2HSTA

Solution structure of the middle domain of human eukaryotic translation termination factor erf1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
136
structure length
136
Chain Sequence
LSDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Eukaryotic class 1 translation termination factor eRF1 - the NMR structure and dynamics of the middle domain involved in triggering ribosome-dependent peptidyl-tRNA hydrolysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Eukaryotic peptide chain release factor subunit 1
total genus 24
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2006-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2hstA00
2VGNA 3WXMB 3E1YA 3VMFB 1DT9A 4AF1A 3OBWA 3MCAB 2HSTA 2QI2A 3OBYA 3AGKA 2VGMA
chains in the Genus database with same CATH superfamily
3G6EN 4FLTA 1NMDA 3WXJA 1NGCA 2KKZA 4JKAA 2IDOA 2IVPA 3VQ9A 1ATNA 2DFEA 2I5JA 4QS7A 3S41A 4PL7A 4K0KK 3OYLA 3QO9A 4JKEA 2Q3SA 3GBTA 1UA1A 3AO1A 4JYAK 3IMXA 4QCLA 2G8FA 4DFMA 1W7AA 4OPKA 4CESA 4HTUA 5J2QA 4M3TA 3LP1A 3CQXA 2BGGA 3PX6A 3LM9A 5BPMA 4R79A 1DTQA 3D2FA 3ZEUB 3MAQA 2D0OA 3H1QA 2NZTA 1SAZA 3QINA 5SZTA 2E6LA 3MMVA 1JCFA 3O8MA 2VGNA 3OYJA 1Q18A 4BWJA 1N34K 3HL8A 3VQAA 1S5JA 3DLEA 4OKKA 4BG8A 1HJOA 4DQPA 4CD1A 5GIPA 4DTOA 3S3NA 3CCMN 3CCVN 1U4BA 3IAYA 4BG9A 3VTIA 3UB5A 3AVJA 4CJ5A 3KK2A 4B1UB 4JNEA 2E20A 4B3SK 1X1PA 4FM0A 3KVGA 3HM9A 1D5AA 3NH2A 1VQKN 3OYEA 1ZYQA 3D45A 3SJHA 2G8KA 3VF6A 2NRVA 3R6MA 2NUBA 2JGUA 1KVBA 5M1PA 1YI2N 5CY4A 5A2QO 4DTPA 4BRNA 4AH9A 2O8EA 3QIOA 3QB0A 1EKEA 4C8KA 4ISGA 4BRLA 1RDUA 5EU7A 5AJ3K 3CG7A 4CVNE 5EOYA 1L3UA 1NGIA 3NGYA 4DTJA 4DR4K 3SBGA 1N8RO 3TU5A 3HTVA 5LL6Z 1NK5A 4KI4A 3KKSA 1QZ5A 5CR4A 4BGAA 3O3HA 4J2BA 1LAVA 4IDKA 5KQDA 2GX9A 5AZJA 4IOAL 5KPZA 3WXMB 1OVQA 3AGKA 4OKJA 4LF8K 4FYDA 4EHTA 4FJHA 4BQLA 4NLBA 3OYKA 3ZX2A 4EP4A 1X9MA 1IBLK 4DTRA 2FBYA 4OO1J 5FROA 2IVNA 4AHCA 4HCCA 3T69A 4A2BA 2YHYA 3OVNA 2BE2A 4BWMA 2F9WA 3V9UA 1T8EA 1YT3A 2BANA 2GV9A 3TSUA 2PY5A 4FWOA 3WXIA 1RTDA 1Z25A 1Z6RA 2E6MA 5M1QA 1EP4A 1O13A 4DF4A 3IRXA 4ZTJA 4CGGA 4K43A 2UUCK 1Q7YO 1BA1A 3T1AA 2NNWA 1CZ9A 2P9PA 1DEJA 3K5NA 3K59A 4E7JA 3ZSVA 3QEXA 3ZSRA 3VA0A 3C6HA 1ZBSA 2LSNA 1QTMA 2YNGA 3IDHA 4FWSA 1C1AA 4NO7A 2VQEK 3VGKA 4DTXA 3NVMA 3GDQA 1U2VA 1VQ7N 1EX4A 3V9SA 4DTMA 4CJSA 4EAHD 4E19A 4ID5A 3CFOA 4DV3K 5IWAK 3NH1A 1WSIA 3HT3A 1EO1A 3QFPA 1QQMA 1XNRK 2QWPA 1BHLA 4JAXA 5C24A 3KK7A 2HBLA 5F1XA 3AV9A 3OJSA 1CXQA 3HVTA 3V4IA 1GLJO 3EYZA 3ENHA 3EO3A 4B9LA 4DR3K 3WNHA 1M1KO 4B3OA 3QERA 4A57A 4FZXC 1NLVA 5AQLA 5FPMA 3V1RA 5AFUA 5C0YA 3J7AP 2JLEA 5ADXH 1S1XA 3I8DA 1J5EK 2QI2A 1ZBLA 1D4XA 5TKYA 2G8IA 1HUXA 3DLRA 1Y64A 3DLBA 2J4RA 3DLLL 2HBKA 4Y0WA 2YI1A 4CZLA 2O8CA 2KHOA 1Z26A 1JL2A 3MECA 4JKGB 3NGZA 4BACA 2Q36A 3VENA 3LDLA 1ITGA 3MCAB 2P5OA 4WQ5C 4CZMA 5J1EA 3C95A 2ITMA 1QHTA 4H0YB 3PY8A 3J81O 3RTVA 4E1JA 4FO0A 5J2NA 3I33A 3WXLA 4KREA 4DS4A 2O8FB 1JXEA 1BCMA 3K9KA 3PV8A 3U3YA 3C6AA 3CCEN 1BU6O 3AVNA 2YHAA 3K5OA 1XUPO 3LDNA 4FJGA 1E4GT 4X64K 1VSEA 4PHTX 3MEDA 5DK5A 3VEWA 4O5FA 1C0GA 4OJRA 5EXWA 2I7NA 1VSKA 3V9XA 2B5JA 4BGBA 4RTFD 4DSJA 4G1QA 4FWNA 4FLWA 4B9SA 3SUOA 3PO4A 1WN7A 3C94A 1JXBA 2V51B 1VQPN 4IWVA 1NGBA 3FE1A 3DWLA 4IOCL 3SLCA 3KHYA 4KV8A 1J9AA 3EE9A 3ZT2A 1TGOA 1ATRA 5I3UA 4BE0A 2UXBK 2KW4A 1J6ZA 4N76A 1VSHA 5EX5A 4JKGA 4W5OA 4J2EA 3OYCA 1HPMA 4FVUA 1YVNA 1NKCA 3VPZA 1S9GA 1WSGA 4Q5VA 5JS1A 4A61A 4DWIA 5KPTA 4AILC 1JLFA 1LW2A 3QEPA 4E3SA 5FPEA 2XHBA 2CGLA 3M5RA 2FF3B 3SQ4A 3K9JA 4RW9A 1U49A 3HP6A 5M1KA 3AO5A 1HYSA 3RSEB 3KKRA 2E88A 1KAYA 3D6RA 4LFAK 3OYBA 3FZMA 4YDUA 1FW6A 1T44A 2WOMA 4ISFA 3ZSZA 4Z0UA 4DCHA 1L5UA 3HPGA 1W97L 4V19S 1RBTA 1RGIA 2D5RA 3E1YA 2ASPA 2ZF5O 1QHAA 5AQKA 4F8RA 1G99A 4E7IA 4AHVA 4CJWA 3LZIA 2P9KB 4BQZA 3U3GA 1JCEA 4X65K 1TK0A 3SJJA 4PA1A 2QTDA 4B9MA 3DI6A 3GG4A 1HR0K 3AVCA 2HBMA 1VAZA 2VG7A 4BRCA 3KLEA 2UYTA 3B6OA 4BVOA 3NE6A 1VSMA 4WQ4C 4LSLA 3BF1A 1JLGA 4BC3A 1YJ9N 2X78A 1Q8IA 2P9KA 3C65A 4JKCA 1S6PA 1VRUA 2R7YA 3TR8A 3BP8A 4E1NA 3CQ8A 4IJAA 3T3FA 2NRHA 1BA0A 3THWB 1YJNN 3ZEUA 5EVZA 4CZGA 1YITN 2HW3A 1N32K 3KLGA 3IFRA 4ELUA 3L2VA 4B8AB 5C10A 3P1GA 1YUWA 4FJLA 5JMVA 3MX5A 3A0IX 5LJVA 1RDWX 1KLMA 4FZYA 3OYAA 1BISA 5J2PA 4DQSA 1Y97A 4FLYA 1C1BA 3ZT1A 1K9MO 4CHQA 4FM1A 3TARA 1S3XA 2DFFA 5IT9O 1TL3A 3WXKA 2QM1A 3AA2A 2HHTA 4M45A 4CJ4A 4XIUA 3HPOA 3KIOA 2YNHA 1GLCG 3SCXA 5AZJB 4PKGA 4CERA 1RNHA 1RTIA 3HYFA 5LJWA 5M1OA 4DQRA 2YNIA 2QK9A 4KH6A 5GINA 4K42A 4FM2A 1R59O 3VQ8A 4OLAA 3NF7A 1S1TA 5E26A 3ZYYX 3QLHA 4PL8A 4W5RA 1GLAG 3FFIA 4NCGA 4HWIA 4DU3A 3RR7A 2FSJA 4CBUA 4BY9C 3PIPL 1IKWA 1NGGA 3AA4A 2WTUA 3RMBA 4QOZB 3UKUA 2VWKA 3VEVA 3VOVA 4B9QA 4JI7K 5ELZA 3SNNA 3NHGA 3AO4A 4CZHA 4O0JA 2VYPA 3G25A 4C8NA 2OPRA 4CFAA 5FPDA 2Z1IA 4BRFA 5JICA 4DTUA 1J53A 4CF9A 4MDAA 1E4FT 3QICA 2OZMA 1LCUA 1P90A 2W42A 1VQMN 1XI1A 1IG9A 3H6EA 1U04A 4MO5A 3MN5A 4FWKA 5C15A 3O1WA 5BREA 4AM7A 4H0XB 3EN9A 4LF7K 4LH5A 4JK9A 2Q2RA 1XC3A 1BG3A 2HF3A 5AQPA 3RRGA 4JI5K 3N4QA 3VQ6A 2ZJQL 3SUNA 4IEIA 1SL0A 1D9FA 3CJ7A 2CH5A 2P9SB 4NXMK 5FRNA 1IH7A 4CZFA 1RT6A 3CJCA 3L4QA 2E2OA 4CZEA 2BH1A 2KFZA 3CERA 3T19A 1K8AO 1HX1A 3LAKA 3I56N 4CZIA 3FR0A 4IFYA 4CJQA 3K2PA 4CJKA 4JS4A 2DPNA 4BVPA 5KI6A 4CZKA 3OYDA 1OH5A 4Z4CA 1KXPA 4GW6A 3WQUA 2E1YA 3THVA 4RW6A 5LMUK 1ZBFA 1ASVA 5HRNA 4HVJA 5JVHL 1UWBA 1JKHA 4CJEA 3ZT0A 2PBDA 5HP1A 3GL1A 1NJZA 2ZGYA 1MU2A 2EWSA 3OY9A 3ZETB 3ZSXA 2YX6A 3M6GA 4BRQA 4CHPA 3NBPA 1OH8A 4Z4HA 4GV3A 2E2PA 3AVKA 4ELVA 3FZFA 3HBTA 4C8MA 2ZD1A 3VQEA 3JAMO 4KH5A 3EKSA 1HRHA 3NF8A 2QWRA 5AQTA 1HJRA 1GLLO 1EQYA 3CM5A 3THYA 3IKMA 1RFQA 3K5MA 3NDKA 3O4NA 3KD5E 3BF3A 2F4VK 1K8KB 2D4WA 1WBBA 3TAPA 1IO2A 4M3XA 4Z94A 2UXCK 4CJRA 1TKDA 4IG3A 2GWKA 4FVMA 4BRPA 1QZ6A 4DV7K 3U6FA 3NCIA 3KWGA 4YOWA 2IC3A 1NBWA 2HMPA 1RBSA 1M90O 1BL3A 1C0TA 5E41A 3NH0A 3RMAA 2WC9A 4BC5A 2VQFK 1NK7A 1JLCA 5EY4A 1S9EA 2YHWA 5KPRA 3ZT3A 1IKVA 2HNYA 3PO5A 3LP2A 2Y1JA 3BY5A 4NLCA 4CGFA 3CJAA 1WUAA 3CM6A 1KTQA 2GTDA 3SYZA 1TVRA 4E89A 3LDSA 4IFEA 3VQPA 1B9DA 4MFBA 4H4OA 4A59A 4CK1A 5AFUH 2P9LB 4KRFA 4H5TA 1HKBA 3A5NC 3I8BA 1RDDA 1RCHA 4FXDA 2QWMA 4CJVA 3FFKB 3TAFA 2P9SA 3QDKA 4DF8A 3NFAA 2KZZA 3JSMA 3L0QA 4DU4A 1WB9A 3CCUN 4B3TK 2PYJA 2O8DA 4MLEA 2ASOA 2H3GX 3V1OA 2HVHA 4IEEA 4JHDA 3OYNA 1P8ZA 4B1WB 5C12A 2ZM6K 1NGHA 4JI2K 3DLKA 2WFBA 5BN9A 4DS5A 4OPHA 3AA5X 1MWMA 2QXLA 4YDUC 4CEZA 1J5OA 3EE8A 2FC0A 2P9IA 4RG8A 3I55N 1HNXK 4L3QA 3ATUA 2Q97A 2HHXA 4MLHA 3VN5A 3A5LC 3E9OA 3TAQA 3E9PA 4JKFA 4PKIA 2ITGA 3CI5A 1NK6A 4IXCA 3ID6A 4EZ6A 3NMUA 2A41A 4RCHA 1C6VA 3VF4A 3LWMA 3R9PA 1VQ8N 3U9DA 1S1WA 3K58A 3OW2M 4CECA 1SQKA 2E1ZA 4FPAA 5AQMA 5JLHA 3L3VA 3CC7N 3E9LA 3ZX0A 3OYHA 2P9LA 3SAFA 3V81A 1LWFA 3DOKA 5CYQA 3ITHA 3TTFA 3S3OA 1RT4A 1YXQA 3CIPA 3CMAN 4FOEA 2E2NA 1C0MA 2Z1HA 2FBXA 2O4IA 4LH4A 1L3VA 1WSJA 3DRSA 4YFUA 1OVYA 4HUEA 3MK6A 4I2PA 1TAUA 2X6SA 3U8XA 3VQDA 3LP3A 3L6QA 2XY5A 2F7TA 3UIQA 4R5PA 2XO7A 4CEOA 4E7HA 4PKHA 4LSNA 4K8XA 3L8BA 3NF6A 3D0PA 1MDUB 1FK9A 4GVEA 1KRPA 4RW8A 5BR8K 5HROA 4FW2A 3CPWM 4DUZK 3M3ZA 4BRAA 3SMSA 3OBYA 4O0IA 2QEXN 4M3UA 3DRPA 5C2DA 1U45A 2KTQA 1NMNA 1K8KA 4XH5A 2P9UA 4CEQA 3WNFA 3NVKA 2Z1JA 4LC9B 4DMNA 4IG0A 4Q0BA 3DAWA 3P5JA 1X3MA 1LW0A 4M42A 1YHQN 5B8HA 4CGIA 2NRZA 1TK8A 1ZXOA 4Y1CA 3P38A 4FK0A 1TUUA 4B1VA 4M3WA 2VG6A 1QQNA 3U4LA 5BRDA 2CGKA 4OLBA 4B1XB 1XHXA 2NRRA 4OPAA 5AQIA 1H1VA 4O44A 4YOUA 3HOSA 3THWA 5D3GA 3DJCA 2P9NA 4KHNA 4H5RA 2XY6A 4J2DA 1ASWA 2ETJA 2QWLA 1MA9B 3V6DA 4N56A 2FSNA 2QXFA 4FJMA 1QVGM 5FRMA 1Z05A 2YJEA 3QBXA 4BR0A 5I42A 3OJUA 1Q9YA 3RMDA 1LAWA 4JKBA 2PAVA 3T1HK 2A3ZA 3AVLA 4BR5A 4HUFA 3Q7BA 4IO8A 4CEFA 4DQQA 1E3MA 2Y1IA 4J2AA 3CC4N 2VG5A 3LWLA 1J54A 3O08A 4FCYA 3ID8A 1QSSA 4O4GA 1QQCA 5CZ2A 5AQJA 4JD2A 3UKUB 5BRFA 3THYB 2UU9K 1RBRA 4O55A 3TTCA 4CHYA 4ZTFA 3C6TA 1RBUA 4GNIA 1B9FA 1NKEA 3QEWA 1RT7A 3LANA 3QEIA 4Z4EA 1CLQA 2Z1GA 4ILJA 4H4MA 4QS9A 1EWRA 1WNSA 1QS4A 4W5QA 4L8RB 2YJFA 4JD2B 4BDZA 4CFDA 3KTQA 1QVFM 3PX4A 1N6QA 2G8VA 5F2RA 3H3OB 3OS1A 2F9TA 5KRSA 4FWLA 4DV1K 1VQ6N 4JN4A 4CF2A 3SMPA 4CIEA 3IUCA 2RHKA 4FWMA 3HI0A 3T7ZA 4O8UA 4BC2A 1UA0A 1T3VA 3MXIA 1OKJA 1YJWN 3SPZA 3HP9A 3JYTA 3CXCM 3O3FA 4N5SA 1SL2A 4CI6A 4HHTA 3TI0A 2HMIA 2EHGA 5DMRA 3AA3A 3CFRA 3LM2A 4AM6A 3TABA 3OYGA 4BRMA 4YOYA 5FPNA 2AJQA 1HKCA 2V52B 3VEXA 2OPSA 4XH1A 2HVIA 4I6MA 3MXJA 3BZKA 1XMOK 4RWTA 4C8OA 1Q9XA 4CW7B 1T03A 4W5NA 3AGRA 4CEAA 3OYIA 1GOBA 4I6MB 1RILA 3WNGA 2VCPA 4LF6K 3EL2A 2OTJN 2IIRA 1HPZA 5JS2A 4CJ3A 4BDPA 4KI6A 3HSCA 3O9TA 3SQ0A 3ISNC 3AVGA 5CHIA 1XMQK 4IZ9A 1GOCA 3I0RA 2X74A 3CQYA 4GMJB 2A42A 3VGLA 1RT3A 2HNDA 4FLZA 5M1NA 1NJXA 2XY8A 4KAZA 3MN6A 3P83D 3ZLJA 4DLGA 1IBMK 3KLFA 1QSYA 4F9OA 1S1VA 1NK9A 2E2QA 3O80A 1GLFO 4FL9A 1VQ5N 3MN9A 2RE2A 3H1VX 1KVCA 1NK4A 4Z4GA 5HL7L 4B9UA 4I9LA 3TWHA 5CE3A 4NCAA 2D0AA 2F8TA 4KFBA 3VTHA 2ZJRL 2NRTA 4UQGA 3CPEA 3OS0A 4NB4A 3OA9A 3H08A 1ZBUA 4FJJA 1JLEA 2A1SA 4B08A 1RBVA 5ADXA 4JK8A 3LDOA 3MN7A 4KO0A 5AQQA 4FJ7A 5AQOA 4CBXA 1U6ZA 2CGJA 1WAJA 4CZJA 4DUYK 1ZBHA 4DFPA 4IOXA 3O9UA 3VERA 3FLCO 3WQTA 4JK7A 3SPYA 1T6DA 4JS5A 4MQ3A 3CCLN 3RRHA 3SV4A 4GV9A 4CFBA 2JWLA 1RT5A 1G15A 4PQUA 1VHXA 3RR8A 3WEEB 4BRIA 2OA8A 2IOCA 2ZGZA 4AQYK 2F96A 2XY7A 2D1KA 5KRTA 1NNEA 1NGEA 3L2UA 3PSFA 1EXQA 4BR4A 2G8HA 4WFNL 4HCBA 3ZX3A 2WBNA 4DR6K 1BIZA 3RMCA 1K6YA 1DGKN 1XQSC 1MWKA 3OHRA 3MWPA 3MX2A 2OPQA 1HQUA 4B9VA 1XNQK 3EEQA 3P39A 5DM7L 5MLCQ 4DTSA 3QNOA 4ILHA 4M41A 3OYFA 3TSPA 2W40A 2ASMA 2F8SA 3DMJA 3EKUA 2QWOA 1N36K 4DHYA 4OPJA 3AARA 4YOTA 3I0SA 4JI0K 2E4LA 1BGXT 1FJGK 1JLAA 1NU0A 3HVRA 3CC2N 3QIPA 4B3RK 1DTTA 1YAGA 3AO3A 1KVAA 1QSLA 3H46O 1FKPA 5I9EB 1IG8A 1L3TA 1T7PA 2GWJA 3ALYA 4DV4K 4M7YA 3KZBA 1HYZA 1A5XA 4FK4A 4WCEL 1XC9A 5HRPA 3QBWA 4F3TA 4DSKA 4OGCA 3H3NO 1VSFA 1TV6A 4M3RA 4CBWA 1GLBG 4ICLA 4ILGB 3KLHA 4X62K 3K0SA 4CIGA 1UAXA 1I94K 3R1XA 2UXDK 5AZIB 1HNZK 3VQ7A 3ULEA 1JL1A 3SAHA 3L2RA 3QMLA 4FJXA 3SUPA 4H0TB 1BUPA 4X66K 5DM6L 1U48A 4DR7K 4KTZA 3LDPA 5AQFA 3W0LA 4K25A 5JVGL 1VSDA 2ATQA 4B3MK 2E5LK 3G71N 5GADP 3ENOA 3UKRA 1HLUA 5H1SQ 3HO1A 4G9ZA 1S6QA 4NYFA 2OTLN 4YOVA 3VEYA 3A8YA 2PYLA 1GLDG 3TTDA 3M8SA 1A5VA 3AVFA 4FJ8A 4I2QA 4LY7A 3V1QA 4KHQA 3SQ1A 1Q81O 3CCRN 4WYBA 3A5MC 4C8LA 4CFCA 1DKGD 5KTQA 1TUYA 3KK3A 4E7KA 3JXUA 2VGMA 1TYQA 1N33K 3O1BA 4C1NI 3EZ5A 4DU1A 2QKKA 3NF9A 4FK2A 2YNFA 3CMEN 3VF2A 3HOTA 4FW1A 4GKJK 3G4SN 2A5XA 1KCFA 4FJ5A 2O4GA 1TYQB 5AQHA 4ELTA 4F3OA 3HPHA 4BRGA 4IJNA 3O9SA 3KD1E 4U7BA 4WQ5A 2HF4A 1BOTO 4FOIA 3CCSN 3VETA 3L4IA 3MWTA 4H8KA 4M3YA 1W9HA 5LY3A 2P51A 2BUPA 1V4TA 1VSIA 3JS6A 3D2FB 3VGMA 4H0PA 3ASMA 3EY1A 2IVOA 1KC8O 4LF5K 3ULDA 3D7EO 4CK3A 3E66A 1JCGA 3RSEA 5BR9A 3SBTA 2FF6A 4YOXA 1ESVA 4CK2A 4JRQA 5F0XA 1BQNA 1X9WA 3LALA 4FWPA 4E7LA 4KKOA 3CFPA 3QEVA 2O8FA 1JJ2M 4BROA 1SKSA 4CEBA 3LP0A 2AA4A 1X3NA 3S3MA 1X9SA 4N47A 4KHWA 1NWKA 1NGDA 4FLUA 3CCJN 1CZAN 1NGJA 1N5YA 2P1JA 4F2RA 3KWIA 4CD3A 4B9NA 2P9IB 4PWDA 1ATSA 2WUSA 2RPIA 2YHBA 2UUAK 3CJ9A 1BDGA 3AVAA 2OZSA 5HLFA 4BRKA 4M63C 1C1CA 5HOOA 2D0CA 1EETA 1Q82O 5E84A 4LFCK 5AQGA 3WT0A 2RN2A 1U47A 1D8YA 4LF4K 3F73A 3DXKA 1F21A 4C23A 2B4JA 4K41A 4DSFA 2W41A 4EP5A 5SWMA 1VQLN 4IKFA 1TKZA 2PFUA 3BEXA 4I9QA 1YTUA 1X9JA 1YIJN 2GEMA 1OH7A 2HBJA 2OPPA 1NK8A 3C7NA 4H0OA 2ZWHA 1SZ2A 5AQVA 2EX3A 2HB5A 4E1MA 3OS2A 4WFAL 3HSTB 3J7YP 4DTNA 1RT2A 5KGWA 1R0AA 4CEDA 4DV0K 4M7XA 5AQNA 1NGAA 3FZLA 5AZIA 3PUFA 2BDPA 4DR1K 1T6CA 3M8RA 2YHXA 1W2BM 4DB3A 3MCPA 3Q7CA 5J2MA 1YTAA 2FLOA 4CHNA 3M1FA 4J8FA 2HHUA 2YV0X 2GUIA 4O5BA 4FPBA 1SS6A 1I3AA 3G10A 4DV6K 1LV5A 2FXUA 3CCQN 2D0BA 2NLXA 2FBVA 5C25A 3GE1A 1RTJA 1JLBA 2B6AA 3VESA 2KQ2A 2HHVA 2O8CB 1LWCA 3MEEA 5LMNK 1SKWA 2RF2A 3DXMA 1WBDA 3BDPA 2P9PB 4JHDB 2X6NA 4BE1A 2GBZA 4NCBA 4QAGA 1EWQA 4CEEA 3HZ6A 2QWQA 4MO4A 2O8DB 4FLXA 3LPTA 2OYQA 1ILYA 2O8EB 3LPUA 3SAGA 4JRPA 3GOIA 1I39A 3C6UA 1KQSM 2A40A 2GELA 4H0VB 3HM8A 3VQQA 3AO2A 3J7ZO 4DG1A 4LF9K 4RW7A 3G0ZA 3AAQA 2P9UB 3F9MA 1KSPA 2GUPA 3LAMA 1VRTA 4FJ9A 4MDBA 1A5WA 3DXMB 1KLNA 5GAEP 1IKXA 4FLVA 1T05A 4KPYA 4DQ8A 1WAFA 4B9TA 5FDLA 4WF9L 1HNVA 1O1WA 3ZSYA 1FKOA 5BPNA 1CZBA 4KB0A 2HHQA 4E0DA 2HHHK 1TK5A 3VEZA 4LFBK 3AAPA 1GOAA 4I7FA 3SV3A 5CZ1A 2HOEA 4B8CA 4GV6A 1U2VB 4AHUA 4CJUA 5AQYA 1D9DA 5K14A 4BE2A 2QA4N 3CYMA 4HUGA 3MXMA 4ZHRA 1NKBA 4WQ4A 3HRGA 1SKRA 1QE1A 4O8KA 3OTOK 4BRHA 4BDYA 3TAMA 3LDQA 3THXA 2P5GA 4XEIA 1BCOA 4BR9A 3B8AX 2XRIA 4OKEA 3TSQA 3RWUA 1CXUA 1BI4B 4DFJA 2V7YA 1DT9A 4FJIA 5HRSA 4KTQA 2VWBA 4JI1K 5FLXO 3SQ2A 3A5OC 4DLEA 1RDCA 5AQUA 4Z4FA 2Q0RA 3CETA 4DR5K 1NJYA 5C42A 1YVUA 3O9QA 3H45C 5AQRA 5HBMA 2NRXA 3F5TA 1LWEA 3WEEA 5KQ8A 4EHUA 3P4IA 4H5VA 1HMVA 2HNZA 2G8WA 3J80O 1UOCA 5JLFA 2G8UA 2UUBK 5AQZA 1YF5L 1QQOA 4AHSA 3R3LA 2HHSA 2DFHA 2YCHA 3BGRA 1L3SA 4CJFA 1TL1A 4IBNA 5AQXA 1VQ4N 3DLGA 1DLOA 2IGIA 4CJLA 4DSEA 4DFKA 1ASUA 4W5TA 1NGFA 4RW4A 1ZBIA 3UKRB 4FJKA 4IO9L 3IS9A 4DQIA 4IFVA 1HNWK 1KFDA 3PLAA 3QNNA 3ATVA 3V9ZA 1VQ9N 4CCHA 4WFBL 3L2QA 3CJ1A 4KBOA 1NM1A 3CD6N 4KHYA 3P31A 5KGXA 3F9KA 4U67L 3C7NB 3ZSOA 3A2FA 3O4WA 4WE1A 4F4KA 4DR2K 2A1RA 4BR2A 2I7PA 4BREA 3CF5L 2IS3A 4FJNA 4BRDA 4YY3K 3KJVA 3VA3A 4CE9A 3OYMA 3AVMA 2O8BB 4F2SA 1SV5A 2QW9A 2ZJPL 2E8AA 1S22A 4CF0A 3O3GA 2DY4A 2O8BA 4AHTA 1NOYA 4C1NK 4XH4A 2ZE2A 2P9NB 2KFNA 1ZC6A 1KFSA 4KB1A 2A6AA 3MEGA 4EFHA 3D2EA 4CHZA 3BZCA 4NXNK 1WSFA 4H5NA 3HK2A 3QFUA 4KH4A 2VWJA 3J8AA 4AHRA 1XHZA 3W3DA 4CF1A 3N4PA 3QESA 3VQCA 2V7ZA 1BO5O 3OBWA 3UE5A 5GAHP 2KZMA 2CH6A 4BR7A 4A62A 1S1UA 1TKTA 3DM2A 1BI4A 4N41A 2OCEA 1K73O 2HHWA 1KAXA 5BN8A 3FZKA 4Y1DA 3THXB 4CIFA 3HJFA 5HRRA 2YKMA 5GAGP 5AQWA 3ZSQA 1RDBA 2W6LA 1NK0A 4Z4IA 2OANA 4JEPA 4K8ZA 4B1ZA 1XWLA 3M8QA 4ID1A 4A5AA 1VK0A 4YHHK 3AVIA 4IDHA 4FWRA 4KHUA 3O4QA 4JI3K 2JWKA 5BRHA 1WOQA 2DTUA 1B92A 3WNEA 2Q1NA 4NYNA 3WUHA 1OH6A 4FSVA 4HTLA 5M1FA 1BQMA 5TKWA 3QETA 4YNQA 4JI6K 2PZSA 3E01A 4GY2B 1IBKK 5BPLA 4JLHA 4BC4A 4CHOA 3HXMA 3EZWA 2NRWA 1RDAA 1WLJA 1KAZA 3O6WA 2WONA 3R8EA 1W0HA 3LL3A 5AR0A 1TAQA 4JI8K 1SUQA 3ULEB 4EIAA 4QS8A 1VSLA 4KTWA 4KHPK 3L2WA 1IJJA 2YKNA 3BUZB 4CJPA 1HYVA 1FXXA 3V9WA 1GLEG 3SUQA 4JI4K 1NJWA 4DV5K 3F2KA 5GIOA 2Q0UA 4YORA 3TANA 4DSIA 4PUOA 4DV2K 1LOTB 4B1YB 4OVLA 3NAEA 3TAGA 3FZHA 4UY8O 4DKWA 1JLQA 3VMFB 1HKGA 3ZETA 4EZ9A 4GKKK 3U9ZA 3VQ4A 3CHWA 4JKDA 4PY5A 3CJBA 2W6KA 3AY9A 2FSKA 2IAJA 3RVCA 1VQNN 3T1YK 2ZQBA 3MDQA 3SI6A 2AP1A 4JV5K 4CJTA 2KLAA 3ZT4A 1C0FA 3PIOL 3C0BA 1NJIO 3DLHA 4KHSA 3DYAA 3AVBA 3NGIA 1RT1A 3DOLA 3VEOA 3KLIA 4AF1A 4CGDA 1V4SA 3SZ2A 4DSLA 1RTHA 5C2FA 3ZSWA 2FBTA 4OGEA 3PX0A 3DRRA 4A5BA 4CGJA 1NOZA 4OX9K 4LD0A 3PSIA 4H03B 3L3UA 4JKHA 4M3ZA 2QKBA 1Q86O 4CGHA 4H5WA 3IG1A 1WSHA 5AQSA 3ZCMA 3AVHA 3S9HA 1S72N 4FWQA 3K5LA 3TAEA 1WSEA 1BWFO 1TKXA 1HNIA 2QWNA 1SL1A 4TSXA 3B6PA 5CYMA 3FGUA 1NG9A 3VQ5A 1IKYA 4ISEA 3DXKB 1C0UA 5T7BA 4GVMA 3KK1A 3D2EB 3ENBA 4FZZA 1VSJA 1KD1O 3O5BA 1IV0A 3K57A 4CF8A 3M8PA 4CJ7A 2D0PA 3LZJA 2BTFA 3TPQA 2RKIA 2Q31A 1HQEA 1VQON 4A2AA 1REVA 3O9RA 1BIUA 2HSTA 3SK3A 3VQBA
chains in the Genus database with same CATH topology
3G6EN 4M7XA 4JKBA 5AQNA 1NMDA 2PAVA 1NGAA 3WXJA 3FZLA 2A3ZA 5AZIA 1NGCA 5JMVA 2KKZA 4JKAA 4BR5A 2IVPA 3MX5A 1ATNA 3Q7BA 4IO8A 3A0IX 1T6CA 5LJVA 1RDWX 2YHXA 4QS7A 3S41A 4PL7A 1W2BM 4DB3A 3MCPA 3CC4N 3Q7CA 3GBTA 4JKEA 3O08A 3ID8A 2FLOA 3M1FA 4J8FA 5AQJA 4FPBA 1SS6A 4JD2A 1K9MO 3IMXA 3UKUB 5BRFA 2FXUA 3CCQN 3TTCA 2NLXA 1S3XA 3CQXA 3WXKA 2QM1A 3GE1A 3LM9A 4GNIA 5BPMA 4R79A 3VESA 3D2FA 3ZEUB 1GLCG 5AZJB 2D0OA 3H1QA 2NZTA 4ILJA 1SAZA 4PKGA 4QS9A 3MMVA 1JCFA 2YJFA 5M1OA 3O8MA 5LJWA 4JD2B 2VGNA 3DXMA 1Q18A 1QVFM 4KH6A 5GINA 2P9PB 4K42A 4JHDB 1R59O 5F2RA 3H3OB 4BG8A 1HJOA 2F9TA 4FWLA 1VQ6N 4JN4A 3SMPA 5E26A 3HZ6A 2QWQA 4MO4A 3ZYYX 4CD1A 4PL8A 5GIPA 3CCMN 1ILYA 3IUCA 2RHKA 4FWMA 3CCVN 3HI0A 3T7ZA 3SAGA 1GLAG 4O8UA 4BC2A 3GOIA 1T3VA 1OKJA 1KQSM 1YJWN 2A40A 4HWIA 2GELA 4H0VB 2FSJA 4BG9A 3VTIA 3HM8A 3CXCM 3UB5A 3J7ZO 4CBUA 4BY9C 3PIPL 1NGGA 4CI6A 3AAQA 2P9UB 3F9MA 3UKUA 3VEVA 5JVGL 2GUPA 3VOVA 4B1UB 4B9QA 5ELZA 4JNEA 4CZHA 5FPDA 2VYPA 3G25A 3LM2A 4MDBA 2E20A 3DXMB 4AM6A 4BRFA 4BRMA 3KVGA 5JICA 5GAEP 4YOYA 1VQKN 4DQ8A 5FPNA 3SJHA 1HKCA 2V52B 3VEXA 4XH1A 3VF6A 4WF9L 2NRVA 3R6MA 4MDAA 1E4FT 3QICA 4I6MA 1LCUA 5M1PA 1P90A 5BPNA 1YI2N 4RWTA 1VQMN 3AGRA 3VEZA 3H6EA 4MO5A 3MN5A 4FWKA 4I6MB 5C15A 3O1WA 4BRNA 5BREA 3AAPA 4AM7A 4H0XB 2HOEA 3QB0A 4GV6A 1U2VB 3EN9A 4ISGA 4BRLA 2VCPA 4JK9A 1RDUA 5AQYA 2Q2RA 1XC3A 2QA4N 1BG3A 5EOYA 2HF3A 5AQPA 3EL2A 4WQ4A 1NGIA 3N4QA 2OTJN 3SBGA 2IIRA 3HRGA 3TU5A 2ZJQL 1N8RO 3HTVA 4IEIA 4O8KA 4BRHA 1QZ5A 3HSCA 3O9TA 5CR4A 4BGAA 3LDQA 3CJ7A 2CH5A 2P9SB 5CHIA 4XEIA 4CZFA 4BR9A 5KQDA 3B8AX 3CJCA 2GX9A 3L4QA 4IZ9A 5AZJA 5KPZA 4IOAL 3TSQA 2E2OA 3WXMB 3AGKA 4CZEA 3CQYA 3VGLA 2A42A 2V7YA 1DT9A 4EHTA 2BH1A 5M1NA 3CERA 4BQLA 1K8AO 2VWBA 3MN6A 4NLBA 3ZX2A 1HX1A 3I56N 3A5OC 4CZIA 5AQUA 3FR0A 4F9OA 4OO1J 2Q0RA 3CETA 2E2QA 3O80A 2IVNA 3O9QA 1GLFO 4FL9A 1VQ5N 3H45C 3MN9A 2DPNA 2RE2A 5AQRA 3H1VX 3T69A 4BVPA 4A2BA 2YHYA 2NRXA 3F5TA 2F9WA 4CZKA 5KQ8A 3WEEA 4EHUA 5HL7L 3TSUA 3P4IA 4FWOA 4H5VA 1KXPA 3WQUA 3WXIA 5CE3A 2E1YA 5JLFA 5M1QA 1Z6RA 3VTHA 2ZJRL 1O13A 2NRTA 3CPEA 4NB4A 5AQZA 3OA9A 5JVHL 1YF5L 1QQOA 3R3LA 4K43A 2YCHA 1Q7YO 1BA1A 2PBDA 3GL1A 2NNWA 5ADXA 2ZGYA 2P9PA 1DEJA 2EWSA 4JK8A 3ZETB 3LDOA 3MN7A 5AQQA 2YX6A 3M6GA 5AQOA 5AQXA 4BRQA 4CBXA 3C6HA 1ZBSA 1VQ4N 1U6ZA 2CGJA 4CZJA 4GV3A 2E2PA 3FZFA 3HBTA 4IOXA 3EKSA 3IDHA 3O9UA 1NGFA 3FLCO 4FWSA 4KH5A 3VERA 4JK7A 3WQTA 2QWRA 1T6DA 3UKRB 4NO7A 5AQTA 3VGKA 3CCLN 3NVMA 4IO9L 4GV9A 1GLLO 3GDQA 1U2VA 2JWLA 1EQYA 1VQ7N 3PLAA 3IKMA 1RFQA 4EAHD 3ATVA 3WEEB 4BRIA 1VQ9N 4WFBL 2ZGZA 3BF3A 1K8KB 2D1KA 2D4WA 3CJ1A 4KBOA 1NM1A 3CD6N 3P31A 1NGEA 1EO1A 3QFPA 1QQMA 2QWPA 4U67L 3C7NB 4JAXA 4Z94A 3KK7A 3O4WA 4BR4A 2HBLA 5F1XA 2GWKA 4BRPA 4WFNL 1QZ6A 4BR2A 3ZX3A 3KWGA 4YOWA 2WBNA 1NBWA 2I7PA 4BREA 3CF5L 1GLJO 2HMPA 3ENHA 3EO3A 4BRDA 1M90O 1DGKN 1XQSC 1MWKA 3OHRA 3MWPA 1M1KO 3MX2A 4A57A 2QW9A 2WC9A 2ZJPL 1NLVA 2E8AA 1S22A 4BC5A 5EY4A 5AQLA 5FPMA 4C1NK 5AFUA 2YHWA 5KPRA 5C0YA 4XH4A 3P39A 5DM7L 5ADXH 4NLCA 5MLCQ 2QI2A 3CJAA 1D4XA 1WUAA 2P9NB 5TKYA 2GTDA 1ZC6A 4ILHA 2A6AA 1HUXA 4EFHA 3D2EA 3TSPA 2W40A 2ASMA 4H5NA 1Y64A 4IFEA 3EKUA 2QWOA 3QFUA 4DHYA 3AARA 4KH4A 2J4RA 3DLLL 4YOTA 3J8AA 2HBKA 4Y0WA 4A59A 5AFUH 2P9LB 2YI1A 3N4PA 3W3DA 4H5TA 4CZLA 2V7ZA 2KHOA 3A5NC 1HKBA 3I8BA 3CC2N 4JKGB 1BO5O 1YAGA 3OBWA 2QWMA 2Q36A 3UE5A 3H46O 3LDLA 3VENA 1IG8A 5I9EB 3MCAB 3FFKB 5GAHP 2P9SA 2CH6A 4WQ5C 3QDKA 2GWJA 4BR7A 4A62A 4CZMA 4M7YA 3KZBA 4WCEL 2ITMA 3QBWA 1K73O 4H0YB 3L0QA 1KAXA 3H3NO 5BN8A 3CCUN 3FZKA 4E1JA 4FO0A 4MLEA 2ASOA 4CBWA 3I33A 5GAGP 3WXLA 5AQWA 1GLBG 2H3GX 4ILGB 3K9KA 3R1XA 4IEEA 4JHDA 5AZIB 3ULEA 1P8ZA 3SAHA 4B1WB 3QMLA 2OANA 3C6AA 4JEPA 3CCEN 4B1ZA 5C12A 1BU6O 4H0TB 1BUPA 1NGHA 2WFBA 5BN9A 4A5AA 5BRHA 1XUPO 3LDNA 5DM6L 1E4GT 4IDHA 4OPHA 4PHTX 4FWRA 1MWMA 2QXLA 3LDPA 4YDUC 2JWKA 5AQFA 3EE8A 3VEWA 2P9IA 4K25A 1WOQA 4O5FA 1C0GA 4L3QA 3W0LA 3I55N 3ATUA 5EXWA 2I7NA 2Q97A 3G71N 4MLHA 5GADP 2Q1NA 3ENOA 3WUHA 3UKRA 3A5LC 1HLUA 4BGBA 5H1SQ 3E9OA 4G9ZA 3E9PA 2OTLN 4YOVA 3VEYA 3A8YA 4FSVA 4HTLA 4JKFA 5M1FA 4PKIA 4RTFD 1GLDG 3TTDA 4FWNA 5TKWA 3CI5A 4GY2B 4IXCA 3ID6A 1Q81O 2V51B 3NMUA 2A41A 3CCRN 4RCHA 1VQPN 4WYBA 3A5MC 4IWVA 3VF4A 1NGBA 3FE1A 5BPLA 3DWLA 3R9PA 4BC4A 4IOCL 1DKGD 3SLCA 3U9DA 1VQ8N 3KHYA 3OW2M 1TUYA 3EZWA 1SQKA 2E1ZA 3EE9A 1KAZA 2NRWA 4FPAA 3JXUA 2VGMA 3O6WA 1TYQA 5AQMA 5JLHA 1ATRA 3O1BA 4C1NI 3R8EA 3CC7N 3CMEN 3E9LA 3LL3A 1J6ZA 5AR0A 3VF2A 3HOTA 2A5XA 3G4SN 3ZX0A 2P9LA 3ULEB 4EIAA 5AQHA 1TYQB 3SAFA 5EX5A 4JKGA 4BRGA 4IJNA 4QS8A 4FVUA 1HPMA 3O9SA 1YVNA 4U7BA 4WQ5A 3VPZA 3TTFA 1IJJA 2HF4A 3BUZB 1BOTO 4FOIA 3CCSN 1YXQA 1GLEG 3CIPA 3VETA 4FOEA 3L4IA 3CMAN 3MWTA 3F2KA 5GIOA 2E2NA 2Q0UA 4YORA 5LY3A 2BUPA 1V4TA 1LOTB 4A61A 4B1YB 5KPTA 3JS6A 3D2FB 3FZHA 1OVYA 4UY8O 3MK6A 4DKWA 5FPEA 3VGMA 3VMFB 4H0PA 1HKGA 3U8XA 2IVOA 3ZETA 1KC8O 3U9ZA 2CGLA 3M5RA 2FF3B 3D7EO 3L6QA 3E66A 1JCGA 3CHWA 3K9JA 2F7TA 3CJBA 3AY9A 4JKDA 3RSEA 2FSKA 5BR9A 3RVCA 5M1KA 4PKHA 3SBTA 2FF6A 1VQNN 4YOXA 1ESVA 3MDQA 1MDUB 2AP1A 5F0XA 3RSEB 2E88A 1KAYA 3D6RA 2KLAA 4FWPA 1C0FA 3PIOL 3C0BA 1NJIO 3FZMA 4YDUA 4GVEA 1T44A 1JJ2M 4BROA 3CPWM 3VEOA 4ISFA 4AF1A 3M3ZA 4DCHA 4BRAA 2AA4A 1V4SA 1X3NA 1W97L 3OBYA 3SMSA 2QEXN 1RGIA 5C2DA 3E1YA 1NGDA 1NWKA 2ASPA 1QHAA 2ZF5O 1CZAN 5AQKA 5C2FA 1NGJA 3CCJN 1G99A 1K8KA 3KWIA 4CD3A 4A5BA 4XH5A 2P9UA 2P9IB 3NVKA 2P9KB 4BQZA 1ATSA 1JCEA 2WUSA 4H03B 4LC9B 3DAWA 2QTDA 1X3MA 4JKHA 3CJ9A 1BDGA 1Q86O 1YHQN 3GG4A 4H5WA 5B8HA 4BRKA 2NRZA 2HBMA 1VAZA 4M63C 4BRCA 5AQSA 5HOOA 1ZXOA 2UYTA 1Q82O 5E84A 3P38A 1S72N 4FWQA 4BVOA 5AQGA 1TUUA 3WT0A 4B1VA 1BWFO 1QQNA 2QWNA 4WQ4C 3U4LA 5BRDA 2CGKA 3BF1A 3DXKA 4BC3A 1YJ9N 4B1XB 4C23A 2P9KA 3C65A 4K41A 2NRRA 2W41A 4JKCA 3FGUA 4OPAA 5AQIA 1H1VA 4YOUA 3HOSA 4ISEA 3DJCA 3DXKB 2P9NA 1VQLN 2PFUA 3BEXA 1X9JA 3BP8A 1YIJN 3D2EB 2GEMA 3ENBA 4H5RA 4IJAA 2HBJA 2NRHA 1KD1O 1BA0A 3C7NA 2QWLA 3O5BA 2ZWHA 4H0OA 1YJNN 1MA9B 3ZEUA 4CJ7A 1SZ2A 5AQVA 2D0PA 5EVZA 4CZGA 2BTFA 3TPQA 2Q31A 1YITN 1VQON 4A2AA 2FSNA 3IFRA 4WFAL 5C10A 1QVGM 1Z05A 3O9RA 2YJEA 2HSTA 3QBXA 4BR0A 3SK3A 1YUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGN A;  3WXM B;  3E1Y A;  3VMF B;  1DT9 A;  4AF1 A;  3OBW A;  3MCA B;  2HST A;  2QI2 A;  3OBY A;  3AGK A;  2VGM A; 
#chains in the Genus database with same CATH topology
 3G6E N;  4FLT A;  1NMD A;  3WXJ A;  1NGC A;  2KKZ A;  4JKA A;  2IDO A;  2IVP A;  3VQ9 A;  1ATN A;  2DFE A;  2I5J A;  4QS7 A;  3S41 A;  4PL7 A;  4K0K K;  3OYL A;  3QO9 A;  4JKE A;  2Q3S A;  3GBT A;  1UA1 A;  3AO1 A;  4JYA K;  3IMX A;  4QCL A;  2G8F A;  4DFM A;  1W7A A;  4OPK A;  4CES A;  4HTU A;  5J2Q A;  4M3T A;  3LP1 A;  3CQX A;  2BGG A;  3PX6 A;  3LM9 A;  5BPM A;  4R79 A;  1DTQ A;  3D2F A;  3ZEU B;  3MAQ A;  2D0O A;  3H1Q A;  2NZT A;  1SAZ A;  3QIN A;  5SZT A;  2E6L A;  3MMV A;  1JCF A;  3O8M A;  2VGN A;  3OYJ A;  1Q18 A;  4BWJ A;  1N34 K;  3HL8 A;  3VQA A;  1S5J A;  3DLE A;  4OKK A;  4BG8 A;  1HJO A;  4DQP A;  4CD1 A;  5GIP A;  4DTO A;  3S3N A;  3CCM N;  3CCV N;  1U4B A;  3IAY A;  4BG9 A;  3VTI A;  3UB5 A;  3AVJ A;  4CJ5 A;  3KK2 A;  4B1U B;  4JNE A;  2E20 A;  4B3S K;  1X1P A;  4FM0 A;  3KVG A;  3HM9 A;  1D5A A;  3NH2 A;  1VQK N;  3OYE A;  1ZYQ A;  3D45 A;  3SJH A;  2G8K A;  3VF6 A;  2NRV A;  3R6M A;  2NUB A;  2JGU A;  1KVB A;  5M1P A;  1YI2 N;  5CY4 A;  5A2Q O;  4DTP A;  4BRN A;  4AH9 A;  2O8E A;  3QIO A;  3QB0 A;  1EKE A;  4C8K A;  4ISG A;  4BRL A;  1RDU A;  5EU7 A;  5AJ3 K;  3CG7 A;  4CVN E;  5EOY A;  1L3U A;  1NGI A;  3NGY A;  4DTJ A;  4DR4 K;  3SBG A;  1N8R O;  3TU5 A;  3HTV A;  5LL6 Z;  1NK5 A;  4KI4 A;  3KKS A;  1QZ5 A;  5CR4 A;  4BGA A;  3O3H A;  4J2B A;  1LAV A;  4IDK A;  5KQD A;  2GX9 A;  5AZJ A;  4IOA L;  5KPZ A;  3WXM B;  1OVQ A;  3AGK A;  4OKJ A;  4LF8 K;  4FYD A;  4EHT A;  4FJH A;  4BQL A;  4NLB A;  3OYK A;  3ZX2 A;  4EP4 A;  1X9M A;  1IBL K;  4DTR A;  2FBY A;  4OO1 J;  5FRO A;  2IVN A;  4AHC A;  4HCC A;  3T69 A;  4A2B A;  2YHY A;  3OVN A;  2BE2 A;  4BWM A;  2F9W A;  3V9U A;  1T8E A;  1YT3 A;  2BAN A;  2GV9 A;  3TSU A;  2PY5 A;  4FWO A;  3WXI A;  1RTD A;  1Z25 A;  1Z6R A;  2E6M A;  5M1Q A;  1EP4 A;  1O13 A;  4DF4 A;  3IRX A;  4ZTJ A;  4CGG A;  4K43 A;  2UUC K;  1Q7Y O;  1BA1 A;  3T1A A;  2NNW A;  1CZ9 A;  2P9P A;  1DEJ A;  3K5N A;  3K59 A;  4E7J A;  3ZSV A;  3QEX A;  3ZSR A;  3VA0 A;  3C6H A;  1ZBS A;  2LSN A;  1QTM A;  2YNG A;  3IDH A;  4FWS A;  1C1A A;  4NO7 A;  2VQE K;  3VGK A;  4DTX A;  3NVM A;  3GDQ A;  1U2V A;  1VQ7 N;  1EX4 A;  3V9S A;  4DTM A;  4CJS A;  4EAH D;  4E19 A;  4ID5 A;  3CFO A;  4DV3 K;  5IWA K;  3NH1 A;  1WSI A;  3HT3 A;  1EO1 A;  3QFP A;  1QQM A;  1XNR K;  2QWP A;  1BHL A;  4JAX A;  5C24 A;  3KK7 A;  2HBL A;  5F1X A;  3AV9 A;  3OJS A;  1CXQ A;  3HVT A;  3V4I A;  1GLJ O;  3EYZ A;  3ENH A;  3EO3 A;  4B9L A;  4DR3 K;  3WNH A;  1M1K O;  4B3O A;  3QER A;  4A57 A;  4FZX C;  1NLV A;  5AQL A;  5FPM A;  3V1R A;  5AFU A;  5C0Y A;  3J7A P;  2JLE A;  5ADX H;  1S1X A;  3I8D A;  1J5E K;  2QI2 A;  1ZBL A;  1D4X A;  5TKY A;  2G8I A;  1HUX A;  3DLR A;  1Y64 A;  3DLB A;  2J4R A;  3DLL L;  2HBK A;  4Y0W A;  2YI1 A;  4CZL A;  2O8C A;  2KHO A;  1Z26 A;  1JL2 A;  3MEC A;  4JKG B;  3NGZ A;  4BAC A;  2Q36 A;  3VEN A;  3LDL A;  1ITG A;  3MCA B;  2P5O A;  4WQ5 C;  4CZM A;  5J1E A;  3C95 A;  2ITM A;  1QHT A;  4H0Y B;  3PY8 A;  3J81 O;  3RTV A;  4E1J A;  4FO0 A;  5J2N A;  3I33 A;  3WXL A;  4KRE A;  4DS4 A;  2O8F B;  1JXE A;  1BCM A;  3K9K A;  3PV8 A;  3U3Y A;  3C6A A;  3CCE N;  1BU6 O;  3AVN A;  2YHA A;  3K5O A;  1XUP O;  3LDN A;  4FJG A;  1E4G T;  4X64 K;  1VSE A;  4PHT X;  3MED A;  5DK5 A;  3VEW A;  4O5F A;  1C0G A;  4OJR A;  5EXW A;  2I7N A;  1VSK A;  3V9X A;  2B5J A;  4BGB A;  4RTF D;  4DSJ A;  4G1Q A;  4FWN A;  4FLW A;  4B9S A;  3SUO A;  3PO4 A;  1WN7 A;  3C94 A;  1JXB A;  2V51 B;  1VQP N;  4IWV A;  1NGB A;  3FE1 A;  3DWL A;  4IOC L;  3SLC A;  3KHY A;  4KV8 A;  1J9A A;  3EE9 A;  3ZT2 A;  1TGO A;  1ATR A;  5I3U A;  4BE0 A;  2UXB K;  2KW4 A;  1J6Z A;  4N76 A;  1VSH A;  5EX5 A;  4JKG A;  4W5O A;  4J2E A;  3OYC A;  1HPM A;  4FVU A;  1YVN A;  1NKC A;  3VPZ A;  1S9G A;  1WSG A;  4Q5V A;  5JS1 A;  4A61 A;  4DWI A;  5KPT A;  4AIL C;  1JLF A;  1LW2 A;  3QEP A;  4E3S A;  5FPE A;  2XHB A;  2CGL A;  3M5R A;  2FF3 B;  3SQ4 A;  3K9J A;  4RW9 A;  1U49 A;  3HP6 A;  5M1K A;  3AO5 A;  1HYS A;  3RSE B;  3KKR A;  2E88 A;  1KAY A;  3D6R A;  4LFA K;  3OYB A;  3FZM A;  4YDU A;  1FW6 A;  1T44 A;  2WOM A;  4ISF A;  3ZSZ A;  4Z0U A;  4DCH A;  1L5U A;  3HPG A;  1W97 L;  4V19 S;  1RBT A;  1RGI A;  2D5R A;  3E1Y A;  2ASP A;  2ZF5 O;  1QHA A;  5AQK A;  4F8R A;  1G99 A;  4E7I A;  4AHV A;  4CJW A;  3LZI A;  2P9K B;  4BQZ A;  3U3G A;  1JCE A;  4X65 K;  1TK0 A;  3SJJ A;  4PA1 A;  2QTD A;  4B9M A;  3DI6 A;  3GG4 A;  1HR0 K;  3AVC A;  2HBM A;  1VAZ A;  2VG7 A;  4BRC A;  3KLE A;  2UYT A;  3B6O A;  4BVO A;  3NE6 A;  1VSM A;  4WQ4 C;  4LSL A;  3BF1 A;  1JLG A;  4BC3 A;  1YJ9 N;  2X78 A;  1Q8I A;  2P9K A;  3C65 A;  4JKC A;  1S6P A;  1VRU A;  2R7Y A;  3TR8 A;  3BP8 A;  4E1N A;  3CQ8 A;  4IJA A;  3T3F A;  2NRH A;  1BA0 A;  3THW B;  1YJN N;  3ZEU A;  5EVZ A;  4CZG A;  1YIT N;  2HW3 A;  1N32 K;  3KLG A;  3IFR A;  4ELU A;  3L2V A;  4B8A B;  5C10 A;  3P1G A;  1YUW A;  4FJL A;  5JMV A;  3MX5 A;  3A0I X;  5LJV A;  1RDW X;  1KLM A;  4FZY A;  3OYA A;  1BIS A;  5J2P A;  4DQS A;  1Y97 A;  4FLY A;  1C1B A;  3ZT1 A;  1K9M O;  4CHQ A;  4FM1 A;  3TAR A;  1S3X A;  2DFF A;  5IT9 O;  1TL3 A;  3WXK A;  2QM1 A;  3AA2 A;  2HHT A;  4M45 A;  4CJ4 A;  4XIU A;  3HPO A;  3KIO A;  2YNH A;  1GLC G;  3SCX A;  5AZJ B;  4PKG A;  4CER A;  1RNH A;  1RTI A;  3HYF A;  5LJW A;  5M1O A;  4DQR A;  2YNI A;  2QK9 A;  4KH6 A;  5GIN A;  4K42 A;  4FM2 A;  1R59 O;  3VQ8 A;  4OLA A;  3NF7 A;  1S1T A;  5E26 A;  3ZYY X;  3QLH A;  4PL8 A;  4W5R A;  1GLA G;  3FFI A;  4NCG A;  4HWI A;  4DU3 A;  3RR7 A;  2FSJ A;  4CBU A;  4BY9 C;  3PIP L;  1IKW A;  1NGG A;  3AA4 A;  2WTU A;  3RMB A;  4QOZ B;  3UKU A;  2VWK A;  3VEV A;  3VOV A;  4B9Q A;  4JI7 K;  5ELZ A;  3SNN A;  3NHG A;  3AO4 A;  4CZH A;  4O0J A;  2VYP A;  3G25 A;  4C8N A;  2OPR A;  4CFA A;  5FPD A;  2Z1I A;  4BRF A;  5JIC A;  4DTU A;  1J53 A;  4CF9 A;  4MDA A;  1E4F T;  3QIC A;  2OZM A;  1LCU A;  1P90 A;  2W42 A;  1VQM N;  1XI1 A;  1IG9 A;  3H6E A;  1U04 A;  4MO5 A;  3MN5 A;  4FWK A;  5C15 A;  3O1W A;  5BRE A;  4AM7 A;  4H0X B;  3EN9 A;  4LF7 K;  4LH5 A;  4JK9 A;  2Q2R A;  1XC3 A;  1BG3 A;  2HF3 A;  5AQP A;  3RRG A;  4JI5 K;  3N4Q A;  3VQ6 A;  2ZJQ L;  3SUN A;  4IEI A;  1SL0 A;  1D9F A;  3CJ7 A;  2CH5 A;  2P9S B;  4NXM K;  5FRN A;  1IH7 A;  4CZF A;  1RT6 A;  3CJC A;  3L4Q A;  2E2O A;  4CZE A;  2BH1 A;  2KFZ A;  3CER A;  3T19 A;  1K8A O;  1HX1 A;  3LAK A;  3I56 N;  4CZI A;  3FR0 A;  4IFY A;  4CJQ A;  3K2P A;  4CJK A;  4JS4 A;  2DPN A;  4BVP A;  5KI6 A;  4CZK A;  3OYD A;  1OH5 A;  4Z4C A;  1KXP A;  4GW6 A;  3WQU A;  2E1Y A;  3THV A;  4RW6 A;  5LMU K;  1ZBF A;  1ASV A;  5HRN A;  4HVJ A;  5JVH L;  1UWB A;  1JKH A;  4CJE A;  3ZT0 A;  2PBD A;  5HP1 A;  3GL1 A;  1NJZ A;  2ZGY A;  1MU2 A;  2EWS A;  3OY9 A;  3ZET B;  3ZSX A;  2YX6 A;  3M6G A;  4BRQ A;  4CHP A;  3NBP A;  1OH8 A;  4Z4H A;  4GV3 A;  2E2P A;  3AVK A;  4ELV A;  3FZF A;  3HBT A;  4C8M A;  2ZD1 A;  3VQE A;  3JAM O;  4KH5 A;  3EKS A;  1HRH A;  3NF8 A;  2QWR A;  5AQT A;  1HJR A;  1GLL O;  1EQY A;  3CM5 A;  3THY A;  3IKM A;  1RFQ A;  3K5M A;  3NDK A;  3O4N A;  3KD5 E;  3BF3 A;  2F4V K;  1K8K B;  2D4W A;  1WBB A;  3TAP A;  1IO2 A;  4M3X A;  4Z94 A;  2UXC K;  4CJR A;  1TKD A;  4IG3 A;  2GWK A;  4FVM A;  4BRP A;  1QZ6 A;  4DV7 K;  3U6F A;  3NCI A;  3KWG A;  4YOW A;  2IC3 A;  1NBW A;  2HMP A;  1RBS A;  1M90 O;  1BL3 A;  1C0T A;  5E41 A;  3NH0 A;  3RMA A;  2WC9 A;  4BC5 A;  2VQF K;  1NK7 A;  1JLC A;  5EY4 A;  1S9E A;  2YHW A;  5KPR A;  3ZT3 A;  1IKV A;  2HNY A;  3PO5 A;  3LP2 A;  2Y1J A;  3BY5 A;  4NLC A;  4CGF A;  3CJA A;  1WUA A;  3CM6 A;  1KTQ A;  2GTD A;  3SYZ A;  1TVR A;  4E89 A;  3LDS A;  4IFE A;  3VQP A;  1B9D A;  4MFB A;  4H4O A;  4A59 A;  4CK1 A;  5AFU H;  2P9L B;  4KRF A;  4H5T A;  1HKB A;  3A5N C;  3I8B A;  1RDD A;  1RCH A;  4FXD A;  2QWM A;  4CJV A;  3FFK B;  3TAF A;  2P9S A;  3QDK A;  4DF8 A;  3NFA A;  2KZZ A;  3JSM A;  3L0Q A;  4DU4 A;  1WB9 A;  3CCU N;  4B3T K;  2PYJ A;  2O8D A;  4MLE A;  2ASO A;  2H3G X;  3V1O A;  2HVH A;  4IEE A;  4JHD A;  3OYN A;  1P8Z A;  4B1W B;  5C12 A;  2ZM6 K;  1NGH A;  4JI2 K;  3DLK A;  2WFB A;  5BN9 A;  4DS5 A;  4OPH A;  3AA5 X;  1MWM A;  2QXL A;  4YDU C;  4CEZ A;  1J5O A;  3EE8 A;  2FC0 A;  2P9I A;  4RG8 A;  3I55 N;  1HNX K;  4L3Q A;  3ATU A;  2Q97 A;  2HHX A;  4MLH A;  3VN5 A;  3A5L C;  3E9O A;  3TAQ A;  3E9P A;  4JKF A;  4PKI A;  2ITG A;  3CI5 A;  1NK6 A;  4IXC A;  3ID6 A;  4EZ6 A;  3NMU A;  2A41 A;  4RCH A;  1C6V A;  3VF4 A;  3LWM A;  3R9P A;  1VQ8 N;  3U9D A;  1S1W A;  3K58 A;  3OW2 M;  4CEC A;  1SQK A;  2E1Z A;  4FPA A;  5AQM A;  5JLH A;  3L3V A;  3CC7 N;  3E9L A;  3ZX0 A;  3OYH A;  2P9L A;  3SAF A;  3V81 A;  1LWF A;  3DOK A;  5CYQ A;  3ITH A;  3TTF A;  3S3O A;  1RT4 A;  1YXQ A;  3CIP A;  3CMA N;  4FOE A;  2E2N A;  1C0M A;  2Z1H A;  2FBX A;  2O4I A;  4LH4 A;  1L3V A;  1WSJ A;  3DRS A;  4YFU A;  1OVY A;  4HUE A;  3MK6 A;  4I2P A;  1TAU A;  2X6S A;  3U8X A;  3VQD A;  3LP3 A;  3L6Q A;  2XY5 A;  2F7T A;  3UIQ A;  4R5P A;  2XO7 A;  4CEO A;  4E7H A;  4PKH A;  4LSN A;  4K8X A;  3L8B A;  3NF6 A;  3D0P A;  1MDU B;  1FK9 A;  4GVE A;  1KRP A;  4RW8 A;  5BR8 K;  5HRO A;  4FW2 A;  3CPW M;  4DUZ K;  3M3Z A;  4BRA A;  3SMS A;  3OBY A;  4O0I A;  2QEX N;  4M3U A;  3DRP A;  5C2D A;  1U45 A;  2KTQ A;  1NMN A;  1K8K A;  4XH5 A;  2P9U A;  4CEQ A;  3WNF A;  3NVK A;  2Z1J A;  4LC9 B;  4DMN A;  4IG0 A;  4Q0B A;  3DAW A;  3P5J A;  1X3M A;  1LW0 A;  4M42 A;  1YHQ N;  5B8H A;  4CGI A;  2NRZ A;  1TK8 A;  1ZXO A;  4Y1C A;  3P38 A;  4FK0 A;  1TUU A;  4B1V A;  4M3W A;  2VG6 A;  1QQN A;  3U4L A;  5BRD A;  2CGK A;  4OLB A;  4B1X B;  1XHX A;  2NRR A;  4OPA A;  5AQI A;  1H1V A;  4O44 A;  4YOU A;  3HOS A;  3THW A;  5D3G A;  3DJC A;  2P9N A;  4KHN A;  4H5R A;  2XY6 A;  4J2D A;  1ASW A;  2ETJ A;  2QWL A;  1MA9 B;  3V6D A;  4N56 A;  2FSN A;  2QXF A;  4FJM A;  1QVG M;  5FRM A;  1Z05 A;  2YJE A;  3QBX A;  4BR0 A;  5I42 A;  3OJU A;  1Q9Y A;  3RMD A;  1LAW A;  4JKB A;  2PAV A;  3T1H K;  2A3Z A;  3AVL A;  4BR5 A;  4HUF A;  3Q7B A;  4IO8 A;  4CEF A;  4DQQ A;  1E3M A;  2Y1I A;  4J2A A;  3CC4 N;  2VG5 A;  3LWL A;  1J54 A;  3O08 A;  4FCY A;  3ID8 A;  1QSS A;  4O4G A;  1QQC A;  5CZ2 A;  5AQJ A;  4JD2 A;  3UKU B;  5BRF A;  3THY B;  2UU9 K;  1RBR A;  4O55 A;  3TTC A;  4CHY A;  4ZTF A;  3C6T A;  1RBU A;  4GNI A;  1B9F A;  1NKE A;  3QEW A;  1RT7 A;  3LAN A;  3QEI A;  4Z4E A;  1CLQ A;  2Z1G A;  4ILJ A;  4H4M A;  4QS9 A;  1EWR A;  1WNS A;  1QS4 A;  4W5Q A;  4L8R B;  2YJF A;  4JD2 B;  4BDZ A;  4CFD A;  3KTQ A;  1QVF M;  3PX4 A;  1N6Q A;  2G8V A;  5F2R A;  3H3O B;  3OS1 A;  2F9T A;  5KRS A;  4FWL A;  4DV1 K;  1VQ6 N;  4JN4 A;  4CF2 A;  3SMP A;  4CIE A;  3IUC A;  2RHK A;  4FWM A;  3HI0 A;  3T7Z A;  4O8U A;  4BC2 A;  1UA0 A;  1T3V A;  3MXI A;  1OKJ A;  1YJW N;  3SPZ A;  3HP9 A;  3JYT A;  3CXC M;  3O3F A;  4N5S A;  1SL2 A;  4CI6 A;  4HHT A;  3TI0 A;  2HMI A;  2EHG A;  5DMR A;  3AA3 A;  3CFR A;  3LM2 A;  4AM6 A;  3TAB A;  3OYG A;  4BRM A;  4YOY A;  5FPN A;  2AJQ A;  1HKC A;  2V52 B;  3VEX A;  2OPS A;  4XH1 A;  2HVI A;  4I6M A;  3MXJ A;  3BZK A;  1XMO K;  4RWT A;  4C8O A;  1Q9X A;  4CW7 B;  1T03 A;  4W5N A;  3AGR A;  4CEA A;  3OYI A;  1GOB A;  4I6M B;  1RIL A;  3WNG A;  2VCP A;  4LF6 K;  3EL2 A;  2OTJ N;  2IIR A;  1HPZ A;  5JS2 A;  4CJ3 A;  4BDP A;  4KI6 A;  3HSC A;  3O9T A;  3SQ0 A;  3ISN C;  3AVG A;  5CHI A;  1XMQ K;  4IZ9 A;  1GOC A;  3I0R A;  2X74 A;  3CQY A;  4GMJ B;  2A42 A;  3VGL A;  1RT3 A;  2HND A;  4FLZ A;  5M1N A;  1NJX A;  2XY8 A;  4KAZ A;  3MN6 A;  3P83 D;  3ZLJ A;  4DLG A;  1IBM K;  3KLF A;  1QSY A;  4F9O A;  1S1V A;  1NK9 A;  2E2Q A;  3O80 A;  1GLF O;  4FL9 A;  1VQ5 N;  3MN9 A;  2RE2 A;  3H1V X;  1KVC A;  1NK4 A;  4Z4G A;  5HL7 L;  4B9U A;  4I9L A;  3TWH A;  5CE3 A;  4NCA A;  2D0A A;  2F8T A;  4KFB A;  3VTH A;  2ZJR L;  2NRT A;  4UQG A;  3CPE A;  3OS0 A;  4NB4 A;  3OA9 A;  3H08 A;  1ZBU A;  4FJJ A;  1JLE A;  2A1S A;  4B08 A;  1RBV A;  5ADX A;  4JK8 A;  3LDO A;  3MN7 A;  4KO0 A;  5AQQ A;  4FJ7 A;  5AQO A;  4CBX A;  1U6Z A;  2CGJ A;  1WAJ A;  4CZJ A;  4DUY K;  1ZBH A;  4DFP A;  4IOX A;  3O9U A;  3VER A;  3FLC O;  3WQT A;  4JK7 A;  3SPY A;  1T6D A;  4JS5 A;  4MQ3 A;  3CCL N;  3RRH A;  3SV4 A;  4GV9 A;  4CFB A;  2JWL A;  1RT5 A;  1G15 A;  4PQU A;  1VHX A;  3RR8 A;  3WEE B;  4BRI A;  2OA8 A;  2IOC A;  2ZGZ A;  4AQY K;  2F96 A;  2XY7 A;  2D1K A;  5KRT A;  1NNE A;  1NGE A;  3L2U A;  3PSF A;  1EXQ A;  4BR4 A;  2G8H A;  4WFN L;  4HCB A;  3ZX3 A;  2WBN A;  4DR6 K;  1BIZ A;  3RMC A;  1K6Y A;  1DGK N;  1XQS C;  1MWK A;  3OHR A;  3MWP A;  3MX2 A;  2OPQ A;  1HQU A;  4B9V A;  1XNQ K;  3EEQ A;  3P39 A;  5DM7 L;  5MLC Q;  4DTS A;  3QNO A;  4ILH A;  4M41 A;  3OYF A;  3TSP A;  2W40 A;  2ASM A;  2F8S A;  3DMJ A;  3EKU A;  2QWO A;  1N36 K;  4DHY A;  4OPJ A;  3AAR A;  4YOT A;  3I0S A;  4JI0 K;  2E4L A;  1BGX T;  1FJG K;  1JLA A;  1NU0 A;  3HVR A;  3CC2 N;  3QIP A;  4B3R K;  1DTT A;  1YAG A;  3AO3 A;  1KVA A;  1QSL A;  3H46 O;  1FKP A;  5I9E B;  1IG8 A;  1L3T A;  1T7P A;  2GWJ A;  3ALY A;  4DV4 K;  4M7Y A;  3KZB A;  1HYZ A;  1A5X A;  4FK4 A;  4WCE L;  1XC9 A;  5HRP A;  3QBW A;  4F3T A;  4DSK A;  4OGC A;  3H3N O;  1VSF A;  1TV6 A;  4M3R A;  4CBW A;  1GLB G;  4ICL A;  4ILG B;  3KLH A;  4X62 K;  3K0S A;  4CIG A;  1UAX A;  1I94 K;  3R1X A;  2UXD K;  5AZI B;  1HNZ K;  3VQ7 A;  3ULE A;  1JL1 A;  3SAH A;  3L2R A;  3QML A;  4FJX A;  3SUP A;  4H0T B;  1BUP A;  4X66 K;  5DM6 L;  1U48 A;  4DR7 K;  4KTZ A;  3LDP A;  5AQF A;  3W0L A;  4K25 A;  5JVG L;  1VSD A;  2ATQ A;  4B3M K;  2E5L K;  3G71 N;  5GAD P;  3ENO A;  3UKR A;  1HLU A;  5H1S Q;  3HO1 A;  4G9Z A;  1S6Q A;  4NYF A;  2OTL N;  4YOV A;  3VEY A;  3A8Y A;  2PYL A;  1GLD G;  3TTD A;  3M8S A;  1A5V A;  3AVF A;  4FJ8 A;  4I2Q A;  4LY7 A;  3V1Q A;  4KHQ A;  3SQ1 A;  1Q81 O;  3CCR N;  4WYB A;  3A5M C;  4C8L A;  4CFC A;  1DKG D;  5KTQ A;  1TUY A;  3KK3 A;  4E7K A;  3JXU A;  2VGM A;  1TYQ A;  1N33 K;  3O1B A;  4C1N I;  3EZ5 A;  4DU1 A;  2QKK A;  3NF9 A;  4FK2 A;  2YNF A;  3CME N;  3VF2 A;  3HOT A;  4FW1 A;  4GKJ K;  3G4S N;  2A5X A;  1KCF A;  4FJ5 A;  2O4G A;  1TYQ B;  5AQH A;  4ELT A;  4F3O A;  3HPH A;  4BRG A;  4IJN A;  3O9S A;  3KD1 E;  4U7B A;  4WQ5 A;  2HF4 A;  1BOT O;  4FOI A;  3CCS N;  3VET A;  3L4I A;  3MWT A;  4H8K A;  4M3Y A;  1W9H A;  5LY3 A;  2P51 A;  2BUP A;  1V4T A;  1VSI A;  3JS6 A;  3D2F B;  3VGM A;  4H0P A;  3ASM A;  3EY1 A;  2IVO A;  1KC8 O;  4LF5 K;  3ULD A;  3D7E O;  4CK3 A;  3E66 A;  1JCG A;  3RSE A;  5BR9 A;  3SBT A;  2FF6 A;  4YOX A;  1ESV A;  4CK2 A;  4JRQ A;  5F0X A;  1BQN A;  1X9W A;  3LAL A;  4FWP A;  4E7L A;  4KKO A;  3CFP A;  3QEV A;  2O8F A;  1JJ2 M;  4BRO A;  1SKS A;  4CEB A;  3LP0 A;  2AA4 A;  1X3N A;  3S3M A;  1X9S A;  4N47 A;  4KHW A;  1NWK A;  1NGD A;  4FLU A;  3CCJ N;  1CZA N;  1NGJ A;  1N5Y A;  2P1J A;  4F2R A;  3KWI A;  4CD3 A;  4B9N A;  2P9I B;  4PWD A;  1ATS A;  2WUS A;  2RPI A;  2YHB A;  2UUA K;  3CJ9 A;  1BDG A;  3AVA A;  2OZS A;  5HLF A;  4BRK A;  4M63 C;  1C1C A;  5HOO A;  2D0C A;  1EET A;  1Q82 O;  5E84 A;  4LFC K;  5AQG A;  3WT0 A;  2RN2 A;  1U47 A;  1D8Y A;  4LF4 K;  3F73 A;  3DXK A;  1F21 A;  4C23 A;  2B4J A;  4K41 A;  4DSF A;  2W41 A;  4EP5 A;  5SWM A;  1VQL N;  4IKF A;  1TKZ A;  2PFU A;  3BEX A;  4I9Q A;  1YTU A;  1X9J A;  1YIJ N;  2GEM A;  1OH7 A;  2HBJ A;  2OPP A;  1NK8 A;  3C7N A;  4H0O A;  2ZWH A;  1SZ2 A;  5AQV A;  2EX3 A;  2HB5 A;  4E1M A;  3OS2 A;  4WFA L;  3HST B;  3J7Y P;  4DTN A;  1RT2 A;  5KGW A;  1R0A A;  4CED A;  4DV0 K;  4M7X A;  5AQN A;  1NGA A;  3FZL A;  5AZI A;  3PUF A;  2BDP A;  4DR1 K;  1T6C A;  3M8R A;  2YHX A;  1W2B M;  4DB3 A;  3MCP A;  3Q7C A;  5J2M A;  1YTA A;  2FLO A;  4CHN A;  3M1F A;  4J8F A;  2HHU A;  2YV0 X;  2GUI A;  4O5B A;  4FPB A;  1SS6 A;  1I3A A;  3G10 A;  4DV6 K;  1LV5 A;  2FXU A;  3CCQ N;  2D0B A;  2NLX A;  2FBV A;  5C25 A;  3GE1 A;  1RTJ A;  1JLB A;  2B6A A;  3VES A;  2KQ2 A;  2HHV A;  2O8C B;  1LWC A;  3MEE A;  5LMN K;  1SKW A;  2RF2 A;  3DXM A;  1WBD A;  3BDP A;  2P9P B;  4JHD B;  2X6N A;  4BE1 A;  2GBZ A;  4NCB A;  4QAG A;  1EWQ A;  4CEE A;  3HZ6 A;  2QWQ A;  4MO4 A;  2O8D B;  4FLX A;  3LPT A;  2OYQ A;  1ILY A;  2O8E B;  3LPU A;  3SAG A;  4JRP A;  3GOI A;  1I39 A;  3C6U A;  1KQS M;  2A40 A;  2GEL A;  4H0V B;  3HM8 A;  3VQQ A;  3AO2 A;  3J7Z O;  4DG1 A;  4LF9 K;  4RW7 A;  3G0Z A;  3AAQ A;  2P9U B;  3F9M A;  1KSP A;  2GUP A;  3LAM A;  1VRT A;  4FJ9 A;  4MDB A;  1A5W A;  3DXM B;  1KLN A;  5GAE P;  1IKX A;  4FLV A;  1T05 A;  4KPY A;  4DQ8 A;  1WAF A;  4B9T A;  5FDL A;  4WF9 L;  1HNV A;  1O1W A;  3ZSY A;  1FKO A;  5BPN A;  1CZB A;  4KB0 A;  2HHQ A;  4E0D A;  2HHH K;  1TK5 A;  3VEZ A;  4LFB K;  3AAP A;  1GOA A;  4I7F A;  3SV3 A;  5CZ1 A;  2HOE A;  4B8C A;  4GV6 A;  1U2V B;  4AHU A;  4CJU A;  5AQY A;  1D9D A;  5K14 A;  4BE2 A;  2QA4 N;  3CYM A;  4HUG A;  3MXM A;  4ZHR A;  1NKB A;  4WQ4 A;  3HRG A;  1SKR A;  1QE1 A;  4O8K A;  3OTO K;  4BRH A;  4BDY A;  3TAM A;  3LDQ A;  3THX A;  2P5G A;  4XEI A;  1BCO A;  4BR9 A;  3B8A X;  2XRI A;  4OKE A;  3TSQ A;  3RWU A;  1CXU A;  1BI4 B;  4DFJ A;  2V7Y A;  1DT9 A;  4FJI A;  5HRS A;  4KTQ A;  2VWB A;  4JI1 K;  5FLX O;  3SQ2 A;  3A5O C;  4DLE A;  1RDC A;  5AQU A;  4Z4F A;  2Q0R A;  3CET A;  4DR5 K;  1NJY A;  5C42 A;  1YVU A;  3O9Q A;  3H45 C;  5AQR A;  5HBM A;  2NRX A;  3F5T A;  1LWE A;  3WEE A;  5KQ8 A;  4EHU A;  3P4I A;  4H5V A;  1HMV A;  2HNZ A;  2G8W A;  3J80 O;  1UOC A;  5JLF A;  2G8U A;  2UUB K;  5AQZ A;  1YF5 L;  1QQO A;  4AHS A;  3R3L A;  2HHS A;  2DFH A;  2YCH A;  3BGR A;  1L3S A;  4CJF A;  1TL1 A;  4IBN A;  5AQX A;  1VQ4 N;  3DLG A;  1DLO A;  2IGI A;  4CJL A;  4DSE A;  4DFK A;  1ASU A;  4W5T A;  1NGF A;  4RW4 A;  1ZBI A;  3UKR B;  4FJK A;  4IO9 L;  3IS9 A;  4DQI A;  4IFV A;  1HNW K;  1KFD A;  3PLA A;  3QNN A;  3ATV A;  3V9Z A;  1VQ9 N;  4CCH A;  4WFB L;  3L2Q A;  3CJ1 A;  4KBO A;  1NM1 A;  3CD6 N;  4KHY A;  3P31 A;  5KGX A;  3F9K A;  4U67 L;  3C7N B;  3ZSO A;  3A2F A;  3O4W A;  4WE1 A;  4F4K A;  4DR2 K;  2A1R A;  4BR2 A;  2I7P A;  4BRE A;  3CF5 L;  2IS3 A;  4FJN A;  4BRD A;  4YY3 K;  3KJV A;  3VA3 A;  4CE9 A;  3OYM A;  3AVM A;  2O8B B;  4F2S A;  1SV5 A;  2QW9 A;  2ZJP L;  2E8A A;  1S22 A;  4CF0 A;  3O3G A;  2DY4 A;  2O8B A;  4AHT A;  1NOY A;  4C1N K;  4XH4 A;  2ZE2 A;  2P9N B;  2KFN A;  1ZC6 A;  1KFS A;  4KB1 A;  2A6A A;  3MEG A;  4EFH A;  3D2E A;  4CHZ A;  3BZC A;  4NXN K;  1WSF A;  4H5N A;  3HK2 A;  3QFU A;  4KH4 A;  2VWJ A;  3J8A A;  4AHR A;  1XHZ A;  3W3D A;  4CF1 A;  3N4P A;  3QES A;  3VQC A;  2V7Z A;  1BO5 O;  3OBW A;  3UE5 A;  5GAH P;  2KZM A;  2CH6 A;  4BR7 A;  4A62 A;  1S1U A;  1TKT A;  3DM2 A;  1BI4 A;  4N41 A;  2OCE A;  1K73 O;  2HHW A;  1KAX A;  5BN8 A;  3FZK A;  4Y1D A;  3THX B;  4CIF A;  3HJF A;  5HRR A;  2YKM A;  5GAG P;  5AQW A;  3ZSQ A;  1RDB A;  2W6L A;  1NK0 A;  4Z4I A;  2OAN A;  4JEP A;  4K8Z A;  4B1Z A;  1XWL A;  3M8Q A;  4ID1 A;  4A5A A;  1VK0 A;  4YHH K;  3AVI A;  4IDH A;  4FWR A;  4KHU A;  3O4Q A;  4JI3 K;  2JWK A;  5BRH A;  1WOQ A;  2DTU A;  1B92 A;  3WNE A;  2Q1N A;  4NYN A;  3WUH A;  1OH6 A;  4FSV A;  4HTL A;  5M1F A;  1BQM A;  5TKW A;  3QET A;  4YNQ A;  4JI6 K;  2PZS A;  3E01 A;  4GY2 B;  1IBK K;  5BPL A;  4JLH A;  4BC4 A;  4CHO A;  3HXM A;  3EZW A;  2NRW A;  1RDA A;  1WLJ A;  1KAZ A;  3O6W A;  2WON A;  3R8E A;  1W0H A;  3LL3 A;  5AR0 A;  1TAQ A;  4JI8 K;  1SUQ A;  3ULE B;  4EIA A;  4QS8 A;  1VSL A;  4KTW A;  4KHP K;  3L2W A;  1IJJ A;  2YKN A;  3BUZ B;  4CJP A;  1HYV A;  1FXX A;  3V9W A;  1GLE G;  3SUQ A;  4JI4 K;  1NJW A;  4DV5 K;  3F2K A;  5GIO A;  2Q0U A;  4YOR A;  3TAN A;  4DSI A;  4PUO A;  4DV2 K;  1LOT B;  4B1Y B;  4OVL A;  3NAE A;  3TAG A;  3FZH A;  4UY8 O;  4DKW A;  1JLQ A;  3VMF B;  1HKG A;  3ZET A;  4EZ9 A;  4GKK K;  3U9Z A;  3VQ4 A;  3CHW A;  4JKD A;  4PY5 A;  3CJB A;  2W6K A;  3AY9 A;  2FSK A;  2IAJ A;  3RVC A;  1VQN N;  3T1Y K;  2ZQB A;  3MDQ A;  3SI6 A;  2AP1 A;  4JV5 K;  4CJT A;  2KLA A;  3ZT4 A;  1C0F A;  3PIO L;  3C0B A;  1NJI O;  3DLH A;  4KHS A;  3DYA A;  3AVB A;  3NGI A;  1RT1 A;  3DOL A;  3VEO A;  3KLI A;  4AF1 A;  4CGD A;  1V4S A;  3SZ2 A;  4DSL A;  1RTH A;  5C2F A;  3ZSW A;  2FBT A;  4OGE A;  3PX0 A;  3DRR A;  4A5B A;  4CGJ A;  1NOZ A;  4OX9 K;  4LD0 A;  3PSI A;  4H03 B;  3L3U A;  4JKH A;  4M3Z A;  2QKB A;  1Q86 O;  4CGH A;  4H5W A;  3IG1 A;  1WSH A;  5AQS A;  3ZCM A;  3AVH A;  3S9H A;  1S72 N;  4FWQ A;  3K5L A;  3TAE A;  1WSE A;  1BWF O;  1TKX A;  1HNI A;  2QWN A;  1SL1 A;  4TSX A;  3B6P A;  5CYM A;  3FGU A;  1NG9 A;  3VQ5 A;  1IKY A;  4ISE A;  3DXK B;  1C0U A;  5T7B A;  4GVM A;  3KK1 A;  3D2E B;  3ENB A;  4FZZ A;  1VSJ A;  1KD1 O;  3O5B A;  1IV0 A;  3K57 A;  4CF8 A;  3M8P A;  4CJ7 A;  2D0P A;  3LZJ A;  2BTF A;  3TPQ A;  2RKI A;  2Q31 A;  1HQE A;  1VQO N;  4A2A A;  1REV A;  3O9R A;  1BIU A;  2HST A;  3SK3 A;  3VQB A; 
#chains in the Genus database with same CATH homology
 3G6E N;  4M7X A;  4JKB A;  5AQN A;  1NMD A;  2PAV A;  1NGA A;  3WXJ A;  3FZL A;  2A3Z A;  5AZI A;  1NGC A;  5JMV A;  2KKZ A;  4JKA A;  4BR5 A;  2IVP A;  3MX5 A;  1ATN A;  3Q7B A;  4IO8 A;  3A0I X;  1T6C A;  5LJV A;  1RDW X;  2YHX A;  4QS7 A;  3S41 A;  4PL7 A;  1W2B M;  4DB3 A;  3MCP A;  3CC4 N;  3Q7C A;  3GBT A;  4JKE A;  3O08 A;  3ID8 A;  2FLO A;  3M1F A;  4J8F A;  5AQJ A;  4FPB A;  1SS6 A;  4JD2 A;  1K9M O;  3IMX A;  3UKU B;  5BRF A;  2FXU A;  3CCQ N;  3TTC A;  2NLX A;  1S3X A;  3CQX A;  3WXK A;  2QM1 A;  3GE1 A;  3LM9 A;  4GNI A;  5BPM A;  4R79 A;  3VES A;  3D2F A;  3ZEU B;  1GLC G;  5AZJ B;  2D0O A;  3H1Q A;  2NZT A;  4ILJ A;  1SAZ A;  4PKG A;  4QS9 A;  3MMV A;  1JCF A;  2YJF A;  5M1O A;  3O8M A;  5LJW A;  4JD2 B;  2VGN A;  3DXM A;  1Q18 A;  1QVF M;  4KH6 A;  5GIN A;  2P9P B;  4K42 A;  4JHD B;  1R59 O;  5F2R A;  3H3O B;  4BG8 A;  1HJO A;  2F9T A;  4FWL A;  1VQ6 N;  4JN4 A;  3SMP A;  5E26 A;  3HZ6 A;  2QWQ A;  4MO4 A;  3ZYY X;  4CD1 A;  4PL8 A;  5GIP A;  3CCM N;  1ILY A;  3IUC A;  2RHK A;  4FWM A;  3CCV N;  3HI0 A;  3T7Z A;  3SAG A;  1GLA G;  4O8U A;  4BC2 A;  3GOI A;  1T3V A;  1OKJ A;  1KQS M;  1YJW N;  2A40 A;  4HWI A;  2GEL A;  4H0V B;  2FSJ A;  4BG9 A;  3VTI A;  3HM8 A;  3CXC M;  3UB5 A;  3J7Z O;  4CBU A;  4BY9 C;  3PIP L;  1NGG A;  4CI6 A;  3AAQ A;  2P9U B;  3F9M A;  3UKU A;  3VEV A;  5JVG L;  2GUP A;  3VOV A;  4B1U B;  4B9Q A;  5ELZ A;  4JNE A;  4CZH A;  5FPD A;  2VYP A;  3G25 A;  3LM2 A;  4MDB A;  2E20 A;  3DXM B;  4AM6 A;  4BRF A;  4BRM A;  3KVG A;  5JIC A;  5GAE P;  4YOY A;  1VQK N;  4DQ8 A;  5FPN A;  3SJH A;  1HKC A;  2V52 B;  3VEX A;  4XH1 A;  3VF6 A;  4WF9 L;  2NRV A;  3R6M A;  4MDA A;  1E4F T;  3QIC A;  4I6M A;  1LCU A;  5M1P A;  1P90 A;  5BPN A;  1YI2 N;  4RWT A;  1VQM N;  3AGR A;  3VEZ A;  3H6E A;  4MO5 A;  3MN5 A;  4FWK A;  4I6M B;  5C15 A;  3O1W A;  4BRN A;  5BRE A;  3AAP A;  4AM7 A;  4H0X B;  2HOE A;  3QB0 A;  4GV6 A;  1U2V B;  3EN9 A;  4ISG A;  4BRL A;  2VCP A;  4JK9 A;  1RDU A;  5AQY A;  2Q2R A;  1XC3 A;  2QA4 N;  1BG3 A;  5EOY A;  2HF3 A;  5AQP A;  3EL2 A;  4WQ4 A;  1NGI A;  3N4Q A;  2OTJ N;  3SBG A;  2IIR A;  3HRG A;  3TU5 A;  2ZJQ L;  1N8R O;  3HTV A;  4IEI A;  4O8K A;  4BRH A;  1QZ5 A;  3HSC A;  3O9T A;  5CR4 A;  4BGA A;  3LDQ A;  3CJ7 A;  2CH5 A;  2P9S B;  5CHI A;  4XEI A;  4CZF A;  4BR9 A;  5KQD A;  3B8A X;  3CJC A;  2GX9 A;  3L4Q A;  4IZ9 A;  5AZJ A;  5KPZ A;  4IOA L;  3TSQ A;  2E2O A;  3WXM B;  3AGK A;  4CZE A;  3CQY A;  3VGL A;  2A42 A;  2V7Y A;  1DT9 A;  4EHT A;  2BH1 A;  5M1N A;  3CER A;  4BQL A;  1K8A O;  2VWB A;  3MN6 A;  4NLB A;  3ZX2 A;  1HX1 A;  3I56 N;  3A5O C;  4CZI A;  5AQU A;  3FR0 A;  4F9O A;  4OO1 J;  2Q0R A;  3CET A;  2E2Q A;  3O80 A;  2IVN A;  3O9Q A;  1GLF O;  4FL9 A;  1VQ5 N;  3H45 C;  3MN9 A;  2DPN A;  2RE2 A;  5AQR A;  3H1V X;  3T69 A;  4BVP A;  4A2B A;  2YHY A;  2NRX A;  3F5T A;  2F9W A;  4CZK A;  5KQ8 A;  3WEE A;  4EHU A;  5HL7 L;  3TSU A;  3P4I A;  4FWO A;  4H5V A;  1KXP A;  3WQU A;  3WXI A;  5CE3 A;  2E1Y A;  5JLF A;  5M1Q A;  1Z6R A;  3VTH A;  2ZJR L;  1O13 A;  2NRT A;  3CPE A;  4NB4 A;  5AQZ A;  3OA9 A;  5JVH L;  1YF5 L;  1QQO A;  3R3L A;  4K43 A;  2YCH A;  1Q7Y O;  1BA1 A;  2PBD A;  3GL1 A;  2NNW A;  5ADX A;  2ZGY A;  2P9P A;  1DEJ A;  2EWS A;  4JK8 A;  3ZET B;  3LDO A;  3MN7 A;  5AQQ A;  2YX6 A;  3M6G A;  5AQO A;  5AQX A;  4BRQ A;  4CBX A;  3C6H A;  1ZBS A;  1VQ4 N;  1U6Z A;  2CGJ A;  4CZJ A;  4GV3 A;  2E2P A;  3FZF A;  3HBT A;  4IOX A;  3EKS A;  3IDH A;  3O9U A;  1NGF A;  3FLC O;  4FWS A;  4KH5 A;  3VER A;  4JK7 A;  3WQT A;  2QWR A;  1T6D A;  3UKR B;  4NO7 A;  5AQT A;  3VGK A;  3CCL N;  3NVM A;  4IO9 L;  4GV9 A;  1GLL O;  3GDQ A;  1U2V A;  2JWL A;  1EQY A;  1VQ7 N;  3PLA A;  3IKM A;  1RFQ A;  4EAH D;  3ATV A;  3WEE B;  4BRI A;  1VQ9 N;  4WFB L;  2ZGZ A;  3BF3 A;  1K8K B;  2D1K A;  2D4W A;  3CJ1 A;  4KBO A;  1NM1 A;  3CD6 N;  3P31 A;  1NGE A;  1EO1 A;  3QFP A;  1QQM A;  2QWP A;  4U67 L;  3C7N B;  4JAX A;  4Z94 A;  3KK7 A;  3O4W A;  4BR4 A;  2HBL A;  5F1X A;  2GWK A;  4BRP A;  4WFN L;  1QZ6 A;  4BR2 A;  3ZX3 A;  3KWG A;  4YOW A;  2WBN A;  1NBW A;  2I7P A;  4BRE A;  3CF5 L;  1GLJ O;  2HMP A;  3ENH A;  3EO3 A;  4BRD A;  1M90 O;  1DGK N;  1XQS C;  1MWK A;  3OHR A;  3MWP A;  1M1K O;  3MX2 A;  4A57 A;  2QW9 A;  2WC9 A;  2ZJP L;  1NLV A;  2E8A A;  1S22 A;  4BC5 A;  5EY4 A;  5AQL A;  5FPM A;  4C1N K;  5AFU A;  2YHW A;  5KPR A;  5C0Y A;  4XH4 A;  3P39 A;  5DM7 L;  5ADX H;  4NLC A;  5MLC Q;  2QI2 A;  3CJA A;  1D4X A;  1WUA A;  2P9N B;  5TKY A;  2GTD A;  1ZC6 A;  4ILH A;  2A6A A;  1HUX A;  4EFH A;  3D2E A;  3TSP A;  2W40 A;  2ASM A;  4H5N A;  1Y64 A;  4IFE A;  3EKU A;  2QWO A;  3QFU A;  4DHY A;  3AAR A;  4KH4 A;  2J4R A;  3DLL L;  4YOT A;  3J8A A;  2HBK A;  4Y0W A;  4A59 A;  5AFU H;  2P9L B;  2YI1 A;  3N4P A;  3W3D A;  4H5T A;  4CZL A;  2V7Z A;  2KHO A;  3A5N C;  1HKB A;  3I8B A;  3CC2 N;  4JKG B;  1BO5 O;  1YAG A;  3OBW A;  2QWM A;  2Q36 A;  3UE5 A;  3H46 O;  3LDL A;  3VEN A;  1IG8 A;  5I9E B;  3MCA B;  3FFK B;  5GAH P;  2P9S A;  2CH6 A;  4WQ5 C;  3QDK A;  2GWJ A;  4BR7 A;  4A62 A;  4CZM A;  4M7Y A;  3KZB A;  4WCE L;  2ITM A;  3QBW A;  1K73 O;  4H0Y B;  3L0Q A;  1KAX A;  3H3N O;  5BN8 A;  3CCU N;  3FZK A;  4E1J A;  4FO0 A;  4MLE A;  2ASO A;  4CBW A;  3I33 A;  5GAG P;  3WXL A;  5AQW A;  1GLB G;  2H3G X;  4ILG B;  3K9K A;  3R1X A;  4IEE A;  4JHD A;  5AZI B;  3ULE A;  1P8Z A;  3SAH A;  4B1W B;  3QML A;  2OAN A;  3C6A A;  4JEP A;  3CCE N;  4B1Z A;  5C12 A;  1BU6 O;  4H0T B;  1BUP A;  1NGH A;  2WFB A;  5BN9 A;  4A5A A;  5BRH A;  1XUP O;  3LDN A;  5DM6 L;  1E4G T;  4IDH A;  4OPH A;  4PHT X;  4FWR A;  1MWM A;  2QXL A;  3LDP A;  4YDU C;  2JWK A;  5AQF A;  3EE8 A;  3VEW A;  2P9I A;  4K25 A;  1WOQ A;  4O5F A;  1C0G A;  4L3Q A;  3W0L A;  3I55 N;  3ATU A;  5EXW A;  2I7N A;  2Q97 A;  3G71 N;  4MLH A;  5GAD P;  2Q1N A;  3ENO A;  3WUH A;  3UKR A;  3A5L C;  1HLU A;  4BGB A;  5H1S Q;  3E9O A;  4G9Z A;  3E9P A;  2OTL N;  4YOV A;  3VEY A;  3A8Y A;  4FSV A;  4HTL A;  4JKF A;  5M1F A;  4PKI A;  4RTF D;  1GLD G;  3TTD A;  4FWN A;  5TKW A;  3CI5 A;  4GY2 B;  4IXC A;  3ID6 A;  1Q81 O;  2V51 B;  3NMU A;  2A41 A;  3CCR N;  4RCH A;  1VQP N;  4WYB A;  3A5M C;  4IWV A;  3VF4 A;  1NGB A;  3FE1 A;  5BPL A;  3DWL A;  3R9P A;  4BC4 A;  4IOC L;  1DKG D;  3SLC A;  3U9D A;  1VQ8 N;  3KHY A;  3OW2 M;  1TUY A;  3EZW A;  1SQK A;  2E1Z A;  3EE9 A;  1KAZ A;  2NRW A;  4FPA A;  3JXU A;  2VGM A;  3O6W A;  1TYQ A;  5AQM A;  5JLH A;  1ATR A;  3O1B A;  4C1N I;  3R8E A;  3CC7 N;  3CME N;  3E9L A;  3LL3 A;  1J6Z A;  5AR0 A;  3VF2 A;  3HOT A;  2A5X A;  3G4S N;  3ZX0 A;  2P9L A;  3ULE B;  4EIA A;  5AQH A;  1TYQ B;  3SAF A;  5EX5 A;  4JKG A;  4BRG A;  4IJN A;  4QS8 A;  4FVU A;  1HPM A;  3O9S A;  1YVN A;  4U7B A;  4WQ5 A;  3VPZ A;  3TTF A;  1IJJ A;  2HF4 A;  3BUZ B;  1BOT O;  4FOI A;  3CCS N;  1YXQ A;  1GLE G;  3CIP A;  3VET A;  4FOE A;  3L4I A;  3CMA N;  3MWT A;  3F2K A;  5GIO A;  2E2N A;  2Q0U A;  4YOR A;  5LY3 A;  2BUP A;  1V4T A;  1LOT B;  4A61 A;  4B1Y B;  5KPT A;  3JS6 A;  3D2F B;  3FZH A;  1OVY A;  4UY8 O;  3MK6 A;  4DKW A;  5FPE A;  3VGM A;  3VMF B;  4H0P A;  1HKG A;  3U8X A;  2IVO A;  3ZET A;  1KC8 O;  3U9Z A;  2CGL A;  3M5R A;  2FF3 B;  3D7E O;  3L6Q A;  3E66 A;  1JCG A;  3CHW A;  3K9J A;  2F7T A;  3CJB A;  3AY9 A;  4JKD A;  3RSE A;  2FSK A;  5BR9 A;  3RVC A;  5M1K A;  4PKH A;  3SBT A;  2FF6 A;  1VQN N;  4YOX A;  1ESV A;  3MDQ A;  1MDU B;  2AP1 A;  5F0X A;  3RSE B;  2E88 A;  1KAY A;  3D6R A;  2KLA A;  4FWP A;  1C0F A;  3PIO L;  3C0B A;  1NJI O;  3FZM A;  4YDU A;  4GVE A;  1T44 A;  1JJ2 M;  4BRO A;  3CPW M;  3VEO A;  4ISF A;  4AF1 A;  3M3Z A;  4DCH A;  4BRA A;  2AA4 A;  1V4S A;  1X3N A;  1W97 L;  3OBY A;  3SMS A;  2QEX N;  1RGI A;  5C2D A;  3E1Y A;  1NGD A;  1NWK A;  2ASP A;  1QHA A;  2ZF5 O;  1CZA N;  5AQK A;  5C2F A;  1NGJ A;  3CCJ N;  1G99 A;  1K8K A;  3KWI A;  4CD3 A;  4A5B A;  4XH5 A;  2P9U A;  2P9I B;  3NVK A;  2P9K B;  4BQZ A;  1ATS A;  1JCE A;  2WUS A;  4H03 B;  4LC9 B;  3DAW A;  2QTD A;  1X3M A;  4JKH A;  3CJ9 A;  1BDG A;  1Q86 O;  1YHQ N;  3GG4 A;  4H5W A;  5B8H A;  4BRK A;  2NRZ A;  2HBM A;  1VAZ A;  4M63 C;  4BRC A;  5AQS A;  5HOO A;  1ZXO A;  2UYT A;  1Q82 O;  5E84 A;  3P38 A;  1S72 N;  4FWQ A;  4BVO A;  5AQG A;  1TUU A;  3WT0 A;  4B1V A;  1BWF O;  1QQN A;  2QWN A;  4WQ4 C;  3U4L A;  5BRD A;  2CGK A;  3BF1 A;  3DXK A;  4BC3 A;  1YJ9 N;  4B1X B;  4C23 A;  2P9K A;  3C65 A;  4K41 A;  2NRR A;  2W41 A;  4JKC A;  3FGU A;  4OPA A;  5AQI A;  1H1V A;  4YOU A;  3HOS A;  4ISE A;  3DJC A;  3DXK B;  2P9N A;  1VQL N;  2PFU A;  3BEX A;  1X9J A;  3BP8 A;  1YIJ N;  3D2E B;  2GEM A;  3ENB A;  4H5R A;  4IJA A;  2HBJ A;  2NRH A;  1KD1 O;  1BA0 A;  3C7N A;  2QWL A;  3O5B A;  2ZWH A;  4H0O A;  1YJN N;  1MA9 B;  3ZEU A;  4CJ7 A;  1SZ2 A;  5AQV A;  2D0P A;  5EVZ A;  4CZG A;  2BTF A;  3TPQ A;  2Q31 A;  1YIT N;  1VQO N;  4A2A A;  2FSN A;  3IFR A;  4WFA L;  5C10 A;  1QVG M;  1Z05 A;  3O9R A;  2YJE A;  2HST A;  3QBX A;  4BR0 A;  3SK3 A;  1YUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...