2HRPH

Antigen-antibody complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
226
structure length
226
Chain Sequence
DVQLVESGGGLVQPGGSRKLSCAASGFTFMRFGMHWVRQAPEKGLEWVAYISSGSSTIYYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTALYYCARSGGIERYDGTYYVMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of an Fab-peptide complex: structural basis of HIV-1 protease inhibition by a monoclonal antibody.
pubmed doi rcsb
molecule keywords MONOCLONAL ANTIBODY F11.2.32
molecule tags Complex (immunoglobulin/peptide)
total genus 38
structure length 226
sequence length 226
chains with identical sequence N
ec nomenclature
pdb deposition date 1996-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hrpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hrpH01
1CFTB 2Q8AL 1E28B 3GIVB 4JHAH 4PGEB 4ZFGL 4FFVD 4XMPL 2AEPL 3A67H 3OHXB 4OLUH 5D1ZB 4M5YL 2OQJB 4LHQB 4KROC 1B6DA 1CFNB 1GOFA 3D2UB 1BMGA 4JRXB 4NCDA 4NT6A 5DUML 3HNSL 1F6FB 3UPRA 2O93L 4LSUL 3NN8B 1Z3GH 4K8RL 3GZKA 5B4MD 3PWPE 2YA0A 1LO2L 4GKNB 3HUJF 4MAUL 4GUPB 4O2EB 3IJHA 1KULA 4YHYC 4N9OB 1PAMA 4JVUA 4Q74A 5I1JH 2DWDB 4QY8A 3DUSB 5F6HJ 3SN6N 5J1AB 1ZTXH 3CXHK 4FRWA 3TJEH 4F37K 3C6LB 3U7YH 3WN5A 4JO2H 5EORL 4G6FB 5BRZD 1Z9SA 1IGML 4XBEL 3GMLA 4XWGH 4NQXA 3ARFC 5K9OA 1WC7B 3K8KA 4OFIA 3E3QC 3SDXB 5CSZA 2P7TA 1Z9LA 5KN5A 2ESVB 2AGJH 3IXTA 4OLWH 1RULL 3BZ4A 5L2JB 2VAJA 1IGFL 1ZANH 4ZPVA 2DQEL 2P48B 3N50A 4OCYL 1FGVL 4YZFF 1IEBA 1NFIA 4MNHA 5EU6B 4PGJA 2AK4E 2HN7A 4ZTOL 5DRXA 1H3TA 1ORQB 4M7KL 1DQML 3SE3A 3STBA 1IC7H 1LO0H 2KKQA 1RZ8B 2VN7A 3Q5OA 2R69H 5HTSA 4EVNA 1IGTA 5DJ8B 4OCNC 1NLBH 1GL4B 3I85A 3QFJE 5IQ7H 4HEPG 5CJ5A 2YUZA 3CJJA 2MCG1 2WQ8A 2EDYA 4YDLC 1NBVL 3LV3B 4YFLI 4PJBE 3VXUE 1HXMA 5A1AA 5C7XL 3RWDB 5IHUH 2QADB 2AJSL 1HHKB 3KNBA 1U3HB 1QLRB 4U6VH 5EWIL 1YEKL 4LLYB 4F7TB 3RL1A 5I1CL 5IVNA 4G42B 2FR4B 3MA9H 1KJ2H 3MLSH 4G9DA 1IILE 5E6ID 5F1OB 2X1PA 2C1OB 4YBQD 5C1MB 1U93B 4OD3L 1OQOA 2JJWA 1IZKA 3AB0C 2DYPD 4LSRL 4JVWA 1IAMA 2I60H 2DQHH 3LS5H 4RIRB 1QA9B 5C86A 3N1PC 32C2B 1JWMB 2NLJB 4I3RL 1QR4A 2NR6D 5DHVH 5JXAH 3VJ6A 2YRZA 2VZVA 5ACZA 4RRPG 3L95B 1DE4A 4WCYL 1HQ4A 2X4NB 3MLVL 1CBVL 3HUJB 4PLKC 4GMSH 3MROA 4G8GA 2ZCHH 1WIUA 3HI5L 3QBTB 5T1MA 1NCBL 5TFSH 1SJXA 4MDJA 1FZJA 5IHBA 1VFOA 4MXWL 5F7LB 3W39A 1FFRA 4QRPB 4OCXH 3VGGA 3BWAB 1JIBA 4FQQB 2B0SH 5F7KC 5C08B 1I1AD 1EBPA 1KG0B 1RUQL 3IF1A 5E8PA 3UTSE 3NCYP 3IDMA 4JO4H 4OIBA 1AR1C 1U42A 3HLAB 1MIMH 2UWEA 3O4LB 4KQ3L 3VE0A 5CD3B 4OAWB 5E00A 2XKSA 1KPVA 5DJCA 2HTLD 4JM2F 4LPYA 1VGEH 4F3FB 5IEKB 2W0FB 5FHBL 4JDVA 1AQKH 4XAKD 4K7FA 1T3FB 3SEPA 2JJUA 3PWJB 1FO0A 1U9KA 3GNML 4QOKE 5FF6A 3CVHB 2DLHA 1U8IA 4LCUB 1RU9L 5I76B 3I75A 3ARGD 3VFWA 4YHNA 2LAAA 3FOMA 5IG7B 4HT1H 1MJ7H 2GITA 4N0UB 4TOYH 3VXMA 1U8MA 1M71A 3RGHA 2A9MH 3HAEA 4E9LA 3PL6D 3JWOC 3HA0A 3DRTB 2E27H 2EDEA 1FLRH 4K07A 3MRPA 1N6VA 4GW1B 4NJAL 2BC4A 4X7SL 3RGVA 5BMFL 4OF8A 4PTTA 2YA1A 1F4WL 3UYRH 4X6EB 4RA0C 5IROC 5IB4B 1SYSB 3T0VA 4KKLC 1ROWA 2H1PL 2QADC 4NHCH 2Z8WC 1U3HC 4NPYB 1NC4B 2W38A 3QJHA 1QLFB 3INUL 1JV5A 3DTXA 1QR1A 5EZIL 2C3VA 3DO7A 5FB8A 4GAGL 3RA7H 1QRNB 3S6CA 3V5DA 2OL3A 4ZUSA 5JZ7D 3PWNA 3I6GA 1MFDL 1DQQB 2HYMA 2VDNH 2AK1H 4YNYA 5DFWH 2BCKA 1KTDB 2VMFA 3H9SD 1RPQA 4ZTPH 2NW3B 3QUXA 3WDIA 4UV7L 2CRZA 4IMLB 1Y18A 4N90E 5INDB 1H15A 5CJBA 4LVNB 1DANT 3BVNA 4D3CH 5GS0D 3T0EB 1RURL 2WZPD 4NGHH 1P2CA 1N59B 2YN3A 2BMKA 3HE6D 3JVGC 4P5TB 4QHKI 3RVTC 1RZFL 2NY0B 3WNMA 4UI2A 3EYSL 4QHLA 1XCQB 4WI4A 1I1AA 3FB6A 1REIA 1PZUB 5BV7H 2HT4D 1TJHL 2D9QB 2BOCB 4NZRL 4U3XA 5AG9A 5FO7B 3SGKA 4HUVB 1DL7L 1QD0A 3NCEB 4OCMC 1AHWA 4DN4H 4MNGB 4JM2B 4P2CG 3O6ML 1N2RA 1X7QB 2HFFB 3LRSA 1P9MC 3SE4C 1EX0A 5T3XE 1SVCP 1QSVA 3HFML 4LRIC 3MV9B 4NDMB 4JLRB 2VISB 4YWGL 1HCFX 5DJYB 2L7UA 3WNKA 1CLYH 5GIRA 1BQSA 1FVDB 1T4KB 3PL6A 3QIBA 5MEQB 1F4AA 1U8LA 1MIEH 3WEXB 4AIZA 3JWDL 5I1EH 3SO3B 5FYLL 3L7EA 3P30H 1MREL 1PQZA 4RDQF 1VFMA 5E5MB 2QHRL 2GSGB 3TO4C 4AEEA 1A1MB 2O5XL 5DJAA 4L4TA 5ALCH 2BDNL 4NM8H 4NHUA 1S7WA 4WV1A 1W0VA 2BRRL 4GRWB 3RNQA 2BSSB 1XGUA 5F7EH 2NXYD 5M7QA 1X5YA 3D87B 4ZNCD 4ZMAT 4JJHA 4ELMF 4YUEL 1L7IL 3HNTH 5EULV 2A6IA 5JDSB 3QQ3B 5E1AB 3IDIA 1QSZA 1KACB 1EZVY 3UJJH 5HPOA 1MF2L 3GMQA 4MWFB 3HG1B 3H9SA 4FQIL 1KB5A 2ICES 4H5SB 3EUUA 3LKQA 5GZOD 4IMKC 4CL7A 5KVFH 3VDCA 1CGSH 4GG6A 2ED9A 3T0EC 1I3GL 4URTB 4PLNC 3GRWH 4WFED 5ENWA 5DQJB 4O5LH 2QHLA 2B5IB 2KQMA 1IKFH 1JP5A 4GSDL 1C7TA 4P5TC 2NY0C 1TZHB 1ULVA 3O6LL 3P0YL 3P9LB 2C3XA 1LO3H 3CFKB 4XXDA 3ARRA 1PLGH 5JW3L 1OAQL 5F93C 4X7DC 4NSKB 4CW1A 4LEXH 3DX7B 4G8FB 2EKSB 2R23A 4HK3J 4M8VA 5H94A 1FO0L 4JM2C 4UNVA 4KI5E 1HHGB 5EBGA 4U6XA 2H26B 4Y4HB 2UUDH 4DFIA 1AFVH 1I7TB 4J3WA 1LD9B 5E9DD 3QRFM 1BFVH 1HHIB 1WF5A 2R56H 4LKXB 4PS4L 3FT3B 3L3KB 4U1HB 1INEH 3ZE2E 5KW9H 3UTQA 3RWGB 3T0DA 2VLKD 2FWOB 3MJ8B 4JFYB 4UILL 3SO3C 2ENSA 1BAFH 2WWMC 3SY0B 4L8BA 35C8H 3SJVA 2FNBA 2CDEB 3UEZA 4ETQA 4DCQB 5B3JE 1P7QA 4Q9BA 4AEIL 3HPLA 4U33A 1HILB 2D0GA 2J3SA 3QWRA 2DI8A 4MX7B 2OL3L 3U1SH 3MCKA 4E42A 5CILH 5FV2A 4ZFOB 2WUCL 5AD0B 4X80L 3OGOE 2DICA 3GM0A 2GHWB 3QEQD 5B39A 3OR6B 3ESUF 4Q6YA 4WUUA 2YKLH 4P5MB 3TT3L 3PWPB 3DIFA 4JFDA 4M00A 4YAQB 4IOFC 3H9HA 3LZFH 3L6FB 3D3VD 1X5XA 5D6DC 2N7BA 1JRHL 1ZT7A 3EHBC 3TYGH 4FG6D 2Q8BH 1MPAH 2XQYG 5KVGH 4P23B 1MJUH 4Y1AD 3X3FL 1UB5B 2NY6B 1MJJB 5EC1B 4JFZL 2ZSWA 3EYQC 3T3MF 4JHWL 4QGTA 2B5IC 5JNYA 1G84A 3TZVD 3QPQC 4MJIB 4ZUUA 5DWUL 4C56E 3BYTA 4GOSA 1KCVH 2EYRB 4XCYB 4RFOH 5MP6L 3WFDL 2XY2A 1QFOA 1Z5LB 4GKSB 4NFDA 1CLZL 1CXFA 5FHAH 3TBYA 4F33A 5E8DH 4NKMA 1T1YB 2EDBA 1F42A 1I9EA 2VKXA 1VCAA 1RZKC 5DSCA 1F8TL 3SQBA 2AK4B 4Y4HC 5LCVL 3C5SA 2E9BA 4NKDA 3RY6C 2DF3A 2NY7H 5J0BA 4MA7H 4J2XA 3DHMA 5FUCE 1GGYA 3JV0A 2J8OA 3L9RB 5E9DA 4JFXB 1HQRB 5E94B 5LKNA 1HSBA 3C2AH 3QFJB 1KXTB 1MVUB 2EDOA 4E5XB 2XACC 3VCLA 1WIOA 2HA1A 4Q0XH 2ATPA 3LMJH 1GC1C 3GHEL 4K9EH 3VXUB 4NNXB 5EZJB 1MCOL 3HZMA 4HFUH 4J1UB 4TSCH 2Y36L 1KTRL 2BX5A 3BT2H 1XEDA 3GMOB 2V5MA 5B3NA 4M7JL 1BZ7B 2WNGA 3R1GL 1UM6L 2Z0BA 4WENB 3G5VB 3PQYB 3FO9A 3P11L 5EUKB 4DVBA 1R3LB 5F6HI 5FO8B 2HH0H 1A7PH 1IFHL 5F7UA 5JHLH 4AQOA 5B8CB 2O5YL 1CD0A 4RBPK 5GJSL 1CG9B 3GJFK 5SWQA 1V5JA 1NBZA 3EYOA 3WS6C 4M43L 4G43A 4NWUL 4L4JA 3MV8A 1KB5L 1JTPA 3CFCL 1CXEA 5F89B 2EIDA 5EFIA 5JO5A 4OV5A 4JKPH 5EG6C 3MV7B 4P23C 3BQUB 4UTAL 4JO3H 4WNQA 2NY6C 4F15B 1A6AA 1CIDA 3MBED 2M8XA 3NVQA 43C9B 4ZXBB 3IVKB 4O02L 1C16A 2HJFB 2EXWC 5TE4H 3L5IA 3UJIL 5I2IB 2PCPB 3HRZB 1JF1A 3UTSB 3GJEA 1I3RB 1F6AB 3R0MA 1YQ2A 4R96B 4PRDB 1MHCA 4D9QE 2VLMD 4HHAA 1BX2B 4UIKL 3QPXL 4NO3B 1LEGA 4Z78B 5BW7C 3ZDYF 2VL4A 3PGCB 3ZTNH 1A7OH 2V2XA 4RQQB 4QOKB 5C09A 3WIIL 1L0YA 3MMEB 4X5XA 2MMXA 5I8KL 4RNRA 1H8SA 3AS2A 3THMH 1WEJH 4HIEA 3ARYA 3WNLA 3SBWC 3D85A 4J8RB 1MCRA 3G04B 3HZYB 5ESVA 4NN6B 1RZ7L 4Z77B 3UBXG 3ZMRA 1YECL 3BGFC 5JLZA 3S35L 1H3GA 3S88L 3T2QA 3OKMB 1FV1A 5BS0D 2ZZUT 2FD6H 2IWGA 4U1MB 3IT8D 5ADPH 3LS4H 1QBLH 3O8XD 1CLOL 5KS9A 5F1NB 5ALBL 2ITCA 2EH7L 5DMGD 1OGAD 2XKNB 5HVGB 4CNIA 5ADOH 3QNXA 2X1OA 2V7NA 4C55A 3P77A 4M62H 1GJIA 5IKCB 1DSFH 2NY4B 4N9GA 5C07A 4YE4H 1U8JB 1KLUB 3P4MA 5IF0B 3PABA 4AENA 3ILPA 1CDBA 1T0PB 2XYCA 2X4TB 4H0HB 2HT2C 1XH3B 2VZ1A 4IRSB 5C0BD 2FJHA 3TEUA 5GGTH 4HF5H 1KELH 2DQGL 5HYJB 3P0VL 3TVMD 4XCCH 1ZHNB 4ODHL 4L4VD 4YH6A 1MCWW 1OD7A 2JJTA 3BQUC 3QDJB 3D48R 2P8MB 4ONHA 4F15C 1CFQA 1VSCA 4NRZA 3TPKA 3UX9B 5GHWH 1KPUB 2YUVA 4ZS6D 4ZXBC 4R2GD 4PRNB 1T66D 1MFCH 3SDYL 1A3RL 4WEBL 1LP9A 4P3DB 3AS1A 5KVDH 2GCYA 4MNQD 1FP5A 4X0KA 4NO2B 5A2JH 5DHXB 1JPFB 3BXNA 4KUCF 1YYML 4P5KB 5L9DL 4FFYL 3MBXH 4PRHB 1NCCH 3GMMB 1A6UL 3MGOA 2J4WH 4ERSL 4OCSL 3CSYA 4KDTC 3LKSA 3EYUL 3U79A 1IM3A 2XN9A 3KYMA 1DUZA 4R7NA 3O3EA 2GUOA 4NN6C 1F02I 3UTOA 2R0LH 1UQSB 4TVPD 3KHQA 1HH9A 5E8OA 3MA7A 3TBVB 2I25N 2Y5TA 5IK3A 1MUJA 3DETC 1FNFA 5KSAB 1T5WA 4PGBB 1WFTA 1IAIL 5B3JF 4YQXL 5IMKB 4XC3L 1OTTC 3O3AB 2P5WD 4JAMA 4XNYL 3GI9L 1RZGB 4OM0H 3I2CL 2XFXA 3O8XA 2WBKA 5I17B 1NGPH 2DM4A 2FBJL 1PZ5B 4GQPH 2H32A 4HFWA 4UDTB 2VL5A 5CUSH 2Q1EA 2R1WA 1S3KL 1XF2B 4B5EA 4OGYH 5KSVA 2RR3A 1ZVHA 3N9GH 2DN7A 1MCFA 3KPRD 2VITB 2FL5A 4PY7B 3GIZL 4KI1A 3VRIB 1H3XA 1A3LH 4TRPL 3MRJB 1Z9MA 3I6KA 1AGFB 5GISH 3SDAA 2WM0A 4KQ4H 3B9AA 1OTSD 2AXJA 1M7IA 2RAMA 4IRSC 3RVXC 2BVUA 4POZC 3KLAA 5JUEH 1E4WH 1B9ZA 1LMKA 5LWYH 4CADA 2VLJA 3IDXL 4P46B 2H9GB 3VD3A 1UM4H 4N1HB 4Y16D 4XHJD 1KJMB 5FYLE 1DLHB 2NW2B 2OXHA 2VH5H 1OF2A 3TVMA 5MENE 4RMSA 1U8QA 3MNVB 2VLLA 3JWOH 5GGVY 5E5RB 4KK9D 3L5HA 2EDNA 1FNSH 1FGNH 3MFFB 2KDGA 3QO1A 3PDOA 5JMOC 3BD5A 4XPFL 2VXVL 1KXVC 4NZTH 5A43C 5GRJH 2F54D 3IGAB 1FC2D 1GPOL 5DFVD 3C8DA 1RUMH 1JNLH 1UEMA 1IKNC 3O0RL 4UINH 4Q6IB 1EHNA 5FGSA 4G8GE 3CX2A 1ZLUH 1NC2A 2ZOKB 4YXLH 5JQ6H 1XF3A 4GW4B 4ETYA 3DSFH 2VLRD 4QXGL 4YPGB 2V5YA 2DQTL 2ICWJ 4PJDA 4TSBH 1A4KA 1BBDL 5KSAC 3DUUB 5F9AC 2UWEE 1FNGA 3MJ7A 3B8YA 1FSKB 1SY6A 1U8NB 4KMLB 3L3JA 4LSQL 4ISVA 1YEDB 5GSVA 4Y2DD 1OW0C 5DJDA 3RPKA 2AERT 3GMPA 1FFOA 2Z91B 5BOPA 1D5IH 1EH9A 1UYWL 1R3JB 1YUHA 5GZND 3FN9A 1DQTA 1UCBL 4ZFZA 3ROOA 3SOBH 4XGZA 2V7HB 3FN0H 4TTDC 4R4BB 1JNHB 3VXME 4WW1A 4JN1L 2MKLC 5C2BL 3JUYA 4WJ5A 3PP3H 5C0FB 3AFLA 1JMZA 3CVHH 4P46C 1KEGH 2OP4H 1RUKH 2GY7B 3LB6C 3P73A 5D2LF 4AIOA 3BH8B 3OKDA 2G2RB 1J0JA 4L3ED 1PX3A 1JN6A 5IB2B 3GBNH 3KWWA 4JB9L 3UC0L 1FFNA 3ECBA 5C0AA 2E5EA 2OMBA 4ZDHB 4C56B 1DBBH 3UJTL 4V2BA 2DJUA 5HI4C 1LEKB 1YMMA 5J13B 3IJYA 4NKOA 3BEWB 4PJIA 2CD0A 2IAND 1FZOA 3EYFB 3HZKB 5D6CA 5T33H 4DGIH 1JYNA 1K4CB 1S7XA 5K59E 4HJGB 1C5BH 4I8DA 4K7PH 3NCCB 3WE6A 4Z6AT 5A2FA 1FVCB 1NUNB 3K74B 4PJHE 4M6ML 1MY7A 3TV3L 4IRZH 3WLWC 1B4JL 3GJFA 3EOBA 4Q6IC 4M1DL 1J5OH 3EO9H 2AEQL 2X40A 5CAYB 2R29L 2CXGA 1XGRA 1I7RA 2APWA 5HYSA 3RUGA 1DQJA 4OZIA 1C12A 1BPVA 2Y06L 1T0NB 4K2UH 5FYKH 4YGAB 3MV11 2AQ3A 2XRAL 4YK4B 4QHUA 2PW2A 5EPMA 2J6EH 4KAQH 4GQ9H 3TC9A 2VQ1A 2BFVL 3GSOA 4PGDA 3T77A 5CS7A 4Y5VB 2IMMA 2VXQH 1FZMA 2Z35B 1FSKC 1C08B 3WXVH 1KLGB 3CD4A 3IAGC 4J3XA 4X4XB 1G6RH 3VXQB 3MRHB 4LDEB 5C0JB 4Q9QH 1TVHA 5BZWB 1MAMH 2IAMD 3QEGH 3QUZB 5EIQA 5FM8A 3QNZA 3QQ4B 4Y2DA 3QRGL 3UAJD 2QLVB 4JN2B 4ZAKB 3VFPB 1KJ3L 3MRBB 4EN3B 2PUQT 1ZWIB 3EDEA 9CGTA 2VWEC 4NRXB 2UUDK 2Y07H 3GO1L 4HIJA 3F58L 4OFKA 2B1HH 4EIZC 5F72S 1YJDL 4OZGA 4XMLH 3WL9B 1I3VA 1AIFB 1N5AA 4JO1H 3ULUD 4ZODA 3TFKC 3ULVD 1VDGA 1LNUA 3BISA 4NBYB 2QQLH 4JCMA 5D2LB 5JOPE 1WICA 4Q9RH 4L4TE 2VIRA 5F71A 1AD0A 2DQDL 3KPTA 3GK8L 1U8KA 5DRZB 1F13A 3Q2CA 4JDTH 4ODUB 1FBIH 2I9TA 3EDKA 3EDJA 3L3IA 4H1LH 1G7MA 4JPIB 3KPSA 4FQ2H 1CFVH 4XPTH 4K8RC 3EW3B 4U1LB 4GRWH 2ZUYA 1AE6H 4KTEH 1UA6H 1ED3A 4QRRD 1X9QA 3HI6L 4ZNEA 2XWBA 1TTFA 1MAJA 3FO1B 4GG6E 5E99L 3X17A 3FO2A 1T7YA 3ZDXF 4Z7NE 4CKVX 3C8KA 4TVPL 1S9XB 4YK4C 1IARB 2B1AH 2UZYB 4PFEA 4OI7A 4PJEE 4PG2A 5IOPA 1M6OB 5T1KB 2HRPL 1V3KA 2VABA 1HZHL 4Y5VC 2NY3D 1ZLWH 3EO0A 3T2NL 2WV3A 3V8CA 2V2TA 3ZT6A 2IQAB 1KIQB 1X5ZA 4N5ED 1PX4A 4YDVB 3X11A 5K9JH 2OJEA 5L6YH 4LCWD 4IS6B 1O7SA 4HWBH 4HUWB 4V1DA 4ZAKC 3ZTJG 4UV4H 1D5BB 4EN3C 1IAOA 4KVCH 2DMBA 1R3IL 4Y4KB 3QIUD 3RTQC 3ARPA 1WZ1L 1C5DB 2FIKA 5F7DA 1BIIB 1G7PB 1RZKH 2IBZX 1RIVH 5TF1H 3SJVE 3MNZA 1HYSD 2CRMA 4F57L 2E9IA 3T4AA 1T89A 1YQVH 4D9RE 5BZDA 1HHHB 5C0IA 1MLBA 1RHHA 3S5LA 5FOBB 1J1OL 3QUYD 3QHFL 4TUOA 1JWUB 4P57A 2FX8L 4LMQI 3PP4H 1CK0L 4I5BB 4DKEL 3IS1X 1PDKA 4ZUWA 1AJ7L 3RZWA 2CSPA 2WBJB 2CJUH 4G8IA 2W92A 3VFRB 1H3VA 4WUUE 1PJ9A 4N0CD 1UACL 4JFDE 5SX5H 1RFDH 4X98A 1XGPA 4OLEA 5EH1A 5HGGS 4TVSa 3IJHB 1AGDA 5J7CC 4P2QD 4ODXB 4UTBL 3F12B 4PIRF 3BJLA 4KV5E 2EECA 4Z8FH 3WN5B 3TCLA 4PGCA 1TETH 1AR2A 1TVDA 1A64A 3KYNB 3GMLB 4NQXB 3UPAA 1PVHA 4TNVF 4XCFL 4KZEL 2F5AL 2N4IA 5CSZB 3RI5K 1GGBH 2UWEF 5KN5B 2YMXL 4HW6A 3NA9H 3IXTB 1XF4A 3BZ4B 2CO6B 3RVWC 1BWWA 2A73A 4P4RA 1OLLA 4GG8A 5EO0A 5FA4A 4IHOA 1U6AL 5TQ0L 1EUTA 1IEBB 1RVFH 1S7QA 4FHBD 4MNHB 1G1YA 2HN7B 1M7DB 5DRXB 5GGQH 3MXWH 1FVEA 2NX5D 2CK0H 5ITBL 1OSPL 5TDNA 4YXHH 4H20L 4Y4KC 4D9LH 4HJ0D 3VXRA 4PB0H 5FDYA 4EVNB 1IGTB 3C5ZA 1S7SB 1HE7A 5KSBA 3NCMA 3W9EA 3MRRB 3QIUA 2HFGL 2R2EA 4H25A 3BJ91 4B53A 1NUFA 5H37G 1UZ8A 4NM4H 2H2PD 3CZFA 2JELL 2JCCF 2MQCA 2ADGA 3FL7A 5JIKA 3QWQB 3CZJA 1UB6B 3KNBB 3EBAA 5JMRA 3RL1B 2XXCB 4G9DB 5LG1A 2NNAA 2F8OA 4ZO9A 2ORBL 3QUYA 5C0EB 1H5BB 4JG1L 3UBXI 3CVIL 5BQ7A 3QP3A 4RGOL 3QO0A 3D0LA 3DBXA 2WBJC 4W81A 2RQ8A 4EBQL 3L3GA 3W5MA 4P9ML 3U9UB 4AY0A 5FYJL 4EEEA 3MV8E 5DD6A 1DE4B 1JPTL 3PGDB 1HQ4B 2LE9A 2Y6SD 1JMXA 3OZ9L 5DGRA 4G8GB 4B7IA 1NEUA 5T1MB 3B2UD 4X8JA 5DEFB 3LH2H 3WN5C 1KLFA 4MDJB 3SKJH 1FZJB 3BIBX 5KSUA 5D1XD 2YPLA 5I9QB 3C08H 2CQVA 3BH9A 3IJSA 3DX8A 5J6HA 1ZGLP 4L29A 3O9WD 4JRYD 1ADQA 1G7HA 1I1YA 2JB6A 2YRPA 1T0MA 2V17H 1TJGL 3U4BL 2UWEB 4JY5L 4Z7VA 3FT2A 3MX0A 2OTUB 4H1LG 4JDVB 1CYGA 4LSDA 2ARJQ 3MRCA 1L7TL 4XVSH 4K7FB 1CE1H 1FO0B 4MJ5A 5C09E 1U8IB 3RIFK 4LAQH 3F7VA 2R0WL 3VFWB 5HDOA 3FOMB 2GITB 4PJ9D 5EU4A 1LDSA 1U8MB 3VXMB 1M71B 3V2AR 3ZL4L 4LSVH 3MLUH 1TJIL 1MI5D 4PJGA 1L6XA 2B4CH 2BY1A 2ERJB 3I9GH 3MRPB 5MHSD 3CU7A 3RGVB 3OJVC 1NLDL 3C60D 3JWDC 3ULUL 1EBAA 3KPPA 1K8IB 3ULVL 3NFNB 3O2WH 5KS9E 4YHLH 5J3HC 2VQTA 3BGMA 2GI7A 3CFDA 1JV5B 3DTXB 1L4IA 2C3VB 3DO7B 3NIDE 8CGTA 1T22A 5FB8B 1RIUL 5JIIA 3BOVA 5E6IB 1H5BC 5FFLA 5I8OL 2NTSP 2V5TA 2OL3B 1OAKL 4ZUSB 3VD7A 1HIML 2DKUA 5C07E 4RGNE 3PWNB 5CP3H 2IPTL 3SDCA 4W70A 5CJXA 4AZ8A 3I6GB 1BZQK 1T80A 4NWTL 1UCTA 2ICWI 3ZE1F 4AG4L 2WW8A 3FHQA 4YNYB 2BCKB 3WUWG 4BZYA 5B4MC 5EOTA 3QZWB 2XZAL 3L5WA 3IRPX 1Y18B 5KAQF 4GG6F 5JIPA 1FL6A 3BVNB 3FB7A 4Z7NF 4WO4A 3S8WA 5D9SB 5D2NA 5DA4A 1N4XH 5I9QC 2BMKB 1OY3B 3CXDL 4OLZH 5TE6L 2BRQA 4UUJA 3QHTC 1LP9E 3B3IA 3QFDB 4QHLB 5E2TL 1I1AB 3FB6B 1J8HA 3VD5A 4YIQA 3O9WA 3JV5A 4HEME 4NBZB 1ZVSA 4JRYA 4GBXD 3NOIA 1U36A 5F7HA 4RDQG 1AHWB 4PRPA 1ZHKA 1OPGL 4LFHG 1F4HA 1N2RB 4LIQH 3OAYK 3U7WL 3LRSB 2MPAL 1TCRA 2XN9E 4JFQA 4LBEA 5IBUB 5FGCB 1L0QA 3MRIA 3QDGD 2EE2A 4QXUH 2ERJC 2PNDA 5GIRB 1UWXH 1QFPA 3PL6B 3QIBB 4XT1C 1U8LB 1JGUL 4AIZB 2XXMB 3RGVC 4HUKB 2VE6A 4WW2A 3MUZ1 1MCIA 1QQDA 3L7EB 4RFEA 3RBGA 1PQZB 5CEYB 3TIDA 5J6GA 1CDCA 1RMFH 4P4KA 1OL0A 1N5YL 1YYLH 4J23A 4O2FB 4S1DD 3F7PC 1TENA 4L4TB 1S9VB 4OZHE 1S7WB 3PF2A 1W0VB 5I1HH 1PG7H 2UZIH 4R90L 4ELKA 3AGVA 3BIAX 5E6IC 4FTVE 1RUAL 2Y9RT 4YBQC 1QSFD 1OAYH 4DK3A 5CEZE 3NCBB 1W0WA 1XAUA 1YNTB 5IJKC 4LSSL 1EEQA 5J9PA 3WNOA 3QXDA 1GZPA 5D7JA 4CVZA 2CIIB 4ZYKB 1KEMH 5D1QD 1LK2A 3NPSB 2R1YA 1BM3H 1N64L 2VLJE 3H9SB 5IB3A 5LGHH 1KB5B 5HXMA 3DJ9A 2CKNA 3PP3K 3TNNB 2B20A 3LKQB 4YDKL 5AZ2L 3KYOA 2YHGA 1HSAA 4GG6B 3LVEA 3EFDL 4PJXA 5ENWB 1N3NA 5IVZB 1KENH 5L2KD 1AKJA 1UJ3A 1ADQL 1JGLH 5L8KB 1N26A 3MFGB 4U0RB 3HE6B 2PW1A 4GKZB 5D7IA 4XXDB 1I1AC 3TESA 3E8UH 1FFPA 1FORH 3WFCL 4CW1B 3S3JA 3WO3B 3RZCA 2R23B 1ZK9A 4X8XA 1JYXA 1AHWC 3QA3A 3BZEA 2X1QA 4U6XB 1S5HB 3NFPB 3GBML 4MSWA 3DMMA 3OSKA 3K4AA 5I66B 3ARGC 1ACYH 1I85C 3QCTH 4ODTL 1KCSH 2W9LA 3OPZL 3ROLA 3QDGA 3UTQB 4PJDE 4BQCA 3PL6C 4NO5A 1TFHA 2EXYC 3C9NA 2J8HA 5IW6A 3MJ9H 4HKJA 4YC2B 2C4FU 3G08A 3VG0H 2BY0A 5EIVA 2EICA 3GSXA 1BBJA 3HC4L 4ETQB 4PJ8A 1ZV5A 1OAUH 4OGAD 3HPLB 4DW2H 3ZKXB 3BDYH 3FTGA 5I6XB 1INDH 3RY4A 3DXAD 4HCRH 2EYSA 3T65A 1NCAH 5IUSA 4KDWA 4R7DA 5SWSD 3MJ6A 1FAKT 4FFWC 4E42B 2VQUA 4LP4A 5AG8A 5F1IB 5FM4A 1TTUA 2AJVH 3JV6B 2UY6A 4X7TA 5B39B 2MFNA 5BJTA 3NH7H 3MRDA 4O00A 4WUUB 5IESL 1P7KA 4JFDB 2HLFD 4ZO6A 4O2CA 3NPSC 1MQKH 3H9HB 1MEXL 2XT1B 4U1NA 1ZT7B 5E7BA 5ERWB 1YEEH 5HHMD 4M5ZL 1A6VH 4TULL 3KJ6L 1A14L 4OLYL 3IU3A 4OT1H 3P3YA 2H2SD 1HN1A 2ZSWB 4P59H 5JNYB 5C0AE 3MUGA 4XPAH 3MRMB 4ZUUB 1DANU 3MRLA 2IH1A 1IM9A 4U0RC 3HE6C 1FNEA 1YMME 4KFZC 5F3HA 5C0CD 4PJIE 1M1SA 4KK8C 2XTJD 1I8MA 4KJWD 5C9JB 5F70A 4F33B 2CR6A 2HWZL 3V4UH 4NKMB 5E2VL 3FZUD 2HT4C 1BD2A 1HINL 5JPMA 3ARFA 4CBPA 4EUPA 5JHDD 4Z95L 5DSCB 2P46B 4NJ9L 1GZQA 2AKRA 3C5SB 2BNQA 2NXZD 2Q8AH 4ZFGH 1QPXA 4XMPH 2AEPH 3EKCA 4NNPL 1U2CA 4JFFA 4M5YH 4G6AD 3GSWA 3RUGE 4OZIE 5E9DB 3HMWL 1WBXA 1HSBB 5DUMH 3HNSH 3IYLW 4ODVH 4LSUH 1NGQL 4K8RH 4I1NB 2FBOJ 4FNLL 3P9WB 5ID0A 1LO2H 3VCLB 2DD8L 2MSPA 2ATPB 2VLKB 3PHOA 2EC9T 2EDRA 2AJYL 2F58L 4KY1L 4MAUH 3Q1SL 4K3DL 3HZMB 4JQIL 1A6ZA 1CGUA 3MRFA 5EZOL 5I8CA 3Q6FA 3W82A 4TN9A 2VUYA 3ZKXC 4J7RA 4Z7UE 3HE7A 2PF6A 5I6XC 5EORH 1ZLWK 2P47B 5C6PB 4OFPA 5HVHB 3RX8A 3C5JA 4MXVF 1E27A 1IGMH 4XBEH 1YPZA 3L3OA 3DXAA 4XX1E 1IEHA 5A3ID 1D3CA 5D7LA 5HGAB 3G5ZB 3CH1A 5SWQB 5JA9A 1YEIL 3X3GL 2NXYC 2FGWL 1RULH 4R97B 5LVEA 1NBZB 4OD2A 4G43B 1JZ7A 3OV6A 1K8DA 2NY1B 2GJJA 1CFTA 4OZGE 2W0KA 3MV8B 2DQEH 1F4XL 5IHLB 1AQDB 4OCYH 5EFIB 1FGVH 4XP5L 5JO5B 1XIWA 3RNKB 4OV5B 3CMOL 4ZTOH 1WITA 3I6LE 1R6VA 4M7KH 1DQMH 4WNQB 4KJYB 5GZOC 1A6AB 2DWEB 2NY2B 1GSMA 3N1FC 4Y1AB 4GKNA 3TIEB 1F3RB 4O2EA 3TZVB 1JF1B 4GRLD 4WY7L 3GJEB 1QFHA 2P49B 5IB1A 3JSSA 4PJ5A 4OTXL 3BE1L 1NBVH 1KB9K 1MHCB 4Z76A 3TBSA 2VB5A 4XRCA 5C7XH 4X9FA 3MLZL 3VGFA 5T1LD 4W6WB 1G1CA 2AJSH 4HHAB 4LPVA 4ONGL 3KPSE 1NCUA 5EWIH 1LEGB 1YEKH 5I1CH 2GKIA 2HLAA 5FYJE 1A1NA 1NANH 1X5IA 4HLZH 4F7PA 43CAB 3O2DL 1CXKA 5C09B 3SDXA 5JHDA 5C0ND 3VXOA 4X5XB 1CZ8L 4RWYL 5I1IL 2G5RA 5SX5K 4RNRB 4ZNEE 4OD3H 1I8LA 2P8PA 1ZVYA 4BK5A 5DYOA 5C0GA 4G7YL 4LSRH 5ESVB 1CD8A 2R8SH 2VXUH 1X44A 4I3RH 5EU6A 1FNLA 4FTVD 4TUKL 2K7PA 4QNPF 1BFTA 3H0TA 4WCYH 1KN2L 4IOIA 5DI8B 3MLVH 1CBVH 2JK5A 3HI5H 5I0DA 1NCBH 3O11B 4OUOA 4U49A 1P5VA 1Z0NA 3OMZA 2KUTA 5D5MA 5HVHC 4CNIB 3QDMD 2YXFA 4MXWH 4V1DE 1H3UA 2V7NB 4X6CA 3P77B 4HG4J 2K3TA 2EDFA 3RWDA 5IM7B 4N9GB 4RGNB 1AXTL 1QLRA 2KQNA 3P4MB 3VI4E 4AENB 4G42A 3ILPB 2Q76A 4R97C 1UENA 2IJ0C 4TYUA 4KQ3H 3FRPA 1OGTB 5IW3A 3VXNA 2NY1C 4W6YB 2C1OA 2ZOLB 3KPQB 1I9JL 5CGYD 1U92B 1U93A 5FHBH 3T08A 4MD5A 2R0KL 4HV8B 4HULB 3TJHC 2H8PB 3QHZL 5DS8B 1YEJL 2CUHA 3GNMH 2A38A 4FQHA 1QA9A 1UJTA 1BEYL 1CS6A 1OHQA 4FG6C 2NLJA 4ONHB 1CFQB 2VUOA 4NRZB 4O51B 3E6HB 2ZSVA 3L95A 3MBEB 2X4NA 4NQED 3HUJA 3TZVC 5DJ0B 4Q2ZB 4NJAH 4LU5L 4X7SH 5BMFH 2D9CA 3G6JF 3WS3A 4KRPD 3BXNB 1F4WH 1FG2A 3BKYL 2H1PH 2Q6WA 1J18A 5A40E 4QRPA 2YD8A 3BWAA 3MGOB 1QEWA 3INUH 3JVGA 4QRSA 1DN0B 2L0DA 3CSYB 4G9FD 1X4YA 2AEIT 4XAWL 4EXPX 5JDJA 3LKSB 5EZIH 2JLLA 2F53E 2I24N 4GAGH 2IGFL 1R5VA 3BAEL 1CGXA 3F62A 1I75A 1IM3B 3HLAA 3UP1A 2XN9B 5CD3A 4JFEA 3UPCA 3KYMB 4OAWA 1DUZB 4R7NB 2GUOB 5FXCH 5IEKA 3VFVB 5C92A 1MFDH 2Y4SA 1T3FA 2GQHA 1ZE3C 2Y5TB 1P9MA 5IK3B 1MUJB 3SE4A 3SQOL 1KOAA 1ZLSL 4N5UA 4IJ3B 1T5WB 2E7MA 2QL1A 5BS0B 4N0UA 4LRIA 1IJ9A 4OGXL 4UV7H 3IFLL 4JAMB 1N6UA 3B9VA 2BERA 1I9IL 3O8XB 1QYGL 4YXKL 5DMKB 2BXZA 4UBDC 2FEDD 1RURH 3LN5A 2H32B 3J8F7 4HFWB 5TH2A 1OGAB 3ABZA 2R1WB 2EEAA 2JF1A 1OB1B 4WU7B 5KSVB 1RZFH 3L3HA 4RGNC 3QCUL 3EYSH 1PW3A 3TO4A 3VXRE 1IC1A 4F9LA 2YPVL 1QLFA 3P4LA 3B2VL 5KSBE 3SDAB 1TJHH 5EU7E 1M7IB 4NZRH 2N1KA 1DL7H 4G6ML 2VLJB 3KPNA 3O6MH 1CE6A 1UC6A 1SJHA 4I3SL 1J0ZA 5E1HB 1D9KD 3QXAA 3TVMB 1DQQA 1A6TA 3RWFA 1U8QB 1J8KA 3HFMH 3WFHA 4JGUA 1V05A 2H3NA 3FONA 3VW3L 5BO1L 4YWGH 2HVJA 3MBEC 3QO1B 5J8OA 3LRHA 1F11A 4NFCA 4PJIF 3TP4A 3V8OA 3TH4T 5I1LA 3S98A 3JWDH 4IMKA 5FYLH 1BHGA 1MREH 3G6JB 4XWOD 3T0EA 1XGYL 4FXKA 1MY5A 2QHRH 4KH2A 3P9MA 1QNZL 5HDLA 3VGAB 2EE9A 1NCWL 2O5XH 1QACA 1T1ZA 1WBZA 2BDNH 3FQTB 2BRRH 5E2JA 1NC2B 2VZOA 3AXLA 3F6LA 1XF3B 5EOCJ 1A1OA 5IMMA 4HS8L 2E8ZA 25C8L 3HNVL 4Z7QF 2ADJA 4WGVB 5FO7A 2YPLE 1PKQB 2ZUVA 1B88A 3CFBA 3I02A 4MNGA 4YUEH 4JPVL 4PYGA 1L7IH 4PJDB 1A4KB 1X7QA 5DD3L 1DUYA 1VEPA 1DQDL 2IADA 4W4NA 4IJ3C 1MF2H 5F97E 4Q9CA 3V52L 1FNGB 1JGEA 3MJ7B 2AABL 4FQIH 4LQ1A 4Z7VE 2ZKHL 3MV9A 3L3JB 4WHTA 2BNRD 4ISVB 1U3ZA 2VISA 1P53A 3O8XC 5DJDB 3QEHB 1T4KA 4O58L 1VEMA 5MEQA 1I3GH 2DQJL 3UTTD 5DMGC 4M3JA 1YUHB 4HLZG 4WI3A 4E0RA 4GSDH 1T1XB 4ZFZB 1UADC 4XGZB 1B0GB 1CTOA 3OAUL 3O6LH 3P0YH 1IGIL 4DAGL 4WW1B 3CLEL 3ZYOA 4MVBD 1U95A 5JW3H 1A1MA 1OAQH 5B21A 2XWJA 4PJGE 4WJ5B 3U0PA 3RDTD 1Q9LB 1S7TA 4HG4K 2DTML 4AH2A 5HHXL 1JK8A 1FO0H 3ARXA 2HJKA 2MCPL 3QXVA 1A2YA 4NQSB 2EDWA 3P73B 3BDBA 1F90L 4ZPTA 3TVMC 4Y16B 3OKDB 5CCKL 1PEWA 4LHUA 2FECI 5JDSA 1KSRA 1JN6B 1QTYT 4PS4H 5E1AA 4C59B 3KWWB 1EGJL 1FFNB 3ECBB 5C0AB 3OB8A 5HD8D 5D6DA 1B0WA 4ZS6C 4R2GC 1T66C 3BPOB 3KG5A 3DI2B 3IJYB 4NKOB 4PJIB 4UILH 5D6CB 1FZOB 3ETBF 1S7XB 1WTLA 3K8MA 1JNJA 1R5WB 4KK6D 1CL7L 4LPXA 5DQJA 3VGAC 1TIUA 4AEIH 3EOBB 4NRYA 1A3QA 1IVLA 3P9LA 5DD5L 2IG2L 3CFKA 3TH2T 5C6TL 2OL3H 3ARDA 1XGRB 1I7RB 2WUCH 5SWZD 4X80H 5HYSB 1EEYB 1C12B 2A2QT 2RBLA 4G8FA 2EKSA 3EIFA 5E4EB 1O7VA 5D2NE 4HGKC 4YEEA 2A6JA 3JUZA 4G3YL 4QHUB 2PW2B 3ELAT 5EPMB 3U2SA 1KBGL 3TT3H 3LEVL 3GSOB 1I7TA 4PGDB 3T77B 1YEGL 1J8HE 1FZMB 1JRHH 4LKXA 4XI5D 3AROA 3FT3A 3L3KA 5DJ6A 4PRPE 3X3FH 3NZ8B 1TVHB 3RWGA 2BHYA 5I16A 2X89D 4GAFB 4JFZH 2FWOA 1QSEA 4Y2DB 4JHWH 2P5ED 3FFCA 2ADFL 3F7RA 3SY0A 4NQCD 4YHIB 5DWUH 1MFNA 4EKXA 4U1IA 5MP6H 3WFDH 1WUNT 2YD4A 1S9YB 4HIJB 1CLZH 3Q5YA 4F9PC 4NKQB 4UT9L 4J4PD 1CLCA 1B3JA 1JYVA 1OTSC 1VPOL 1N5AB 1IAIM 1F8TH 3E2HC 2E7LC 2F19L 3ULUF 1LNUB 3OKOB 5LCVH 5CEXA 5E6YA 3D39D 3ULVF 1A4JA 4EDWL 4XNXL 3PHQB 4PJFF 2HJLB 4Y16C 3WS6A 4ELMA 2VIRB 3P4NA 4NUGL 4CVWA 4CDGC 3DVFA 1U8KB 4X4YB 4L3EB 3L6FA 5DZOA 3LD8B 1JHKL 1EIBA 3BPOC 4KPHL 2I9TB 2Z31A 4WWID 4P23A 3U83A 3GHEH 1RAMA 4JRWA 3W0WD 2IANB 1MCOH 1MJJA 2CMRL 2Y36H 3CX5J 3ZT7A 3KPSB 3Q48A 4M7JH 2X4RB 3R1GH 1UM6H 4MJIA 3LRGA 1U3YA 1H3WM 1ED3B 2EYRA 4XH2B 1IQWL 3P11H 4RMWA 3U48A 1NMBL 2XWBB 1EJOL 1R3HA 1IFHH 5DJZB 1MRCL 4N0RA 5E4EC 3FO2B 1UZ6E 1VFBB 4BUGA 4KRLB 2O5YH 3C8KB 5GJSH 1F2XK 4XBPA 5ESQA 3VXSE 3MC0A 5BW7A 5J89A 4M43H 4O9HL 4NWUH 5IOPB 4EI6A 5D7IE 2MNUA 1KB5H 4XP4L 4YX2L 3CFCH 4LLDB 4OI8A 1R24A 3VWKD 4YBHA 2ZUXA 4M61B 2V2TB 4UMGA 5ABDE 1HQRA 1KXQE 2Y7QA 5E94A 4UTAH 3X11B 3LKOB 2LFGA 2A6DB 3MNWA 1ZT4A 4Y2DC 4Y5YA 3UTPD 5MEOA 4O02H 4NNXA 4FZ8L 3UJIH 3VRLF 2KPNA 4J1UA 5GZNC 2X2YA 3QIWD 3RWEB 4WFFE 2PYEA 3BKML 5EA0L 4JANA 3G5VA 1FNHA 1KIUA 2OCFD 2FIKB 5EIIB 5F7DB 2BVTA 2R1XB 1R3LA 4DUWA 3GSNA 4UIKH 1L9MA 3QPXH 1LILA 3I84A 2AXFA 3S36L 4EI5D 1BVLA 3T4AB 3WIIH 5I8KH 2OMNA 1ZLVH 5BZDB 3WIFA 4UZGA 1DEEA 3CUPA 5C0IB 1MLBB 3S5LB 3D39A 5T3ZL 3KS0H 4PJFB 1IEAA 2QSCL 4TUOB 3OG4B 1VFAB 3CPLB 2E3VA 1R3KB 3RY5A 1RZ7H 3DYMA 3MPCA 4HPOL 5F89A 1YECH 1XGTB 3S35H 3LD8C 3S88H 5CSGA 3H9ZA 1RJYA 4DGYL 2WINA 2LV4A 5ECJE 2BJMH 4G8IB 1JZ6A 4G6JL 5FM5O 3DARA 4Y19D 3EFFB 2FYYA 1CLOH 3IVKA 3LOWA 1XGPB 5JPNA 5ALBH 4WTXA 2EH7H 1R0AL 3TBTB 2PCPA 1AGEB 3B9KA 1AGDB 3G5YB 5DZNA 3TLRA 5CKGA 4DKFL 4CMMA 1CDJA 4QRRB 1KGCE 1QBML 4FN0A 2GYSA 3DSNA 3FQWA 3HAEG 4ZD3L 2J8UA 5HBBA 5GRXG 4Z78A 4FZEL 3MOQA 4KDTA 4RQQA 4PG2C 4HGWA 2IPUK 1F4YL 5E2UL 3IDJB 4BJLA 1BVKA 4XP6L 1M7XA 1XF4B 2DQGH 2G60L 3P0VH 5CLWA 4J8RA 3G04A 3CU1A 2A73B 4ODHH 4GG8B 5EO0B 3VWKA 1BD2E 4IHOB 5I18L 4E41D 1FL3B 1S7QB 4HGMA 1GC1L 4R0LC 3VGEA 3E3QE 4YO0A 2BNQE 5TQ2L 2KZWA 2OI9B 4NUJB 1NFDF 4U1MA 2BVPA 2W59A 2W9EL 4JFFE 5CP3A 4PP1D 1A3RH 3UAJC 4WEBH 3GGWA 5TDNB 3U7YL 2FJFA 3WDJA 2AW2A 3VXRB 3H2WA 4PJGF 4JR9L 5I1GL 3C09B 5KSBB 1YYMH 5CHNB 2XKNA 3IS0X 3QIUB 4FFYH 3RWHA 5L9DH 4H26A 2VZSA 4OCRL 5JXEA 4I9WE 1FYTD 1A6UH 4OF3A 3UZQA 4TPRL 3CZFB 4OCSH 5HHPB 2ADGB 1G6VK 4J3UA 1KLUA 3ULUC 5IF0A 2AI0L 4EI5A 3ULVC 3EYUH 1DBJL 1I8IB 1YZZA 1P4LA 1V8HA 2NNAB 1JHLL 5FECB 1XH3A 5E8NA 2Z93A 4K23L 4DVRL 3QUYB 1HNFA 1YPZE 2DAVA 5HYJA 5BQ7B 5D7LE 1ZHNA 3QO0B 3D0LB 3KPOA 1EZVX 3DBXB 2PO6D 3QDJA 4KK5D 3BD4A 3T0AA 3GKZA 4MS8C 3F65A 1IAIH 4YQXH 1GXEA 4XC3H 1NEZG 4XNYH 1FIEA 3GI9H 4PRNA 5F7FA 3NCJL 4NQDA 2FBJH 5DUPL 5H2BB 4XVTL 1JPFA 3T0WA 1S3KH 4P5KA 4X8JB 2D4DA 2DOCA 4LSTL 2MQ0A 1BWMA 3GMMA 5KSUB 4MYWB 2YPLB 3O6FD 3GIZH 3IJSB 2R2HB 4PD4K 3GHBL 4TRPH 5J6HB 5HHOD 3EZJB 1W72L 2O5ZL 2ITDA 2G9HB 4ZUVA 2OR9L 1I1YB 4PJ5E 2JB6B 3TNMB 1T0MB 3IDXH 5EBMA 1LK3L 3HB3D 2NY3C 5ETUA 3FT2B 3L1OL 4K3EL 4LARL 5E03A 3BIKA 3ILQC 5JW5B 5ISZD 1A6WL 3SDXE 4MJ5B 3WFZA 2UYLB 2V6HA 3F7VB 4PGBA 1GGTA 1FPTL 2X9YA 4XPFH 1NFDB 2VXVH 1CFSA 5IMKA 2QKIA 1CD1B 1X5LA 3C09C 2GJ6D 4RMUA 4PJGB 5B38G 1GPOH 3GSNL 3QIUC 1WWWX 2B0SL 5EU6E 1JZ3A 4UDTA 4AJ0A 3R06A 2C1PA 3V5KB 1UGNA 2YD2A 3PJSB 3U6RA 4CUCA 2DIAA 3O0RH 4HPYL 1V7NL 1FYTA 5EO1A 1J9CT 3HI1A 1HYSC 3BGMB 3MRJA 5DJ2A 5JTWA 4I2XB 1NGZA 4LLQA 3REWA 4QXGH 1T22B 5D5ME 1MFBL 4RX4A 3QUYC 2DQTH 4JEGB 3Q0HA 4X6CE 4L1DA 1AD9B 3LIZL 1G7JB 4LGRB 3SDCB 1BBDH 4KXZI 5DVNA 1Q8MA 4D8PA 4PJ7F 1SJEB 3T4YB 5D4QA 1IMHC 2VERN 4LSQH 3SKMA 1NAKL 3MFFA 2WAHA 5IQ9A 4N8VA 4HBCL 5EOTB 5FEBA 2APFA 4L8CB 4HIIA 5ILTL 2BP3A 5D7KD 1UYWH 3TA3D 3IGAA 1DZBA 1XMWA 5TJWK 1WCBA 4XTRD 4WFHE 1UCBH 5ITFA 3KLHC 3RVVC 3DVGB 4PJXF 4WO4B 2C7UA 3MV01 4JN1H 5C2BH 3ESVF 1E0OB 4FQLL 4HZAA 1M4KA 3MJ9A 4Q6IA 5D1XB 1T7XA 3HUJE 3CIQA 5AAWA 5AYUL 3TN0D 3B3IB 1EHXA 2ZOKA 3OG6B 1ZHBA 4LCYB 3O9WB 4GW4A 2OZ4A 1ZVSB 4JRYB 4WHDA 3BFOA 4YPGA 4ENED 2ATKA 2FX9L 4QRPE 1YMHB 2DQUL 4PRPB 2CPCA 1ZHKB 2O26U 2V5RA 2EDJA 1MHHA 3V6ZB 2OK0L 4JB9H 3UC0H 2NMSA 5ISZA 4FXLA 1K3IA 3DUUA 4YR6A 3O4LE 4JFQB 4LBEB 1WFUA 1YNKL 4JFEE 5DEGA 3UJTH 4NQUA 3V4VL 5DK0A 2GJZA 3G6AA 1V3JA 5GSRA 1MI5B 3T3PE 1R3JA 2FEEL 4M6MH 3TV3H 4PLJD 4XNUL 1B4JH 4RFEB 4OZFA 4N0UE 4M1DH 4WI8A 3C60B 3CDYA 2H2PC 5DLML 2AEQH 1BOGA 2VDML 4ZSOA 3P4OB 2R29H 3WDHA 4X9BA 4F7EB 5C0FA 3RJDA 3WUZA 1YN7B 2BNUA 2Y06H 4ELKB 4OSUL 4BQBA 3LEYL 2XRAH 5C3LD 1W0WB 2BFVH 3SDCC 5CJXC 2FLBT 4OUUA 5J9PB 1CLYL 1GZPB 4CVZB 4MB5A 4TNVK 5IB2A 1SVZA 2QQKL 4PJ7B 1LK2B 4FQXD 5I1EL 5CJOL 3O45B 4ZDHA 2H32H 4KUZL 1UM5L 5IB3B 1IAKA 2BSRB 2Y6SC 3EYFA 4DGVL 5CEZH 3QRGH 1K4CA 3M45A 3KS0J 1KJ3H 1FIGL 3TA3A 5FYKE 1FLTX 4HC1A 1FVCA 4PJXB 2X1WL 1N3NB 1ZAGA 3F58H 1ZHLB 5D1XC 2W0LA 1UJ3B 3M8OL 4POUB 1OSZA 1P4BL 4R4FL 1YJDH 5D7IB 4IDJL 4QCIB 3KGRA 3O9WC 2IC2A 3RZCB 3BMVA 5LBSL 3T0EE 1CI5A 1T0NA 1JPSL 3QA3B 1Q38A 3BZEB 4UT7L 1I3UA 4HUXB 5CBAA 1Y6MR 3EOYG 3IKCA 2DQDH 7FABL 2LU7A 3GK8H 1H8NA 1J1PL 4MSWB 4P2RD 3DMMB 3L5JA 1F3DH 5TPWL 1UT9A 3MRKA 3A6CL 3QWOA 3QQNA 4X4XA 3BW9A 4PJ9C 4MNGE 2BVOA 1GGCL 2D0FA 2Z9TA 5CJ8A 5D71L 3QDGB 3ROLB 5C0JA 2DB8A 1NUGA 5LJYH 4LKCB 3DV4B 1UWEL 1JTTA 3FHAA 5IW6B 1A7QL 4Z18A 4HKJB 4KC3B 5LXGL 3G08B 4ZAKA 3VFPA 3KXFD 2FZ3A 4Y2OA 3GSXB 4YHML 3C60C 5CJQL 4UQ2A 3MV9E 4PJ8B 3HI6H 3RTQA 4P48A 3FTGB 5E99H 5D1ZD 1W8NA 4XP9L 3T65B 1YPZF 4NQVB 4TVPH 3B4NA 3D2UD 2ZP0T 2AXGA 4JRXD 1GHFL 1QLEL 3BKJL 3WJJC 2HRPH 3RIFF 5SV4A 5BJTB 1H0DA 1HZHH 5D2LA 3HN3A 3JXAA 5J1TC 3MRDB 1P7KB 4YHZL 3T2NH 2MJWA 5DRZA 2YSSA 4S1QL 4WI5A 1KFAL 1U0QA 4ODUA 2DI9A 4U1NB 1MLCA 3WD5L 4KROB 1DFBL 4JQVC 1UKTA 1SM3L 3O4OB 4U1SB 3C6LD 2I07A 5DC9B 4WIQA 3SE8L 4LLWA 4G6FD 4BZ2L 1R3IH 3LQAL 3UMTA 5T3ZE 1HOCB 4IDLA 3MUGB 4U1LA 1WZ1H 2IH1B 1X5AA 2HG5B 4YHYB 1IM9B 1FNEB 2OZ4L 2ESVD 2W65B 1BQHG 3L5XL 1I8MB 2AV7B 1W2KT 4FFZL 3RZCC 3PV6A 1EFQA 4TTGA 4XPGL 4F57H 4GBXC 5JPMB 3ARFB 4X6BA 4EUPB 1G7QA 4J6RL 2AKRB 1J1OH 3QHFH 2BNQB 1M6OA 5DK2B 4Z9KB 2FX8H 5KOMC 1E6JL 4JFFB 1CK0H 1OCWL 3FQRB 5BCAA 4BFGA 4DKEH 4H8WL 1AJ7H 1WBXB 2IQAA 1QFUL 4BSJA 5F7NC 2ZG1A 1MWAA 5D70L 5T1DL 5AUMA 4GRMB 4HUWA 1KNOA 4FQCL 4JFHD 1UACH 4K3JL 4HWUA 4HKXB 3EJZC 1NUDA 1D5BA 3PHOB 3H3PL 2QADD 3FQUA 1G7IA 1NBYA 1DLFL 1A6ZB 4HD9A 3MRFB 4PJ8C 3KXFA 4S1SH 4Y4KA 1X5JA 4UTBH 3L7FA 4Q97A 5I8CB 3Q6FB 4GKOA 4MQTB 2JJSC 5D5MF 3HE7B 4RMRA 2CLVB 1G7PA 1QSEE 4X6CF 4YDLB 1HXYA 3FFCE 3C5JB 1E27B 4W4OC 1Q9WB 1YPZB 3L3OB 3DXAB 4NCC1 3QEUB 4XCFH 5D7LB 4Z7OE 5F3BA 2F5AH 4KZEH 4XBGB 2YMXH 4MA3A 4OD2B 4LPWA 5FOBA 1K8DB 5J56B 1JWUA 3PGFL 1ZEAL 1K6QL 3S7GA 15C8L 4I5BA 2ZG3A 1P4IL 1U6AH 1OAZL 1T1WA 1XIWB 3D25A 4LVEA 5TQ0H 3AB0B 2WBJA 3O4OC 4KHXL 4HC1L 3PDDA 3MRQB 3VFRA 4ELME 5HHMB 5CZVL 5ITBH 1OSPH 4H20H 1GGIH 1G9NL 5C08D 4HKZB 3G9AB 1ZLVK 3GSQA 3CK0L 4FQPA 2HFGH 4ODXA 5IB1B 3F12A 4PG9B 1JWSA 4PJ5B 4Z76B 3TBSB 1WISA 5C0CB 4XRCB 4MB4A 2JELH 2WBWB 2XTJB 1RY7B 4MDIB 4UU9B 4R8WH 5JA8B 3KYNA 2HLAB 2D7OA 4MJIE 4QTIL 1CDHA 1A1NB 4F7PB 5JHDB 4HZLB 5IHZB 3VXOB 2JIXA 1YN6A 2ORBH 1J1XH 4JG1H 4KMTL 2NXZB 2IFGA 3CVIH 2P8PB 2X4QA 5DYOB 4RGOH 4J12A 5C0GB 5CD5C 2PTVA 1WT5C 3T3PF 1HDMA 4EBQH 4P9MH 1ZT1A 1M7DA 3VH8B 5FYJH 1WQVT 1JPTH 3H0TB 1P5UA 4IOIB 2Q7NA 4JKLA 1A02N 3OZ9H 3TYFA 1NC4D 2JK5B 5DUBB 4BFIA 4CMHC 1S7SA 2XA8L 3MRRA 3HE7C 4OGAC 5D5MB 1QRND 2ED7A 2AV1A 4X6CB 3QCVL 3WKML 1UB6A 3WSQL 2XWTA 2PYEE 5DVMA 3WLBA 2Q76B 1TJGH 4A6YA 3VXNB 4JY5H 2E6JA 3PQYE 4PREA 4U0QB 1Z0MA 5C0EA 1H5BA 2HLFC 4MD5B 1A5FL 1AO7D 1L7TH 1XIWC 2Y23A 3CMGA 3EOTL 4YFEA 4TUJA 4W6XB 4N8CL 3QDHA 1BJMA 2OJZL 4FQHB 2R0WH 3LEXB 3UTZA 1A0QL 5F96L 4Y5XA 3SKOB 3U9UA 5KVMC 2ZSVB 4K3HA 4P5TD 3ZL4H 1NSNL 2H2SC 3PGDA 1TJIH 3W2DL 3K46A 1EFXD 1DSFL 5E2WL 2I5YL 1EAJA 1YDPA 4CAGA 3MV7E 1NLDH 3WS3B 4MQXD 3PWVB 3PHSA 5DEFA 1FG2B 3ULUH 2XTJC 4KJWC 3ULVH 2Q6WB 3A6BL 3S34L 5F9DC 4JM2D 4OZ4A 1QEWB 3T3ME 4HF5L 4QRSB 3SPVB 1MOEA 3FZUC 4K71B 5EDXA 5BRZA 1MFEL 1HWHB 1RIUH 5JIHA 1R5VB 1IGYB 5I8OH 1I8LC 1TVBA 2NXZC 3FB5B 4JFEB 2KL6A 1OAKH 1HIMH 1MWAL 2IBGA 4G6AC 2IPTH 2OTUA 3WFEL 3IDGA 2EIZB 4NWTH 5DQ9A 4OQTA 1UEYA 1MCNA 2VDPL 3TPUA 3MYJA 2A9NL 4K94L 2XZAH 2Y25A 3VMPA 2VDOL 4RMQA 2EC9U 5FUOL 3EDFA 2VYRE 4I0PD 3ZZ1A 3LN5B 5TH2B 5EZLA 3CXDH 5TE6H 1F3DJ 4PRID 3V0WL 2D0HA 2IPKA 4JFOB 3QDMB 1K8IA 3L3HB 3NFNA 2JCCA 2NZ9D 5A3IC 3TO4B 5E2TH 1M05A 3CAFA 3QUKA 4WFGE 3S4SA 3T8XB 2VZTA 3HG1D 5E6IA 3H7BB 4WTZA 3KPNB 1OPGH 1OLZA 1CE6B 1SJHB 3U7WH 5CMAA 1BJ8A 2MPAH 1AO7A 2PXYD 3M07A 5EOQH 2XZCL 3QXAB 4HLJA 5IJKA 2DYPA 1A6TB 3RWFB 3EYQD 5J4MA 5HYSG 3WFHB 2Z8SA 4QYOA 2H3NB 3FONB 1FAIL 4J3OC 4WI7A 2HVJB 3MLTA 1CXHA 3V5HA 1BJ1H 1F11B 3QZWA 4FMKA 5HYJE 2ILLA 4M6AA 2XNAB 1JGUH 4NQEB 5I1LB 2EYTB 5LQBL 1U8HB 3QDJE 1WAAF 3LPFA 3EOAA 5D9SA 4FXKB 3GMRB 3P9MB 5FDWA 1U58A 1N5YH 3LKRA 4UNTA 4LIQE 5JUEL 1T1ZB 3QB7C 4K71C 4Y4HD 1WBZB 1C5CL 3I3EA 4NQDE 3QFDA 4R90H 1LEIA 3ORJA 5MERA 3AXLB 4G5ZL 1RUAH 4JQXA 5C0NC 3FB8B 1A1OB 1AP2A 4PRHE 5IMMB 3FO0L 2ADJB 1CDYA 3CFBB 3I02B 4LSSH 3ZE0F 3ZDYE 1DUYB 4JHBA 3EYVA 4HBQA 2IADB 4R3SA 1BLNB 2R4RL 1JZ2A 1N64H 2MKWA 1FL5B 1JGEB 3ARGA 4M48L 4WHTB 1I85A 4W68A 3OXRA 5TDPA 5AZ2H 4YDKH 1JHTA 1EMTL 4LFHD 5IT2L 4YEFA 1CVSC 1UKQA 2E7BA 2V5SA 1DBAH 3IFPB 4C57C 4F80A 3EFDH 2YPKA 1RV6X 3RPIB 4E0RB 4Z7OF 5CEYA 4LDOB 1ADQH 5IB5B 4BA8A 4PRIA 5LAXA 4A6YL 4F9LC 1U95B 4O2FA 4LQFL 2XWJB 3PWPD 1S9VA 4AM0A 3WFCH 3U0PB 1S7TB 2E7HA 1CDIA 2EO1A 4AH2B 1JK8B 1IE5A 2HJKB 5CGYC 1VHPA 4TQEL 2W1NA 3MODL 12E8L 1A2YB 1AGCA 1BZ9A 5IVOA 1VGKA 4BQ9A 1WGOA 1YNTA 2NY6D 5D72H 4UIMB 4ZPTB 1ZA6A 1CQKA 1E4XL 4LHUB 4PJCA 3OBAA 2CIIA 4ZYKA 1JZ4A 1WCQA 4ODTH 3BDXA 1ZA3B 4HMDA 1X5KA 5HGBA 3EJJX 3OPZH 2X41A 3CGTA 3TNNA 5I1DA 2NCMA 3HMXA 1J0YA 3V7MA 3UXFA 5CIPB 1T21A 3WO4B 4KRPC 1KYOJ 3HC4H 4ZO8A 5IVZA 3CDFA 3WUWA 3S97C 1KUMA 3VFTA 3ARZA 2AK4D 4U7MA 4NRYB 3LQMA 1RUKL 3HE6A 4LGPB 3VGHA 2JB5L 1ERNA 2EDHA 5IJVA 4GKZA 1N8ZB 2WIMA 3ARDB 3FFDA 3QFJD 2A6JB 4OQTL 3QISA 4FQ1L 2RB8A 5IESH 4OFYD 2SEBA 3U2SB 1S5HA 1NCDL 3NFPA 3VXUD 2YA2A 1D7FA 5A16A 2DBJA 3IETA 1MEXH 5I66A 2HFTA 1KN4L 1MELA 4KTDL 4M5ZH 5DJ6B 4TULH 3KJ6H 1A14H 3S5LG 4OLYH 5I16B 3R4DA 4G6KL 4LOUD 1QSEB 3FFCB 1JE6A 2FEDC 3UTTB 1KTKE 3RIAF 2F5BL 2Y1VA 4U1IB 5GS1B 2R39A 4IRJD 5ACMA 1K85A 4CGTA 1JPST 1EEZA 2APVA 2HWZH 3VFOB 3PUCA 5E2VH 4RMVA 2DLFL 5L8LB 5ELIA 4WWKD 5CP7A 1HINH 4X4MA 5I71B 1NMCB 5HVWA 4Z95H 1IAII 2BVYA 5F1IA 4NJ9H 2FSEA 5CEXB 3JV6A 1A4JB 2VWEE 3V6FA 4S10A 4NNPH 4ZSOE 2CLZB 4OI9A 4ELMB 3UZVB 3WKNA 3P4NB 1W8OA 3HMWH 5ACLA 3M17A 2QV2A 3UTSD 4DQOL 2NYYD 1NGQH 3HZVA 4FNLH 2Z31B 5ERWA 4WUKL 2DD8H 1N7ML 2AJYH 4KY1H 3Q1SH 3WO4C 4K3DH 4JQIH 3R8BB 2ZCLL 3ALPA 2WLYA 3LPGA 2V9QA 5EZOH 4MHHG 3MR9A 4HUMB 4XWOC 4QRUB 1CD9B 3MRMA 2ZCKL 4QOKD 2GTWA 4ONOA 2X4PB 3ARDC 1OAXL 1R3HB 5HI3D 4WDIA 5C9JA 3RVUD 1RZJL 1NGYB 2J8UF 4QWWD 5DMIL 4GXVL 1YEIH 5GRZA 3X3GH 4XBPB 5ESQB 1SEQL 3WHXA 2FGWH 2GEEA 4RGMB 3DETD 4M3KB 4EI6B 1JNNH 4OFYA 1F4XH 4YDJA 2B2XL 3WFBL 3HPJB 1W72B 4PJBA 1R24B 3CMOH 1Y6NR 3MRGA 5JQHC 5D93B 2Y7QB 4F8TA 4POYA 2HKHL 3BGFB 2BZDA 2EE3A 4X7FC 4CVXB 1CVRA 1EO8L 3DROA 3MNWB 1ZT4B 4XNQB 3OKLA 4Y5YB 1GYAA 4U1JA 2VLKA 5MEOB 2NY4D 2P5EB 1A7BA 5DA0B 4WY7H 5FO9A 4NQCB 2PYEB 5GS1C 4OTXH 3BE1H 4JANB 1EVUA 4MVBC 1VA9A 3MLZH 1OWWA 4MAYD 3VD4A 3GSNB 4ONGH 1A9EA 5I71C 3RDTC 1NMCC 2AXFB 4N90D 1BVLB 1CIUA 4WWKA 5HGAA 3G5ZA 4RWYH 5L7XL 1CZ8H 5I1IH 4MCYA 3WIFB 1DEEB 3CUPB 3D39B 3QEQA 4YFDB 3D9AL 1IEAB 1MJ8L 1NBQA 3RU8L 1IBGL 5E95B 1J0KA 1AQDA 3HMXL 3RNKA 4Q58C 3CFJA 3GKWL 2OYPA 5HD8C 1RJYB 4TUKH 2Z31C 2A1WL 4JFPA 3D3VA 5DZLA 2WINB 5D2LE 4RAVB 4KJYA 1KN2H 5GS0L 2FB4L 2DWEA 4Y1AA 2FYYB 1P6FA 3NCFB 3IAQA 3W0WB 2AEWA 3TIEA 4KK6C 5JPNB 3Q6GL 5T3XD 3B9KB 1IT9L 3TZVA 2BOBB 4MCZA 2VDKL 1EERB 4CMMB 1KYOK 3CSBA 4CN1A 4YHKL 3FQWB 1AXTH 2J8UB 1QO3A 1BJ1J 1KCUL 1LDPL 1BF8A 3ARSA 4RGMC 4APQD 43CAA 3NACL 4HGWB 4XP1L 5IWLC 5KSAD 1QFWI 1EVTC 2E7CA 3ES6A 1BVKB 1UXWA 2R0KH 4NO0D 3VI3E 3QHZH 1YEJH 2DQIL 5D93C 3VWKB 5I30L 4U6YA 4XI5C 5DR5L 1BEYH 4UNUA 1S78C 4YO0B 2FECL 4Y5YC 2FX7L 3QDAA 1CXIA 3BP4A 4BSWA 2BVPB 4XNZC 2YD7A 5DI8A 1SQ2N 5HYQA 3GGWB 2FJFB 3AAZB 2A0LD 1D5XA 4N0YL 4PV9A 3IXAA 2DBLL 4LU5H 2GTZA 3O11A 4KHTH 3RWHB 3BKYH 4H26B 5L8JB 4EUPH 5JORB 4JPKL 5AWNL 1IGCL 4P46D 3IKKA 1EK3A 4MAYA 4O4YL 4XAWH 5IM7A 2YRLA 4MJ4A 1FG9C 5EUOA 3BHBA 1HHJB 2IGFH 3TT1L 4EI5B 3BAEH 1P4LB 1OGTA 5E8NB 2ZOLA 2Z93B 3KPQA 5HY9B 1U92A 1MCEA 4HV8A 4M6OL 5HI4D 2H8PA 3AVEA 2HFEB 5DS8A 3KAAA 3KPMA 3KPOB 3SQOH 1WJ3A 1ZLSH 4L9LA 1UFUA 4O51A 2YWYA 3E6HA 2OXGA 4OGXH 1CICD 3IFLH 4GFTB 4KI5D 3ARBD 4Y19B 1U91B 3MBEA 1LO4L 1I9IH 5HDBF 1QYGH 1AY1L 4YXKH 3B9KC 4NQDB 5DJ0A 4Q2ZA 1OT1A 4H88L 3F7YA 3SGDH 3JV4A 5FKAB 4PRAA 1FJ1A 4I18C 1KT2B 1B2WL 3QCUH 2VOTA 1V7MH 1IC5L 2YPVH 3DPBA 3B2VH 1DN0A 1PY9A 2ITDB 3O41A 3MREB 4OV6F 4ZUVB 4G6MH 3D18B 5HJ3B 1U3JA 1DBML 2WP3O 5EBWA 5EBMB 4LVHB 4G80A 4I3SH 3FQNB 3KVQA 1J7VR 5ETUB 3VFVA 3VWKC 3ZDXE 1Q9OA 3BIKB 4K3GA 4ODSL 4ZQKA 4X4ZA 2DQFA 4CJ1A 2F74B 3VW3H 5BO1H 4OF5A 7CGTA 5BS0A 5DO2D 1BFSA 4FA8A 1CFSB 2YUXA 3RHWF 4C4KO 2QKIB 4ZOCA 5DMKA 3NGBB 1XGYH 1QNZH 2PYFA 1Q94B 1ZSDB 1OGAA 1LVEA 2C1PB 3R06B 4UOJA 5JXEC 5K9KB 1NCWH 1T83A 1OB1A 4WU7A 3U6RB 1N0XL 3BKCL 4NZDA 1FYTB 5EO1B 2ZUUA 3HI1B 2ENYA 4EI5C 3SDDD 4BYHA 3GFUA 2MTPA 5DJ2B 2P44B 1NGZB 4LLQB 3REWB 4HS8H 25C8H 3HNVH 4C56D 6FABL 5C0BA 4JPVH 4LEOB 4M1CC 5T5NG 1G7LA 5DD3H 2FATL 5IR1B 1CF8L 4PV8B 4LL9A 1DQDH 2V9TA 2YR3A 4KMQA 4L4VA 4D8PB 3V52H 4HXAL 2AABH 4K8RD 2ZKHH 3MCLL 4OKDA 3QXTA 3SCMD 3SKMB 4I4WB 5FKPA 4AEHL 3U4EB 5IQ9B 4N8VB 1CICA 4HIIB 4JZNB 3ARBA 4O58H 5GS3A 2DQJH 2VXSL 2L7JA 1WCBB 5ITFB 4RISL 3K2UL 1MSPA 3OAYH 4MNQA 1PGRB 3G6JA 1OP5H 2C7UB 3BMWA 3OAUH 4M6NL 1IGIH 4DAGH 3CLEH 3VMNA 5F88A 2ZJSL 2WIIB 2ARJA 1KPRA 3FQTA 5CFHA 2DTMH 3GI8L 5HHXH 5HHOB 1ZHBB 1NL0L 2G5BB 2MCPH 3DX9A 4LVHC 3CC5B 2ATKB 1PKQA 1F90H 1Q1JL 3G6DL 3JZ7A 3QUZD 5CCKH 4NN7B 5BRZE 4DZBB 1MHHB 2J2ZA 2EDTA 1A7RL 2JE8A 5CINL 4EN3D 1EGJH 5ISZB 4HKBA 3E6FB 2HTKD 4YR6B 2GAZA 4QHKJ 5DEGB 3O3UN 3DX6B 5DK0B 5KANG 2M26A 4PP1C 2GJZB 3EDDA 3G6AB 4NYLA 5FUZH 3NGBC 1MHEA 2P5WA 3ZKND 5IW1A 3QEHA 3E1F1 5GSRB 3N1QC 4AEFA 5C8JA 1CL7H 2GJ6B 1QRKA 1WWCA 4HJJL 4UB0L 1T1XA 2ICWB 2VDQL 1TZGL 3RKDD 4UDUA 4N1CA 1WSST 4OFVA 1B0GA 4OZFB 4ZO7A 5GRVK 2YXMA 5DD5H 5FCSH 4AL8L 3RP1A 2IG2H 5C6TH 1BOGB 1FRGL 4ZSOB 3KPRA 3QH3A 5FK9A 2P4AB 4F9PA 1ACZA 2W0PA 1Q9LA 2BNUB 5DT1L 3OX8A 2ARWA 5GPRA 2D7MA 2W91A 4FOMA 2IMNA 2E7LA 4G3YH 4ODWB 1KBGH 4NQSA 3TWCL 3LEVH 2JCCE 4OUUB 4D9QD 5IFHL 4Y16A 1YEGH 1G0DA 2PO6C 1LHZA 3BP5A 4KK5C 4QXWA 2GFBA 3J7HA 3QJFB 1E4JA 4EUPG 4OIAA 5T3XL 1L9NA 3WJLC 1IAKB 2P24A 4OFDA 2KBGA 2ADFH 1NAML 1ONQA 1YC8A 4L8DA 3V4PL 1FQ9C 3TA3B 2F54A 1R5WA 1CCZA 4DUVA 3A6OA 3WYRA 3X14A 3LQAC 5T1KD 4KGJA 5KBNC 1OSZB 4UT9H 2LAGB 4YDIL 3VI3F 1VPOH 3TN0B 2EIEA 1HWGB 1MNUL 1EEYA 4S2SB 2F19H 3PWUA 1J0IA 3T2PA 4EDWH 4XNXH 2VLRA 1GCFA 4LP5A 5CBAB 3HB3C 4NN7C 1OARL 2D31A 3IKCB 4NUGH 2V2WA 1IGJA 4F2MB 2VDLL 3MGTA 2QQQA 4HWEL 3U0WL 4GW5B 1JHKH 3I3BA 4Y8DC 4KPHH 3MRKB 4L5FL 3QWOB 1JGVL 3BW9B 5HYEA 2BVOB 4H8WC 3NZ8A 2IEPA 2XZQL 3AMLA 4NC0B 2CMRH 1TPXB 1X4XA 5DMJB 4LLVA 4XAKE 1EJ6A 2Z92A 4YHIA 2FZ3B 4Z0BL 3MUJA 2E9WA 5FGCE 3G9VA 4UQ2B 1IQWH 2VR4A 1SJVA 3RTQB 1S9YA 1NMBH 1EJOH 3NAAL 2YC1A 1MRCH 1WBYA 4JZJC 5ANMA 2AXGB 2DIJA 3CCHB 4CN6A 4O9HH 3OKOA 3SO5A 4QHMB 3PHQA 2HJLA 4JM4L 1H0DB 2EEBA 3B5HA 4XP4H 4YX2H 3B43A 4BFEA 1AXSA 3S3SA 1AC6A 4X4YA 2YSSB 4L3EA 1TDQA 1MLCB 3TO2A 4FQXB 4ACPA 2DQCL 1KIPB 1AXIB 2D7PA 4QRQB 2I07B 3TA3C 4F7MA 5GGRA 2IANA 4FZ8H 4LLWB 4RAUB 4KTYA 3ZE1E 1PD6A 5ICXA 3BKMH 1NCAL 5EA0H 2X4RA 1DDHB 2F15A 3ZDZF 3BEVA 3H9SE 4L3AA 1NKRA 1G9NC 2CKBA 4XH2A 3D69A 3DV6A 2UV3A 5DHYA 3ZLQC 3TN0C 5DJZA 1S9KC 3NH7L 3PV6B 3S36H 1VFBA 3EJYD 1A21A 1L0XA 3L3DB 3STZB 4ENEC 4X6BB 1G7QB 5T3ZH 5D8JL 3ZKQD 1Y0LA 2C3WA 2QSCH 2UY7A 1ZXQA 4MGXA 4GJTB 4HPOH 4LLDA 4CDHA 1BGXL 5BVJB 5CIPH 4M61A 5EOCL 4BZ1H 4DGYH 2EH8L 3TH3T 1I9RL 5JW4Q 2X70A 3LKOA 4BM7A 4G6JH 1MWAB 1DBKL 5AUMB 1TPXC 2A6DA 1KNOB 4R0LA 5EBLB 3DOSA 4ZG1A 2IAMA 3FQUB 4MHHI 4OD1L 4RCAA 1G7IB 5FYLD 1R0AH 1NBYB 2R0ZL 2C5DC 3RWEA 3S37H 3KXFB 5K33A 3VWJD 1JCKA 4DKFH 1OVZA 1H8OA 3MLYL 4AMKL 3L7FB 5MEND 1RUPH 1QBMH 1CU4L 1NQBA 2FLRT 3ALWA 5EIIA 3NA4A 2R1XA 5KZCB 3BO8A 4ZD3H 1HXYB 2C3HA 3I3DA 3AM8C 2BSTB 4FZEH 1A9BB 2FGZA 2OTPA 4Y88A 2NY5L 4FP8L 5F3BB 1F4YH 5E2UH 4K7PX 4XP6H 4MA3B 4PJFA 2G60H 3BRDA 4ODVL 2EDKA 4U6HA 2X09A 4PB9L 4NQTA 1VFAA 3CPLA 1R3KA 1GGUA 4X4ME 5DQDL 5I18H 1B0RA 1XGTA 4G8GD 1T1WB 4FQXC 3D25B 1I7UA 4ZOEA 1GC1H 2AJUL 4JG0L 2AS5M 5TQ2H 2Q20A 1NJ9A 3RQ3A 2W9EH 2VSCA 2UZXB 1DCLA 4I0KA 4LSPL 3EFFA 2B7DT 4ONFL 1VFUA 4JR9H 1E6OL 3U0TA 5I1GH 3H8NA 3VFNA 3GSQB 3TBTA 2Q7YB 1AGEA 3G5YA 1Q0YL 4OCRH 5E7FA 4YGVB 2A74B 3HR6A 1JWSB 2R2BA 4QRRA 4TPRH 3VFUA 1VERA 2AI0H 1INQB 1DBJH 1TMCB 4WFEE 3CSPA 1JHLH 1SBSL 1PSKL 4K23H 4DVRH 1CQYA 2JIXB 3B6SA 3IDJA 1YN6B 3PIQA 4U6TA 1IC4L 3VXMD 2X4QB 3GB7A 4ODBD 3N06B 2AQ1A 1FL3A 1HDMB 1EAPA 3FAXA 2PETA 1MCKA 1ZT1B 2Q86A 3RGVD 4P3CL 4LCWA 1MCCA 3SKNA 3FOLA 4NUJA 1J10A 3NCJH 3TYFB 3BD3A 5DUPH 2VC2H 5E9DE 4K94C 4BFIB 4XVTH 3MO1B 1JVKA 1TNNA 5GGSB 5CHNA 3OJDA 4LSTH 3VWJA 5MENA 1CN4A 4PR5B 5DD0L 4MMXC 1H3PL 3WMSA 2VLKE 3B8SA 2AV1B 2D03H 1AGBA 2AP2A 3GHBH 5D1ZC 4JE4B 3W11D 2XG4A 4P3WA 5HHPA 2RJMA 2Z4QA 1W72H 2XWTB 4LDLB 1JFQH 2O5ZH 5FGRA 3WLBB 2OR9H 2R8SL 2VXUL 1I8IA 2I9LA 5IMLA 1S5IL 5INCB 4A6YB 2P45B 5FECA 1LK3H 4QT5A 4PREB 2DJSA 3QUXD 3L1OH 4K3EH 4LARH 2FHBA 1A6WH 4TUJB 2OX5A 3STLA 5GJTL 3OGCA 4MA8L 3S36X 3UTZB 1FPTH 3QEQE 4Y5XB 4CJ0A 4QXTA 3C6LC 4M1GH 5H35B 5C70A 2CKBL 5DMYA 3GDBA 1S7UA 3BN3B 3GSNH 1QZ1A 2Z8VC 5EO9A 4HK0A 5HHVL 5H2BA 1YDPB 3D3VE 5IEHB 1T2JA 4P2QA 1FDLL 4HPYH 1V7NH 3BUYA 2O61A 4KKCC 4Y1AE 5E8EA 4XCNB 4OZ4B 2R2HA 2P43B 5BRZB 5FYKU 2P8LA 1HNGA 1MFBH 2G9HA 4GAJL 1G9ML 3TNMA 1F45A 1TVBB 1S9WB 3S37X 4KJPD 3ARWA 3LIZH 4FABL 2C4FT 3QNYA 3QIBD 2DM3A 2EXYD 3IDGB 4QGYA 5I1AA 5DQ9B 5JW5A 2Q3AA 3DLQR 4HX1A 5DTFA 1NAKH 4Y0GA 2UYLA 5JOEA 1FE8L 1T03L 4HBCH 3TPUB 3MYJB 2APTA 3VA2C 2ZG2A 1NFDA 5ILTH 2NX5A 4P2OD 5JOPD 1CD1A 3V6BR 4L4TD 2E9JA 3MOAL 2G75B 4ZOAA 1UH3A 4LHUG 4GRWF 3ARQA 5LGJA 4FFWD 4D0BB 5EZLB 3V5KA 4FQLH 3PJSA 2IPKB 4EOWL 5AYUH 2JCCB 4KKNA 3BSZL 4RZCA 1M05B 2CRYA 3QUKB 3MLXH 3MACL 4I2XA 3S4SB 3OR7A 4FQJL 5DDHA 4PJHA 2FX9H 3CDCA 2DQUH 2EDDA 2B39A 4MXVE 4FFVC 1AD9A 5CMAB 4I48A 5F21B 5AEAA 5EUOE 1G7JA 1AO7B 2OK0H 3LN4B 3V0AC 4PJCF 2DYPB 4Y5XC 1YNKH 1MCQA 2KZ1B 4Y7MA 1Q72L 1SJEA 3T4YA 1WFNA 3V4VH 3FQXA 3X12B 4QYOB 1G6RB 1XR8B 4OM1L 4X83A 4EDXB 3MLTB 1WWAX 4L8CA 3V5HB 2ZNWA 4LHJB 3GSUA 5IFJA 2D7TL 2MOVA 4KK8D 3LKPA 1K9TA 4L8SA 1EFXB 4XNUH 1ES0A 4MA1B 3U7AA 3DVGA 5I19L 3EOAB 2W60A 3VFGL 3OTTA 5DLMH 1U58B 3K3QA 5FDWB 1NEZA 3LKRB 4BKLB 3NTCL 2VDMH 5D1XA 3BWUC 1X5FA 1A7NL 1I4FB 4GAYA 5MI0B 4XNMB 1LEIB 5MERB 3T1FA 2X42A 4OSUH 1F58L 1RK1A 1YEFL 2CXKA 4LCYA 3LEYH 2YBRB 1AP2B 1XF5B 2W9DL 1T20B 2LABA 3ISWA 3U36A 3KYAA 3QUMA 5DK3A 1YMHA 1RJLA 2VLME 3BP6A 5IV2B 3V6ZA 1OP5K 2MWCA 3EYVB 1S7RA 1YY8A 3D6GA 2QQKH 5HGHA 3SJVD 1VADA 5CJOH 4R3SB 4KUZH 1UM5H 4LRNL 1HKLL 1P7QD 4D9RD 3ARGB 5TDPB 3OXRB 1BECA 1JHTB 4DGVH 4PJ9A 5KJRL 4OB5L 4H1LB 1MCWM 1FIGH 4P2OA 1AH1A 3HR5A 3VGDA 5FCUL 4G7VL 3QWRD 4U7KA 1MI5A 1PEZA 2DDQL 3EGSA 2YPKB 4I0PB 1U2HA 3QQ9D 3MRNA 5GRUL 4QNPE 4P9HL 5BS0E 1T2QL 2J88L 3M8OH 1U8OA 3C60A 1P4BH 4R4FH 4PRIB 5LAXB 4LNRA 1C1EL 4IDJH 1BVZA 4WUUD 3P4OA 2EIBA 5J11B 4NFBA 4JFDD 4AM0B 4F7EA 5B38A 1YN7A 5LBSH 1JPSH 1OGAE 3O2VL 1PY4A 3FN3A 4UT7H 4YHPA 4OJFL 5HHNB 3AY4C 3I50L 1AGCB 1BZ9B 3WJJA 1VGKB 7FABH 1J1PH 3HC3L 4PP2A 1ZA6B 4LVNC 1ITBB 5GRVL 4H0IA 2PXYB 4PJCB 4PUBL 5TPWH 3H42L 3T0XA 2JTDA 3GSRA 4PJ7A 5JOFA 2NR6C 3A6CH 3O45A 5KANI 5HGBB 1GGCH 5C0BE 5D71H 4AIXA 2EO9A 2BSRA 5I1DB 1UWEH 4PJEA 4JQVA 1A7QH 5LXGH 4J3TA 4MA1C 4L4VE 1T21B 1N6QH 3AS0A 4YHMH 1KB9J 1YNLL 4MQXC 4JKMA 5CJQH 5DD1L 3WUWB 3V6OA 4GS7B 1ZHLA 3VFTB 4OF6A 4HS3B 3W81A 5MI0C 2R4SL 5IJVB 4XP9H 4QCIA 3BZFA 4JQXC 4TSAL 4MNQE 1CGYA 3MGAA 3G6JE 1GHFH 4ZOBA 1QLEH 3FFDB 3BKJH 1WLHA 3RWCA 5FA3A 4YHOL 4GBXA 1RZJC 2VO5A 1RI8A 4YBLB 4HUXA 3T2OA 2HTLC 4YHZH 2SEBB 1KCRL 2F8XC 4X7CC 4S1QH 4PJBF 1KFAH 1QKZL 5A16B 3O2DA 3ZKSD 2OTWB 3IETB 3WD5H 4I13B 3RAJL 1DFBH 4GLRH 1PKQE 1SM3H 4QF1A 5E6ZA 4KRNA 4Z7WA 3SE8H 4BZ2H 4LKCA 4TVPE 3DV4A 3NABL 3LQAH 3OQ3B 4I0PC 3CDGA 4KDVA 5GQBA 1CR9L 3B5GA 2APBA 3MLRL 3OAZH 2OZ4H 4XXCC 3MOBL 3L5XH