2HRPH

Antigen-antibody complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
226
structure length
226
Chain Sequence
DVQLVESGGGLVQPGGSRKLSCAASGFTFMRFGMHWVRQAPEKGLEWVAYISSGSSTIYYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTALYYCARSGGIERYDGTYYVMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY F11.2.32
publication title Three-dimensional structure of an Fab-peptide complex: structural basis of HIV-1 protease inhibition by a monoclonal antibody.
pubmed doi rcsb
molecule tags Complex (immunoglobulin/peptide)
total genus 38
structure length 226
sequence length 226
chains with identical sequence N
ec nomenclature
pdb deposition date 1996-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hrpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hrpH01
3TC9A 4NO5A 1H9VA 1TCRA 1MCNA 1NCDH 2FH8A 1QRNE 4ODUB 4RISL 2HJLB 2Q6WB 3HE6B 5ILTH 5JR1H 5ANME 3FONA 3QRFM 3V5KB 2R8SH 5ESVB 3VFWA 4B53A 5C0AD 4LLVB 2X4OB 1SM3L 4B41A 4XAWH 3P11H 3VRJA 3RA7L 3C5SA 3TN0D 1MJ8H 3ZTJG 5FFLA 5SWQB 4P4RA 5IB3B 1FFPB 3OKYA 5FGBA 3B8SA 3ISWA 1EFXB 3BRDA 4Y4HB 1RQ5A 5DFTA 4Q0XL 4N90E 4RA0C 3OAZH 1H5BB 4QHMA 3KPPB 4YNYB 3CCHA 1YECH 1HYRC 3MCLL 4PRNA 3HPLB 5E1HB 5FGCE 4OLVL 1UWXK 3A6CL 1FN4A 3RNKA 1V3JA 1CLYH 2P8MB 2BOBB 3VU2A 1XIWD 1LE9B 5TDOB 4JHAL 5CJXA 1QSFA 3L7EB 2ZNWA 3VD9A 5D1ZD 3QEQA 1NFIA 4HZLB 1U3HB 1H15B 5HHPB 1F2QA 4LSDA 1RK0A 4NFCA 3FTGA 4ONHA 1MIML 4HQQL 1FSKC 3DNKA 4X7TB 4J4PC 3IDMA 1IGYB 4OLZH 1KUMA 4XTRD 1WWAX 3FZUC 3L3IA 4OCNC 3JWOL 2AJYH 2IPTH 3GHEH 5D7JD 2V2XB 4GRWB 1W8NA 3HTLX 4P2RE 3QFJA 3N1MC 1S9WA 2IH3B 4JRYD 3TVMD 1VFAB 1AC0A 5FHBH 1L7IH 4WO4A 2X1PA 1DEEB 1NC2D 3MRIA 2G60L 4LSQL 1XR8B 1AKJA 1IT9L 4NP4L 1NGXB 1J88A 4XP5L 5ESVA 3LKPA 4I18A 1FVDA 1KB5L 5JHDA 4YPGA 2QQQA 3E3QC 2HKHL 3NCBB 5FYKD 4EEEA 1O5DT 3JUZA 4MXWH 1PW3A 2BC4B 1JYXA 3LH2L 4AEIL 3F7YB 2BVOA 3TJEH 1PZ5B 2Y5EA 1CZ8H 3PDOA 4GQPH 4NKQB 4PLJC 3L7FA 1H5BA 3SEPA 5LGHH 1K85A 2AXJA 1WFUA 5IBTH 3AS3A 3B2UC 1U2CA 4CU6A 2PR4L 5JW5B 1G7LB 1FFOB 1MCPH 4NN6B 3VGAB 4FFVD 3UBXI 5L2KB 2HFFA 2EZ0D 4W68A 3FHQA 1YMMD 3FQWB 2VXQL 3NGBB 4RGMB 4OFIA 1K2DB 1B0WA 1TZHB 2J88H 4HZLA 4LLMB 1UADC 3BDXA 2XN9A 1H15A 1PLGL 4DKEL 1ZXQA 3QWOB 4WFFD 3PV6B 1JGDB 3UZQA 4G6MH 1MUJA 1TJGH 3AU1B 4X7TA 2EH7L 5KVMC 3F58L 4QHUB 1IM9D 5A3ID 1RVFL 1JWMB 4LF3B 3JVGA 1FO0L 3KGRA 4HHAB 3VFGL 5D2NB 1F4XL 2CMRH 4F3FB 3QHZL 4XCYB 4JG0H 3EIFA 5FUOH 5D71H 4TULL 4DTGL 3LY6A 4M48L 1DEEA 4UINH 4XMPL 4UTAL 4ONGL 4NFDA 1NGXA 1HKLH 4LHUA 1U0QA 2EDOA 5L2JA 1MWAH 4ZUTB 1UACL 3PGFL 1NCAH 2ZOLB 1K3IA 2XWTB 4JM2B 4X5XB 3AVEA 3TZVD 3THMH 2VLME 3GSVA 3DMMB 4OUUA 4M6OH 1CXFA 2HLAA 1MY5A 4BJLA 5TE7L 4DFIA 2MMXA 1ZGLA 3HMWL 4BH8B 4OQ1A 1VHPA 5JW5A 4FTVE 5CEYA 3RWJB 1JZ6A 1CF8L 2H26B 2FDBP 5IM7B 3FQNB 1MRCH 5L2KA 1BVKB 1M7DB 3VDAA 1HOCB 5F44A 3OKKB 5TQ2L 4DJMA 1KNOB 1UB5A 3PXJA 2VZVA 3BQUC 4EDWL 2GJJA 3QIUA 1K2DA 5FOJA 5HYJA 4HXBH 4LLMA 2UWEF 1MWAB 3V52L 3WFBH 5IW3A 1WUNT 3QWOA 1KFAL 4PR5B 1CDJA 3QXVA 1JGDA 2OS7A 1FL3B 3C5ZB 5IMMA 3FFCA 4R4FL 3LMJL 4X7DC 3JWDL 1HINL 5HVFB 2YC1B 1K4DA 3ES6B 4FFYL 4GBXA 1NGPH 2XFXA 5HTSA 5C07D 4LF3A 1TVBA 2CK0L 3GRWH 4JO4L 4Q9BA 1TQCB 5DRZA 3BH9A 4XCYA 4MXVE 5IMLB 4WI7A 4LLYB 2IBZX 5GGQH 2X9WA 2AEPH 4YHPA 2A0LC 3OXSB 2XWJB 5DC9B 4GO6B 5L8LB 3QCUH 1QSEE 4HKJB 5FM4A 5IBUB 4D0CB 3RI5K 2VNCA 4HV8B 5F3HA 2NZ9C 1KJ2L 3E8UL 3HG1E 4WU7B 4ZPTB 4LKCA 4NQCE 4KJPC 3FQRA 4YLQT 2AXGB 3L3JB 1B0RB 3MFFB 2DQJH 4JVUA 5T3XL 2ZJSL 4GAGL 1FGNH 3HCVB 3IGAB 3OB8A 1DVFC 5HHNB 3DBXA 4RWYH 4PP1D 2ZCHH 3GMRB 2YPLD 2GK2A 3O4OC 4GAJL 1E4XH 5CJBA 2ESVE 3L3GB 4HLZG 2E27L 3UTPE 4MA8L 5DDHB 4LLUB 3QRGL 2H32B 3B5HA 2AI0L 4MDIA 5F7UA 1RJYA 4EXPX 4K3DL 5T3ZL 3FQNA 1TETH 1M7DA 1YEHL 1RZJC 4QCIB 5CP3H 4POYA 1FPTL 5TPWH 2I24N 5FF6B 1JNJA 3FO2B 3T08A 1UJ3C 1MWAA 4BUGA 4PJGA 5SX5K 1BWMA 3EHBC 1BQHA 3U83A 1NFDB 2Y36H 3MA7A 2UWEE 4PR5A 2YXMA 1INEL 4JR9H 4O5LL 1KEML 1U8NA 1D5BB 1BLNA 2Z35B 3SDCC 2QQLL 2E6QA 3KPSE 4LSSH 5MHSD 4JFED 4RDQG 2VDML 2R2BB 3FMGL 4YBQD 3MYJA 2GTZB 2QQNH 4S1SH 4OZ4B 3U0PA 4NZJA 2XWJA 1A21A 3CFJA 4G8EA 5JXAL 2NY0D 1XGYL 3PGCB 3NCYP 2Y25A 5CIPB 3R8QA 2FO1A 4Y19B 3NAAL 4NRYB 1F45A 2DWEB 1HQ4B 4ZPTA 4LVOC 4E9LA 2WWMC 1EAJA 4FZEL 5B39A 4AG4H 4P0DA 1G9NH 1OGAE 4C56E 3MFFA 1A1NA 4HXAL 4YQXH 2B4CL 3HCVA 2X70B 1EGJL 4HIIA 1BFVH 2UZIH 4LMQE 1T83A 4XWGL 2BNQE 4PRDB 2H3NA 5DJDA 5C0ND 3U4BH 1LHZA 1CYGA 1G9MH 1CICB 4M3KB 2XQYK 1JPGB 3VGGA 4LAJH 3WN5C 4LLUA 5D1QC 3PNWA 1TTUA 1E6OH 1H0DA 5D70H 3VXSE 4J3SA 1OT1A 3E2HB 4X6FB 2IF7A 4DQOH 3UAJC 2EYTB 4APQB 2F53E 4NCDA 4L8CA 4PJEB 5FF6A 2C3GA 2FX7L 1QSFD 5CJ8A 3ROLB 3TA3C 1T5WA 2I5YH 3QIBD 1BJ8A 3RGHA 5FHAH 1VEPA 2BJMH 2EIBA 1J8HE 1MJ7L 2B0SH 4CVWA 2DDQH 4KDTA 1L7TL 5C6TH 1CD1A 1D5BA 3MA9H 4P57A 1NBVH 5IESL 1KPRA 1IGFH 1NGQH 2F58L 2AXHA 3EAKA 5IBUG 5DEGB 3QQ9C 4G9FB 1G7MA 2FBOJ 4HWEL 3DJ9A 1T21B 4PYHA 5I76A 3VXRE 4DCQB 1P1ZB 3EDEA 5TQ0H 4G6FB 3L3DA 3ILPB 3HPJB 5BZDA 2UUDK 4WO4D 4Q6IB 4RQQB 1MCBA 1UT9A 5EUOA 4M62L 4WW2C 3HE7D 2XQBL 3EOTL 2CPCA 4F33B 5CKAA 4WFHD 2OR7A 5JHDD 2R56L 1SBSH 1FNHA 3W11C 4P48A 2QQKH 4HAFA 5DMIL 1RFDH 2OR9L 3GSQA 4N0YH 4Y16A 2X70A 1EJOL 1WBXB 2VL5A 4JPWH 4JFFA 4OT1L 3ET9F 4JN2B 4PRDA 4ACPA 4PGEA 3V5DB 1NMBH 1CICA 4PS4H 3TO4C 3IAPA 2OMNA 5EORL 4IOIA 5E5MA 1W8OA 5JOPD 2JCCA 3GJFB 2GJ6A 1NAKH 1YEIL 2FZ3B 4GUPB 3Q6FB 3ULVD 5I19L 2X4RA 4X6FA 5KOMC 3IKCB 1IVLA 4APQA 4G6JH 1VACA 5F6IC 4RNRB 4MXQD 4LAQH 2FBJH 3GI9L 5ETUB 1FH5L 1TENA 2IAND 1CG9B 1GJIA 3MLRH 3TP4A 5CZXD 3VXQB 3WDHA 2ADJB 3DTXB 3W9EB 1X4XA 1B4JH 4L29B 3WUZA 4WCYH 5E8OA 1DL7H 2DM2A 3O2DL 1IEAB 1P9MC 2BHYA 4KHTH 3S37H 5IMKA 2J8UA 5BJTA 1LK2A 1DQJB 1V3MA 3ILPA 3RP1A 2MPAL 5DJ2B 3ZKXB 3UTOA 4YDKL 3SDYH 1UFUA 3AREA 4CN6A 3FT4A 3KPQB 3OKMB 1CDGA 4L8BB 3KS0H 1P7QB 3GJEB 4L9LA 2VH5L 4LVEA 4JG1H 4MCYB 5T1LB 3MLWH 3N85H 4CNIB 4KQ3H 3UEZA 5I18L 3ROOB 1P4LB 4JFDE 5DA4A 4RBPK 2FB4H 3V5DA 1DBBH 3LQAH 5D8JH 4IDJL 3S36L 2A6DB 4Y4FC 4ZXBC 3O3BB 4OLWL 4IRSA 3F8UB 1XF4A 1ZAGA 3GBML 5C6WH 3SPVB 4Z0XA 3PL6A 2R4RL 1CLOL 3Q6FA 3QUZC 1Q9KB 4QRQA 4NUJB 3X11B 4PJXA 3FO9A 5JDJA 1U3ZA 5KSAA 2PW1B 1H3WM 5GGTH 4NZRH 1BECA 3QIUD 4JKKA 2UVFA 1RUKH 2HN7B 4PRAB 3FN9A 2NY5C 5E2VL 5J3HC 2BVUA 5BVPH 1M7IB 4YUEL 1A8JH 4NQEE 4PJBF 5I1IL 1D5IH 1T1ZB 4RAUB 3VXQA 2ADJA 3W9EA 1AQDB 5C0EB 3BZEB 5SWZE 1C16A 3AB0B 4MB5A 1ZLSH 1KJMB 4I3RL 3CLEL 1IFHL 4JFHE 5F9DC 4EN3A 2DMCA 3KYKH 1S9VA 3RBSA 3X14A 3R1GL 1HYSD 1JFQL 5CBAA 2FJFB 2YUXA 4GQ9H 4YHKH 3SKOB 2GSIB 3E6HA 5TDPA 1JPSL 3Q6GH 3T3MF 2Z93B 4TOYH 3BE1H 3NCEB 5F97E 1XGPA 4JGUA 5JOEA 3IDIA 4OCXH 3QUMH 2HT4C 4NUGH 1P7QA 4GW5B 4HMCA 5T1LA 1Q72H 4WUKH 4F9PC 1KCVL 2IQAB 3ROOA 5JPNB 1WAAF 5ID0B 4NQXB 5GIRB 3IFNH 4L8SC 1BZ7B 4PREA 1QQDB 3B5GA 1JHLH 5BS0B 5IF0B 3C8KB 3TPUA 1RZIB 3C5JB 2BK8A 1U41A 2L0DA 1FBIL 5EULV 5KVGL 3I75A 5F6HI 5IB2A 2WBJD 5DMGD 2A74A 4OSUL 2WUBL 2GITA 4I4WA 5F1KC 5FYJU 12E8H 3CMOL 1Q9KA 2VXUH 2EC9T 3X11A 3UJJL 1R3HB 4Z7UB 1J11A 1RZGB 1W72L 4F58H 3NZ8B 5HI5C 4LPVA 2OK0H 4ODVL 3FN0L 3MREA 4FQCH 3VWKA 5KSUA 2LU3A 5I71C 1T1ZA 5TH2B 3CAFA 5I1JL 4PJBE 2DIAA 4HJJH 1OP5H 5C09E 1CL7I 4RMVA 4ELMA 4L4TB 1KC5L 5EU7C 3NCYS 4Z7NE 5D7IA 3K80A 1TVHB 4NKIL 4JQIH 5GPRA 1T7ZA 2OCFD 2FJFA 4LLQB 4GSDH 2HRLA 3SKOA 5DUPL 4ORZC 1O0VA 1L0QA 2Z93A 2AEQH 3GFUA 4GRLC 4MJIA 2EDEA 4JB9H 5DC4B 1JZ2A 5GGTA 1AY1L 4XNYL 2EH8H 4R8WH 5CGYD 3T3ME 2CXKA 2X4NB 4YFLF 5C0AB 4ZFOL 5EU6D 2YUZA 1IKNA 4X99B 3TJHD 1C7TA 2R69H 4HK3J 1FDLL 3TN0B 3CSBA 1I85A 4GRMB 4HG4K 3FQTA 4ZD3L 5GS0D 2M2DA 1A0QH 1KLFA 3K8MA 2Q8BH 1X5GA 2PYFA 5J06A 1QQDA 3JWNC 1WAAE 4OF3A 1YJDH 1BD2E 4E41A 1WWWX 4KI5F 3VXPA 4R2GB 2R1WB 1URLA 4FQHB 4CVZA 4P5TD 4YXKH 1DQML 1FVCB 2AJ3A 2FHCA 3SHSA 1M6OB 5IMOB 2BSSB 2D03H 4OD3H 2CH8A 4OQTA 5MEQB 5J6HB 1KCSH 1JNNH 4X8JA 2HTLC 2NY3B 5D5MB 4Z7UA 3V6OA 3SCMD 3S4SA 3WFZA 4NBXB 1A7PL 3HKFA 3BIBX 1G7QB 2DQGL 1MJJA 3A67L 3QUMA 2IPKB 4EI5D 2XZQH 1Z9SA 4F2MA 2NW3B 1NLBL 4TUKL 1IC5L 4GKSA 2VC2L 4C58B 1IGIH 2FJHA 4Q9RH 4HJ0D 1YPZA 3QJFB 3IVKB 1N2RB 2N7BA 3HNSH 4I0PA 3CSPA 3O3DB 3CU1A 2K9UA 2GSGA 4XVTL 5AUMB 2DOCA 4OIAA 3VFMA 2R23A 3O2VH 3C60B 2VLRB 4WTWA 2D9QB 2DIJA 4TUJB 2Z92B 2DQTL 2MCPH 4JRYB 3TVMB 4X7FC 2WBWB 5I1HL 2AV1B 4MD5A 1JPFA 2YD1A 3EO0B 5JQ6L 3RY6A 4KJYB 4CADA 3EYSH 4BZ2L 1X3DA 2ATPB 2APXA 1HILB 3W39B 4XWOD 3ZDYF 1MLCB 3IU4H 3MRBA 2ZZUT 1U8MA 4IRZH 3QI9C 4HD9A 3CVHL 3H9SA 2VLKE 2A6JB 2DQUH 3O3AB 3MGTA 4P5MB 2WANA 4KI5E 1FVCA 1OAXH 3BFOA 3O6FB 4LVHB 4OF5A 1G6RB 5EPMA 2AABH 3FB7A 3QULB 3ZYZA 4OCRL 3NACL 5FUZL 4F15C 5J6HA 1QD0A 2L4OA 4PGCB 2Z9TA 1D9KB 4UQ3B 4YBLC 1G7QA 3KNBB 5SWSE 4LL9A 1OCWH 3HFMH 2BRRH 2IPKA 4WI5A 4HKZB 5F8QC 4WV1B 3LEVL 4PJDF 2BSTB 5DT1H 3UP1A 1BFOA 1OTTC 1X7QB 2QTEA 3WNNA 3D3VB 3LKNB 1RZKL 2XG5A 3ESUF 4PJ5B 2FX9H 4HIJB 1VFUA 1HXYB 1NCTA 4I2XB 5ENWA 1TZGL 5BOPA 1WITA 4GMSH 3C60A 2VLRA 4N5EC 4GAYB 2VDNL 4MD0A 3P9WB 3QQNA 3TH4T 3U4AA 4RISH 1LEKB 3V5HB 4YZFF 2ZSWB 1VDGA 4UT9L 1P4BL 1FV1B 3ZKNC 3RZCC 1MQKL 3EO0A 2B5IB 2F9BT 4P23D 4WY7L 2YPVL 5DJ8A 1SM3H 3V7AE 3RA7H 3IDGB 4EDXB 1HILA 3D39D 5JQHC 1S9YB 5D2LF 1JPTL 4O4YL 1S7UA 1T66C 3M17B 3GHBL 5FUCC 4OBSA 4JQVC 3TZVB 3WS3B 4Q0XH 4X6DA 4F9LA 4PRHE 4JM4L 4RX4D 4P5MA 3OJVC 1BVZA 3MCLH 1N0XL 4WI4A 2GAZB 4KDWA 4OLVH 3A6CH 4S0SD 5AAWA 1QFOA 4OZHB 4Q74A 3O6FA 3KPRE 2Q76B 1A64A 1JI1A 3DURB 5IK3B 1GC1C 2M1KA 4X4MA 4XXDA 1FE8L 1J1OL 3SJVD 1CVSC 1K9TA 2HRPL 5E95B 5IKCB 2LQRA 1ZVSB 4JHAH 4PGCA 1QLFA 1D9KA 1T89A 3UTTD 5J12C 1RU9L 3LKOA 4HS8L 5DRNA 2NYYD 4U0RC 2OXHA 4ODXA 2OBGA 3HAEB 5E5UB 4PJDE 3RUGA 1MIMH 1CIUA 3HNVL 3D3VA 4HQQH 4PJ9B 2ZOKA 4X7EC 3L3HB 4PJ5A 3SGDH 1WBYB 5ITBL 4LOUC 4DW2L 3ZT6A 3JWOH 3UDWC 1JNHB 5JW4Q 5KVFL 4I5BA 3CFIC 4OV5B 3VXME 1BIHA 4JZJC 2XTJC 2ZSWA 1KLUA 3WJLC 1AGEB 4LNVA 1V3KA 3FKUS 4K7FB 4YZFE 4ZMAT 4LSQH 2G60H 4DZ8B 1IT9H 4NP4H 3KYNB 4XP5H 2RGSA 1KIPA 4ZFGL 1KB5H 3C09C 4FFWD 5F7KC 4HK0A 4NNYA 2HKHH 3VFTB 1N0LA 5HJ3A 1T2XA 2R2EA 5E8PB 3VH8B 4ISVB 4EQ2A 4YX2L 4GJTB 1P53A 4X83A 4NQDD 1Z9OA 1BZ9A 1CXIA 1SQ2N 3CNKA 3LH2H 5GGSY 3SE9L 3M17A 4KV5F 4PY8I 3WS3A 3V4PL 5D2LE 5CAYB 5F6HJ 4OF7A 3RGVA 3SKNB 5GZOD 1FVEA 1NFKA 4YFLI 4QOKD 5EH1A 4EIGB 1OW0C 1R5IB 4HIEB 3GSUB 4V2BA 2PR4H 3SGKA 3WIFB 2NW2B 3H6JA 5JMRA 5IK3A 2M26A 3PWPB 4AEEA 4FMKA 2VXQH 1UWXH 1CDIA 3WUWB 1ZVSA 5JIPA 2G9HB 4OZGB 5F1NA 1UM6L 5IG7A 4JZNB 2F54D 1ZT1A 1PLGH 3G6JF 3O4LA 5TDNA 2YXFA 4DKEH 3NOIA 3HAEA 1YNKL 2DQDL 3VWKD 2EH7H 4YR6A 1JHTB 5JUEL 5I17B 4PD4J 3KPTA 3F58H 2B2XL 2EKJA 2DL9A 1RVFH 1OAUL 1F4AA 1FO0H 3SGJC 5DMKB 3VFGH 1GOHA 5GGVY 1F4XH 4CW1B 1G7HB 5FDWB 3QHZH 1ULVA 25C8L 4QXUL 4G8GD 2NCMA 1QRKA 1U95B 2D7NA 4PV8A 3ARGA 1LE5B 4KJWC 4TULH 2GTWB 1AGEA 3I6LD 3RVWC 4DTGH 2IH1B 5GGRA 4M48H 4XMPH 4UTAH 4ONGH 2VAAB 4RZCB 1H8OA 2NY0B 4CRPA 1ZGLM 4PGBB 5E00B 1E4KC 3F5WA 4KVNL 4HX1A 2DLTA 2Q3AA 5E8PA 5EO1B 5CD5C 3F6IA 1UACH 3PGFH 1IAOB 3T0EB 5INCB 1I7UB 5IW6B 3SKNA 1N8ZA 5ESQB 1K8IB 1ZHNB 5TE7H 3OF6A 2GQHA 1R5IA 4RAHA 3HMWH 4PRPE 3V0WL 3WIFA 1U6AL 2NW2A 1CF8H 1UXWB 1HCVA 3DXAE 4MNGB 2YN3A 1L9NA 1W0WA 1C5DA 5HHMD 5TQ2H 3JTTA 2IAMC 5IFHL 4EDWH 3RVTD 1KB5A 4GW4B 3ZHKA 1NDMB 3V52H 1JZ5A 5E8NA 3QIBB 2VLJB 1S7XA 2ENSA 5FM8A 1KFAH 3G6JE 1DQDL 3UYOD 4R4FH 1WIOA 3LMJH 1CGWA 3JWDH 1HINH 4ELKA 4FFYH 4GLRI 2UYLA 3P77A 4G9DB 2CK0H 2DM3A 4JO4H 3U9UB 5DMKA 4CW1A 1G7HA 4KKLC 2X4UB 5D7LA 3VH8G 1ZVYA 1MVFA 1GHFL 3QDJD 1YA5A 2PTTB 3BMWA 1GYAA 2FLRT 1FFRA 3OQ3B 4NHCL 4DKAA 5H94B 1NL0L 5F72S 3CGTA 2OJEB 3QEUB 4O00A 4K8RC 1KJ2H 3E8UH 3BPCA 3F12B 2DRUA 3HI1A 5EO1A 3EUUA 1YEFL 5T3XH 1AGCA 4F8TA 1NH6A 2ZJSH 1BJ1J 4GAGH 5INCA 3B3IB 3T77A 4MA1C 2P5WD 1AXSA 4GAJH 4PJCB 3STBA 3WE6B 5C0RL 3WUWG 1ZT4A 2E27H 5DYOA 1FO0A 4UT7L 3QYCA 4J23A 4MA8H 2EXYD 4R90L 1RUAL 4MAUL 4WEBL 4LPWA 1M71B 1A9EB 3MV8A 3QRGH 4A6YB 2AI0H 3QEHB 5HVGB 4K3DH 5T3ZH 4LGSB 1YEHH 4M03A 1FPTH 3T0VA 2O5XL 4HWUA 3TH2T 4M02A 3VRIB 2C4FT 3WFDL 1S5HB 2R0LL 1LO5A 5EC2B 3PQYB 3L5HA 3B9KB 1TQBB 4W81A 4BQBA 2W07A 1ERNA 5EUKA 5I8EB 1INEH 3D0VB 4NT6B 2PO6A 2IANB 2XWBA 4O5LH 1KEMH 4X98A 3QH3A 2EXWC 5FO7B 5CILL 2OL3L 2EEDA 1UYWL 1ITBB 2OTPA 1B90A 3CVIL 1A6TB 5A16A 2QQLH 3U0WL 3N06B 1BBJA 2K3TA 1IKFL 5MEND 2X4UA 4PV9A 5FV1L 4KGJA 2BXZA 2VDMH 3FMGH 1UEYA 4NHUA 4M4RA 1ZMYA 1RZ8A 1QRNB 5JXAH 4PRBB 1XGYH 4Y5YA 4NPYB 1JYNA 2B1HL 4LRIC 1LO2L 4ZFZB 2OJEA 2VMFA 3NAAH 1S9XA 1WICA 1I8MB 1LILA 5E2TL 4FZEH 4ORGB 1T03L 3VI3F 3V8CA 4XPAL 4HXAH 5D6DA 2B4CH 3QPXL 5C0BA 4J3TA 3E6FB 2R0KL 1P7KA 3IFOB 1EGJH 1DE4A 2OM5A 3FOLA 4FQXB 5L0QC 1L0XA 4XWGH 4HDIA 5C0JB 4PJCA 2H1PL 3UBXA 2W1NA 1VADB 5E94B 1T1WB 1M71A 1A9EA 2VITB 3QEHA 5KAQF 1F02I 5FGCB 4ETQA 3TYFB 2IADB 1AI1L 1RV6X 1FCGA 1SJXA 2MWCA 3DWTA 5I2IB 3HUJE 1OB1A 4ZSOE 3OHXA 3HB3D 4LDEB 1U8JB 3IRPX 3VRIA 4A2LA 5CD3B 2FX7H 3MLVL 2FECL 4Y7MA 2DKUA 1KJ2A 1QG3A 3VFUA 1A7QL 2BCKA 3B9KA 1U42A 1ZOXA 4N8VG 3RWCA 2BVQA 4NKDB 1MJ7H 3NFSL 1L7TH 4XVSL 4KK8D 5SX5H 2BERA 1A4JA 2UVEA 3GSOB 4TVPE 1JV5A 3AY4A 5IESH 3VG9C 3PP3H 2F58H 3LN4B 4IIQA 2GY5A 2P1YA 1A6TA 5JOFB 4JRXA 4L5FL 4NJ9L 2ZG2A 2LAGB 3S3PA 4HWEH 3STZB 5I16B 2D7TL 4HUUA 5E8EB 5BRZD 1KENL 1QRNA 1BJMA 2MHAB 4QY8B 4NPYA 4YHZL 4M62H 5ANMA 2XQBH 3EOTH 3LDBC 4PTUB 4Z18A 1I7ZB 3GMMB 4PGZA 3VJ6A 4HF5L 4PY8J 3QXWA 1PQZA 2R56H 5DMIH 2OR9H 3NVQA 2XZCL 1FZMB 1EJOH 4FQXA 2EEAA 3B9DA 4OT1H 3DV4B 4KQ4L 5B8CB 5C0JA 3TLRA 5KN5B 4L3AA 2ED8A 4OCSL 3D5OF 4N1EA 3U48A 2G5BA 4MA3B 1T1WA 5J11C 3QUYD 2WBJB 5E2UL 5I6XC 3W81A 1YEIH 4J3WA 4ZS6D 4Y1AB 5I2IA 5I19H 1OM3L 4ZFFB 1DQQA 1U8JA 1UM5L 4D9QD 4RFOL 1CT8A 5CD3A 1R3KA 1OWRM 2WLYA 4FQQA 5ALCL 3KJ4B 3V2AR 2VTFA 3GI9H 3FB5A 1F6AB 1J12A 1FH5H 4HT1L 2ATKB 3H7LA 2PXYB 1EGJA 2JE8A 3GSOA 4OFDA 2OTWB 1G0XA 2DN7A 2D0FA 4M7ZB 4JPVL 4BQ9A 1BZQK 3O2DH 3BUYB 1S7VA 5JOFA 5DRWB 4U1JA 2LTQB 2VABB 3T0WA 3GO1L 4BSVA 3G9AB 4P2RA 1UXSA 3MSPA 3ARDC 1KPUA 5E8EA 2MPAH 1Q38A 3QO0A 4EOWL 3MLPA 4QY8A 4YDKH 3DYPA 5GGUB 2RCSL 4JKPL 4M4PA 3GMMA 1FNGB 1JRHI 4Y2DC 5EOCL 5DD6A 4ZAKD 1D5ZA 1F8TL 3IDYB 4K71C 3N50A 4K8RL 2VH5H 3WNLA 1MF2L 3QXUA 2VL4A 2EIZA 5GSVB 4H8WL 2JTDA 5I18H 4W4NA 5B8CA 5TGBA 3IF1B 3P9LB 1WFNA 1YZZA 3JV6A 3P40A 5FM5M 4IDJH 3S36H 4MA3A 3OF6D 5A1AA 4OLWH 3GBMH 1HH6B 4WI8A 4P5TB 1S7WB 3R8BB 1F4WL 1UJTA 2R4RH 4M6ML 1MHEB 3AM8C 1CLOH 2X1QA 4Y1AA 3BMVA 3PIQB 4ZFFA 3LQZA 1RHHB 1Y6NR 1BX2B 3SCMB 4NO0A 5EWIL 3GUTB 2AK4E 1OVZA 1D5MA 4M93B 1V3LA 3K81A 1YDPA 5E2VH 2GK0A 3UTSD 4YUEH 4HW6A 5I1IH 3BH8A 4QXGL 2PXYA 4M3JA 4NNXA 4X5WB 2OTWA 1DANT 4P2QD 1T0PB 5KSBE 4I3RH 3CLEH 1IFHH 4EUPB 3HC4L 3O8XA 1FGVL 3R1GH 3RKDD 1MPAL 1PKQB 1VENA 1JFQH 4N9GA 5D7LD 4JKWA 3MV9D 2ICWI 3JV0A 3RWGB 4U6YB 3SDAC 4P3CL 4MJ6A 1KIQB 4KK6C 1JPSH 1KSRA 5ISZD 2DM4A 1U92A 1AD9B 5BW7C 5IB1B 3D25A 5HYEA 4M1CC 5J9PA 2EDTA 4H26B 3MV7D 1ZA3A 4O51A 4PB0L 1CFQA 1NANI 4N68A 1KCVH 3DO7B 5K9QG 1OTSD 4L3EE 5C0FB 3P9LA 3O2DA 3ZKMC 1JF1B 1FBIH 3IXTA 5KVGH 4ZS7L 4HH9A 4DOHE 1LEGB 4RBPH 3MV8D 4OSUH 1ONQB 2WUBH 4FTVA 3HNTL 2DYPA 1JRHL 5F88A 3CMOH 4P9HL 1WLHA 3UJJH 4YK4C 3O6KL 5SV4A 3O41A 1W72H 4HUVA 1RHFA 3GUTA 1UKQA 4ZOAA 4ODVH 4PJFB 1GGIL 3FN0H 4KMQA 4OD2A 1EIBA 4U6HB 5HGBB 2WZPD 4X5WA 5I1JH 4RMSA 3UTZA 3WFCL 1R5WB 2BRQA 2HFEA 4NQTA 5B3NA 3O9WD 4YDVB 1KC5H 2FGZA 4HCRL 3LKRB 3QCTL 4NKIH 4UNUA 5ITFA 4DGYL 4OGAC 3RWGA 2NXYC 2VDLL 5B3JE 1MFAL 5DUPH 4YAQA 3WNKA 5D9SB 4DFHA 3EFFB 1W72B 1AY1H 4XNYH 3BEVA 4P23B 2MKLC 4QHNB 3DUUA 3ARPA 4RMQA 2CR3A 4JLRA 1J0YA 4XXCC 1FDLH 4GG8A 1BFTA 3HG1A 1NC4A 2A73B 1AJ7L 4NQCA 4QHLB 4ZD3H 1TCMA 1OGAB 5KSVA 3DO7A 2ADGA 1CDYA 4KKBC 3PWNA 3RNQA 4W6XB 4N0UE 3OKLB 5C0FA 4TVPL 5A40E 5C71A 1JF1A 4W70A 2ESVA 2BVEA 3CSYA 2NY6C 2BNUB 1DQMH 1VKXB 1N3NB 4ENED 5E9DD 1IEBA 1ONQA 2HT3D 4LFHG 3DYOA 3GMQB 1J1PL 2IMNA 3ULSB 5IEHB 2VSDA 2UZYB 3MYZA 3P4MB 3X13A 5CINL 2DQGH 3KYAA 3A67H 5EOCJ 2IEPA 4PRIB 5MERA 3D2UD 1I8KA 2O5YL 3PE9A 4LPYA 3DARA 2UWEA 3X3FL 1J8HB 1NLBH 1QO3B 3TIDA 3K4DA 4TUKH 1IC5H 2VC2H 1KACB 1D5XB 1R5WA 1U3JA 3LCYA 1DN2A 4OKVB 5IB4B 2H2PC 2X6MA 2YD9A 3JBG7 3LEXB 5FYLD 4P2OA 4XVTH 3MRPB 1W0VB 3KPSA 1I8LA 3L1OL 2M8XA 1OAQL 5T3ZD 2DQTH 5I1HH 3EDFA 5D9SA 1R24B 5FYJE 1W72A 4LP4A 1TPXB 5JQ6H 2A83A 4NQUA 4BZ2H 4QHNA 1IC4L 5CJXC 2LFGA 1SY6L 3OB0H 4QHLA 4XZUB 2BFVL 5K59E 3V6ZA 4NQDB 2NX5D 1OGAA 3B9VA 4C56A 3QZWA 1T04B 5D6CB 1OLZA 3CVHH 2D7OA 3KXFD 1JGUL 1UB6A 3SDDB 1HHJB 3OGCA 3OKLA 3L5JA 2BNQA 4J4PD 1UVQB 4QOKB 1FP5A 2VE6A 3NFPB 3ARXA 1KLGB 3L9RB 5CEZD 3FZUD 3J7HA 1VKXA 1N3NA 1QZ1A 3ARQA 4OF8A 3RDTC 3RL1A 3DOSA 4OCRH 2ZUVA 3NACH 5FUZH 3VXSA 1MI5D 3ULSA 3OAYK 4D3CL 3P0GB 4QXTA 5IT2L 3WHE0 5L8KB 4ZFOA 1JTTA 4L1DA 3VGHA 1BF8A 2F53A 4F8QA 4PRIA 4D9RE 3LEVH 1LD9B 4H88L 3RVVC 4XRCB 4I18C 1J8HA 3DX6B 1QO3A 1EO7A 1RZKH 1D5XA 3KWWB 1OAZL 1T0MA 1A3RL 1YY8A 1BIIB 1ND0A 4K94C 3LEXA 4MA7L 3H7BB 4HWNA 4PLJD 4Y5XB 4PTTB 1TZGH 5IVOA 1H5BC 5EZOL 3EYVA 3VMPA 2C26A 2VDNH 4D8PA 4Q9QL 3B2UD 4G8GB 4M6NL 4XHQA 5HGGS 4UT9H 1IM3B 4GRWE 1P4BH 3PF2A 2NLJB 1MQKH 4HUWB 4XPHL 5IHZB 1FL6A 1P2CA 3PHOA 4WY7H 2YPVH 5MI0B 1XGTB 4P4KA 5F7NC 4UIMB 4XZUA 1JHKL 2RIKA 4RDQF 2OSLA 1SJHA 5GRJL 3T2OA 1JPTH 1T4KB 4O4YH 4XCNB 1U3HC 3GHBH 1T04A 5D6CA 2AAVA 2R1YB 3MOAL 5BOZG 4JM2F 1HSAB 3SDDA 1HHJA 4JM4H 3MODL 4G42B 3OAUL 1UVQA 4XB7A 1SEQL 2CIKA 3L9RA 3NFPA 1N0XH 2IALA 1KB9K 5IVXF 2X10A 4I3GA 1UZ6F 2P7TA 3QNZB 1IGCL 5KJRL 4Y5VB 3JVGC 3IYLW 4S2SA 5KS9F 1FE8H 3LEYL 1J1OH 4S1DC 3KPLB 2HRPH 5HHMB 3W5NA 1F3DJ 3PWUA 4FXLA 1MLBB 2VQUA 4OGYL 1Z9LA 5L2KE 4HS8H 2FO4A 5EBWB 3VWJA 3S8WA 1DTUA 3QDGD 1RPQA 3V6FB 1A1MB 3HNVH 1TZIB 1BJ1H 5FKPA 3RIFK 3CVHA 3S35L 4IS6A 4ZUWA 4XVJL 1U8QA 5ITBH 3H7BA 2ICWJ 5DD5L 4DW2H 1AR1C 4PTTA 1RJCA 1Z2KA 4JFYA 1P5VA 2YA0A 5CFHA 4Z7VF 5IJKA 3HHRB 4Y4FA 1Q0YL 5KVFH 1S7QB 4R7DB 2A6KB 4XGZA 4XAKE 2V2WA 1HHKB 1SJVA 5B38A 1K5NA 2W92A 3QDJB 4V1DD 5D2NE 3NMEA 1E4WL 4NN6C 4ZFGH 5IHZA 3NZHL 3BQUD 4HGWA 3QWRD 4YX2H 5DZLA 3SE9H 4XCNA 1DBML 1MJUL 3V4PH 3W0WD 4ZTOL 1TIUA 2EYRA 5GGVL 2P5WB 4JFDA 5LKNA 4U1IA 2C7UA 2BX5A 5I0ZA 4OGXL 5E99L 4K2UL 4GBXC 5IVXE 3KLDA 2PW2A 1HEZA 3T04D 4Y5VA 2DTSA 1G7JA 2K7QA 5CSBA 2V9RA 2YSSA 4ODHL 3ZDZF 3GI8L 4FQ1L 3EZJB 2A0LD 4LSUL 5HHVL 2WW8A 1UM6H 4HKBB 3CFKA 3S96B 1BOGB 2NZ9D 1IQDA 1YNKH 1HK6A 1NFDF 2DQDH 4NQEA 4KJPD 2Z91B 4NOFA 5JUEH 1I7RB 2H45A 2OTUB 2B2XH 4YDLB 4JY5L 5SWZA 1OAUH 2V7NB 1DVFD 1B4RA 3QDMB 4JJ5B 4KDVA 4R3SB 4WFED 25C8H 3LN9A 4R7DA 4QXUH 1ZV5A 2PYED 1X6LA 1EEQA 3TPKA 1JZ7A 4XP4L 4HS3B 4I9WD 2JLLA 4KVNH 2VQ1A 1QSED 4OGZA 3AAZB 2CIIB 5MP6L 5T1MB 3EHBD 1LNUA 5DVKA 4KPHL 1OL0A 5DSCB 5GS2D 2V9TA 2MFNA 2X89D 4QRPD 1I7TB 3X3GL 2UZXB 3QXAB 3MZGB 5DK0B 4Z95L 3OAZK 1BD2B 5CLTA 3ZHLA 3UMTA 1U6AH 4QYOB 5DC0A 4UDTA 3SDCD 2V7HA 2FR4A 2DQCL 2XXCB 2FHBA 1U8IB 3NIFF 4PJ8B 2XKNB 1WC7B 1Q9WB 2NY4B 3G6DL 1Z0MA 5FYJL 3ZDZE 4PJHF 3V4VL 3ZT7A 4G80B 2AK1L 3H0TB 4HKBA 3S96A 4PJEF 1BOGA 1LO0L 4RGOL 1KJVA 4J3OC 1DQDH 4BK5A 2Z31A 5DQ9B 2WWMD 1I8IB 1CFTA 1AO7B 1NFDE 4PJBA 3D9AL 2ZUQC 5A2LH 5C09A 5JW4R 2H6PB 3BPLC 3DIFB 5ADOL 4MQXC 2P4AB 3L5WA 4PJ7F 1T83C 3KLHC 4JPIA 1GAFL 4J8RA 4WTZA 3OGOE 4GMTL 5C3LD 1GHFH 5D1QD 3MJ8B 3EGSB 1MH5B 5BRZB 1CS6A 4Y8DC 1YNLL 4NHCH 4K7PX 3R06B 1NL0H 4X0KB 2XZAL 5EZJB 1OF2B 5HD8C 3BGFC 5M7QA 3UAJD 5BCAA 4JE4B 3FB8A 1X5AA 2VO5A 3TA3D 2A1WL 4Y19E 1YEFH 4AQOA 5ERWA 3VGEA 3SE4A 4FXKB 2P43B 1HNGA 2A2QT 4DN4L 3U7WL 1CCZA 4H20L 1XAUA 3DHJA 1YYLL 3CDCA 4KDTC 4PJAF 1WAAA 4XH2B 5DK0A 5C0RH 5KVEL 1BD2A 4E42B 4OF6A 2X44D 4RGNB 4UT7H 5F7YC 2GEEA 4R90H 3FFDB 1RUAH 4MAUH 4WEBH 3S3SA 1PG7W 3ARBB 3P30L 3VG0L 4M8VA 3LV3A 5EZLA 1LO4L 3QQ9D 5F1SA 3GKZA 2HVJB 2R2CA 3F6LA 1INDL 2F19L 3DX8B 4LGPB 5D7KE 4MMZC 2O5XH 1WC7A 4KXZI 5I74C 2J12B 3WFDH 1DLHB 4G80A 2R0LH 4Z5RB 4PLKC 1FC2D 2F8VA 3G6AB 3MRHA 4PJEE 3QQ3A 4Y0GA 3W11D 1X5XA 2X1XR 2YMXL 2VRAA 3LS5L 4G7YL 4DEPB 5CILH 2OL3H 3KVQA 1UYWH 1J05B 2KDGA 3BKJL 2C1PB 3CVIH 4RMRA 4Y16C 4X4XA 1JWSA 3U0WH 5F3BA 4YO0A 3ARZA 4WUUD 3TO4D 4PJ7E 1QLEL 3GBLA 4PLOB 1CICC 4O2EA 2IBBA 3DUHA 3MJ8A 3EGSA 4TRPL 3MROB 1MH5A 2IQ9L 4G9FE 2CR6A 5T1DL 3VXRD 4UBDC 2B1HH 1FZJB 5DTFB 1LO2H 1MVUA 2DQHL 5EZJA 1OF2A 2YBRA 3E2HC 3SGEH 5C08D 5E2TH 4XPBL 3EFDL 1MCJA 1MREL 4APQC 1T03H 3MRNA 4XPAH 1NMAL 1EA9C 2V2TB 3QPXH 4FXKA 2FEDC 4KK9C 1ZSDB 2R0KH 3AGVA 2OL3B 3N9GL 4OTXL 4XX1G 3BSZL 1G9NC 5IHLB 2H1PH 3K74B 2VLKA 4PJAE 5DJYB 1B88A 1SJEA 5CJQL 1ITCA 3ARBA 1G9MC 5JPMB 3NABL 4HUKB 4B0MM 5DF0A 3RJQB 3JXAA 4NZUL 2R29L 5K9KA 3K1DA 5EC1A 2P45B 1AI1H 5T5FL 2HVJA 4GH7B 5BZWB 1G7PB 3FO0L 2EICA 2X1OA 2NTFA 5I1LA 3OJDA 2DQEL 1RJZA 4R0LA 1DLHA 1HI6A 3CPLB 2JJVA 3MLVH 4RIRB 4PJIF 2HKFL 1T20B 5SWSA 4YDJA 1A7QH 2FYYA 3MO1A 3AREC 3CFEA 4M7KL 1U91B 4XCEB 1U93B 3VFRB 3NFSH 3G5XA 3UTSB 4XVSH 5EO9B 3LHPL 1C08B 1G0YR 4P2QB 3BN9C 1KT2B 4M43L 5CP7A 2MCG1 2YS4A 4LSRL 1Q0XL 4L5FH 4NJ9H 1DEDA 3ZE2E 4W6YB 2Y06L 5J4MA 3Q3GB 4OF0A 5JMOC 3GBNL 2D7TH 4U2YA 4BZYA 4Y4FD 4ZXBD 4IOFC 1KENH 4IRSC 3TBTA 2Y7QA 4YHZH 3PL6C 5JNYA 2VLLB 3QUZD 2FEEI 4HF5H 1C12A 4M61B 3MNWA 4KY1L 5H8DA 5E6IA 1CDUA 5KSAC 1FRGL 5DHYB 3MV7B 5DXWA 2XZCH 1FZKB 2W60B 5HHQA 2W38A 2NXZC 1X5LA 2OL3A 5J3HD 4KQ4H 1Y0LB 1J18A 2WP3O 2VIRB 4PRHA 1EAPB 4OCSH 3R0NA 4GS7B 2QHLA 3UJTL 5JPMA 3MRCB 5E2UH 4U6VL 5EU4B 3EOAA 3KPRA 1CFSA 4EN3C 4YHML 1U3YA 4NNPL 5D72L 4JZJA 1OM3H 4F7EB 4QHKI 1CE6A 1UM5H 4RFOH 5FCUL 4Z78A 3PHQA 2O5ZL 3HLAA 5ALCH 3ZKXC 1R5VA 4UI2A 4UU9A 1JWUB 5C0GB 4XCEA 1U93A 2VXSL 3QDAA 3VFRA 3C6SA 3BKCL 5C8JB 1UCBL 3ILQC 4HT1H 4EBQL 3I3BA 2VZOA 2HT4D 4PJDA 1QNZL 1X6NA 5BV7B 4EVNB 5DZOA 2WMPA 3O9WB 4JPVH 5DHVH 3PWJB 2DWDA 1I9IL 5FB8A 3CFDA 1RI8A 4MNQD 4GG6B 2AERT 3GO1H 1AHWA 2NY2C 1MQ8A 1CFNB 4EOWH 5IHBA 3VXMA 1XH3B 2G5RA 1CFVL 5DEFA 3WS6C 4L4VD 1WBZB 2RCSH 2VLLA 3FJTA 4JKPH 2WNGA 2ZKHL 5EOCH 1CTNA 1F8TH 4K8RH 5BVJB 5HI5D 3UZVB 4R9HA 1MF2H 3ZMRA 5IIEB 4WFGD 4H8WH 1FZKA 5DHXB 3ORJA 4KRLB 1HH9A 1Y0LA 3VFPB 5D2LA 5B4MC 4LCCB 4ODBD 4ODWA 4NKOA 5DUBB 1CK0L 1EAPA 4MS8C 2R2HB 2R4SL 1I3RB 2WWKT 3AB0C 5ICZB 3MRCA 1F4WH 4M6MH 4LVNB 3SE3C 5BS0E 1N7ML 2FEEL 3LQAC 3PABA 5LAXA 4H5SA 3R4DA 2XPGB 4HJGB 3IXAB 43C9A 1TMCB 5ADPL 2Y23A 3HR5B 1QYGL 5T5NF 5EWIH 3JV4A 4LRNL 4GRLD 4DGVL 5C6PB 4Z7UE 1NGWA 3H3PL 4U6TA 5DD1L 3G6JB 4QXGH 1IKNC 4JFOB 4U2ZA 4QF1B 3RKPA 1T2QH 2IJ0C 3F7PC 1LEIA 3VXTB 5T1KD 1ORSB 3BUTA 1FL5B 3GMNB 3HC4H 1FGVH 5F7DA 5IQ7L 1MPAH 2GI7A 1FFNB 4L4TE 1RMFL 4JFZL 4WI3A 4U6XB 4P3CH 1XH3A 1FAIL 1HSBA 3FT2B 3UCRA 1I1YB 1R6VA 4LCWB 1RIUL 3MRQB 3UXFA 1LP9B 2HTLD 3IJHB 4N5UA 3PDDA 5ALBL 4IHOB 3QG7L 2BY3A 5E2WL 1OP3H 1FIEA 3V6OC 3WHE1 2JJSA 1KG0B 4PB0H 1EEZB 5C0AE 1UQSB 1WV7T 1XR9A 2NX5B 4UOW0 2DLIA 1AP2B 3VFPA 3MBXL 4O9HL 1NBQA 3KXFB 1A1OB 4JEGB 5DUBA 5DHVA 1FSKB 5JLZB 3SBWA 2I9TA 4ZS7H 1I3RA 3TGXA 5ELIA 4PRPA 2DBLL 1BAFL 4I0PC 4P9ML 1E28B 3DXAA 1JRHH 3S88L 2VXTL 3Q5TA 2ARJA 1MI5B 2H9GB 3QIWB 3CFBB 4N8CL 4HJGA 4P9HH 2DMBA 3O6KH 1N5AB 1RK1B 2MTPA 5GZNC 4JGJA 32C2A 5IFJB 4PLNC 1GGIH 5D5ME 3KYMA 5IB5A 4NO2B 1ES0A 3G6JA 2HJFB 3RY6C 4QF1A 4C59B 3WFCH 1EERB 3EO9L 2PETA 1T3FB 1U8HB 4ZO8A 2J3SA 3QI9D 4D0BA 4HCRH 3TBSA 3GMNA 4F7TB 3HZKA 3QCTH 1XF2B 1FFNA 4DGYH 1WCQA 2N1KA 3UYRL 4R2GC 3V6BR 2RB8A 5CJ5A 2VDLH 1MFAH 3O45B 3MCKB 5DA0B 1P84J 2FSEB 5FKAB 1PYWA 2VLRE 4JFXA 3REVA 4H1LH 4X9BA 1XGUB 3K8KA 1DDHA 3ARTA 2AJZB 4JRYE 1E4JA 1MCIA 2YR3A 3BWAA 2NY3C 2DKSA 3EDKA 1N6UA 1AJ7H 4NQSB 4IMLB 1HXMA 2P8LB 4W6WB 3WLBA 1UQSA 2LU4A 4NYLB 4KKCC 1AP2A 1EHLL 3E1F1 4JFQB 1OTTD 2DI9A 4Z7WF 4TVPH 3REWA 1OQXA 4XPGL 3IAGC 5F7LB 3EYOB 1YJDC 1L6XA 3RWDA 4XMLL 3WNOA 1REIA 4K55A 3SY0B 5JW4N 4AMKL 1J1PH 4N5ED 4JZOB 2LAAA 1ZA6A 3QIWA 3C60C 4CL7A 4JDZB 3VXUD 1N5AA 1RK1A 4XNZC 5CINH 5DJ6A 4X4ME 5F89B 4HEME 2VUYA 4LRIA 3WL9A 3ZKND 1YMME 2ZCLL 4OZIB 3RZCD 4KFZC 4P5KB 1WFOA 4FRWA 2O5YH 4RCAA 4NO2A 4JREC 1Q9LB 3X3FH 3QDGB 3C6LA 5K9JL 1FC1A 2JKXA 5DFVC 1KELL 4RRPA 2ITDB 3I6GB 4KAQL 1T66D 3D3VE 3BOVA 5IBLC 4F9LC 3OWEA 3V95A 4PJ5E 1M4KA 3T0DA 2K7PA 4C4KO 5LGJB 3VFVB 3L1OH 1YC7A 4I2XE 1OAQH 4BSWA 4KUCD 2ZUSA 5ICYA 1PEZA 4N0FA 2MQ0A 3O6FC 4LVHC 2P42B 3ZE0F 1XGUA 4FQLL 5JXEA 1JTOA 2BVPA 2HJKB 4HWZB 4YGVA 1A7NL 5KG9A 2EDQA 3OKOA 3ULUE 1IC4H 1I9EA 1Q94A 3PG2A 1D9KC 1T89C 1SY6H 2CDFA 3BGMB 1ZLWH 2BFVH 4D94A 4RMWA 2YD6A 2HA1A 4G43B 1H3UA 1U8OB 2VUOA 4V2CB 3K3QA 1NLDL 3P9MA 1ZLUH 4WV1C 1E27B 1MIEL 3W0WB 1JGUH 1JIBA 2HT2C 4YE4L 4Z7WE 3QWQB 4PRHD 4U1NB 3HZVA 3RY4A 1I1RA 3EYOA 4KH2A 4QHKJ 4LOUD 3H42L 2P5EB 2Q86B 5FECB 5IEKA 1I1CA 4JZOA 4D3CH 5HGDA 5GS1A 5IT2H 3ARFA 4JDZA 4H1LA 3HUJA 4OZHE 4ZSOA 2XTJD 2JIXD 4X7SL 5F89A 1NGZA 5JW3L 4OZGF 3ULUC 2Z4QA 4H88H 3L6FA 3TCXA 2B5IC 1LK3L 2ERJB 5DI8B 2VKXA 4NN7B 1UZ8A 4NJAL 3EO1B 1I75A 1OAZH 1A3RH 1OP5K 1RUPL 2ICWA 5E70A 4MA7H 1T1YA 2YRLA 4BFIA 3NH7L 3I50L 4LEOB 3RGVC 5EZOH 3O4OB 4YEEA 5E4EC 2QR0B 3MXWL 4Q9QH 5LGJA 2GUOA 5I8CB 1EJ6A 2P8PB 5C07E 4XT1C 4M6NH 2PYEB 5C0DB 3DUSB 3D85D 3QXTA 4XNQA 3SGKC 1YEDB 3WD5L 1NBYA 5E08L 5GRUL 5AD0A 4XPHH 5IVNA 4LHQB 3ZE0E 2AKRB 3ARRA 3EYFA 1S9KC 5IV2B 4OQTL 4UTBL 1JHKH 4S1RL 3OG6B 5GRJH 1UJ3B 4PY7A 1J0KA 4PP2B 5HGHA 3MOAH 5CWSB 1EPFA 4QRPB 3MODH 3OAUH 5EOTA 4HS6B 4PJ9C 1SEQH 4GFTB 5M94B 1IGCH 1UA6L 5KJRH 5B21A 4MLSA 1A4KB 2YPLE 1R3LB 3SDCB 4OLUL 3CUPA 3UC0L 3LEYH 1NGYB 4KJWD 4OGYH 3PWPE 4G6AC 3I2CL 3RVWD 1A6AA 3ARGC 1N59B 1ZHBB 1Q9OB 1RAMA 5KANI 1GL4B 2AK4B 1AR2A 1SY6A 5H37H 3H2WA 4OZGE 1MCHA 1MFCL 1K6QL 4WHTB 5CD5D 1RUML 3IETB 4WU5B 3S35H 3CK0L 2AV7B 4WWKA 1KIUA 1C1EL 4RFEB 4XVJH 3LN5B 2XQYG 5DD5H 3FCTB 2X4PA 4MLIA 1JP5A 4YIQA 2W0PA 3VFSB 5J1TC 1Q0YH 1G7IB 4NRZB 2VZUA 2H2SC 3JWOC 3DUSA 4Z0BL 3WN5B 1HHIA 5D1QB 3AM8A 3S5LB 3U36B 2VDPL 1E4WH 4G8FB 5MHSE 4H25B 4JFEE 3ZTJH 4WJ5B 2D0GA 4GOSA 2AKRA 3NZHH 2IAMD 2VDOL 3HZMB 3UPRB 2HFGL 5C1MB 4F7CB 5IV2A 1F3JB 4RAVB 3TA3B 3RY5A 5DLML 4XBEL 1DBMH 1MJUH 4CMHB 4ZTOH 2D2OA 5GGVH 5KAQG 3RPKA 3VFOA 3T0EE 5CMAB 4FG6C 4ZQKA 4OGXH 2J2ZA 5E99H 4K2UH 3UTQB 1NPUA 1RSFA 2DI7A 5EIIA 4HFUL 4YGAB 3G5ZA 3OMZA 4KKLD 2BXYA 3P4OB 4YHLL 4ODHH 4XC1L 4LK4A 3GI8H 4UILL 35C8L 3MMEA 4FQ1H 4MNGE 4NFBA 4LSUH 5GS3A 5HHVH 3ULVF 4X4ZA 1Y6MR 1Q9OA 4CMMA 1VERA 3GSXB 5E56A 2AK4A 4WW2B 2OI9B 3BP5B 3W82A 3TO2A 4K8RD 4JO2L 2DIBA 4QLRA 3IETA 4WU5A 1WT5A 2FIKA 4FFZL 2VLJE 4DAGL 2BY1A 2DICA 3HR6A 1AGBA 4JY5H 4RFEA 3T0EC 3LN5A 5DJAA 5GSRB 2OQJB 5KSBA 4NC1E 3OL2A 3MBEA 1ED3A 4LLDB 5K9OB 3B2VL 3JUYA 3ZKSD 4BELD 2W0FB 2AS5M 4XP4H 1A2YB 5TJWK 3S5LA 1FNEB 3G08A 3KHQA 4H25A 4RMTA 3RRQA 1VEOA 1KCRL 1G6RL 5F70A 4PIRF 2R39A 3UPRA 4ERSL 2YRZA 4RAVA 5MP6H 4JY4A 3QJHB 5AWNL 4KPHH 1ADQA 3IU3A 4WFHE 3X3GH 1SEBB 4Z95H 2I25N 3BP7B 2PO6C 4L3EA 4ZOBA 1NCWL 2EXWD 3QQ4B 2FCBA 1ZHKA 3RIAK 3GGWA 4PJCE 1ZE3C 3BXNB 1MCQA 1XCQB 2RAMA 1T1XB 5MEPB 2DQCH 3KHOA 5GRWA 5JOPE 1OSZA 3QUKA 3G6DH 3P4NB 5FYJH 3V4VH 3LPGA 2OP4L 2AK1H 4GXUM 5DVOA 3ULVE 4Y5YC 5I1AB 3BP5A 4RGOH 1LO0H 1F58L 3U0TB 3ULUL 1JUFB 3ALWA 4LLWA 2YRPA 3CZFB 3PQYE 4MAYB 3RX5A 1RJLA 2ZSVA 3D9AH 3ZDXF 5D6DC 2WIIB 5EU3B 2IANE 5ADOH 3JWDC 1EBPA 3P73B 1GAFH 2HTKC 4EQ3A 1KTLB 4GMTH 2YHGA 1T7VA 5E5RB 1A2YA 1YMHA 1A3QA 4Y4KB 1FNEA 1YNLH 4MZ3A 3GMLA 2XZAH 1A6ZA 5TF0A 1JMZA 1PJ9A 4OAWB 3QUZB 4MX7B 1A14L 4NZDA 4PGDB 5C9KA 2X4QB 3RL2B 2CLZA 2A1WH 3QJHA 1IC7L 2XXMB 1KIRA 3T65B 1SMOA 3B9KC 4DN4H 3U7WH 1PAMA 4H20H 5IVZB 4OCWL 1YYLH 5KVEH 4ZOCA 3BP7A 4N0UA 1UH3A 3QQ4A 4OCYL 3MLUL 5CSZB 3AY4C 3P30H 5C0CD 3VG0H 4IIQC 2O61B 1LO4H 2AJVL 2A9NL 3BYTA 1T1XA 3K2UL 1EXUA 4WGWB 4P46A 2X4TB 4BYHA 1INDH 2F19H 1NEZB 3WV0A 1IGJB 4ZUUA 3LRSA 1D6EB 3BD5A 1OGTA 4GRWH 4XMKL 2KQMA 3KPOA 4L3CA 4IRJA 3BIKB 1MFEL 5J6GB 4FQ2L 3SDXB 3BW9A 2CK2A 3DROA 4M7LL 2YMXH 4RFNB 3LS5H 4G7YH 3TNNB 3CZFA 4MAYA 4KTEL 4P3DB 5E1AB 5LCVL 4OI7A 4CVXB 5FA4B 3VW3L 3BKJH 4TVPD 4FQXC 3QUXA 4L8SB 3P73A 2QKIA 1MHHB 5EB9A 4E0RA 1PX3A 1QLEH 3W5MA 3PGDA 2F5BL 4TRPH 3RDTA 2ZUUA 2IQ9H 3QB7C 5T1DH 4X8XA 5GJTL 2AEWA 4L4VB 1UWGL 4ODTL 2DQHH 4PGDA 4CN4A 4ODUA 2HJLA 4XPBH 2Q6WA 3EFDH 3HE6A 1MREH 3V5KA 4KZDL 1NMAH 4HLZH 4IBLT 4LLVA 2X4OA 3DVGB 3N9GH 4OTXH 3P0YL 3BSZH 4MGXA 1NUFA 4KWUA 4HUXB 2B4CC 4ZOEA 5SWQA 3N1GC 1R3IL 5IB3A 1FFPA 1NAML 5C92A 5CJQH 1JGEB 1EFXA 4QT5B 1AXTL 2ZWLT 3NABH 4Y4HA 3UYPA 4J3XA 4NZUH 2R29H 2C4XA 1VPOL 1I1AB 3KPPA 5T5FH 4YNYA 3HC3L 2EE2A 3K1KC 3HPLA 3ARDD 3FO0H 5IWLA 2R0ZL 2DQEH 3OPZL 5FOBB 4Y1AE 5HYQB 2Y4SA 2HKFH 1YN7B 1CD8A 1U9KA 4GRLB 3BPOC 2P8MA 2BOBA 4M7KH 1LE9A 4Y2DD 5TDOA 5EFIB 4BSJA 1TVDA 3L7EA 1T6WA 4JO1L 3LHPH 1U3HA 5HHPA 4GT7A 4KTYA 4M43H 4XHJC 1NDGB 3RZWA 2V5MA 1Q0XH 4LSRH 3VGDA 4UOW1 5B8CC 2Y06H 3GKWL 3GBNH 1I1FB 4MQ7B 1IGYA 2YEZB 4PUBL 3HS0B 5F7WC 3OKNB 1MRDL 4HGKC 2V2XA 1XEDA 5GRYA 2IH3A 2LE9A 3MCG1 1DQLL 5FO8B 4KY1H 1VFAA 3QFDB 5ACMA 5F1OB 3MGOB 1FRGH 3KLAB 2HG5B 4HUNB 1XR8A 5DQJB 1F11B 3HMXL 3KJ4C 3QG6B 1QFHA 1DZBA 4LDOB 1NEZG 3WSQL 1YQVL 2PXYC 2BC4A 1TITA 4EZMA 1IGTB 2GJZB 4KGLA 3F7YA 3UJTH 5IHUL 1PZ5A 3M07A 3MUJA 4M7ZC 4UQ2B 4U6VH 1FHGA 5IVXB 5KZCD 1I1AA 4YHMH 3O8XC 5DJXB 4NNPH 5D72H 2W9LA 3MLZL 3SDAD 5FCUH 3T1FB 3PJSB 1G7LA 5KS9B 1FFOA 4KK6D 2O5ZH 2IC2A 5BO1L 4H0IA 5EZIL 3VXNB 3FQWA 5TF1L 1GZPB 2Y9RT 1TFHA 2VXSH 3BKCH 1UCBH 4F7PB 4M1CD 4EBQH 3EYUL 1EEYB 4PJFF 2AGJL 3M45A 1QNZH 4J3VA 1N6QL 5J56B 1TZHA 3B43A 3IDYC 1S3KL 2VWEE 3VXOB 2NQCA 2ORBL 1I9IH 3PV6A 2KZ1B 1VEMA 2BNRD 5C2UB 3AU1A 1HKFA 3ZKMD 2DKMA 4WEUD 5CCKL 2ENYA 4QHUA 2YEZA 5DK2B 3SO5A 5L9DL 2X5PA 4Z7VB 5FA3B 1JWMA 5FM5O 1CFVH 3B6SB 1PKQE 4HHAA 5D2NA 2C3VB 3FL7A 4F3FA 4A6YL 2H32H 2ZKHH 3DGGB 5DVNA 1CGXA 4F15B 3EW3B 5FO8A 3F65A 4FNLL 3QFDA 3MXVL 1MCEA 4OV6F 5JIIA 4TSCL 4YBLB 3ULVL 2NPLX 2ICEB 5DFWH 1PZUB 2AXFB 4U1SB 4ZUTA 2RHEA 5FIEA 1CK0H 2ZOLA 1Y18B 2JK5B 2XWTA 4OM1L 4JM2A 4X5XA 4YC2C 1IGTA 4QRSB 2R4SH 1DUZB 3DMMA 1HCFX 1N7MH 4QRRB 3KPNB 3VFNB 5IVXA 1EHXA 1NKOA 1JTPA 2VISB 5DJXA 4FP8L 5EOQL 4HFWB 4OGAD 2BSRB 4BH8A 2NXYD 5ADPH 3VXUB 3RWJA 1XCTB 1MCCA 1QYGH 2H26A 4FXGB 5IM7A 4R7NB 1BVKA 4LRNH 1SYVB 3VXNA 4DGVH 1HOCA 4R96B 1GZPA 3OKKA 4JHBA 2HMIC 8FABB 1KNOA 4K9EL 2Q3ZA 5IJVB 4F7PA 3H3PH 3BKYL 4EI6B 1EEYA 5DD1H 2N56A 5CIPH 3OKEB 3QAZC 4PJFE 5K9QI 1BM3L 3BP6B 5I8KL 4KKBD 3PP3K 2EDDA 4UMGA 3L3OB 5J1AB 4JQXA 1FL3A 4X5LA 3C5ZA 1V5JA 3NPSB 3SO3C 5IQ7H 3JTSB 4NDMB 1FYTD 1RMFH 2YC1A 2NY6D 2JJWA 3AXLB 3ES6A 4JFZH 4Z7VA 4KU1A 5FA3A 3TBVB 3OTTA 3W9DB 1PG7L 3DVIA 4AY0A 1PG7X 5TFSL 1FAIH 2C3VA 5IMLA 3DGGA 4LLYA 1RIUH 3T4AB 4I3SL 3BJLA 5ALBH 3QG7H 1JYWA 3OXSA 5E2WH 3BD3A 4HKJA 5FHBL 4D0CA 5CZKA 3CX5J 3RVXC 3O6ML 4UOJA 4HV8A 4FHBD 2VN7A 4U0RB 4XP1L 1ORQB 3MBXH 4O9HH 4OLYL 4WU7A 2Q1EA 4LGRB 1Y18A 2JK5A 4XBGB 2AXGA 3L3JA 1B0RA 2H2PD 2C9AA 2HP4A 1AGDB 3LQMA 3IGAA 3D0LB 3Q5OA 4R97C 2DBLH 3MRJB 5HHNA 4JFPB 1BAFH 3SKUD 2OR8A 4QRRA 3GMRA 3KPNA 4JHZA 3VFNA 4P9MH 3S88H 4P2OC 1KBGL 3L3GA 4LASL 2VXTH 3BN3B 5DDHA 4N8CH 4M8QB 4FA8A 5HY9B 5IR1B 1I8LC 2D9CA 3AC0A 3LPFA 2H32A 3ZHDA 4P59L 1XCTA 2XTJB 5HPMB 2JIXB 5HYIA 2PCPB 4ETYA 2J8OA 3C9NB 5FK9B 4QCIA 1MCRA 3U7YL 4PJHB 2G2RB 3C09B 4X6BB 3UTTE 3BO8B 3OKEA 3FO2A 3G5VB 3O2WL 4PRIE 2MQ3A 3EO9H 4R4NC 3FAWA 4Q97A 1NFDA 3QEQD 3BP6A 4GKNB 3AS1A 2DS4A 4J7RA 4NDMA 1EZVX 3UYRH 5GHWL 2Z35A 4PJ7B 2W0LA 5IROA 3W9DA 4AH2B 4F7MB 3FQUB 5D7IF 3RDTD 4YHIB 1QEWB 3L95B 2EKSB 3GJFH 2R2BA 2DAVA 5A2FA 2GTZA 5I1EL 3QFJD 2Z0BA 4AYFA 1DN0B 4OZ4A 5EBMB 4BH7B 2MQCA 1E4XI 1WQVT 4MWFB 1ZS8B 2VDRL 3PGCA 1MCKA 5CIPA 4Y19A 1AKJD 4NRYA 1QFWI 3RVVD 1EHLH 2DWEA 1HQ4A 4XBGA 1ZT7B 3BP4B 4NQDE 4IM8A 4DKFL 4FS0A 4XPGH 1FZOB 3JV5A 4PJAB 2YD8A 3D0LA 3MRJA 4XMLH 3NIDF 4QOKE 4AMKH 4U4BA 2DF3A 3OX8B 3RTQB 1JPGA 1IL1B 2C3XA 2PCPA 5CLWA 5HVHB 4LSPL 5IQ9B 2G75B 3RHWF 2ZCLH 1WEJL 3ARYA 1KYOJ 3MRDB 5C3TA 3MNZB 2EYTA 3ALPA 5K9JH 4PJEA 3SKMB 3ROLA 5HHXL 4P4KC 1KELH 4KAQH 1U2HA 1U3HD 2XN9D 1YEEL 2QLVB 1A47A 5GS0L 1T22B 3SDDC 1YPZF 2W65B 5A43C 5C2BL 4DUWA 4PJ7A 3PWLB 4LPXA 4YXHL 3MTRA 2XA8L 5DEGA 3QO1B 4YHIA 4G9FA 4W4OA 4FQLH 1T21A 4G8GE 4S1DD 4DCQA 2QSCL 1P1ZA 1NBZB 3KDMB 1A7NH 5EBMA 3I6LE 1PY4A 4U1HB 3HPJA 4KJQC 3CFCL 4FMFA 4Q6IA 4RQQA 1FFQA 3WEXB 3QXDB 1WF5A 4F33A 4JO3L 1NLDH 2FD6L 3FQXB 3VWJC 4LHUD 1MIEH 2CDGB 5BXFB 2CLVB 5M95B 1TDQA 2F74B 4YE4H 1H3GA 3WNPA 1U8KB 4C57C 2IBGA 4PJAA 1WBXA 1AR1D 4UDUB 4AEIH 4JN2A 3H42H 1FAKT 5J0BA 3OR6B 4Y5XC 3NIDE 3OG4B 3GSRB 1Z3GL 1FNSL 5IJKC 3RTQA 3S36X 3S34L 1B6DA 4X7SH 3GJFA 2P24B 3WHXB 3MRKB 2FZ3A 4GUPA 2G75A 5JW3H 1QFWL 5J13B 3N1FC 1OTUC 5HHME 5L2KD 3DGCR 3BZFB 1LK3H 4PJIB 3IKCA 1UCTA 3SKMA 4KHXL 4NWUL 4NJAH 5MI0C 3FOMB 4RNRA 3OKDB 5HYJD 1A3LL 2VXVL 5ETUA 2CUIA 4D2NA 1RUPH 1V8HA 4CJ0A 1RZKC 3NH7H 1CG9A 5D1XB 3CC5B 3I50H 5JORB 4BQ8A 4U1MB 3MXWH 3DTXA 4AM0B 3FFCD 3HI6L 4L29A 2V5YA 4GBXD 1IEAA 1RURL 5F7EL 5TE6L 3WD5H 5E08H 3CIQA 1KXTB 1MFNA 4Y5VC 2NR6C 2JB6B 1DQJA 1NBZA 4KROC 1CXEA 3DVFA 3QDJE 2EIEA 5DJ2A 3G5YB 3MLTB 1MOEA 4OQTH 3ZT5A 2BVYA 1FORL 4UTBH 4S1RH 4M9OA 2L7UA 3U6RB 3KPQA 3OKMA 3FB6B 3X12B 4LNRB 1MAJA 4I13B 5JA8B 4JDVB 4L8BA 4N8PA 4ZUVB 5BXFA 4U1GC 3A6OA 2F74A 3GJEA 5F7FA 4MCYA 1GIGL 3IFPB 4CNIA 2X42A 5I15L 5GISL 1N6VA 3CU7A 4X6DF 1UA6H 1P4LA 2P5WE 3LB6C 1T0NB 4KVCL 3IJSB 4OLUH 4OZFB 3UC0H 3GSRA 2VKWA 4A2MA 2A6DA 3O3BA 5HI3C 3WS6A 3I2CH 3SPVA 4YHNB 4R4BB 2Y72A 1TXKA 1F90L 4NUJA 3TT1L 1WZLA 1MFCH 1S8DB 2PF6A 2F8OA 1MFBL 1K6QH 2PW1A 4LKXB 5L88L 1RUMH 3EKCA 4Y2OA 2D4FA 3FOMA 3CK0H 2HN7A 1QLRB 1C1EH 4PRAA 3L3KB 3RUGF 3MR9B 4PG2A 1M7IA 5D1XA 3BJ91 5DURB 4F37F 5CBEB 2BDNL 5L0QB 5F9WB 3MRLB 4RAUA 5JZ7C 4KRPC 1AQDA 5C0EA 3BZEA 3MACL 4YXLL 2DTML 3SE3A 4HH8A 1KJMA 4Z0BH 4FQPA 3QDME 2VDPH 1T7YA 5MENE 4ZDHB 4XCCL 2VDOH 3IJYB 2HFGH 1V7NL 3WFHB 2GSIA 3V7MA 4YBHA 3OB0K 5DLMH 5HDQL 3D6GA 1UWEL 4XBEH 5DJ0B 4LNRA 5I8OL 4DN3L 2IFFL 2E3VA 4PD4K 2Z31C 4GW5A 4S1QL 1YEGL 3GMPB 2IQAA 4GW1B 3I02B 4QNPF 5EBLB 5ID0A 5JPNA 4NQXA 3VG9B 5GIRA 4XP6L 4YDLC 1BZ7A 2XNAB 2E5EA 3CD4A 4MQXD 5C0CB 4HFUH 1QHPA 3IJSA 3KLHD 4I1NB 5BS0A 5IF0A 3C8KA 1RZIA 3BAEL 3C5JA 4YHLH 1U8PB 2J6EA 4XC1H 4UILH 3H3BC 35C8H 2HH0L 2E9IA 4YHNA 3ZKQD 1MRFL 4R4BA 3FO1B 4QEGA 4XVUC 1CDCA 3LDBB 5HYFA 1S8DA 3WLWC 1KGCD 5HD8D 5I1KL 5DS8B 1ZHLB 1R3HA 1XIWB 4BFBD 3CXHJ 1RZGA 4JO2H 4LQFL 3NZ8A 3EJJX 4FFZH 4FOMA 5D1ZB 4ZYKB 4B7LA 4DAGH 4X6CB 2JELL 4G6JL 3MNVB 2GCYB 3SE4C 3IDUA 1F3RB 3MJGX 4U1KB 2FBJL 1AO7E 9CGTA 1AFVL 3NCFB 5TH2A 3JSSA 1MCWW 4BQ6A 2CKBB 3B2VH 4L4TA 1HHGB 1DUYB 4TNWF 4LP5A 5DRXB 5J11B 3TBWB 1TVHA 2L7JA 5D7JB 3IS1X 4NC0B 4LLQA 2IFGA 4AENB 1KCRH 1G6RH 3IJYA 3KYOB 4ERSH 5BRZE 4TNVF 2NNAB 4PJ8C 2FJGB 2NY4C 2CRYA 1NC2B 4PLKD 5DJ0A 5AWNH 2FL5B 2X4NA 4CDGC 5C0AA 3ECBB 4X99A 4OZFG 5F8RC 1CL7L 3TN0A 2CRZA 2PTUA 4GRMA 1NCWH 1B0GB 3D1MC 3MUGB 1PSKL 2E6PA 1FG2B 5ABDE 2YPKB 3CH8A 5BQ7B 1S5IL 2XNAA 4QNPE 4Y16D 4RGNE 4JFFD 3KPMB 2R1WA 4FQHA 1DQTA 1CICD 5FGSA 5INDB 1M6OA 5AG8A 5IMOA 5D7KD 4UBDD 1A7BA 2BSSA 2OP4H 4NQVB 3FO1A 2GJ6D 3VE0B 4WNQB 5MEQA 1YMMB 3NPZB 1F58H 1LDPL 5D5MA 1ZHLA 3ULUH 4Y2DB 4APQD 3ZSTA 5D1ZA 4KZEL 5I30L 2CDEB 4MQTB 4EKXA 1UG9A 2FEDD 4KK9D 2BHZA 3PWVB 2WIMA 2NW3A 3MRGB 2CKBA 3QJFA 3IVKA 1N2RA 3QA3B 1KPVB 4RGNC 1IM9B 4MVBC 3O3DA 3ARBC 4KI5C 5AUMA 3TBWA 2IMMA 5D7JA 2V17L 4Q2ZB 1A14H 4PBXA 4G8IB 4JDTL 4TUJA 3TWCL 2Z92A 4JRYA 2NNAA 3TVMA 2E9BA 1IAIM 2AV1A 1HN1A 4R0LC 1IC7H 4OD1L 5E8DL 3ARED 4N0CC 2FL5A 4R6UA 2APBA 1ETZB 4KJYA 3O0RL 2ATPA 4OCWH 3W39A 2RFXB 1QFUL 4K23L 1MLCA 4E5XB 3HAEH 4OCYH 4TUOB 3IDNB 5FAAA 3MLUH 3BN9D 3ZDYE 4Z7WB 2YPKA 2FWOB 2AJVH 2VZSA 2A9NH 5T5NG 2A6JA 3K2UH 4WWID 3O3AA 5KZCB 1JF6A 1GPOL 2VQTA 5INDA 4AT6B 1JK8B 2EYSB 4IOFD 5JHLL 4XMKH 3SDAB 3J8F7 4IRSD 1G6RA 2NY1C 4NM8L 1MFEH 3ZE1F 3QULA 4FQ2H 1GVIA 3PL6D 3QNXB 1KTDB 1ACYL 1YMMA 5ACLA 4UQ3A 3EJZC 4M7LH 1A6VL 5E6IC 5KSAD 3KNBA 3MUHL 4KTEH 2CDEA 4POZC 5LCVH 4XNMB 4HKZA 4WV1A 3VW3H 2BSTA 3UPCA 3UTSE 3VA2C 2NXZD 1X7QA 3VGFA 3MRGA 3LKNA 1UC6A 2P49B 3DX9B 4P2QE 1N26A 5I73C 3FAXA 4HIJA 2F5BH 1HXYA 4GG6F 5C07B 4I2XA 4R26L 4C54A 3C8DA 2GKIA 5GJTH 1UWGH 1U8LB 4ODTH 3BVNB 5DMJB 4EN3D 4GAYA 5E2JA 4S10A 1WTLA 1H3XA 3ZYIA 2AQ3A 2FGWL 1LEKA 3V5HA 3LSOB 4FABL 3EOYG 3FRUB 4YDIL 3TIEB 2XRAL 3CDFA 1FV1A 4KZDH 3K0WA 2X4SB 4K3EL 3ILQD 3P0YH 3IDGA 3MV7E 5KANG 1GSMA 3EDDA 4EDXA 2E7LA 2RFXA 4E5XA 5C0IB 2XG4A 1IAKB 1P7QD 1S9YA 3U82B 1R3IH 4Z7WA 1NAMH 2P47B 5T1LD 3TZVA 1AXTH 2FWOA 3MRMB 4FQIL 1JJUA 5EDXA 3RU8L 5GJSL 1VPOH 5HDBF 1KV3A 2YPLB 5HPOA 3HC3H 2QADC 2NY2D 1AHWC 2GAZA 2R0ZH 4OZHA 5E0QA 5I1CL 2Q76A 3OPZH 4HBCL 3DURA 3RPIB 1X5HA 3BX7C 1S7RB 3ZE1E 3FRPG 5CGMA 5HI4C 5IKCA 4HWBA 4M9PA 2Y5TB 4JO1H 3MLYL 3WCYA 3DRTB 3GSNB 4NCC1 4K07A 3MUY1 5B4MD 1NAMB 4PJ9A 3GKWH 4MS8D 2CJUL 3L3HA 1I4FB 4HIHB 1FYTB 4PUBH 1WBYA 3DHMA 4MQSB 1MRDH 5C07A 3LS4L 4OI8A 4JRWA 1JNHA 4GG6E 3GSWB 1U8LA 2BHUA 5HYSB 4JFEB 3STLB 4OV5A 1DQLH 5E7BA 4NO5B 1TCRB 4K7FA 1LP9F 4DZ8A 3KYNA 3HMXH 3FONB 4MJID 5GRXG 3UO1L 3VFTA 4HULB 3ETBF 1ZWIB 4OFKA 3VFWB 3VH8A 4ISVA 3WSQH 1YQVH 5F7HA 2LABA 4POUB 3D48R 3DPBA 1NKRA 2UV3A 5IHUH 1NUGA 4MNHB 4XP9L 3RWHB 4P4RB 4KV5E 2ARWA 2YPLA 1WVZA 3ZSSA 4E41D 5DUML 2GHWB 4HIEA 3GSUA 3Q48A 3MLZH 1EUUA 2V5SA 4PRNB 5E9DE 3PWPA 4KKNA 5BO1H 3SGDI 5EZIH 1FN4B 5TF1H 3WUWA 3EYUH 1CBVL 2G9HA 4OZGA 5D93C 1N6QH 5GRVL 1QSFB 4JZNA 1S3KH 2JJSC 3MLXL 4N1HB 3RI5F 3QEQB 2ORBH 1NFIB 4ZUSB 1NAMA 1JHTA 1RK0B 5I17A 3FTGB 5CCKH 4ONHB 1JPST 1Q8MA 3K8LA 5L9DH 1JMXA 3SBWC 3F7RA 5CS7A 5FYLE 3IDMB 4I0PD 4N8VB 3L3IB 4LVNC 5FDWA 4A6YH 4JFEA 1U95A 3STLA 3LKSB 4FNLH 1RUQL 3O6LL 1LE5A 3QFJB 4Z9KB 2GTWA 1NCBL 1S9WB 3MXVH 5GZND 2IH1A 4TSCH 3ULVH 2VAAA 4G6KL 3BESR 4LCWE 4RZCA 4WO4B 1LP9E 2AJSL 4PGBA 5E00A 3HE7B 3GEWB 4M7JL 3I9GL 3MRIB 1AKJB 1ZWIA 3LKPB 4I18B 1RD6A 1FVDB 5JHDB 4YPGB 4H8WC 4HC1L 1CLZL 1IAOA 4OM1H 3T0EA 2NX5E 1VGKB 4MNHA 1I7UA 3RWHA 5IW6A 3KXFE 4WIQA 2BVOB 3PDOB 1K8IA 1ZHNA 5ESQA 3RBGA 1PDKA 3IS0X 4UV4L 3H9SD 3L7FB 4FP8H 5EOQH 2XACC 5CEZE 3NCCB 4R2GD 1IQWL 2B1AL 1UXWA 2LVEA 4MNGA 4P2CG 4ZNCD 4LCYB 5HHOE 1MI5E 2X1WL 2GYSA 2ZP0T 4K9EH 2HFFB 4M1GL 3BKYH 1G9EA 4OZIF 3HMXA 2NY3D 2APWA 4GW4A 1NDMA 4Z7OF 2C3WA 2Q7YB 3QIBA 2VLJA 1BM3H 5I8KH 3ARSA 1PX4A 4ZUSA 4KKCD 3E3QE 2XN9B 2WSKA 4I0CC 1CQKA 5HYSG 2FATL 1MUJB 1DJSA 1O7VA 2F5AL 1PG7H 4G9DA 3U9UA 4N8VA 5TFSH 4CDHA 1LO3L 1DSFL 4MB3A 3LKSA 3C60D 4I3SH 2VLRD 3QIWC 2PTTA 4QXWA 2ZG1A 5H94A 3V79C 3HE7A 3O6MH 3QEUA 2XOTA 3MV11 5E7FA 4XP1H 1BGXL 4OLYH 3SQOL 4LHUB 3F12A 2HAZA 5L2JB 1X5ZA 3C6LC 5DFVD 1VGKA 3B3IA 3V4UL 1N5YL 3U79A 4LSTL 4BUHA 4GXUN 4WEMB 3WE6A 5IBLD 3GSVB 1KBGH 1WZ1L 1MCLA 2CQVA 2AP2A 4OUUB 3SKJL 4LASH 2HLAB 1F4HA 5F9OL 3HN3A 3KG5A 4A6YA 4WHYG 1GCFA 4P59H 1ZGLB 5CHNB 4WI6A 1DLFL 3WNMA 4LCYA 4P9HC 3O6FD 4LU5L 5CEYB 3U7YH 5JXEC 5F96L 4UUJB 2E8YA 3ME0A 1UB5B 3BZ4B 2Q7YA 3O2WH 4XPTL 1D9KD 4TPRL 3RX7A 4OZIE 1S5HA 3QIUB 4GKZB 5EC2A 4Z7OE 3PQYA 2J1KA 5CJOL 5HYJB 3QDGE 3K46A 4LIQE 3S6CA 2OX5A 5I8EA 4NT6A 3D0VA 2IANA 4CJ1A 2HT2D 3HRZB 3D3VD 5FO7A 2DJ4A 5IMMB 3FFCB 5GHWH 4AJ0A 1GOGA 5I9QC 4PJ5D 1FCCA 1UGNA 1K4DB 4GBXB 1CGSL 2XFXB 2EDBA 1TVBB 2J4WL 4MXVF 1A7RL 5I1EH 4U3HA 5DRZB 3BH9B 2BOCB 5GS1C 4I48B 4V1DE 3ARFC 1I3GL 5EA0L 4PRBA 4YHPB 1OAKL 2VDRH 3ULUD 4ZFZA 2WK2A 1CTOA 1I8MA 4XC3L 4ORGA 5F3HB 4X80L 4DKFH 4OCMC 4LKCB 3FQRB 3E6FA 3VI3E 3IFOA 3W0WE 5BV7L 3TCLB 1J0JA 4ZNEE 3RGVD 3MPCA 4BQCA 4U7KA 3DBXB 2DD8L 4KUZL 1VADA 5E94A 5EORH 1TJHL 4G5ZL 5FEBA 2VITA 5CHNA 2P5EE 4LSPH 2X40A 5AZ2L 3TYFA 5KW9L 2IADA 4MDIB 1RJYB 2NMSA 1WEJH 4UUJA 3H3KA 3ELAT 3M8OL 2MJWA 2CGRL 1WCBB 2F15A 3BZ4A 1OPGL 3TV3L 5HHXH 4GKZA 1A6UL 4ZTPL 1IBGL 3O4LD 4NKDA 4PJGB 1YEEH 1BQHB 1JGLL 3MA7B 5GS0H 3C08L 3HRZA 4PJ9D 5C2BH 3LN4A 1U8NB 3RWIB 4YXHH 2Y6SC 2XA8H 1BLNB 4WFEE 3STZA 5I16A 2Z8VC 4LHUG 2QSCH 1P69B 2PYEE 2WQRA 2BOCA 4I48A 4G6AD 3MYJB 1QHOA 2MHAA 3ARGD 3CFCH 4G3YL 4I9WE 5D96C 5KTEL 4LPUA 1OP3K 5IOPB 3U0PB 1CD9B 4PTUA 3CFJB 4JO3H 1I7ZA 1MFDL 4G8EB 4Z7QF 2FD6H 3IAQA 4QGYA 4KI1A 1MAML 5EU6B 2ERJC 2B8OT 4NN7C 4M5ZL 1FZMA 1ZANL 3DVNB 5B39B 2OLDA 4QRPE 2ZUQB 4WWKC 4YHOL 3TCLA 1A1NB 5L8JB 3DV4A 2GW5A 3BPLB 2N4IA 5KN5A 4HIIB 1Z3GH 1FNSH 5DJDB 2H3NB 2H2SD 4X9HA 4EUPH 5FYLL 1JI2A 4LCIL 3S34H 4TSAL 2WBJA 2QV2A 1QFWH 3PWPD 2CD0A 3PNWB 1H0DB 1CGYA 1WCBA 3BGFB 2E9WA 2DLHA 1CFBA 4WW2F 4KHXH 4NWUH 1IZKA 4PGJA 1SVZA 1A3LH 4L8CB 3OZ9L 1WJ3A 2VXVH 3Q1SL 1F6AA 1T5WB 2OMBA 4EI5B 5AEAA 2ATKA 5FYKU 4O58L 1ROWA 4BFEA 3C2SA 3HI6H 4FG6D 4I77L 3RWIA 1CD1B 4FZ8L 4P57B 4D9LL 1X4ZA 1KPRB 3BUYA 1RURH 5DRWA 5F7EH 5TE6H 4IJ3B 2VABA 5CEZL 15C8L 4LARL 4FQJL 1G7MB 5C7XL 2ZG3A 2XICA 1DBKL 5I76B 5I74B 1FORH 3L3DB 5GGUA 5IOPA 5BZDB 2WQ8A 3SE8L 1FNGA 5EUOB 1KJ3L 2V5TA 4Z7QE 5EU6A 2IGFL 1GIGH 1WT5C 5GSVA 2DQFB 5I15H 3DVNA 5GISH 3T0ED 3GSQB 4TVSa 3IDXL 4J6RL 4Y16B 4KVCH 2VL5B 4AIOA 3IF1A 4JFFB 3MBEC 5CUSL 4PGEB 1HH6A 3GRWA 1S7WA 2W0KA 3P4LA 4P5TA 2EDWA 3U30C 4IOIB 5E5MB 2JCCB 1MHEA 2FRGP 4CU8A 1BQHG 2GJ6B 3PIQA 1F90H 3BKML 3BDYL 1RHHA 3TT1H 1G0DA 3WYRA 1MFBH 1VCAA 1BX2A 2X4RB 3SCMA 5L88H 4JVWA 5F7MC 2AJXL 2DMKA 1VACB 1T80A 4HEPG 2VLJD 4JKMA 4EI5A 3BPNC 4CMHC 2BDNH 2A9ML 2PNDA 2PO6D 3MACH 4YXLH 2DTMH 2FNBA 4NRXB 2CO6B 4OBRA 2IPUK 4EUPA 4HBQA 5E8OB 4WUUE 1PKQA 3BD4A 4CGTA 5IMKB 4XCCH 1YY9C 2KQNA 4U6YA 1V7NH 2J8UB 4J2XA 3AFLA 1LK2B 5BJTB 1KIQA 4G7VL 2I07B 1Z6JT 1AD9A 5B39G 5CP3A 5IB1A 1I9RL 1ZLWK 3B4NA 5HDQH 1UWEH 3PP4L 5I8OH 3AREB 2P46B 4DN3H 4NN5C 5C08E 3FT4B 2OI9C 2IFFH 4NSKB 1ZLUK 4H26A 4S1QH 1J8KA 1YEGH 4YHYB 2DQFA 3D39B 4LIQL 3GDBA 4L9LB 1RZ7L 1SBBA 4XP6