A;  4BET A;  1G3N B;  4TXQ A;  3B7U X;  4GTM A;  4DI4 A;  3AG3 E;  4TUM A;  4XI9 A;  4Q96 A;  4U8H A;  4BT9 A;  1IHB A;  2V4L A;  3V31 A;  3JUI A;  3KEA A;  4JEU A;  2MYO A;  2BKG A;  2UWJ G;  5CHE E;  4G2V A;  3ZRH A;  3KSQ A;  1EYH A;  5CMY A;  3ABM E;  1PAQ A;  1MHQ A;  2VGX A;  3NAW A;  3FUL A;  2A5U A;  3HXE A;  2XEV A;  4I43 A;  3SO8 A;  3FUM A;  3Q7A A;  3FP3 A;  4EZJ A;  1NL4 A;  4J7W A;  4FJY A;  1XGW A;  3EHN A;  4JB8 P;  1H0A A;  4CDR A;  1O1T A;  5HQ8 A;  4UQY A;  2LSV A;  4GYY A;  3APD A;  2NC9 A;  1XNF A;  2XEH A;  1TR4 A;  4PS8 A;  1V55 E;  1INZ A;  3MV2 B;  3DRA A;  3G2S A;  3HXF A;  4GZ6 A;  1D8E A;  3P1U A;  2X6J A;  3KD7 A;  3C3R A;  5FQ7 A;  3UQ3 A;  4LER A;  2OND A;  1UN9 A;  3B7S A;  3DST A;  3JUE A;  1W3B A;  2FO7 A;  5B3S E;  4CDN A;  1HG5 A;  1E7U A;  4BSX A;  2QY7 A;  3RRN B;  2C0L A;  5AAO A;  3ULE G;  1Z3X A;  3QNK A;  1MJ0 A;  3I5P A;  2GRN B;  3X2Q E;  3MA5 A;  2WXR A;  4XI0 A;  2WXQ A;  3BG0 B;  3HHM A;  4HOT A;  2GRL A;  3TWV A;  4GML A;  3Q5M A;  1ZB1 A;  4B8C B;  4GYW A;  3B7T A;  1SA4 A;  2J07 A;  3CVU A;  2OV8 A;  2VGX B;  1D8D A;  2GRO B;  2QZA A;  4AP2 A;  4HLE A;  4DUI A;  5KWD A;  2P9N G;  3CHR A;  5FQ8 A;  3SY2 A;  4K03 A;  1B89 A;  2B0O E;  2WB2 A;  4A63 B;  4EBA A;  4I17 A;  1BD8 A;  2WXM A;  2MOW A;  3D9P A;  3PVL A;  2FBN A;  3UIN C;  1HU3 A;  3HIZ A;  3RU0 A;  3L13 A;  4G8L A;  1ZBP A;  1JCS A;  4G26 A;  5EIB E;  3ASF A;  3CK8 A;  4GYO A;  1TN6 A;  3E30 A;  5AJL A;  2GRM A;  3LDZ A;  2EIL E;  1LTX A;  3SHF A;  5AQA A;  1ELW A;  3FU5 A;  1QZ2 A;  2J08 A;  4HOQ A;  5FQ4 A;  1E8W A;  4GTV A;  5FWQ A;  1IHG A;  3UM3 A;  1GW6 A;  3DEO A;  2PL2 A;  3PEV B;  4JHJ A;  4V3I A;  3U4T A;  3L54 A;  3B7B A;  3DSV A;  4MRU A;  3ZGQ A;  1E7V A;  5JJ7 A;  5CBO A;  2A5E A;  2ILR A;  1K8K G;  5BW8 C;  3NB2 A;  4EPZ A;  2AXU A;  3Q47 B;  2VSN A;  4BTB A;  2WXI A;  4JA9 A;  2E0I A;  5D0O D;  3FH8 A;  4BX9 A;  4HFG A;  1ZU2 A;  3VLE A;  4MS6 A;  2EIJ E;  3CHO A;  3CQC B;  3E4B A;  3CIA A;  2PZI A;  2OOE A;  2KCK A;  1PY1 A;  4JA7 A;  3D9O A;  1L5J A;  1OWL A;  4GB9 A;  3D9J A;  4U0U A;  4AV7 A;  4C48 B;  5FQ6 A;  3RRU A;  4Y6W A;  2WQ6 A;  3TG4 A;  5G55 A;  4EBA G;  2LUH A;  3FHE A;  3PNL B;  5CBN A;  1NA0 A;  2QC9 A;  2H6I A;  2GRP B;  2IO2 C;  4I2Z A;  2GRQ B;  4DX5 D;  4UWG A;  2A4Z A;  2F37 A;  3FFL A;  3AU5 A;  3UM0 A;  1IKN D;  4MKT A;  2BUG A;  3QOU A;  5HI7 A;  2HO1 A;  4LEU A;  3IKO B;  2GRR B;  5EX0 A;  3I3N A;  3TWT A;  1MX4 A;  4J0U A;  2UY1 A;  1TYQ G;  2Y69 E;  3HVE B;  5CMW A;  1QNF A;  3FTX A;  2IQC A;  4OVU A;  4H7Y A;  3W9G A;  3DXK G;  3LY7 A;  4TV3 A;  3MZL B;  2ETB A;  3ZUV B;  5ITZ F;  4Q94 A;  3FTU A;  2XS8 A;  4N3C A;  4U96 D;  1K1B A;  4WNF A;  3EDT B;  3T5V A;  5EKQ D;  1QYM A;  4BT8 A;  1H2V C;  2X6K A;  3IEG A;  1LD7 A;  4HB5 A;  1JWG A;  5A6C A;  3Q9N C;  1S63 A;  1X5B A;  4EZK A;  4GTO A;  4ABN A;  3JXI A;  3FUJ A;  1MX2 A;  3ASD A;  2V5Q C;  3P2B A;  5T3R A;  4XE0 A;  3UT8 A;  2I9C A;  1HFA A;  3GZ1 A;  1TJC A;  3FUH A;  3JYS A;  2ETA A;  3LJ3 A;  3D9L A;  3CGH A;  1UG3 A;  4DLO A;  2LAI A;  5M72 A;  1OWN A;  3ENE A;  1OWP A;  3LCA A;  2P9K G;  3MX3 A;  3DXM G;  4FLH A;  2DYS E;  4KVM A;  4ACL A;  3LY9 A;  3MYV A;  4B93 B;  4HLL A;  3CKC A;  5AEN A;  4LSZ E;  3NQP A;  4W9R A;  1LD8 A;  2KAT A;  2KC7 A;  1SA5 A;  3PRE A;  3Q9U C;  4GMR A;  2FI7 A;  3NOC D;  2JEK A;  4GCO A;  5G04 J;  2IEJ A;  3NZU A;  4GTQ A;  3ZHE A;  3N71 A;  5H7P A;  3FEY A;  3ABL E;  4AY5 A;  2I1J A;  4U07 A;  2X6H A;  4WWO A;  1D9S A;  3OXL A;  5ENT D;  2Y4U A;  4FHJ A;  5AIJ A;  3GYZ A;  4CZ2 D;  2PQR A;  3LVR E;  1UOH A;  3ULY A;  4P29 A;  3FTZ A;  2NXP A;  2E2E A;  2YHE A;  2LXL A;  1TNU A;  1SQM A;  2KBX A;  3FTS A;  2L0I A;  1E8Y A;  2KCL A;  1Y8M A;  5HS0 A;  4QFV A;  2VTB B;  4BER A;  4LCT A;  1E90 A;  1JCR A;  4UQZ A;  3B95 A;  4U0S A;  2EIK E;  3FUK A;  4BSZ B;  3UKR G;  5JMN D;  1BLX B;  2P2C P;  3D9I A;  4AM9 A;  1N94 A;  3EIJ A;  5EIL A;  3S7B A;  4GPK A;  4G1T A;  3FTY A;  4ILI A;  4K5B A;  4GTS A;  2X3M A;  3CVN A;  3QDN A;  4TRQ A;  4NIK A;  4N3A A;  5ENR D;  2IO3 C;  5CED B;  4UUC A;  3ZEF A;  2VYI A;  2Y0B G;  3FDH A;  5CEA A;  5E76 A;  5ENP D;  3URZ A;  2DCP A;  4C0E A;  4UI9 K;  3TJP A;  2WQ7 A;  2VSX E;  3MKQ B;  1OCO E;  5DIZ A;  3FWV A;  3V30 A;  3JCK C;  3SF4 A;  5G04 C;  4WUY A;  3ML9 A;  3Q49 B;  1Y6I A;  3RO2 A;  3IXE A;  3BU8 A;  4B89 A;  1ELK A;  3OTN A;  3VTX A;  1WY6 A;  5KJK A;  2C2L A;  1TN7 A;  3U9W A;  3E37 A;  4IUL A;  1N11 A;  2X6F A;  3SBS A;  5HRY A;  4ANX A;  5CEC B;  3IV0 A;  3APC A;  5BPP A;  3FUI A;  2WXK A;  4BX8 A;  4FUL A;  3EJN A;  3KSL A;  3T5X A;  4JC8 A;  3PEU B;  2FO1 E;  4FHK A;  3L6A A;  1U3D A;  4GZ3 A;  4GCN A;  4KVO A;  2J09 A;  1OCR E;  3B13 A;  3ESL A;  4BY6 A;  3E34 A;  2F8X K;  2CFZ A;  2V5F A;  1EDU A;  2LAH A;  5JJ6 A;  2I1K A;  5LCW J;  3VLD A;  1WG0 A;  4YVQ C;  3DSX A;  3QAQ A;  2YNQ A;  4KYO B;  4ATG A;  2PM6 A;  1FPP A;  3S7J A;  1IQU A;  3V2X A;  3LYA A;  4WWP A;  3RKV A;  4YDW A;  4X8Q A;  3Q15 A;  2P9I G;  4BWR A;  5BV1 A;  2WPV A;  2ZIR A;  1O1S A;  3GZ2 A;  4PS7 A;  2OEV A;  4HOR A;  4A1G A;  2VQ2 A;  2IFU A;  4LNG A;  4NQ0 A;  4DX7 D;  2V0P A;  3OXF A;  3Q73 A;  3BG1 B;  5BNW A;  4F6R D;  1KLX A;  2OEW A;  2P58 C;  1N4R A;  3ZYM A;  3PE3 A;  1HXI A;  4UQX A;  4XIF A;  2WMN A;  1OUV A;  3KEZ A;  3SFX A;  3CHS A;  3CHP A;  3PZ4 A;  2KZT B;  4LNB A;  1N54 A;  4JVS A;  4LNU D;  3DSU A;  3ZU7 B;  4DI3 A;  2NSZ A;  3HVE A;  4XEI G;  1MQS A;  2R5S A;  1N9A A;  2C0M A;  5G2N A;  3B7R L;  4DX2 A;  5FIN A;  4Z68 A;  4I1A A;  4WNG A;  3ZXS A;  5LCW C;  1Q2Z A;  2YIN A;  4F1P A;  3PUJ A;  1H19 A;  2P9S G;  4HNA D;  3ZIM A;  2LXM A;  4DK5 A;  2L6J A;  2J4B A;  3ASO E;  3T8K A;  4GA2 A;  3MGB A;  3LJN A;  1BPO A;  5FJY A;  4BTA A;  4URK A;  4PUC A;  1DNP A;  2WXL A;  2XEN A;  3QWP A;  1U3C A;  3C3Q A;  5LP0 A;  3UIO C;  4IYP A;  1MX6 A;  1NA3 A;  2CFU A;  3FTW A;  2JAB A;  5AJD A;  2XCB A;  2XS1 A;  4CGW A;  4RSY A;  4I9C A;  1K1A A;  5ANL A;  3PE4 A;  2WMO A;  3HRA A;  3FU6 A;  2LO6 A;  1IQR A;  4AVX A;  3EHM A;  2HM8 A;  5T4Y A;  3AG4 E;  2IJG X;  5CCL A;  4AJW A;  4K0R A;  2IU1 A;  4I2W A;  3Q79 A;  4A55 A;  2WXH A;  3ASG A;  2M63 A;  3BEE A;  4APO A;  3C98 A;  5D66 A;  2RKK A;  2GW1 A;  5D0Q D;  1IYG A;  1QBQ A;  3JXJ A;  3CSF A;  2KXP C;  3OAW A;  4NRH B;  3S2A A;  4OAV B;  2IF4 A;  4JD2 G;  4BEP A;  3AG2 E;  2XGS A;  1HS6 A;  4YND A;  2OVF A;  2OCC E;  4RG6 A;  3RIB A;  2ETC A;  5LX8 A;  4N2S A;  3QWW A;  1A5E A;  4HXI A;  2IY0 C;  2VGY A;  4DRX E;  1AP7 A;  1JWF A;  2R03 A;  3D9M A;  3CR3 A;  3L08 A;  2NYJ A;  3AS4 A;  3I4G A;  1NZN A;  2RD0 A;  2KM4 A;  4GTR A;  3UT7 A;  4CCA A;  4WAF A;  1HE8 A;  4HRL A;  4RVB A;  3RSE G;  3C72 A;  4AIF A;  1AWC B;  2AJA A;  1OXJ A;  4I6G A;  1BU9 A;  4FA6 A;  3ZKJ A;  5CRV A;  1H6K A;  5EX3 A;  1JCQ A;  2Y4T A;  4TUU A;  3TXM A;  1S64 A;  2XEE A;  3ASH A;  5G05 J;  5HKP A;  5ANR A;  3ONK A;  4I1O B;  3HXB A;  1IXV A;  2RFA A;  4O60 A;  4QQI A;  2PNN A;  3LEW A;  4OAU C;  3CVV A;  1TEZ A;  3EIQ C;  1S70 B;  2WXG A;  3CVX A;  4E85 A;  5EN5 D;  4GZD A;  4JHK A;  3PZ1 A;  4YDE A;  3T9K A;  2XGO A;  2LSU A;  3G2W A;  4EQF A;  4IRU A;  3WXX A;  1JPL A;  3CLJ A;  5C1D A;  1Z6T A;  1NI1 A;  2YHC A;  1TNB A;  4EZL A;  1HX8 A;  4UWK A;  2BKK B;  4YDY A;  3Q78 A;  2FF4 A;  4HOU A;  1H2U A;  2DWZ A;  3D9H A;  1PC2 A;  4FLB A;  2RG8 A;  5FZR A;  2CG3 A;  1HF8 A;  1UW4 B;  2I6H A;  2P9P G;  1FVF A;  4U0Z A;  2J8S D;  1N0Q A;  3MKR A;  4PDX A;  1BI8 B;  4OYS A;  4MBG A;  4UI9 C;  2VSO E;  2HE0 A;  4I1M A;  3ZYK A;  5B1B E;  4HI9 A;  2DYR E;  4CDM A;  2IOS A;  5ENQ D;  2XRZ A;  1SVX A;  4ZFH A;  3NZS A;  1O1R A;  4Y6C A;  4XKB A;  5KNG A;  2V8S E;  3LVQ E;  4U7E B;  3NF1 A;  4B8A A;  3CVP A;  4G11 A;  3DWL G;  1FCH A;  3MCX A;  3RRM B;  5FIO A;  1E8X A;  5BXO A;  4O1P A;  1OCC E;  2QYU A;  3UMV A;  4CEM A;  1HZ4 A;  2FUL A;  5JA4 D;  1N4P A;  2EIN E;  5IY5 E;  3GZS A;  1OCZ E;  2WQH A;  2KCV A;  4F7A A;  1N0R A;  1S0P A;  4XKC A;  3R7R A;  4FC8 A;  4RQI A;  1LF8 A;  5D2M C;  3ZW3 A;  3IBE A;  5DBK A;  2H6G A;  4MLP A;  2XGM A;  2XQ0 A;  3R7Q A;  1A17 A;  4D10 C;  5JJT A;  4G25 A;  4B0Z A;  4CT0 A;  4UI9 J;  2F8Y A;  3TAX A;  2CHX A;  4ZHB A;  3CKB A;  3LKU A;  5C2Y A;  3UKU G;  3PNT B;  4PS3 A;  1SZ9 A;  3AS8 A;  1SZA A;  1YMP A;  4G24 A;  3TG5 A;  3TWW A;  2VJ8 A;  3Q75 A;  4RLY A;  2V4H C;  4J8S A;  2AVP A;  3TWQ A;  1YA0 A;  3W9F A;  2YQ8 A;  5ENO D;  2HR2 A;  4HQD A;  3MKQ A;  4J6I A;  4AY6 A;  4HRM B;  3ZVV A;  4CT4 A;  2VGE A;  5JHA A;  2R17 C;  4JW1 A;  3J5P A;  3K9I A;  4J8Y A;  2DVW A;  4JHR A;  3D9K A;  3PH0 C;  3TL5 A;  3HXC A;  4AXH A;  3SGH A;  3CVW A;  2XPZ A;  1YCS B;  3RAU A;  4N5C A;  2DZO A;  4C9B B;  2WXP A;  4KZ0 A;  3FTV A;  4ILG A;  3CQG B;  3CHM A;  4EHM A;  2LNI A;  2L6B A;  3LY8 A;  3MJW A;  1DVP A;  3ULQ A;  3BQO A;  1KZO A;  4DX1 A;  5FZS A;  5FT9 A;  4B94 A;  2ZGG A;  3L22 A;  4HI8 A;  3WG7 E;  5KBA A;  3SBT B;  4L7T A;  4JPS A;  4YVO A;  3LXU X;  1Z5S C;  5J90 A;  3O4Z A;  2ZU6 B;  2Y3A A;  3ASN E;  5A7D B;  3TWS A;  2XZT G;  4FJZ A;  2WXJ A; 
#chains in the Genus database with same CATH homology
 5EDS A;  3EHM A;  2HM8 A;  5T4Y A;  2WXF A;  1X5B A;  2IJG X;  5G05 C;  4AJW A;  4K0R A;  5CCL A;  3CK9 A;  2HYZ A;  4EZK A;  4F53 A;  3JQ0 A;  2IU1 A;  5FZQ A;  4I2W A;  3U64 A;  5JHB A;  4A55 A;  2WXH A;  4ABN A;  3ASG A;  3FUJ A;  3HDX A;  3QJZ A;  2M63 A;  3U3W A;  3BEE A;  3ASD A;  4APO A;  3C98 A;  3RJV A;  3P2B A;  5T3R A;  2DBA A;  2GW1 A;  5KJM A;  4XE0 A;  2DIW A;  5D0Q D;  1IYG A;  3UT8 A;  2WVI A;  3CSF A;  4I9E A;  3T8M A;  3PS6 A;  2I9C A;  3ZHE B;  4NAC A;  1HFA A;  3GZ1 A;  1TJC A;  3OAW A;  3D9N A;  3FUH A;  2FEZ A;  3S7F A;  4H7X A;  4NRH B;  3JYS A;  3QK0 A;  3S2A A;  1E96 B;  2IF4 A;  2R59 A;  2XGS A;  1HS6 A;  3LJ3 A;  4YND A;  4HVB A;  2OVF A;  3D9L A;  3ZYL A;  3CGH A;  1UG3 A;  3RK6 A;  4DLO A;  3ZN3 A;  4RG6 A;  2WXN A;  3RIB A;  3PRZ A;  3FUN A;  4DPR A;  2LAI A;  5LX8 A;  4ILH B;  1OWN A;  4PH4 B;  3ENE A;  5M72 A;  1OWP A;  4N2S A;  3LCA A;  3MX3 A;  3SD5 A;  4FLH A;  3QWW A;  2QFC A;  4HXI A;  4OVV A;  4KVM A;  4ACL A;  3CVQ A;  3LY9 A;  4J8E A;  4GU5 A;  2VGY A;  1JUQ A;  3MYV A;  3FH7 A;  3LPZ A;  2L0T B;  3DPD A;  1JWF A;  5CCM A;  3CKC A;  3CR3 A;  2J4D A;  3D9M A;  3L08 A;  4A1S A;  5AEN A;  3AS4 A;  3I4G A;  4RG9 A;  1NZN A;  2Q7F A;  3NQP A;  4F1S A;  4W9R A;  5KJN A;  2RD0 A;  2KM4 A;  2MRI A;  3MV3 B;  2KAT A;  2KC7 A;  3UT7 A;  3PRE A;  2XPI A;  4ACK A;  4CCA A;  5BV0 A;  3CV0 A;  4FP7 A;  4WAF A;  3FUE A;  5A23 A;  3TGO A;  1HE8 A;  3KAE A;  2FI7 A;  2JEK A;  4GCO A;  4RVB A;  3B7U X;  3FU0 A;  5G04 J;  4CRW A;  3NZU A;  4DI4 A;  4AIF A;  3AS5 A;  2X6I A;  3ZHE A;  3N71 A;  4GMJ A;  4XI9 A;  4Q96 A;  4U8H A;  3R9A B;  4I6G A;  1H2T C;  4BT9 A;  3UUX A;  3FEY A;  4ANW A;  5BT1 A;  2V4L A;  4FA6 A;  4J8F A;  3JUI A;  1H6K A;  3ONL A;  4JEU A;  5EX3 A;  4AY5 A;  2I1J A;  4U07 A;  2X6H A;  2UWJ G;  5CHE E;  4G2V A;  3ZRH A;  4WWO A;  1EYH A;  2XHE A;  5CMY A;  2I2O A;  3IHV A;  1PAQ A;  1KT0 A;  1MHQ A;  2VGX A;  2Y4U A;  3OXL A;  4FHJ A;  2Y4T A;  4TUU A;  3APF A;  5AIJ A;  3TXM A;  3GYZ A;  4L1B A;  3FUL A;  2A5U A;  4XZ4 A;  4FAD A;  2XEV A;  2PQR A;  3ASH A;  4I43 A;  5G05 J;  3LVR E;  1UJK A;  3PZD A;  5ANR A;  4P29 A;  3ONK A;  3FTZ A;  3FUM A;  2NXP A;  2E2E A;  4I1O B;  3Q4A B;  2YHE A;  3FP3 A;  1SQM A;  4EZJ A;  4GA1 A;  3G2T A;  3FTS A;  4FJY A;  2L0I A;  1XGW A;  3EHN A;  1UJJ A;  1E8Y A;  3LEW A;  2KCL A;  1H0A A;  3CVV A;  3VLF A;  1Y8M A;  4N2Q A;  4CDR A;  1TEZ A;  3EIQ C;  4QFV A;  2VTB B;  5HQ8 A;  4UQY A;  2LSV A;  4LCT A;  1E90 A;  4GYY A;  3APD A;  2NC9 A;  2WXG A;  3CVX A;  4E85 A;  4GZD A;  1XNF A;  4UQZ A;  3S7D A;  4JHK A;  4PS8 A;  4U0S A;  1INZ A;  3MV2 B;  3G2S A;  3FUK A;  2AW6 A;  1QQE A;  4GZ6 A;  3P1U A;  2OVB A;  2XGO A;  2LSU A;  4AVX A;  2X6J A;  3G2W A;  3D9I A;  4HS2 A;  3QKY A;  4AM9 A;  3KD7 A;  4EQF A;  3EIJ A;  3S7B A;  4GPK A;  4JL0 A;  5FQ7 A;  4G1T A;  4IRU A;  4LER A;  3FTY A;  2OND A;  4XX5 A;  3UQ3 A;  1JPL A;  1UN9 A;  3B7S A;  4KMO A;  3WXX A;  1W3B A;  4ILI A;  2FO7 A;  2AXZ A;  2X3M A;  3CLJ A;  3CVN A;  3QDN A;  4TRQ A;  4CDN A;  5C1D A;  1Z6T A;  4C0M A;  2EQX A;  1HG5 A;  1E7U A;  4N3A A;  4BSX A;  2QY7 A;  2YHC A;  3RRN B;  2C0L A;  1OWO A;  3ZEF A;  1Z3X A;  4EZL A;  1HX8 A;  3QNK A;  2VYI A;  1VDY A;  2CHW A;  4UWK A;  1WAO 1;  2CHZ A;  2ION A;  3FDH A;  3I5P A;  5E76 A;  2FF4 A;  4HOU A;  4HOS A;  5J08 A;  1E8Z A;  3MA5 A;  1EF1 C;  1H2U A;  2WXR A;  5FTP A;  3URZ A;  2DCP A;  2IOL A;  3FY4 A;  4XI0 A;  1PC2 A;  2WXQ A;  3BG0 B;  4FLB A;  4LUN U;  4UI9 K;  3TJP A;  3HHM A;  2RG8 A;  3AU4 A;  4FU3 A;  5FZR A;  2WQ7 A;  4HOT A;  2CG3 A;  2VSX E;  1HF8 A;  3MKQ B;  1NP7 A;  2GRL A;  4GML A;  4KBQ A;  5DIZ A;  3FWV A;  1UW4 B;  2I6H A;  3JCK C;  1FVF A;  4U0Z A;  3Q5M A;  3SF4 A;  4B8C B;  4UWL A;  5BUZ A;  5AYW D;  5G04 C;  4GYW A;  4JXT A;  3ML9 A;  3B7T A;  3Q49 B;  4GZC A;  1Y6I A;  4WUY A;  3RO2 A;  2J07 A;  3IHY A;  3MKR A;  4PDX A;  3CVU A;  2OV8 A;  4NUR A;  2VGX B;  4OYS A;  4B89 A;  1ELK A;  4Q69 A;  3OTN A;  3VTX A;  4AP2 A;  4HLE A;  3QB2 A;  4GZ5 A;  1WY6 A;  4UI9 C;  5KJK A;  2C2L A;  3CHR A;  2VSO E;  5FQ8 A;  2PM7 A;  4I1M A;  4K03 A;  1B89 A;  2XRY A;  3U9W A;  1TJF A;  2WB2 A;  4IUL A;  2WM9 A;  2X6F A;  3ZYK A;  4EBA A;  4I17 A;  3SBS A;  2WXM A;  3CST A;  3D9P A;  2MOW A;  1N52 A;  4CDM A;  3PVL A;  2FBN A;  2IOS A;  4ANX A;  3ZYQ A;  1HU3 A;  3IV0 A;  4ME2 A;  3MEK A;  3U66 A;  3APC A;  3HIZ A;  3RU0 A;  5BPP A;  2XRZ A;  3O48 A;  3NZS A;  3FUD A;  2L9B A;  3L13 A;  3SFZ A;  4LRZ A;  1ZBP A;  4Y6C A;  3FUI A;  4XKB A;  5T8I A;  4G26 A;  4WWN A;  2WXK A;  4BX8 A;  2V8S E;  3LVQ E;  4FUL A;  3ASF A;  3EJN A;  3NF1 A;  4B8A A;  3CVY A;  3CK8 A;  4C0E A;  3D3M A;  4GYO A;  3CVP A;  1P5Q A;  4N39 A;  5AJL A;  2GRM A;  3T5X A;  4JC8 A;  4G11 A;  3PEU B;  3LDZ A;  3SI5 A;  4FHK A;  2XPY A;  3G2U A;  3L6A A;  3SNX A;  1U3D A;  3HYM B;  4DJA A;  4GZ3 A;  3I4R B;  3SHF A;  4GCN A;  4JZY A;  4M3O A;  4KVO A;  5LFA A;  2J09 A;  3B13 A;  1FCH A;  3ESL A;  3MCX A;  4BY6 A;  4J8D A;  3RRM B;  1ELR A;  4CGV A;  1ELW A;  1E8X A;  4EEC A;  3TXN A;  1HH8 A;  2CFZ A;  2V5F A;  3FU5 A;  1EDU A;  2LAH A;  1QZ2 A;  5JJ6 A;  2I1K A;  2J08 A;  3UMV A;  4CEM A;  1HZ4 A;  4APF A;  4HOQ A;  5LCW J;  5FQ4 A;  3CVL A;  2VTB A;  3VLD A;  1E8W A;  4DLQ A;  3UPV A;  5FWQ A;  5KJL A;  2FUL A;  1IHG A;  4YVQ C;  4AEZ C;  1GW6 A;  3QAQ A;  4E6H A;  2YNQ A;  4KYO B;  2PL2 A;  4ATG A;  3GZS A;  3PEV B;  1EPU A;  1HO8 A;  2PM6 A;  4JHJ A;  3QAR A;  4V3I A;  2WQH A;  3L54 A;  3U4T A;  3SZ7 A;  2KCV A;  4F7A A;  4G23 A;  4WNE A;  1S0P A;  3S7J A;  1IQU A;  4XKC A;  3LYA A;  4WWP A;  3RKV A;  3R7R A;  4MRU A;  4FC8 A;  4BFR A;  1LF8 A;  5KCM A;  4UWH A;  3ZGQ A;  3ZW3 A;  3PUK A;  1E7V A;  3IBE A;  3Q15 A;  2XCC A;  5JJ7 A;  5DBK A;  3CHQ A;  4BWR A;  3FH5 A;  5ENN A;  2ILR A;  4MLP A;  2XGM A;  2XQ0 A;  5ARG A;  5BV1 A;  2WPV A;  2CG2 A;  3GZ2 A;  4PS7 A;  2KZT A;  4U63 A;  3R7Q A;  4HOR A;  1A17 A;  4A1G A;  2VQ2 A;  5BW8 C;  2IFU A;  3G2V A;  2AXU A;  4EPZ A;  3Q47 B;  2VSN A;  3L16 A;  4BTB A;  2WXI A;  4D10 C;  3CEQ A;  4NQ0 A;  4JA9 A;  3RO3 A;  5JJT A;  4IN3 B;  4ANU A;  2V0P A;  3OXF A;  2E0I A;  5D0O D;  4G25 A;  2BTD A;  4R7L A;  3FH8 A;  3FEX A;  4B0Z A;  4CT0 A;  3BG1 B;  4UI9 J;  2X38 A;  2VSY A;  4BX9 A;  4HFG A;  3TAX A;  2CHX A;  5BNW A;  3CKB A;  1KLX A;  1HG2 A;  1ZU2 A;  2BF0 X;  1Z3Y A;  3LKU A;  5C2Y A;  3VLE A;  4F3V A;  4MS6 A;  2P58 C;  3CHO A;  3CQC B;  3PNT B;  3E4B A;  1WM5 A;  3LS8 A;  4O6F A;  4PS3 A;  3UX4 A;  1SZ9 A;  3DBS A;  3CIA A;  2PZI A;  2OOE A;  3ZYM A;  3AS8 A;  3PE3 A;  1HXI A;  4UQX A;  4XIF A;  2KCK A;  1SZA A;  4L23 A;  4G24 A;  3TG5 A;  1PY1 A;  4JA7 A;  2VJ8 A;  2WMN A;  4I6E A;  4JEH A;  3OXG A;  1KT1 A;  3D9O A;  1L5J A;  1OUV A;  1OWL A;  4J8S A;  2AVP A;  4GB9 A;  3D9J A;  3KEZ A;  4U0U A;  3CHS A;  3CHP A;  4AV7 A;  2KZT B;  5FQ6 A;  1YA0 A;  1N54 A;  3QC1 A;  3RRU A;  3FUF A;  4JVS A;  2YQ8 A;  3FU3 A;  4Y6W A;  2WQ6 A;  3TG4 A;  2HR2 A;  4DI3 A;  3MKQ A;  5G55 A;  4J6I A;  4EBA G;  2NSZ A;  3HVE A;  4L2Y A;  3ZVV A;  4AY6 A;  4UWF A;  1MQS A;  3FHE A;  4CT4 A;  3PNL B;  5JHA A;  2R17 C;  2JLB A;  2R5S A;  4U04 A;  2C0M A;  4JW1 A;  4A3T A;  3GW4 A;  5G2N A;  3B7R L;  3K9I A;  3ESK A;  4N3B A;  3PDN A;  4JHR A;  3D9K A;  1NA0 A;  3PH0 C;  4I6J A;  3TL5 A;  4I1A A;  4I2Z A;  4KXK B;  1UN8 A;  4WNG A;  4UWG A;  2A4Z A;  4AXH A;  3ZXS A;  3FFL A;  5LCW C;  2PQN A;  2YIN A;  3AU5 A;  3SGH A;  3CVW A;  2XPZ A;  4L2L A;  3PUJ A;  4MKT A;  1H19 A;  3ML8 A;  2BUG A;  3QOU A;  4N5C A;  3ZIM A;  5HI7 A;  2HO1 A;  4LEU A;  4ANV A;  4C9B B;  4DK5 A;  2WXP A;  4KZ0 A;  3FTV A;  3IKO B;  4ILG A;  2L6J A;  2J4B A;  3KS2 A;  5EX0 A;  3CQG B;  4GAA A;  2J9Q A;  5ARF A;  3I3N A;  3CHM A;  4J0U A;  2UY1 A;  3QWV A;  3HVE B;  5CMW A;  2LNI A;  4GA2 A;  1QNF A;  3LY8 A;  3MGB A;  3VTY A;  3MJW A;  3FTX A;  1BPO A;  2IQC A;  4OVU A;  4H7Y A;  5FJY A;  4GA0 A;  4BTA A;  4URK A;  1DVP A;  4PUC A;  3ZPJ A;  1DNP A;  3LY7 A;  2WXL A;  4TV3 A;  3UT4 A;  3CK7 A;  3MZL B;  3QWP A;  1U3C A;  3ULQ A;  5LP0 A;  4Q94 A;  5FZS A;  3FTU A;  4KZC A;  3JQ1 A;  4N3C A;  4IYP A;  5FT9 A;  2UY1 B;  4B94 A;  1NA3 A;  2CFU A;  4A3V A;  3L22 A;  3FTW A;  2AWI A;  3SBT B;  4L7T A;  5AJD A;  4JPS A;  2XCB A;  4WNF A;  4WND A;  3EDT B;  4CGW A;  3T5V A;  4RSY A;  5LOZ A;  3ZFW A;  5EKQ D;  4AOF A;  4YVO A;  4I9C A;  5E75 A;  3LXU X;  5ANL A;  4BT8 A;  1H2V C;  3PE4 A;  2MHK A;  5J90 A;  3O4Z A;  2GGF A;  2WMO A;  2X6K A;  3L17 A;  1FVH A;  3FU6 A;  3IEG A;  1OWM A;  2J49 A;  2LO6 A;  4KT6 B;  2ZU6 B;  2Y3A A;  5A7D B;  1IQR A;  1JWG A;  5A6C A;  2AXV A;  4FJZ A;  2WXJ A;  2WXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...