2HRVA

2a cysteine proteinase from human rhinovirus 2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
139
structure length
139
Chain Sequence
GPSDMYVHVGNLIYRNLHLFNSEMHESILVSYSSDLIIYRTNTVGDDYIPSCDCTQATYYCKHKNRYFPITVTSHDWYEIQESEYYPKHIQYNLLIGEGPCEPGDCGGKLLCKHGVIGIVTAGGDNHVAFIDLRHFHCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2A CYSTEINE PROTEINASE
publication title The structure of the 2A proteinase from a common cold virus: a proteinase responsible for the shut-off of host-cell protein synthesis.
pubmed doi rcsb
source organism Human rhinovirus 2
molecule tags Hydrolase
total genus 38
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00947 Pico_P2A Picornavirus core protein 2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hrvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hrvA01
1BMMH 2UUKB 2FYRA 2WINI 2H9TH 3SUDA 1V2LT 3EQ0H 1QQUA 3M61U 2XBXA 4XDEA 1UHBA 3K2UA 3H5CB 1C1OA 1ZMLA 3NUMA 1UHBB 1TBQH 2XWBI 1DOJA 2BD7A 1A3BH 3K9XB 2FOEA 4AFZA 3ZZ8A 1L0ZA 1J8AA 1EAXA 1UTJA 1GBTA 4YT7H 5HM2A 3SU5A 1RXPA 3OTJE 3BTEE 1DSTA 1BTXA 2A5IA 5BRRE 4GSOA 1WCZA 3RM0H 2HPQH 2BD5A 4ABDA 2QC2A 4XOJA 4D8NA 1DX5M 4MPUA 3STIA 4BAOB 1E38B 5I25A 1C4Y2 4F49A 3ZVFA 1HXEH 4X2WA 1HYLA 3V3MA 1BTWA 3PTBA 1CSOE 4X6NA 6CHAC 1QA0A 4RSPA 4Y71A 1N1LA 3SHAH 2BD9A 2A7JA 1IAUA 2PKSB 1KXDA 8LPRA 2BY5X 1B7XB 5EGMA 1IHSH 1JBUH 2H1UA 1X7AC 1NN6A 1C5PA 3FZDA 3K6YA 1P3EA 2GDEH 1AD8H 1CT2E 2BYAX 3BEUA 4NIWA 1ZRBA 3SU0A 4MTBA 1HAXB 2ZGHA 1FXYA 3T25A 4ISLA 4AB8A 2FDAA 4U01A 3MH5A 5JBCS 1YPMH 1GI7B 3TJUA 1WBGB 1F7ZA 1EPTA 1O5CB 1C5WB 5JYIA 5DP8A 2OQUA 1RS0A 7GCHG 5LPRA 3GCOA 1QR3E 2QV1A 1VJAU 4LZ4B 1OWEA 2P59A 4K3JA 1QTFA 5EPNA 4UFEH 3TGJE 3QN7A 3RUOA 1EZQA 3A83A 1IQFA 4HZHA 1YBWA 4O3UA 4AFUA 4HTCH 1Z8IB 5FX6A 3FZZA 1NZQH 3TITA 1QB6A 4X2VA 1OWIA 1ANCA 3SJOA 1EUFA 1P0SH 4K5ZA 2VU8E 2GZ8A 2F9NA 1BITA 4O3TA 1IQIA 2XW9A 1XUFA 2R2MB 2V3HH 1HFDA 1PFXC 3D65E 4A5TS 3T2NA 2FOFA 2HLCA 2CJIA 5ESTE 4FUEA 3MHWU 2O8UA 2ZCHP 2VIDA 1TRMA 5JB9S 4DY7B 4MPVA 1ELDE 4BXWA 6GCHF 2BQ6B 3U98H 5GIBA 5A0BA 3JZ2B 4Y7BA 4K60A 4NA7A 1JOUB 3SU2A 2HNTE 3RXQA 3ZZ3A 4A1TA 1THPB 3BIVH 2QXHA 3MNBA 4O97A 5E0JA 1OPHB 2ZU1A 1YP9A 1A0LA 2ALPA 2BDYA 3VGCC 4AG1A 1P2MA 3VXEH 2AMDA 2UWLA 3URDA 2FOBA 2QY0B 1GJ9B 3LDXH 3LGTA 1J15A 3G01A 2DE9A 3KGPA 1O2TA 1NRPH 4AYVB 4FVBA 1W0ZU 1MKXH 1DLEA 2PHBA 1LHDH 1F0SA 2HNTF 4JZDH 2TGAA 4WJG2 4MNVA 2OC1A 1DVAH 1KTSB 3RXTA 1HAYB 3SV2H 1O38A 4X1SU 2W3KA 1O35A 1OYQA 4NFEA 1BA8B 3A84A 1QB1A 1ESAA 1ID5H 8GCHG 1C5QA 3M3TA 6CHAB 4TY7A 2ALVA 1ELFA 2ZQ2A 4HGCA 1HJ9A 3A8CA 3SJKA 1HUTH 1Z8GA 1BMAA 5CHAC 2GT7A 1NRQH 1OP0A 1NFWA 3P8NA 1KTTB 1WAYB 3VFEA 3ZZ7A 5DP7A 3SNBA 1NU9A 4Q7YA 1O2IA 4NSVA 1AZZA 3ATKA 3UREA 1TALA 4ZKOU 1INCA 2SFAA 1H9HE 2XWAA 1G2MA 1BDAA 1ZSJA 2AFQB 1GMCG 3SNCA 1CT4E 1V2PT 1Z8JB 1KLIH 3UTUH 4K8BA 4INHA 1LPKB 1SGPE 1Q3XA 1GHWH 4A92A 2BHGA 1GMHF 1C1WH 1O2HA 1KXEA 1G3CA 5FCRA 1AVWA 1EATA 2KAIB 2EI6A 4CRCA 1GHVH 2FWWA 3GCTF 3H7TA 3AAVA 3ZVDA 1TA2A 5J4SA 2A32A 1C1MA 1QL9A 1T4VH 1YM0A 3GY8A 5GCHF 5TCCA 4AYYB 4B2CA 1DWEH 1PYTD 3D49H 1S81A 2YOLA 2XNIA 2FMJA 3M5NA 1G30B 1FIZA 4AZ2B 1PPHE 1LPZB 4X0WU 4UEHH 1YCPH 4KP0A 1DPOA 3RXLA 1DUAA 2WPIS 2YNAA 3L3TA 1F5LA 1GBMA 8ESTE 2FS8A 3UWJH 2ZPSA 3ODFA 2HGTH 3GCNA 1NTPA 3ZV8A 4DCDA 4GCHF 1BMLA 4ZHAA 2ZCKP 1P01A 1KY9A 3F1SB 5C5NA 1FMGA 3ZZ9A 2BD8A 2JETC 1P04A 2VGCC 3U8TH 3F6UH 4WH6A 4DT7B 2WPMS 3VGCB 4K69A 3IG6B 4CRFA 1WYKA 2BLQA 3QLPH 1RGQA 1LTOA 1BJVA 2G55A 3E0NB 1TGBA 1EASA 2FTLE 1MMJN 1XVMA 1V2MT 1Z8RA 3M35A 3PB1E 2G00A 1MZDA 2DUCA 3BTFE 2QAAA 3JZ1B 5F03A 3VB6A 1S83A 5C20A 3E8LA 1DLKB 4Q2KA 1K1JA 3ZZAA 1MQ6A 4B71A 3VEQB 1VITF 3TLOA 1P05A 2STAE 4YESB 1JRTA 1PPGE 2WUCA 4I8LA 2F9PA 4GUXA 3FP7E 1SGEE 2FTMA 1FY4A 1D4PB 1SGDE 1Y5UT 3SBKA 2WPHS 2NU0E 1KDQB 3MWIU 5CHAB 4WMEA 1A46H 1CBWC 1SHHB 2PW8H 2V3OH 4RN6A 4X1QU 4E7RG 1XUHA 3MFJA 2HALA 3UOUA 1XUIA 5C1UA 1GBIA 2XC5A 4BTIB 1UTQA 1FN8A 1ELEE 4WH8A 3MTYA 4CRDA 1BZXE 1HAZB 1MUEB 3MMGA 2RA3A 4NG9H 4UFDH 4AN7A 5EW1H 1TMBH 3BN9A 1WUNH 2SGAA 3LH1A 3O8BA 3OX7U 1ZTLA 3PMHB 1V2WT 3M36A 2JH6D 4GVUA 2J92A 2XBYA 4X8SH 1TNJA 2UWPA 3GYMA 4SGAE 2GGVB 2QXJA 1EAUA 2CXVA 1T8NA 1C1RA 3ELAH 1ZOMA 1GBJA 1EZXC 2BXTH 1NC6A 1GHAF 1W14U 1O2WA 4Y8XA 1RJXB 2QGRA 1TQ7B 1ABJH 1Z7KA 2BD3A 2W26A 5L2ZH 1THSH 2Z6BD 2BY7X 1AGJA 4ZKNU 1MTSA 1PJPA 2ZDNA 1SFQB 4NWLA 3C1KA 2B7DH 2BDGA 4D9RA 1BRCE 1HV7A 1DFPA 3MYWA 4TWWA 1XUGA 1BHXF 2AGGX 3RXPA 1QRZA 2ZQ1A 3P8OA 2BVXH 2ZFFH 1ZMJA 2QYIA 1SR5C 2H5CA 1DUEA 3P95A 3TH4H 1TNKA 3MU0A 3PLBA 4JZEH 3TK6A 1TX7A 1J17T 4IC5A 5F8TA 5JBAS 2IPHA 1AU8A 2ZGXH 4YM9A 1C5YB 2BOHB 1PQ5A 3GY6A 3M7TA 2K1QA 1UTOA 2CMYA 2R0LA 2BDHA 2BY6X 3E91A 1GBFA 2J94A 5HGGA 3NKKA 1ZTJA 1CHOG 2FM2A 2JETB 1LQDB 2XBWA 1SQOA 2GVFA 1ZPBA 1O2YA 2FLRH 1GVLA 1THRH 5HYOA 2FS9A 2GV7A 3K65B 1CGJE 3A7YA 2A7HA 3TNTA 5DO4H 1C5OH 2ZECA 1C5SA 3QUMP 4FUFA 1DITH 3LC3A 2A5KA 1A3EH 5C1YA 2BDCA 2BX4A 1SGQE 2ZFSA 2ZHFH 1FAKH 1NESE 3E3TA 1ZGVA 1SGCA 1O2UA 3RDZA 2WPJS 1A61H 1HAVA 3PMBB 1ANDA 1RTFB 3UNSA 5HMAA 1YC0A 1CGHA 3U69H 3RMLH 1BUIA 2ZHDA 1ZTKA 4B75A 2J95A 2GZ7A 2VH0A 5AVDA 1TRNA 1C1UH 1CBWB 2FIRH 4I31A 3F9FA 1HLTH 7LPRA 4CR9A 3LONA 2PUXB 2VIWA 1BRUP 1AFEH 1P2NA 1J14A 5EG4A 1F5RA 3ZV9A 4NGAH 4Y79A 1O32A 3ZYDA 4GPGA 1QFKH 3E16B 4BAKB 1E35B 1FZZA 3GICB 2HOBA 3HGPA 4KKDA 3BTWE 1EPTC 5DK1A 1Y3XA 3RU4E 3TH3H 1TFXA 1HAGE 2QF0A 3PTNA 3RXCA 4E06H 1EKBB 3LJJA 3R3GB 1QHRB 1OYTH 1SPJA 2FXRA 1D3TB 1O3CA 1O37A 1P9SA 3LGUA 4IC6A 2XYAA 3W94A 1OP8A 4ESTE 8KME2 1MTWA 4H6TA 3S9CA 4I8KA 6LPRA 2HWLB 1O2LA 2J2UA 1E37B 2LNCA 1GBBA 1NFYA 2WV5A 3T28A 1T31A 1WTHD 2VWNA 2G51A 3RP2A 2F91A 2ZFQH 3ZYEA 1LCYA 1NRNH 4BOHA 3BTKE 1CGIE 1LHEH 4IMZA 4Y10E 3NPSA 2OP9A 3BEFB 4Z0KA 1XM1A 3P8FA 2C8WB 3MU1A 4MLFB 3HATH 1Z1JA 2H5DA 1C9TA 1MH0A 1BBRH 2O9QA 4H42U 3SO3A 3RXDA 3PROA 4AX9H 2VH6A 1WOFA 2Y5FA 1ELTA 2BDIA 2V6NA 2BY8X 2OC0A 1DWDH 2THFB 1YCPM 1BRBE 2P3FH 3LIWA 1NRSH 3O8CA 1BB0B 2ZTZA 3OYPA 2OC8A 5EXNA 1P3CA 1P2QA 3KNXA 3QTVH 4JYUH 2ZHEH 1MD8A 2ZWLH 2SGPE 1O2JA 1TX8A 4CREA 1A2CH 2OTVA 5FBIA 2XC4A 2BDBA 6ESTA 2XBVA 3RC4A 2OXSA 4ABFA 1ELBA 3SNAA 1MQ5A 3EGKH 1L1JA 2WPKS 1EX3A 2G8TA 1TABE 3MH4A 4FU7A 2QN5T 1T4UH 5GCHG 5J4QA 4Y8ZA 3S0NA 1QL7A 1O5DH 3TH2H 1BTZA 1O2QA 4Q7XA 2PV9B 3RXGA 1PQ8A 3IWMA 4JZ1A 1AE5A 4CHAC 3HKIB 1RRKA 1K1IA 1NT1A 2ULLA 4AGKA 3RXSA 4DG4A 4ZXXH 2W7SA 1WV7H 1B0EA 1MKXK 1GJDB 2BLWA 3RC6A 2BLVA 4FU9A 1ZZZA 1FQ3A 4XSKU 2AMPA 3SJ9A 5K0HA 1SGIB 4NZLA 1N6XA 2V0BA 3NXPA 1MBMA 2B8OH 4JZIA 2A4GA 3A8BA 2FO9A 3RXKA 1C9PA 1ZGIA 1C5UA 3U1IB 1M9UA 2PTNA 1OWJA 1HDTH 1FY8E 1VITH 3Q00A 4AFSA 5L30H 3MU8A 1FJSA 3B23B 1V2TT 1TWXB 3STJA 2VIVA 4GAWA 2A31A 1G9IE 1GI6A 4NSYA 1SGFA 1K21H 1V2KT 1EPTB 3M3SA 2HNTC 5JPMH 4UD9H 2SGEE 1SGRE 1UTLM 1ZLRA 1C2IA 2VWLA 1EB2A 3RMMH 3DFLA 3BTGE 2Y5HA 3UFAA 1OP2A 1ABIH 2ZU4A 3PM3A 3UQVA 1QJ1B 4INLA 1PPEE 1N6YA 2BTCE 1DY8A 2GX4A 2JKHA 1EOLA 3SUEA 3ZVGA 2QA9E 1KIGH 1CT0E 1TA6A 2OUAA 1KXAA 5TJXA 3PMJA 1TAWA 3QGJA 5T6GA 5F6MA 2FPZA 4JK6A 4BTTB 2GCTB 5T3HA 4F4OC 3MU4A 1GBHA 2JH0D 3ODDA 3BSQA 2ANWA 1ETRH 1JWTA 2ZU5A 4Q7ZA 2ZIQH 1TONA 3RXOA 2ZHWH 5IDKA 4ABJA 5FCKA 1CU1A 2R3YA 1MTUA 4Y0YE 2PGQB 2VJ1A 3FANA 2FODA 3SV7A 4FUGA 1VZQH 2ZFRH 1SOTA 1HBTH 3LOXA 1VCQA 4KELA 1VCPA 3BTQE 4YOGA 1YCPK 3F9EA 1O3HA 4D9QA 4WMFA 2GCHF 4FUIA 3D23A 1C2JA 4FU8A 5C2ZA 1LDTT 3A7XA 2A2XH 4XFQA 5E8EH 1O30A 1MKWK 1S82A 2FOCA 1GHZA 3SI4H 1IQKA 1HGTH 2P94A 1P57B 3O8RA 3LT3A 1ZJKA 4OGYA 3M7UA 1PPFE 1P06A 3P6ZB 1UVTH 3SNEA 1AWHB 3P8GA 2Q6DA 2Z3DA 3SZNA 1C1NA 1GHAG 3V12A 1CE5A 5FXLA 1LHFH 4ZHMU 1LO6A 1BRAA 3DT0H 1GJ6A 2TPIZ 1K2I1 3RMNH 5EU8A 4DGJA 1KLJH 1GBEA 2Z3CA 3R0FA 3KQCA 2RDLA 2ZKSA 4NZQA 1GJ4H 4XE4A 1AY6H 5EOKA 1TYNA 4ABBA 5A09A 3M5LA 4H6SB 1C2DA 4CHAB 1DXPA 1V2NT 1DANH 1C2GA 1FY1A 2B9LA 1C4U2 4ABEA 4RKJB 1EJAA 1GMDF 1HJ8A 1P8VC 1HAIH 3FP8E 3N7OA 1UCYE 4GHQA 1W13U 1BBRE 5HM9A 1IQGA 1GDNA 1TOCB 1A0HB 3F68H 2BD4A 1XXFA 3MO3A 1YPEH 9ESTA 4U30A 2G4TA 2NU3E 1EAWA 4A1XA 3OU0A 3PWBA 3L33A 2RA0A 1O3FA 3ATMA 1K1OA 1OWKA 4CH8B 4B74A 4J2YB 1TGCA 1GG6C 1Z1IA 1FAXA 3A86A 2BB4A 1UMAH 1ZPCA 3RLYH 2ZPRA 4NCYA 4INKA 3P17H 4JMYA 3LU9B 5GJ4B 1QL8A 3DFJA 2ZCLP 1EP5A 3A82A 2Y5GA 1OOKB 2P3TB 4BXSA 1O2MA 1J16A 1S0QA 3TNSA 3S69A 4ISIH 4MDSA 2SNWA 1RIWC 4I8GA 3EA8A 2ZNKH 3T26A 2AH4X 3TU7H 1Q2WA 1UVPA 3SU3A 3I78A 2OC7A 1GI8B 1WQSA 2VWMA 2P16A 4UFGH 1P03A 4IN1A 3NK8A 2PR3A 5T6FA 2C93B 3RM2H 1K9OE 4IBLH 3EA7A 3B9FH 1A5GH 3PO1C 3SGBE 5LPFA 2EI7A 2AGEX 1G3EA 1C2HA 3P92A 2GTBA 3GDUA 2ODPA 3V13A 1QGFA 3UR9A 3EYDA 1HJAC 3Q3KA 3OSYA 2F9VA 1YF4A 3C27B 2O8TA 3UPEA 1BCUH 1FIWA 1YPHE 4B73A 1DM4B 3M7QA 3MOCA 1W11U 4DIIH 1ACBE 3F9GA 1O5BB 2FYQA 2Z94A 1O3LA 3U8RH 2C8XB 1TX6A 7ESTE 4DW2U 1H9IE 1HAOH 3QO6A 2O8LA 4FUDA 3MNXA 2Q1JA 1SFIA 3MO9A 2A7CA 1OX1A 7GCHF 3PLKA 1QJ6B 2AS9A 3A7TA 4WWYA 1MBQA 1GBDA 1Z71A 2Q6FA 4U2WA 3ZZ4A 1SC8U 2QF3A 2VVCA 3UOPA 1OS8A 1K28D 3LH3A 1AKSA 2SGQE 3RXRA 1E0FD 2ZEBA 5AF9H 1GVKB 3E6PH 2FESH 3LGWA 1PQ7A 1G3DA 1O2SA 5T6DA 5AFYH 2Z9IA 3GY5A 1J9CH 2H9EH 3SV6A 3EDXB 1NY22 4ZAEA 1SLUB 2EC9H 1A0JA 1EJNA 4X2XA 2GD4B 4VGCC 1Y3WA 2FX4A 1Y5BT 1ELAA 1TIOA 1GHBF 2B0FA 4Q80A 1XMNB 1QURH 4MPXA 2Z9JA 3SJ8A 1AE8H 1S85A 1ZHMA 2A0QB 2B5TB 4NFFA 1SGFG 3UWIA 1HAHH 3BIUH 2ZF0H 5TCAA 2NU4E 4TY6A 1BTUA 4AG2A 2Z9KA 2Z9LA 4JYTA 4CBOA 1C5RA 1LHGH 1RFNA 1GG6B 1GI2A 2A1DB 4X8UH 2OBQA 4CRAA 2J9NA 1CHGA 1H1BA 4B2BA 5BPEA 4ZXYH 1EZSC 4FVDA 3TK5A 2BQ7B 1LVMA 1RTLA 1G36A 5EQSA 1LVOA 2XRCA 4CBNA 1NRRH 5GPIB 4K1EA 4JCNA 1ZRKA 3RXAA 1C5MD 1GBKA 2F9UA 1TBRH 5DJ7A 4NIXA 1RIWB 2I6QA 4X6MA 1C1TA 3AVZA 3ZVBA 5EQQA 3SUFA 4ISOA 4LK4A 4QT8C 1YPJH 1ZPZA 4MQAA 3UIRA 3V0XA 4Z6AH 1SHYA 4ABHA 2ZU2A 1RTKA 3HKJB 4BAQB 1VJ9U 2OQ5A 3CS0A 1O3EA 4XBDA 3S9AA 5IYTA 3PO1B 2PKAA 1P10A 1JIMA 1ARBA 1O34A 1Y3UA 1ELVA 1H4WA 3A8AA 3QDZB 1C1QA 2G4UA 3RXJA 4HI3A 2VGCB 3E0PB 4FUJA 2P8OC 1HJAB 1MAYA 3ENSB 4X2YA 2CN0H 2STBE 3B8JA 2G5NA 1GHXH 1GWAA 1HCGA 5EPYA 1O2VA 1QBOA 2C8ZB 1YPGH 2CF9H 3K6ZA 4AGJA 4UDWH 1GJ8B 2F83A 5E2OA 1JIRA 1GDUA 3ZZBA 3SV9A 1SI5H 1F0RA 3LPRA 1XUKA 2BLOA 4KTCA 1SB1H 1BTHH 3EE0B 5ESBA 2G5VA 2ZPQA 1TPOA 1OWHA 2ZGBH 1EAIA 3SHCH 4YOIA 2ANKH 1C5LH 3RLWH 3PV4A 4BTUB 4XBCA 4GLYA 5JDUB 1K1MA 1QB9A 3BTME 1XXDA 3TPIZ 1P2IA 1MCVA 1O5EH 1ZHPA 1VR1H 1O3KA 1QIXB 6GCHG 1TMUH 3CS7A 1GBCA 2ZHQH 1EOJA 1HAVB 2D1JA 3A80A 4DVAU 3LGVA 1OSSA 1TE0A 2AMQA 3LKWA 2ZC9H 4BAHB 4ZKSU 4OS2A 1A1RA 2P93A 4AB9A 1QJ7B 3P70B 1G2LA 4AORA 2FZZA 2FEQH 1P2OA 2GP9B 2TGPZ 1IQJA 2GCHG 4M7GA 2FI5E 4ABGA 5FAHA 3PLPA 3SN8A 2M5TA 2QIQA 1NO9H 3A81A 4MPWA 3UNRA 2C90B 3SUGA 1O3AA 3VPKA 2HVXA 1P9UA 1MTVA 1QRWA 1O3OA 1UTNA 4VGCB 1C5XB 1ELCA 3SOSA 1ANBA 3U9AH 1ANEA 1ZJDA 1OWDA 4ZH8A 1TQ0B 4XBBA 1L1NA 2V35A 1K1NA 2PSYA 2C8YB 2Z3EA 3ZZCA 1FNIA 4YT6H 1GJ7B 1L2EA 1VGCC 3Q3YA 2H2ZA 1G3BA 5C5OA 2WV4A 2ZTXA 1KYNA 2SGDE 3KHVA 1LKBA 2Y82A 1LVBA 2F3CE 1O5AB 2FI4E 5CE1A 5DG6A 4B1TA 1UTPA 1C1PA 1B0FA 1AVXA 1TPPA 4R0IA 5B6OA 1ZMNA 1TGTA 5A2MH 2P3UB 1C2FA 1PPBH 1TRYA 3MH6A 1UCYH 3BTTE 5L6NH 1L4ZA 1NU7B 2VWOA 2UUFB 4LOYH 1AO5A 4FUHA 1D3PB 3CENA 3GY2A 5CMXH 5AFZH 2A45B 2BZ6H 3FAOA 1IHTH 4K8YA 2XTTB 1L1GA 1BJUA 4Y0ZE 2F9OA 1SGNE 3TK9A 1FY3A 1GBAA 1SSXA 2P95A 3LGYA 3RC5A 3RXEA 3KN2A 4MNXA 3TJVA 2FOMB 1SLXB 2BVSH 3ATIA 1GGDC 1E34B 4FUBA 3AAUA 4I8HA 2GT8A 1AUJA 1FV9A 4OS7A 4GHTA 2R3UA 2AIPA 1PPZA 1PYTC 1V2RT 4YO9A 1GMHG 1O2XA 2BXUH 1SGYE 1UK2A 2TIOA 1CVWH 4RKOB 3DHKH 1TNHA 1ZHRA 2P8OB 1W7GH 1UTMA 2FOHA 1BQYA 3GCTG 1FPCH 4K1TA 3UY9A 2A2QH 5GDSH 1JMOH 4YOJA 1GJAB 1GHYH 4NA9H 4NIYA 3M5OA 1DSUA 1HPGA 2WYGA 4X8VH 4O03A 1V3XA 4TPIZ 4D7GA 3ITIA 1SQTA 4TYDA 1DS2E 1YLDA 3KF2A 1O31A 1W2KH 1SVPA 1DWCH 1E36B 4CH2B 1YPLH 1UK3A 1AI8H 2HRVA 5DP4A 4WMDA 3QZQA 3GOVB 3MI4A 2J34A 3IITA 4GCHG 2ZDKA 2RCEA 5AHGH 2ZDMA 3RXUA 3QZRA 4TWYA 1ESBA 3A85A 4A6LA 4DJZB 2I6SA 5HXFA 3E1XB 3S7KB 4U32A 2ASUB 2NU2E 4Y7AA 1UJ1A 4ZROA 1SLVB 1ZSLA 4IGDA 2PUQH 2UUJB 3ATLA 4B2AA 3A7WA 1S6FA 1W7XH 4WY3A 1GJCB 2BVRH 4CRBA 1D9IA 2PWXA 2SGFE 1TOMH 1KSNA 2ANYA 1A5HA 2BY9X 5H4IB 4D7FA 1JXPA 1KXBA 1KXCA 4I33A 2D26C 2GDDA 1MZAA 2Z9GA 4MG3A 1V6DA 3Q3XA 1LHCH 5SGAE 4CRGA 5E0HA 2DE8A 1LVYA 1P09A 1VITG 3LJOA 1DT2A 3RXFA 1MAXA 2PLXA 1LKAA 1VGCB 1CHOF 4J1YA 1Y3VA 1QBVH 3CP7A 1O2KA 4D76A 1IOEA 3MNSA 3VB4A 1C5ZB 1GCTC 2VIOA 1Q31A 2ZFTA 4X6OA 4A1VA 1WTGH 3GY7A 2VVUA 1V2JT 3KQDA 2CHAC 2NWNA 1LPGB 2UWOA 2G81E 1TPAE 3RXIA 2OCVB 3UUZA 1AMHA 5GWZA 3VB7A 1F5KU 3SU6A 1MCTA 1MU6B 3RU4D 1IQMA 1O39A 1C1SA 2ODYB 1C1VH 3EA9A 3FP6E 5C67A 2EA3A 2ANMH 1GHBG 3H7OA 1DWBH 1GGDB 1O36A 4SGBE 2WUBA 2Y80A 2BOKA 3BTDE 1W8BH 1HNEE 3KEEA 2FX6A 2IN2A 4TPYA 1DY9A 3T27A 4CR5A 3SU4A 3TGKE 1TB6H 1TNGA 3SV8A 1FONA 2BD2A 2AERH 2TGDA 4E05H 3T5FH 3RMOH 1XX9A 2F9BH 3KCGH 1O3GA 2ZTYA 5DP3A 1AIXH 4Y11E 2CGAA 3D62A 2IOTA 2R2WU 4X6PA 1FLEE 5A8YA 1EP6A 1H8IH 1MD7A 4ABIA 5C3NA 2Q6GA 1BTPA 4YTAA 1Y59T 3BV9B 1BT7A 3SW2B 5C1XA 3Q77A 1EQ9A 2Y7ZA 1P11E 1ETTH 1DDJA 1V2UT 1BOQA 1W12U 2ZDVH 1O3BA 2AEIH 2QXGA 1GJ5H 1EB1H 2FLBH 4R8TB 3ZZDA 1T8OA 3L6PA 5JBBS 1O3JA 3SQHE 1HB0B 2OD3B 2W3IA 4KTUA 2ZP0H 2SNVA 1GI1A 3SNDA 2Y81A 1GCDA 1SBWA 1N8OC 4I32A 1TGSZ 2C4FH 2JH5D 1O2OA 1D6WA 4BANB 1V2VT 3BF6H 3TJOA 4ABAA 3WY8A 2ZO3H 1C5NH 1KLTA 4ZKRU 1SGTA 3GCHC 1UO6A 2CV3A 3HPTB 4KTSA 2R9PA 1F0TA 3MO6A 3SJIA 4NWKA 1WQVH 2Y6TA 1T8MA 3RXMA 4B76A 3AASA 1C5VA 3HGNA 3MU5A 1W3CA 4LZ1H 1YPHC 1YPKH 2XCNA 4MNYA 1ARCA 1DICA 1HRTH 5E2PA 3ZZ6A 1L4DA 1T7CA 4FXGH 1TLDA 2YNBA 1Y3YA 3ATWA 3MH7A 3A7VA 2KAIA 4WXIA 2BM2A 5FX5A 2PFEA 4K2YA 1XUJA 3M37A 3KQBA 5DP6A 1GJBB 2R0KA 5PTPA 3BEIB 1XKBC 1P2KA 5EXMA 5A0AE 1LQEA 1IQEA 1SLWB 1YLCA 3BG8A 5EODA 1GCTB 2AYWA 3QTOH 2PGBB 3FVFB 3KQEA 4ZHLU 1C5TA 1B5GH 1QA7A 4YLQH 1LMWB 3QK1A 1D6RA 3T62A 2NU1E 3ZZ5A 2CHAB 3RXVA 3GDVA 3RXHA 3SGAE 2IJOB 1AUTC 1U6QA 1PQAA 2ZDAH 1GL1A 4UE7H 5K7RA 1O3PB 2H9HA 1GI5A 1FUJA 2AIQA 1MKWH 4OS6A 1V2ST 4HFPB 1AFQC 3QX5H 1SOZA 4WF8A 1IQNA 1C2EA 2XC0A 1FPHH 3VB3A 1ELGA 4ASHA 3W95A 4I8JA 1IQHA 3PMAB 3BG4C 1FY5A 1K1PA 2ZI2H 1AVGH 3E90B 3GDSA 2H6MA 1GI9B 1CA8B 2ZGJA 1S6HA 1ZSKA 2ESTE 4WXVA 5JBTA 5LH8A 1OKXA 1QQ4A 1NPMA 4K1SA 1TPSA 3EAJA 1O2RA 1O33A 3NZIA 4AOQA 3HK3B 3VB5A 3SI3H 5ETXA 1AWFH 1DE7H 1BTYA 4NA8A 9LPRA 1Z6EA 1O5GH 2FI3E 2J4IA 5DPAA 5DGJA 1P12E 3LGIA 3SORA 1H9LB 4UONA 2Y7XA 1FI8A 2O8WA 2VB0A 2A4QA 1O2GH 1A7SA 1GPZA 1D3QB 2OLGA 2QXIA 5JB8S 3I29A 5L2YH 2AGIX 2EEKA 3GY3A 1F92A 1V2QT 1KXFA 4JK5A 3URCA 2W7UA 1AKSB 1WU1A 4JZFH 3T29A 4Y6DA 4LXBH 1KDQA 1GI3A 1SQAA 1SG8B 1MU8B 1T8LA 1UK4A 3A89A 1QRXA 3TJNA 1S5SA 3I77A 3KL6A 4BNRA 3PYHA 2RG3A 4ISNA 1O2NA 7KMEH 1G32B 3MNCA 1EZUC 2A4RA 2BZAA 1AB9C 3PWCA 5LPEA 1A4WH 5DKMA 1N8OB 1S84A 4PROA 1H8DH 4Y8YA 2VIQA 1ETSH 1P02A 1QNJA 5GXPA 4X1NU 2ZU3A 2VNTA 3GCHB 3V7TA 4X8TH 1MTNC 3TIUA 4UFFH 1CA0C 3UQOA 4O9VA 4X1RU 2VIPA 1RD3B 3DD2H 2GMTC 3SU1A 1HXFH 1PPCE 4MNWA 2ZDLA 1A5IA 3TGIE 1F0UA 4NIVA 1TNLA 2ZG0H 4YLUA 3U1JB 1O3IA 1OXGA 1T32A 3O8DA 1NM6A 3A88A 1GVZA 2ZFPH 5F8ZA 3ZVAA 4ZMAH 1YKTA 1UTKA 3QWCH 2GKVE 3KIDU 1Y8TA 2J38A 5I46H 2D2DA 4E7NA 1FN6A 2WYJA 3ZVCA 1QCPA 4X1PU 2ILNA 8GCHF 3A87A 3BTHE 2FP7B 5EXLA 3M3VA 2BDAA 3VXFH 1GBLA 5G4BA 1K22H 4H4FA 1O3MA 1BMNH 3OY6U 2GZ9A 1EXFA 5A0CA 3UNQA 1SMFE 4YZUA 3UR6A 1UCYK 1VCWA 1S0RA 3NCLA 2PKAB 4I7YH 1BBRK 1Y5AT 2Z7FE 1EJMA 4OS4A 1ESTA 4ISHH 3SGQE 2OBOA 2ZGCA 1WSSH 3RXBA 3F9HA 1AFQB 4DIHH 2PTCE 1ZR0A 2EI8A 2CF8H 1QBNA 1FDPA 1ORFA 5F8XA 4OS1A 1C4V2 1IQLA 2ODQA 2TBSA 3DA9B 2BX3A 2QCYA 1GDQA 3BG4B 1GMCF 4ZUHA 1NROH 5EQRA 1AHTH 1AQ7A 4IS5A 3S7HB 2ZA5A 1W10U 2D8WA 1JRSA 2FOAA 5FPSA 3FFGA 1SL3A 1BHXB 3U8OH 2XCFA 3GY4A 1QY6A 1HIAA 1O0DH 2O8MA 4OS5A 1GL0E 1XKAC 4BAMB 1TGNA 1AZ8A 3AW0A 1HIAB 1O2PA 4JYVH 2PKSC 1V2OT 1TNIA 5FHTA 2TGTA 2W5EA 3QGNB 3DUXH 1O5FH 5DP5A 2TRMA 3RU4T 1DXWA 2PSXA 3LC5A 4MVNA 1GI4A 1ZYOA 5LGOA 2VINA 3SQEE 5A8ZA 2LPRA 4A7IB 4DOQA 5DP9A 4IW4E 3NWUA 1YYY1 1O3NA 3OY5U 4IMQA 1AN1E 1W0YH 1XVOA 1YGCH 3AW1A 2OINA 1CO7E 1F2SE 3A8DA 5E0GA 2BQWB 2VVVA 2C3SA 2XXLA 2FOGA 5ABWA 1NS3A 2WPLS 1HAPH 3GISB 1AB9B 4AFQA 1TMTH 1C2LA 4Y76A 5FPYA 3A7ZA 2UUYA 1K1LA 2GV6A 1NFXA 4OGXA 2A5AA 2ZZUH 1Z6JH 1C2KA 1O2ZA 4IN2A 1MTNB 3S9BA 3M5MA 1CA0B 3GYLB 1P2JA 1UVSH 1NFUA 2G52A 3ZVEA 4FUCA 1TBZH 3HK6B 4KGAA 2BMGB 5A8XA 2GMTB 2HPPH 1BIOA 3Q76A 1O3DA 5EW2H 1G37A 1CQQA 3ESTA 3TVJB 1GMDG 1UVUH 2A4OA 5FBEA 4DURA 1UVOA 1D3DB 5FPTA 4THNH 4WVPE 1GI0A 1C2MA 2GCTC
chains in the Genus database with same CATH superfamily
1BMMH 2UUKB 2FYRA 2WINI 2H9TH 3SUDA 1V2LT 3EQ0H 1QQUA 3M61U 2XBXA 4XDEA 1UHBA 3K2UA 3H5CB 1C1OA 1ZMLA 3NUMA 1UHBB 1TBQH 2XWBI 3DCLA 1WXRA 1DOJA 2BD7A 1A3BH 3K9XB 2FOEA 4AFZA 3ZZ8A 4RT0A 1L0ZA 1J8AA 1EAXA 1UTJA 1GBTA 4YT7H 5HM2A 3SU5A 1RXPA 3OTJE 3KYGA 3BTEE 1DSTA 1BTXA 2A5IA 5BRRE 4GSOA 1WCZA 3RM0H 2HPQH 2BD5A 4ABDA 2QC2A 4XOJA 4D8NA 3WW7A 1DX5M 4MPUA 3STIA 4BAOB 1E38B 5I25A 1C4Y2 4F49A 3ZVFA 1HXEH 4X2WA 1HYLA 3V3MA 1BTWA 2M2AA 3PTBA 1CSOE 4X6NA 1WDIA 1QA0A 6CHAC 4RSPA 4Y71A 1N1LA 3SHAH 2BD9A 2A7JA 1IAUA 2PKSB 1KXDA 8LPRA 2BY5X 1B7XB 5EGMA 1IHSH 1JBUH 2H1UA 1X7AC 1NN6A 1C5PA 3FZDA 3K6YA 4P02A 1P3EA 2GDEH 5C0TA 1AD8H 1CT2E 1UW7A 2BYAX 3BEUA 1ZRBA 4NIWA 3SU0A 4MTBA 1HAXB 2ZGHA 2XNDD 1OHHD 1FXYA 3T25A 4ISLA 4AB8A 2FDAA 4U01A 2KX4A 3MH5A 5JBCS 1YPMH 1GI7B 3TJUA 1WBGB 1F7ZA 1KMHB 1EPTA 5CDFE 1O5CB 1C5WB 5JYIA 5DP8A 2OQUA 1RS0A 7GCHG 5LPRA 2QF4A 3GCOA 1QR3E 2QV1A 1VJAU 4LZ4B 1OWEA 2P59A 4K3JA 1QTFA 5EPNA 4UFEH 3TGJE 3QN7A 3RUOA 1EZQA 3A83A 1IQFA 4HZHA 1YBWA 4O3UA 4AFUA 4HTCH 1Z8IB 5FX6A 3FZZA 2WPDD 1NZQH 3TITA 1QB6A 4X2VA 1OWIA 1ANCA 3SJOA 1EUFA 1P0SH 4K5ZA 2VU8E 2GZ8A 2F9NA 1BITA 4O3TA 1IQIA 2KCOA 2XW9A 1XUFA 2R2MB 2V3HH 1HFDA 1PFXC 3D65E 4A5TS 3T2NA 2FOFA 2HLCA 2CJIA 5ESTE 4FUEA 3MHWU 2O8UA 2ZCHP 2VIDA 1TRMA 5JB9S 4DY7B 4MPVA 1ELDE 4BXWA 6GCHF 2BQ6B 3U98H 5GIBA 5A0BA 3JZ2B 4Y7BA 4K60A 4NA7A 1JOUB 3EE7A 3SU2A 2HNTE 3RXQA 3ZZ3A 4A1TA 1THPB 3BIVH 2QXHA 3MNBA 4O97A 5E0JA 1OPHB 2ZU1A 2VBCA 1YP9A 1A0LA 2ALPA 2BDYA 3VGCC 4AG1A 1P2MA 3VXEH 2AMDA 2UWLA 3URDA 2FOBA 2QY0B 1GJ9B 3LDXH 3LGTA 2WSSD 1J15A 3G01A 2DE9A 3KGPA 1O2TA 1NRPH 4AYVB 4FVBA 3OEED 1W0ZU 1MKXH 1DLEA 2PHBA 1LHDH 1F0SA 2HNTF 4JZDH 2TGAA 4WJG2 4MNVA 2OC1A 1DVAH 1KTSB 3RXTA 1HAYB 3SV2H 2YMSC 1O38A 4X1SU 2W3KA 1O35A 1OYQA 4NFEA 1BA8B 3A84A 1QB1A 1ESAA 1ID5H 8GCHG 1C5QA 3M3TA 6CHAB 4TY7A 2ALVA 3UB0A 1ELFA 2ZQ2A 4HGCA 2W6JD 1HJ9A 3A8CA 3SJKA 1HUTH 1Z8GA 1BMAA 5CHAC 2GT7A 1NRQH 1OP0A 1NFWA 3P8NA 1KTTB 1WAYB 3VFEA 3ZZ7A 5DP7A 3SNBA 1NU9A 4Q7YA 1O2IA 4NSVA 1AZZA 3ATKA 3UREA 1TALA 4ZKOU 1INCA 2SFAA 1H9HE 2XWAA 1G2MA 1BDAA 1ZSJA 2QF5A 2AFQB 1GMCG 3SNCA 1CT4E 1V2PT 1Z8JB 1KLIH 3UTUH 4K8BA 4INHA 1LPKB 1SGPE 1Q3XA 1GHWH 4A92A 2BHGA 1GMHF 1C1WH 1O2HA 1KXEA 1G3CA 5FCRA 1AVWA 1EATA 2KAIB 2EI6A 4CRCA 1GHVH 2FWWA 3GCTF 3H7TA 3AAVA 3ZVDA 1TA2A 5J4SA 2A32A 1C1MA 1QL9A 1T4VH 1YM0A 3GY8A 5GCHF 5TCCA 4AYYB 4B2CA 1DWEH 1PYTD 3D49H 1S81A 2YOLA 2XNIA 3F3BA 2FMJA 3M5NA 1G30B 1FIZA 4AZ2B 1PPHE 1LPZB 4X0WU 4UEHH 1YCPH 3PV2A 4KP0A 1DPOA 3RXLA 2QE7D 1DUAA 2WPIS 4RT1A 2YNAA 3L3TA 1F5LA 1GBMA 8ESTE 2FS8A 3UWJH 2ZPSA 3ODFA 2HGTH 3GCNA 1NTPA 3ZV8A 4DCDA 3NRLA 4GCHF 1BMLA 4ZHAA 2ZCKP 1P01A 1KY9A 3F1SB 5C5NA 1FMGA 3ZZ9A 1SKYE 2BD8A 2JETC 1P04A 2VGCC 3U8TH 3F2FA 3F6UH 4WH6A 4DT7B 2WPMS 3VGCB 4K69A 3IG6B 4CRFA 1WYKA 2BLQA 3QLPH 1RGQA 1LTOA 1BJVA 2G55A 3E0NB 1TGBA 1EASA 2FTLE 1S6LA 1COWD 1MMJN 1XVMA 1V2MT 1Z8RA 3M35A 2V7QD 3PB1E 2G00A 1MZDA 2DUCA 3BTFE 2QAAA 3JZ1B 5F03A 3VB6A 4Z1MD 1S83A 5C20A 3E8LA 1DLKB 4Q2KA 1K1JA 3ZZAA 1MQ6A 4B71A 3VEQB 1VITF 3TLOA 1P05A 2YMSB 4M9FA 2STAE 4YESB 1JRTA 1PPGE 2WUCA 4I8LA 2F9PA 4GUXA 3FP7E 1SGEE 2FTMA 1FY4A 1D4PB 1SGDE 1Y5UT 3SBKA 2WPHS 2NU0E 1KDQB 3MWIU 5CHAB 4WMEA 1A46H 1CBWC 1SHHB 2PW8H 2V3OH 4RN6A 4X1QU 4E7RG 1XUHA 3MFJA 2HALA 3UOUA 1XUIA 5C1UA 1GBIA 2XC5A 4BTIB 1UTQA 1FN8A 1ELEE 4WH8A 2K0QA 2AHME 3MTYA 4CRDA 1BZXE 1HAZB 1MUEB 3MMGA 2RA3A 5C0UA 4NG9H 4UFDH 4AN7A 5EW1H 1TMBH 3BN9A 1WUNH 2SGAA 3LH1A 3O8BA 3OX7U 1ZTLA 3PMHB 1V2WT 2GJGA 3M36A 2JH6D 4GVUA 2J92A 2XBYA 4X8SH 1TNJA 2UWPA 3GYMA 4SGAE 2GGVB 2QXJA 1EAUA 2CXVA 2WHXA 1T8NA 1C1RA 3ELAH 1ZOMA 1GBJA 1EZXC 2L6OA 2BXTH 1NC6A 1GHAF 1W14U 1O2WA 4Y8XA 1RJXB 2QGRA 1TQ7B 1ABJH 1Z7KA 2BD3A 2W26A 5L2ZH 1THSH 2Z6BD 2BY7X 1AGJA 4ZKNU 1MTSA 1PJPA 2ZDNA 1SFQB 4NWLA 3C1KA 2B7DH 2BDGA 4D9RA 1BRCE 1HV7A 1DFPA 3MYWA 4TWWA 1XUGA 1BHXF 2AGGX 4XD7D 3RXPA 1QRZA 2ZQ1A 3P8OA 2BVXH 2ZFFH 1ZMJA 2QYIA 1SR5C 2H5CA 1DUEA 3P95A 3TH4H 1TNKA 3MU0A 3PLBA 4JZEH 3TK6A 1TX7A 1J17T 4IC5A 5F8TA 5JBAS 2IPHA 1AU8A 2ZGXH 4YM9A 1C5YB 2BOHB 1PQ5A 3GY6A 3M7TA 2K1QA 1UTOA 2CMYA 2R0LA 2BDHA 2BY6X 3E91A 1GBFA 2J94A 5HGGA 3NKKA 1ZTJA 1CHOG 2FM2A 2JETB 1LQDB 2XBWA 1SQOA 2GVFA 1ZPBA 1O2YA 2FLRH 1GVLA 1THRH 5HYOA 2FS9A 5KGOA 2GV7A 3K65B 1CGJE 3A7YA 2A7HA 3TNTA 5DO4H 1C5OH 2ZECA 1C5SA 3QUMP 4FUFA 1DITH 3LC3A 2A5KA 1A3EH 5C1YA 2BDCA 2BX4A 1SGQE 2ZFSA 2ZHFH 1FAKH 1NESE 3E3TA 1ZGVA 1SGCA 1O2UA 3RDZA 2WPJS 1A61H 1HAVA 3PMBB 1ANDA 1RTFB 3UNSA 5HMAA 1YC0A 1CGHA 3U69H 3RMLH 1BUIA 2ZHDA 1ZTKA 4B75A 2J95A 2GZ7A 2VH0A 5AVDA 1TRNA 1C1UH 1CBWB 2FIRH 4I31A 3F9FA 1HLTH 7LPRA 4CR9A 3LONA 2PUXB 2VIWA 1BRUP 1AFEH 1P2NA 1J14A 1YWUA 5EG4A 1F5RA 3ZV9A 4NGAH 4Y79A 1O32A 3ZYDA 4GPGA 1QFKH 3E16B 4BAKB 4P00A 1E35B 1FZZA 3GICB 2HOBA 2KCAA 3HGPA 4KKDA 3BTWE 1EPTC 5DK1A 1Y3XA 3RU4E 3TH3H 4B6FA 1TFXA 1HAGE 3FN8A 2QF0A 3PTNA 3RXCA 4E06H 1EKBB 3LJJA 3R3GB 1QHRB 1OYTH 5F53A 1SPJA 2FXRA 2KZ4A 1D3TB 1O3CA 1O37A 1P9SA 3LGUA 4IC6A 2XYAA 3W94A 1OP8A 4ESTE 8KME2 1MTWA 4H6TA 3S9CA 4I8KA 6LPRA 2HWLB 1O2LA 2J2UA 1E37B 2LNCA 1GBBA 1NFYA 2WV5A 3T28A 1T31A 1WTHD 2VWNA 2G51A 3RP2A 2F91A 2ZFQH 3ZYEA 5C17A 1LCYA 2J97A 1NRNH 4BOHA 5HIYA 3BTKE 1CGIE 1LHEH 3DSGA 4IMZA 4Y10E 3NPSA 2OP9A 3BEFB 4RI0A 4Z0KA 2IJD1 1XM1A 3P8FA 2C8WB 3MU1A 4MLFB 3HATH 1Z1JA 2H5DA 1C9TA 1MH0A 1BBRH 2O9QA 4H42U 3SO3A 3RXDA 3PROA 4AX9H 2VH6A 1WOFA 2Y5FA 1ELTA 2BDIA 2V6NA 2BY8X 2OC0A 1DWDH 2THFB 1YCPM 3WWFA 1BRBE 2XOKD 2P3FH 3LIWA 1NRSH 3O8CA 1BB0B 2ZTZA 3OYPA 2OC8A 5EXNA 1P3CA 1P2QA 3KNXA 3QTVH 4JYUH 2ZHEH 1MD8A 2ZWLH 2SGPE 1O2JA 1TX8A 4CREA 1A2CH 2OTVA 5FBIA 2XC4A 2BDBA 6ESTA 2XBVA 3RC4A 2OXSA 4ABFA 1ELBA 3SNAA 1MQ5A 3EGKH 4Q4LA 1L1JA 2WPKS 1EX3A 2G8TA 1TABE 3MH4A 4FU7A 2QN5T 1T4UH 5GCHG 5J4QA 4Y8ZA 3S0NA 1QL7A 1O5DH 3TH2H 1BTZA 1O2QA 4F55A 4Q7XA 2PV9B 3RXGA 1PQ8A 3IWMA 4JZ1A 1AE5A 4CHAC 3HKIB 1RRKA 1K1IA 1NT1A 2ULLA 4AGKA 3RXSA 4DG4A 4ZXXH 2W7SA 1WV7H 1B0EA 1MKXK 1GJDB 2BLWA 3RC6A 2BLVA 4FU9A 1ZZZA 5EIYA 1FQ3A 4XSKU 2AMPA 3SJ9A 5K0HA 1SGIB 4NZLA 1N6XA 2V0BA 3NXPA 1MBMA 2B8OH 4JZIA 2A4GA 3A8BA 2FO9A 3RXKA 1C9PA 1ZGIA 1C5UA 3U1IB 1M9UA 2PTNA 1OWJA 1HDTH 1FY8E 1VITH 3Q00A 4AFSA 5L30H 3MU8A 1FJSA 3B23B 1V2TT 1TWXB 3STJA 2VIVA 1NBMD 4GAWA 2A31A 1G9IE 1GI6A 4NSYA 1SGFA 1K21H 1V2KT 1EPTB 3M3SA 2HNTC 5JPMH 4UD9H 2SGEE 1SGRE 1UTLM 3GS9A 1ZLRA 1C2IA 2VWLA 1EB2A 3RMMH 3DFLA 3BTGE 2Y5HA 3UFAA 1OP2A 1ABIH 2ZU4A 3PM3A 3UQVA 1QJ1B 4INLA 1PPEE 1N6YA 2BTCE 1DY8A 2GX4A 2JKHA 1EOLA 3SUEA 3ZVGA 2QA9E 1KIGH 1CT0E 1TA6A 2OUAA 1KXAA 1YLNA 5TJXA 3PMJA 1TAWA 3QGJA 5T6GA 3N99A 5F6MA 2FPZA 4JK6A 4BTTB 2GCTB 5T3HA 4F4OC 3MU4A 1GBHA 2JH0D 3ODDA 3BSQA 2ANWA 1ETRH 1JWTA 2ZU5A 4Q7ZA 2F43B 2ZIQH 1TONA 3RXOA 2ZHWH 5IDKA 4ABJA 3F2HA 5FCKA 1CU1A 2R3YA 1MTUA 4Y0YE 2PGQB 2VJ1A 3FANA 2FODA 3SV7A 4FUGA 3DSOA 1QZ8A 1VZQH 2ZFRH 1SOTA 1HBTH 3LOXA 1VCQA 4KELA 1VCPA 3BTQE 4YOGA 4B6EA 1YCPK 3F9EA 1O3HA 4D9QA 3PRBA 4WMFA 2GCHF 4FUIA 3D23A 1C2JA 4FU8A 5C2ZA 1LDTT 3A7XA 2A2XH 4XFQA 5E8EH 1O30A 1MKWK 1S82A 2FOCA 1GHZA 3SI4H 1IQKA 1HGTH 2P94A 1P57B 3O8RA 3LT3A 1ZJKA 4OGYA 3M7UA 1PPFE 1P06A 2EQNA 3VG8A 3P6ZB 1UVTH 3SNEA 1AWHB 3P8GA 2Q6DA 2Z3DA 3SZNA 1C1NA 1GHAG 3V12A 1CE5A 5FXLA 1LHFH 4ZHMU 1LO6A 1BRAA 3DT0H 1GJ6A 2TPIZ 1K2I1 3RMNH 5EU8A 4DGJA 1KLJH 1GBEA 2Z3CA 3R0FA 3KQCA 2RDLA 2ZKSA 3OE7D 4NZQA 1GJ4H 4XE4A 1AY6H 5EOKA 1TYNA 4ABBA 5A09A 3M5LA 4H6SB 1C2DA 4CHAB 1DXPA 3KQ5A 1V2NT 1DANH 1C2GA 1FY1A 2B9LA 1C4U2 4ABEA 4RKJB 1EJAA 1GMDF 1W0JD 1HJ8A 1P8VC 1HAIH 3FP8E 3N7OA 1UCYE 4GHQA 1W13U 1BBRE 5HM9A 2KCYA 2WZQA 1IQGA 1GDNA 1TOCB 1A0HB 3F68H 2BD4A 1XXFA 3MO3A 1YPEH 9ESTA 4HG6A 4U30A 2G4TA 2NU3E 1EAWA 4A1XA 3OU0A 3PWBA 3L33A 2RA0A 1O3FA 3ATMA 1K1OA 1OWKA 3U28C 4CH8B 4B74A 4J2YB 1TGCA 5EJZA 1GG6C 1Z1IA 1FAXA 3A86A 2BB4A 1UMAH 1ZPCA 3RLYH 2ZPRA 4NCYA 4INKA 3P17H 4JMYA 3LU9B 3ZIAD 5GJ4B 1QL8A 3DFJA 2ZCLP 1EP5A 3A82A 2Y5GA 1OOKB 2P3TB 4BXSA 1O2MA 1J16A 5T1VA 1S0QA 3TNSA 3S69A 4ISIH 4MDSA 2SNWA 1RIWC 4I8GA 2LELA 3EA8A 2ZNKH 3T26A 2AH4X 3TU7H 5KECA 1Q2WA 1UVPA 3SU3A 3I78A 2OC7A 1W0KD 1GI8B 1WQSA 2VWMA 2P16A 4UFGH 1P03A 4IN1A 3NK8A 2JDID 2PR3A 5T6FA 2C93B 3RM2H 1K9OE 4IBLH 3EA7A 3B9FH 1A5GH 3PO1C 3SGBE 5LPFA 2EI7A 2AGEX 1G3EA 1C2HA 3P92A 4ACAA 2GTBA 3GDUA 2ODPA 3V13A 1QGFA 3UR9A 3EYDA 1HJAC 3Q3KA 3OSYA 2F9VA 1YF4A 3C27B 2O8TA 3UPEA 1BCUH 1FIWA 1YPHE 4B73A 1DM4B 3M7QA 3MOCA 1W11U 4DIIH 1ACBE 3F9GA 1O5BB 2FYQA 2Z94A 4ASUD 1O3LA 3U8RH 2C8XB 1TX6A 7ESTE 4DW2U 1H9IE 1HAOH 3QO6A 2O8LA 4FUDA 3MNXA 2Q1JA 4DT4A 1SFIA 3MO9A 2A7CA 1OX1A 7GCHF 3PLKA 1QJ6B 2AS9A 3A7TA 4WWYA 2WV9A 1MBQA 4TT3D 1GBDA 1Z71A 2Q6FA 4U2WA 3ZZ4A 1SC8U 2QF3A 2VVCA 3N7EA 3UOPA 1OS8A 1K28D 3LH3A 1AKSA 2SGQE 5DSFA 3RXRA 1E0FD 2ZEBA 5AF9H 1GVKB 3E6PH 2FESH 3LGWA 1PQ7A 1G3DA 1O2SA 5T6DA 5AFYH 2Z9IA 3GY5A 1J9CH 2H9EH 3SV6A 3EDXB 1NY22 4ZAEA 1SLUB 2EC9H 1A0JA 1EJNA 4X2XA 2GD4B 4VGCC 1Y3WA 2FX4A 1Y5BT 1ELAA 1TIOA 1GHBF 2B0FA 4Q80A 1XMNB 1QURH 4MPXA 2Z9JA 2JIZD 3SJ8A 1AE8H 1S85A 1ZHMA 2A0QB 2B5TB 4NFFA 1SGFG 3UWIA 1HAHH 3BIUH 2ZF0H 5TCAA 2NU4E 4TY6A 1BTUA 4AG2A 2Z9KA 2Z9LA 4JYTA 4CBOA 1C5RA 1LHGH 1RFNA 1GG6B 1GI2A 2A1DB 5HKKD 4X8UH 2OBQA 4CRAA 2J9NA 1CHGA 1H1BA 4B2BA 5BPEA 3OTPA 4ZXYH 1EZSC 4FVDA 3KYFA 3TK5A 2BQ7B 1LVMA 1RTLA 1G36A 5EQSA 2OK5A 1LVOA 2XRCA 4CBNA 1NRRH 1SQRA 5GPIB 4FETA 4JCNA 4K1EA 1ZRKA 3RXAA 1C5MD 1GBKA 2F9UA 1TBRH 5DJ7A 4NIXA 1RIWB 2I6QA 4X6MA 1C1TA 3AVZA 3N7DA 2K8IA 3ZVBA 5EQQA 3SUFA 4ISOA 4LK4A 4QT8C 1YPJH 1ZPZA 4MQAA 3UIRA 3V0XA 4Z6AH 1SHYA 4ABHA 2ZU2A 1RTKA 3HKJB 4BAQB 5FL7D 1VJ9U 2OQ5A 3CS0A 1O3EA 4XBDA 3S9AA 5IYTA 3PO1B 2PKAA 4FOUC 3OFND 2YMSD 1P10A 1JIMA 1ARBA 1O34A 1Y3UA 1ELVA 1H4WA 3A8AA 3QDZB 1C1QA 2G4UA 3RXJA 4HI3A 2VGCB 3E0PB 4FUJA 2P8OC 1HJAB 1MAYA 3ENSB 4X2YA 2CN0H 2STBE 3B8JA 2G5NA 1GHXH 1GWAA 1HCGA 5EPYA 1O2VA 1QBOA 2C8ZB 1YPGH 2CF9H 3K6ZA 4AGJA 4UDWH 1GJ8B 2F83A 5E2OA 1JIRA 1GDUA 3ZZBA 3SV9A 1SI5H 1E79D 1F0RA 3LPRA 1XUKA 2KCPA 2J98A 1H8ED 2BLOA 4KTCA 1SB1H 1BTHH 3EE0B 5ESBA 2G5VA 2ZPQA 1TPOA 1OWHA 2ZGBH 1EAIA 3SHCH 4YOIA 2ANKH 1C5LH 3RLWH 3PV4A 4BTUB 4XBCA 1NBME 4GLYA 5JDUB 1K1MA 1QB9A 3BTME 1XXDA 5EJ1A 3TPIZ 1P2IA 1MCVA 1O5EH 1ZHPA 1VR1H 1O3KA 1QIXB 6GCHG 1TMUH 3CS7A 1GBCA 2ZHQH 1EOJA 1HAVB 2D1JA 3A80A 4DVAU 3LGVA 1OSSA 3AK5A 1TE0A 2AMQA 3LKWA 2ZC9H 4BAHB 4ZKSU 4OS2A 1A1RA 2P93A 4AB9A 1QJ7B 3P70B 1G2LA 4AORA 2FZZA 2FEQH 3F0OA 1P2OA 2GP9B 2TGPZ 1IQJA 2GCHG 4M7GA 2FI5E 4ABGA 5FAHA 3PLPA 3SN8A 2M5TA 2QIQA 2KR7A 1NO9H 3A81A 4MPWA 3UNRA 2C90B 3SUGA 4F48B 1O3AA 3VPKA 2HVXA 1P9UA 1MTVA 1QRWA 1O3OA 1UTNA 4VGCB 1C5XB 1ELCA 3SOSA 1ANBA 3U9AH 1ANEA 1ZJDA 1OWDA 4ZH8A 1TQ0B 4XBBA 1L1NA 2KFWA 1E1QD 2V35A 3UAIC 1K1NA 2PSYA 2C8YB 2Z3EA 3ZZCA 1FNIA 4YT6H 1GJ7B 1L2EA 1VGCC 3Q3YA 2H2ZA 1G3BA 5C5OA 2WV4A 2ZTXA 1KYNA 2SGDE 4I86A 3KHVA 3H09A 1LKBA 2Y82A 1LVBA 2F3CE 1O5AB 2FI4E 5CE1A 5DG6A 4B1TA 1UTPA 1C1PA 1B0FA 1AVXA 1TPPA 4R0IA 2RFKC 5B6OA 1ZMNA 4ACBA 1TGTA 5A2MH 2P3UB 1C2FA 1PPBH 1TRYA 3MH6A 1UCYH 3BTTE 5L6NH 1L4ZA 1NU7B 2VWOA 2UUFB 4LOYH 1AO5A 4FUHA 1D3PB 3CENA 3GY2A 5CMXH 5AFZH 2A45B 4OM9A 2BZ6H 3FAOA 1IHTH 4K8YA 2XTTB 1L1GA 1BJUA 4Y0ZE 2F9OA 1SGNE 3TK9A 1FY3A 1GBAA 1SSXA 2P95A 3LGYA 3RC5A 3RXEA 3KN2A 4MNXA 3TJVA 2FOMB 1SLXB 2BVSH 3ATIA 1GGDC 1E34B 4FUBA 3AAUA 4I8HA 2GT8A 1AUJA 1FV9A 4OS7A 4GHTA 2R3UA 2AIPA 1PPZA 1PYTC 1V2RT 5CHBA 4YO9A 1GMHG 1O2XA 2BXUH 1SGYE 1UK2A 2L74A 2TIOA 1CVWH 3OEHD 3DHKH 1TNHA 4RKOB 1ZHRA 2P8OB 1W7GH 1UTMA 2FOHA 1BQYA 3GCTG 1FPCH 4K1TA 3UY9A 2A2QH 5GDSH 1VKYA 1JMOH 4YOJA 1GJAB 1GHYH 4NA9H 4NIYA 3M5OA 1DSUA 1HPGA 2WYGA 4X8VH 4O03A 1V3XA 4TPIZ 4D7GA 3ITIA 1SQTA 4TYDA 1DS2E 1YLDA 3KF2A 1O31A 1W2KH 1SVPA 1DWCH 1E36B 4CH2B 1YPLH 1UK3A 1AI8H 2HRVA 5DP4A 4WMDA 3QZQA 3GOVB 3MI4A 2J34A 3IITA 4GCHG 2ZDKA 2RCEA 5AHGH 2ZDMA 3RXUA 3QZRA 4TWYA 1ESBA 3A85A 4A6LA 4DJZB 2I6SA 5HXFA 3E1XB 3S7KB 4U32A 2ASUB 2NU2E 4Y7AA 1UJ1A 4ZROA 1SLVB 1ZSLA 4IGDA 2PUQH 2UUJB 3ATLA 4B2AA 3A7WA 1S6FA 1W7XH 4WY3A 1GJCB 2BVRH 4CRBA 1D9IA 3FOAA 1EFRD 2PWXA 2SGFE 1TOMH 1KSNA 2ANYA 1A5HA 2BY9X 5H4IB 4D7FA 1JXPA 1KXBA 1KXCA 4I33A 2D26C 2GDDA 1MZAA 2Z9GA 4MG3A 1V6DA 3Q3XA 1LHCH 5SGAE 4CRGA 5E0HA 2DE8A 1LVYA 1P09A 1VITG 3LJOA 1DT2A 3RXFA 1MAXA 2PLXA 1LKAA 1VGCB 1CHOF 4J1YA 1Y3VA 1QBVH 3CP7A 1O2KA 4D76A 1IOEA 3MNSA 3VB4A 1C5ZB 1GCTC 2VIOA 1Q31A 2ZFTA 4X6OA 4A1VA 1WTGH 3GY7A 2VVUA 1V2JT 3KQDA 2CHAC 2NWNA 1LPGB 2UWOA 2G81E 1TPAE 3RXIA 2OCVB 3UUZA 1AMHA 5GWZA 3VB7A 1F5KU 2IPQX 3SU6A 1MCTA 1MU6B 3RU4D 1IQMA 1O39A 1C1SA 2ODYB 1C1VH 3EA9A 3FP6E 5C67A 2EA3A 2ANMH 1GHBG 3H7OA 1DWBH 3PRDA 1GGDB 1O36A 4SGBE 2WUBA 2Y80A 2BOKA 3BTDE 1W8BH 1HNEE 5HIZA 3KEEA 5DN6D 2FX6A 2IN2A 4TPYA 1DY9A 3T27A 4CR5A 3SU4A 3TGKE 1TB6H 1TNGA 3SV8A 1FONA 2BD2A 3FKSD 2AERH 2TGDA 4ZCNA 4E05H 3T5FH 3RMOH 1XX9A 2F9BH 3KCGH 1O3GA 2ZTYA 5DP3A 1AIXH 4Y11E 2CGAA 3D62A 2IOTA 2R2WU 4X6PA 1FLEE 5A8YA 1EP6A 1H8IH 1MD7A 4ABIA 5C3NA 2Q6GA 1BTPA 4YTAA 1Y59T 3BV9B 1BT7A 3SW2B 5C1XA 3Q77A 1EQ9A 1FX0B 2Y7ZA 1P11E 1ETTH 1DDJA 1V2UT 1BOQA 1W12U 2ZDVH 1O3BA 2AEIH 2QXGA 1GJ5H 1EB1H 2FLBH 4R8TB 3ZZDA 1T8OA 3L6PA 5JBBS 1O3JA 3SQHE 1HB0B 2OD3B 2W3IA 4KTUA 2ZP0H 2SNVA 1GI1A 3SNDA 2Y81A 1GCDA 1SBWA 1N8OC 4I32A 3F2GA 1TGSZ 2C4FH 2JH5D 1O2OA 1D6WA 4BANB 1V2VT 3BF6H 3TJOA 4ABAA 3WY8A 2ZO3H 1C5NH 1KLTA 3W1EA 5IK2D 4ZKRU 1SGTA 2J5UA 3GCHC 1UO6A 2CV3A 3HPTB 4KTSA 2R9PA 1F0TA 3MO6A 3FO8D 3SJIA 4NWKA 1WQVH 2Y6TA 1T8MA 3RXMA 4B76A 3AASA 1C5VA 3HGNA 3MU5A 1W3CA 4LZ1H 1YPHC 1YPKH 2XCNA 4MNYA 1ARCA 1DICA 1HRTH 5E2PA 3ZZ6A 1L4DA 1T7CA 4FXGH 2KM0A 1TLDA 2YNBA 1Y3YA 3ATWA 3MH7A 3A7VA 2KAIA 4WXIA 2BM2A 5FX5A 2PFEA 4K2YA 1XUJA 3M37A 3KQBA 5DP6A 1GJBB 2R0KA 5PTPA 3BEIB 1XKBC 1P2KA 5EXMA 5A0AE 1LQEA 1IQEA 1SLWB 1YLCA 3BG8A 5EODA 3SZEA 1GCTB 2AYWA 3QTOH 2PGBB 3FVFB 3KQEA 4ZHLU 1C5TA 1B5GH 1QA7A 4YLQH 1LMWB 3QK1A 1D6RA 3T62A 2NU1E 3ZZ5A 2CHAB 3OAAD 3RXVA 3GDVA 3RXHA 3SGAE 2IJOB 1AUTC 1U6QA 1PQAA 3DSPA 2ZDAH 1GL1A 4UE7H 3SYJA 5K7RA 4AC9A 1O3PB 2H9HA 1GI5A 1FUJA 2AIQA 1MKWH 4OS6A 1V2ST 4HFPB 1AFQC 3QX5H 1SOZA 4WF8A 1IQNA 1C2EA 2XC0A 1FPHH 3VB3A 5KEDA 1ELGA 4ASHA 3W95A 4I8JA 1IQHA 1H8HD 3BG4C 3PMAB 1FY5A 1K1PA 2ZI2H 1AVGH 3E90B 3GDSA 2H6MA 1GI9B 1CA8B 2ZGJA 1S6HA 1ZSKA 2ESTE 4WXVA 2JJ1D 5JBTA 5LH8A 1OKXA 1QQ4A 1NPMA 4K1SA 1TPSA 3EAJA 1O2RA 1O33A 3NZIA 4AOQA 3HK3B 3VB5A 3SI3H 5ETXA 1AWFH 1DE7H 1BTYA 4NA8A 9LPRA 1Z6EA 1O5GH 1K0HA 2FI3E 2J4IA 2W6ID 5DPAA 5DGJA 1P12E 3LGIA 3SORA 1H9LB 4UONA 2Y7XA 1FI8A 2O8WA 1MABB 2VB0A 2A4QA 1O2GH 2LP6A 1A7SA 1GPZA 1D3QB 2OLGA 2QXIA 5JB8S 5C94A 3I29A 3F0PA 5L2YH 2AGIX 2EEKA 3GY3A 1F92A 1V2QT 1KXFA 4JK5A 3URCA 2W7UA 1AKSB 1WU1A 4JZFH 3T29A 4Y6DA 1E1RD 4LXBH 2HVYB 1KDQA 3WWBA 1GI3A 1SQAA 1SG8B 1MU8B 1T8LA 1UK4A 3A89A 1QRXA 3TJNA 1S5SA 3I77A 3KL6A 4BNRA 3PYHA 2RG3A 4ISNA 1O2NA 7KMEH 1G32B 3MNCA 1EZUC 2A4RA 2BZAA 1AB9C 3PWCA 5LPEA 1A4WH 5DKMA 1N8OB 1S84A 4PROA 1H8DH 4Y8YA 2VIQA 1ETSH 1P02A 1QNJA 5GXPA 2CK3D 2ZU3A 4X1NU 2VNTA 3GCHB 3V7TA 4X8TH 1MTNC 2RDEA 3TIUA 4UFFH 1CA0C 3UQOA 4O9VA 4X1RU 2VIPA 1RD3B 3DD2H 2GMTC 3SU1A 1HXFH 1PPCE 4MNWA 2ZDLA 1A5IA 3TGIE 1F0UA 4NIVA 1TNLA 2ZG0H 4YLUA 3U1JB 1O3IA 1OXGA 1T32A 3O8DA 1NM6A 3A88A 3CNRA 1GVZA 2ZFPH 5F8ZA 4YXWD 3ZVAA 4ZMAH 1YKTA 1UTKA 5EJLA 3QWCH 2GKVE 3KIDU 1Y8TA 2J38A 5I46H 2D2DA 4E7NA 1FN6A 2WYJA 2PP6A 3ZVCA 1QCPA 4X1PU 2ILNA 8GCHF 3A87A 3BTHE 2FP7B 5EXLA 2V3MA 3M3VA 2BDAA 3VXFH 1GBLA 4TSFD 2HLDD 5G4BA 1K22H 4H4FA 1O3MA 1BMNH 3OY6U 2GZ9A 1EXFA 5A0CA 3UNQA 5B6LA 1SMFE 4YZUA 3UR6A 1UCYK 1VCWA 1S0RA 3NCLA 2PKAB 4I7YH 1BBRK 1Y5AT 2Z7FE 4XRNA 1EJMA 4OS4A 1ESTA 4ISHH 3SGQE 2OBOA 2ZGCA 1WSSH 3RXBA 3F9HA 1AFQB 4DIHH 2PTCE 1ZR0A 2EI8A 2CF8H 1QBNA 1FDPA 1ORFA 5F8XA 4OS1A 1C4V2 1IQLA 2ODQA 2TBSA 4Q63A 3DA9B 2BX3A 2QCYA 1GDQA 3BG4B 1GMCF 4ZUHA 1NROH 5EQRA 1AHTH 1AQ7A 2F4LA 4IS5A 3S7HB 2J98B 2ZA5A 1W10U 2D8WA 1JRSA 2FOAA 5FPSA 1BMFD 3FFGA 1SL3A 1BHXB 3U8OH 2XCFA 3GY4A 1QY6A 1HIAA 1O0DH 2O8MA 4OS5A 1GL0E 1XKAC 4BAMB 1TGNA 1AZ8A 3AW0A 1HIAB 1O2PA 4JYVH 3MQKC 2PKSC 1V2OT 1TNIA 5FHTA 2TGTA 2W5EA 3QGNB 3DUXH 1O5FH 5DP5A 2TRMA 3RU4T 1DXWA 2PSXA 3LC5A 4MVNA 1GI4A 1ZYOA 5LGOA 2VINA 3SQEE 5A8ZA 2LPRA 4A7IB 4DOQA 5DP9A 4IW4E 3NWUA 1YYY1 1O3NA 3OY5U 4IMQA 1AN1E 1W0YH 1XVOA 1YGCH 3AW1A 2OINA 1CO7E 1F2SE 3A8DA 3PV5A 5E0GA 2BQWB 2VVVA 2C3SA 2XXLA 2FOGA 5ABWA 1NS3A 2WPLS 1HAPH 3GISB 1AB9B 2EY4C 4AFQA 1TMTH 1C2LA 4Y76A 5FPYA 3A7ZA 2UUYA 1K1LA 2GV6A 1NFXA 2JJ2D 1YY3A 4OGXA 2A5AA 2ZZUH 1Z6JH 1C2KA 1O2ZA 4IN2A 1MTNB 3S9BA 3M5MA 1CA0B 3GYLB 1P2JA 1UVSH 1NFUA 2G52A 3ZVEA 4FUCA 1TBZH 3HK6B 4KGAA 2BMGB 5A8XA 2GMTB 2HPPH 1BIOA 3Q76A 1O3DA 5EW2H 5GNDA 1G37A 1CQQA 3ESTA 3TVJB 1GMDG 1UVUH 2A4OA 5FBEA 4DURA 1UVOA 1D3DB 5FPTA 4THNH 4WVPE 1GI0A 1C2MA 2GCTC
chains in the Genus database with same CATH topology
1BMMH 2UUKB 2FYRA 2WINI 2H9TH 3SUDA 1V2LT 3EQ0H 1QQUA 3M61U 2XBXA 4XDEA 1UHBA 3K2UA 3H5CB 1C1OA 1ZMLA 3NUMA 1UHBB 1TBQH 2XWBI 1DOJA 2BD7A 1A3BH 3K9XB 2FOEA 4AFZA 3ZZ8A 1L0ZA 1J8AA 1EAXA 1UTJA 1GBTA 4YT7H 5HM2A 3SU5A 1RXPA 3OTJE 3BTEE 1DSTA 1BTXA 2A5IA 5BRRE 4GSOA 1WCZA 3RM0H 2HPQH 2BD5A 4ABDA 2QC2A 4XOJA 4D8NA 1DX5M 4MPUA 3STIA 4BAOB 1E38B 5I25A 1C4Y2 4F49A 3ZVFA 1HXEH 4X2WA 1HYLA 3V3MA 1BTWA 3PTBA 1CSOE 4X6NA 6CHAC 1QA0A 4RSPA 4Y71A 1N1LA 3SHAH 2BD9A 2A7JA 1IAUA 2PKSB 1KXDA 8LPRA 2BY5X 1B7XB 5EGMA 1IHSH 1JBUH 2H1UA 1X7AC 1NN6A 1C5PA 3FZDA 3K6YA 1P3EA 2GDEH 1AD8H 1CT2E 2BYAX 3BEUA 4NIWA 1ZRBA 3SU0A 4MTBA 1HAXB 2ZGHA 1FXYA 3T25A 4ISLA 4AB8A 2FDAA 4U01A 3MH5A 5JBCS 1YPMH 1GI7B 3TJUA 1WBGB 1F7ZA 1EPTA 1O5CB 1C5WB 5JYIA 5DP8A 2OQUA 1RS0A 7GCHG 5LPRA 3GCOA 1QR3E 2QV1A 1VJAU 4LZ4B 1OWEA 2P59A 4K3JA 1QTFA 5EPNA 4UFEH 3TGJE 3QN7A 3RUOA 1EZQA 3A83A 1IQFA 4HZHA 1YBWA 4O3UA 4AFUA 4HTCH 1Z8IB 5FX6A 3FZZA 1NZQH 3TITA 1QB6A 4X2VA 1OWIA 1ANCA 3SJOA 1EUFA 1P0SH 4K5ZA 2VU8E 2GZ8A 2F9NA 1BITA 4O3TA 1IQIA 2XW9A 1XUFA 2R2MB 2V3HH 1HFDA 1PFXC 3D65E 4A5TS 3T2NA 2FOFA 2HLCA 2CJIA 5ESTE 4FUEA 3MHWU 2O8UA 2ZCHP 2VIDA 1TRMA 5JB9S 4DY7B 4MPVA 1ELDE 4BXWA 6GCHF 2BQ6B 3U98H 5GIBA 5A0BA 3JZ2B 4Y7BA 4K60A 4NA7A 1JOUB 3SU2A 2HNTE 3RXQA 3ZZ3A 4A1TA 1THPB 3BIVH 2QXHA 3MNBA 4O97A 5E0JA 1OPHB 2ZU1A 1YP9A 1A0LA 2ALPA 2BDYA 3VGCC 4AG1A 1P2MA 3VXEH 2AMDA 2UWLA 3URDA 2FOBA 2QY0B 1GJ9B 3LDXH 3LGTA 1J15A 3G01A 2DE9A 3KGPA 1O2TA 1NRPH 4AYVB 4FVBA 1W0ZU 1MKXH 1DLEA 2PHBA 1LHDH 1F0SA 2HNTF 4JZDH 2TGAA 4WJG2 4MNVA 2OC1A 1DVAH 1KTSB 3RXTA 1HAYB 3SV2H 1O38A 4X1SU 2W3KA 1O35A 1OYQA 4NFEA 1BA8B 3A84A 1QB1A 1ESAA 1ID5H 8GCHG 1C5QA 3M3TA 6CHAB 4TY7A 2ALVA 1ELFA 2ZQ2A 4HGCA 1HJ9A 3A8CA 3SJKA 1HUTH 1Z8GA 1BMAA 5CHAC 2GT7A 1NRQH 1OP0A 1NFWA 3P8NA 1KTTB 1WAYB 3VFEA 3ZZ7A 5DP7A 3SNBA 1NU9A 4Q7YA 1O2IA 4NSVA 1AZZA 3ATKA 3UREA 1TALA 4ZKOU 1INCA 2SFAA 1H9HE 2XWAA 1G2MA 1BDAA 1ZSJA 2AFQB 1GMCG 3SNCA 1CT4E 1V2PT 1Z8JB 1KLIH 3UTUH 4K8BA 4INHA 1LPKB 1SGPE 1Q3XA 1GHWH 4A92A 2BHGA 1GMHF 1C1WH 1O2HA 1KXEA 1G3CA 5FCRA 1AVWA 1EATA 2KAIB 2EI6A 4CRCA 1GHVH 2FWWA 3GCTF 3H7TA 3AAVA 3ZVDA 1TA2A 5J4SA 2A32A 1C1MA 1QL9A 1T4VH 1YM0A 3GY8A 5GCHF 5TCCA 4AYYB 4B2CA 1DWEH 1PYTD 3D49H 1S81A 2YOLA 2XNIA 2FMJA 3M5NA 1G30B 1FIZA 4AZ2B 1PPHE 1LPZB 4X0WU 4UEHH 1YCPH 4KP0A 1DPOA 3RXLA 1DUAA 2WPIS 2YNAA 3L3TA 1F5LA 1GBMA 8ESTE 2FS8A 3UWJH 2ZPSA 3ODFA 2HGTH 3GCNA 1NTPA 3ZV8A 4DCDA 4GCHF 1BMLA 4ZHAA 2ZCKP 1P01A 1KY9A 3F1SB 5C5NA 1FMGA 3ZZ9A 2BD8A 2JETC 1P04A 2VGCC 3U8TH 3F6UH 4WH6A 4DT7B 2WPMS 3VGCB 4K69A 3IG6B 4CRFA 1WYKA 2BLQA 3QLPH 1RGQA 1LTOA 1BJVA 2G55A 3E0NB 1TGBA 1EASA 2FTLE 1MMJN 1XVMA 1V2MT 1Z8RA 3M35A 3PB1E 2G00A 1MZDA 2DUCA 3BTFE 2QAAA 3JZ1B 5F03A 3VB6A 1S83A 5C20A 3E8LA 1DLKB 4Q2KA 1K1JA 3ZZAA 1MQ6A 4B71A 3VEQB 1VITF 3TLOA 1P05A 2STAE 4YESB 1JRTA 1PPGE 2WUCA 4I8LA 2F9PA 4GUXA 3FP7E 1SGEE 2FTMA 1FY4A 1D4PB 1SGDE 1Y5UT 3SBKA 2WPHS 2NU0E 1KDQB 3MWIU 5CHAB 4WMEA 1A46H 1CBWC 1SHHB 2PW8H 2V3OH 4RN6A 4X1QU 4E7RG 1XUHA 3MFJA 2HALA 3UOUA 1XUIA 5C1UA 1GBIA 2XC5A 4BTIB 1UTQA 1FN8A 1ELEE 4WH8A 3MTYA 4CRDA 1BZXE 1HAZB 1MUEB 3MMGA 2RA3A 4NG9H 4UFDH 4AN7A 5EW1H 1TMBH 3BN9A 1WUNH 2SGAA 3LH1A 3O8BA 3OX7U 1ZTLA 3PMHB 1V2WT 3M36A 2JH6D 4GVUA 2J92A 2XBYA 4X8SH 1TNJA 2UWPA 3GYMA 4SGAE 2GGVB 2QXJA 1EAUA 2CXVA 1T8NA 1C1RA 3ELAH 1ZOMA 1GBJA 1EZXC 2BXTH 1NC6A 1GHAF 1W14U 1O2WA 4Y8XA 1RJXB 2QGRA 1TQ7B 1ABJH 1Z7KA 2BD3A 2W26A 5L2ZH 1THSH 2Z6BD 2BY7X 1AGJA 4ZKNU 1MTSA 1PJPA 2ZDNA 1SFQB 4NWLA 3C1KA 2B7DH 2BDGA 4D9RA 1BRCE 1HV7A 1DFPA 3MYWA 4TWWA 1XUGA 1BHXF 2AGGX 3RXPA 1QRZA 2ZQ1A 3P8OA 2BVXH 2ZFFH 1ZMJA 2QYIA 1SR5C 2H5CA 1DUEA 3P95A 3TH4H 1TNKA 3MU0A 3PLBA 4JZEH 3TK6A 1TX7A 1J17T 4IC5A 5F8TA 5JBAS 2IPHA 1AU8A 2ZGXH 4YM9A 1C5YB 2BOHB 1PQ5A 3GY6A 3M7TA 2K1QA 1UTOA 2CMYA 2R0LA 2BDHA 2BY6X 3E91A 1GBFA 2J94A 5HGGA 3NKKA 1ZTJA 1CHOG 2FM2A 2JETB 1LQDB 2XBWA 1SQOA 2GVFA 1ZPBA 1O2YA 2FLRH 1GVLA 1THRH 5HYOA 2FS9A 2GV7A 3K65B 1CGJE 3A7YA 2A7HA 3TNTA 5DO4H 1C5OH 2ZECA 1C5SA 3QUMP 4FUFA 1DITH 3LC3A 2A5KA 1A3EH 5C1YA 2BDCA 2BX4A 1SGQE 2ZFSA 2ZHFH 1FAKH 1NESE 3E3TA 1ZGVA 1SGCA 1O2UA 3RDZA 2WPJS 1A61H 1HAVA 3PMBB 1ANDA 1RTFB 3UNSA 5HMAA 1YC0A 1CGHA 3U69H 3RMLH 1BUIA 2ZHDA 1ZTKA 4B75A 2J95A 2GZ7A 2VH0A 5AVDA 1TRNA 1C1UH 1CBWB 2FIRH 4I31A 3F9FA 1HLTH 7LPRA 4CR9A 3LONA 2PUXB 2VIWA 1BRUP 1AFEH 1P2NA 1J14A 5EG4A 1F5RA 3ZV9A 4NGAH 4Y79A 1O32A 3ZYDA 4GPGA 1QFKH 3E16B 4BAKB 1E35B 1FZZA 3GICB 2HOBA 3HGPA 4KKDA 3BTWE 1EPTC 5DK1A 1Y3XA 3RU4E 3TH3H 1TFXA 1HAGE 2QF0A 3PTNA 3RXCA 4E06H 1EKBB 3LJJA 3R3GB 1QHRB 1OYTH 1SPJA 2FXRA 1D3TB 1O3CA 1O37A 1P9SA 3LGUA 4IC6A 2XYAA 3W94A 1OP8A 4ESTE 8KME2 1MTWA 4H6TA 3S9CA 4I8KA 6LPRA 2HWLB 1O2LA 2J2UA 1E37B 2LNCA 1GBBA 1NFYA 2WV5A 3T28A 1T31A 1WTHD 2VWNA 2G51A 3RP2A 2F91A 2ZFQH 3ZYEA 1LCYA 1NRNH 4BOHA 3BTKE 1CGIE 1LHEH 4IMZA 4Y10E 3NPSA 2OP9A 3BEFB 4Z0KA 1XM1A 3P8FA 2C8WB 3MU1A 4MLFB 3HATH 1Z1JA 2H5DA 1C9TA 1MH0A 1BBRH 2O9QA 4H42U 3SO3A 3RXDA 3PROA 4AX9H 2VH6A 1WOFA 2Y5FA 1ELTA 2BDIA 2V6NA 2BY8X 2OC0A 1DWDH 2THFB 1YCPM 1BRBE 2P3FH 3LIWA 1NRSH 3O8CA 1BB0B 2ZTZA 3OYPA 2OC8A 5EXNA 1P3CA 1P2QA 3KNXA 3QTVH 4JYUH 2ZHEH 1MD8A 2ZWLH 2SGPE 1O2JA 1TX8A 4CREA 1A2CH 2OTVA 5FBIA 2XC4A 2BDBA 6ESTA 2XBVA 3RC4A 2OXSA 4ABFA 1ELBA 3SNAA 1MQ5A 3EGKH 1L1JA 2WPKS 1EX3A 2G8TA 1TABE 3MH4A 4FU7A 2QN5T 1T4UH 5GCHG 5J4QA 4Y8ZA 3S0NA 1QL7A 1O5DH 3TH2H 1BTZA 1O2QA 4Q7XA 2PV9B 3RXGA 1PQ8A 3IWMA 4JZ1A 1AE5A 4CHAC 3HKIB 1RRKA 1K1IA 1NT1A 2ULLA 4AGKA 3RXSA 4DG4A 4ZXXH 2W7SA 1WV7H 1B0EA 1MKXK 1GJDB 2BLWA 3RC6A 2BLVA 4FU9A 1ZZZA 1FQ3A 4XSKU 2AMPA 3SJ9A 5K0HA 1SGIB 4NZLA 1N6XA 2V0BA 3NXPA 1MBMA 2B8OH 4JZIA 2A4GA 3A8BA 2FO9A 3RXKA 1C9PA 1ZGIA 1C5UA 3U1IB 1M9UA 2PTNA 1OWJA 1HDTH 1FY8E 1VITH 3Q00A 4AFSA 5L30H 3MU8A 1FJSA 3B23B 1V2TT 1TWXB 3STJA 2VIVA 4GAWA 2A31A 1G9IE 1GI6A 4NSYA 1SGFA 1K21H 1V2KT 1EPTB 3M3SA 2HNTC 5JPMH 4UD9H 2SGEE 1SGRE 1UTLM 1ZLRA 1C2IA 2VWLA 1EB2A 3RMMH 3DFLA 3BTGE 2Y5HA 3UFAA 1OP2A 1ABIH 2ZU4A 3PM3A 3UQVA 1QJ1B 4INLA 1PPEE 1N6YA 2BTCE 1DY8A 2GX4A 2JKHA 1EOLA 3SUEA 3ZVGA 2QA9E 1KIGH 1CT0E 1TA6A 2OUAA 1KXAA 5TJXA 3PMJA 1TAWA 3QGJA 5T6GA 5F6MA 2FPZA 4JK6A 4BTTB 2GCTB 5T3HA 4F4OC 3MU4A 1GBHA 2JH0D 3ODDA 3BSQA 2ANWA 1ETRH 1JWTA 2ZU5A 4Q7ZA 2ZIQH 1TONA 3RXOA 2ZHWH 5IDKA 4ABJA 5FCKA 1CU1A 2R3YA 1MTUA 4Y0YE 2PGQB 2VJ1A 3FANA 2FODA 3SV7A 4FUGA 1VZQH 2ZFRH 1SOTA 1HBTH 3LOXA 1VCQA 4KELA 1VCPA 3BTQE 4YOGA 1YCPK 3F9EA 1O3HA 4D9QA 4WMFA 2GCHF 4FUIA 3D23A 1C2JA 4FU8A 5C2ZA 1LDTT 3A7XA 2A2XH 4XFQA 5E8EH 1O30A 1MKWK 1S82A 2FOCA 1GHZA 3SI4H 1IQKA 1HGTH 2P94A 1P57B 3O8RA 3LT3A 1ZJKA 4OGYA 3M7UA 1PPFE 1P06A 3P6ZB 1UVTH 3SNEA 1AWHB 3P8GA 2Q6DA 2Z3DA 3SZNA 1C1NA 1GHAG 3V12A 1CE5A 5FXLA 1LHFH 4ZHMU 1LO6A 1BRAA 3DT0H 1GJ6A 2TPIZ 1K2I1 3RMNH 5EU8A 4DGJA 1KLJH 1GBEA 2Z3CA 3R0FA 3KQCA 2RDLA 2ZKSA 4NZQA 1GJ4H 4XE4A 1AY6H 5EOKA 1TYNA 4ABBA 5A09A 3M5LA 4H6SB 1C2DA 4CHAB 1DXPA 1V2NT 1DANH 1C2GA 1FY1A 2B9LA 1C4U2 4ABEA 4RKJB 1EJAA 1GMDF 1HJ8A 1P8VC 1HAIH 3FP8E 3N7OA 1UCYE 4GHQA 1W13U 1BBRE 5HM9A 1IQGA 1GDNA 1TOCB 1A0HB 3F68H 2BD4A 1XXFA 3MO3A 1YPEH 9ESTA 4U30A 2G4TA 2NU3E 1EAWA 4A1XA 3OU0A 3PWBA 3L33A 2RA0A 1O3FA 3ATMA 1K1OA 1OWKA 4CH8B 4B74A 4J2YB 1TGCA 1GG6C 1Z1IA 1FAXA 3A86A 2BB4A 1UMAH 1ZPCA 3RLYH 2ZPRA 4NCYA 4INKA 3P17H 4JMYA 3LU9B 5GJ4B 1QL8A 3DFJA 2ZCLP 1EP5A 3A82A 2Y5GA 1OOKB 2P3TB 4BXSA 1O2MA 1J16A 1S0QA 3TNSA 3S69A 4ISIH 4MDSA 2SNWA 1RIWC 4I8GA 3EA8A 2ZNKH 3T26A 2AH4X 3TU7H 1Q2WA 1UVPA 3SU3A 3I78A 2OC7A 1GI8B 1WQSA 2VWMA 2P16A 4UFGH 1P03A 4IN1A 3NK8A 2PR3A 5T6FA 2C93B 3RM2H 1K9OE 4IBLH 3EA7A 3B9FH 1A5GH 3PO1C 3SGBE 5LPFA 2EI7A 2AGEX 1G3EA 1C2HA 3P92A 2GTBA 3GDUA 2ODPA 3V13A 1QGFA 3UR9A 3EYDA 1HJAC 3Q3KA 3OSYA 2F9VA 1YF4A 3C27B 2O8TA 3UPEA 1BCUH 1FIWA 1YPHE 4B73A 1DM4B 3M7QA 3MOCA 1W11U 4DIIH 1ACBE 3F9GA 1O5BB 2FYQA 2Z94A 1O3LA 3U8RH 2C8XB 1TX6A 7ESTE 4DW2U 1H9IE 1HAOH