2HSTA

Solution structure of the middle domain of human eukaryotic translation termination factor erf1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
136
structure length
136
Chain Sequence
LSDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Eukaryotic class 1 translation termination factor eRF1 - the NMR structure and dynamics of the middle domain involved in triggering ribosome-dependent peptidyl-tRNA hydrolysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Eukaryotic peptide chain release factor subunit 1
total genus 24
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2006-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2hstA00
3MCAB 1DT9A 2VGNA 3E1YA 2VGMA 3WXMB 3VMFB 2HSTA 4AF1A 3OBYA 2QI2A 3OBWA 3AGKA
chains in the Genus database with same CATH superfamily
4DQRA 2E1ZA 4ILJA 1W0HA 1HNXK 3C95A 3TARA 2D4WA 4G9ZA 2OCEA 2NLXA 3NDKA 3OS2A 1BUPA 3MEEA 4CJWA 4YOTA 4ISEA 3SAHA 3FLCO 2YKMA 4PHTX 3ATVA 4JRPA 3BGRA 1BG3A 5CYMA 1YJNN 3OJSA 3PX0A 2BANA 5HP1A 2FF6A 3O6WA 2QEXN 2PFUA 2GX9A 3KLIA 3KD1E 2H3GX 3CCLN 2D0AA 1HJOA 4MQ3A 5LL6Z 3ID6A 3K5OA 1YVUA 3I0RA 4FJ8A 4FJKA 1HPMA 4HWIA 2CGJA 3S41A 4BR2A 3FZMA 2OANA 1RDAA 3VQDA 1BWFO 1VSFA 4Y1CA 4CW7B 1BO5O 3K5LA 1RBUA 5T7BA 3KTQA 3HK2A 3AAPA 3I56N 4LH5A 1VQMN 3KK3A 2B5JA 2D0CA 3C6TA 3KHYA 1NJWA 2VCPA 3DWLA 3S3MA 4KI6A 4FJ7A 4TSXA 5FRNA 4GVMA 4JKFA 4JNEA 4BR4A 1ITGA 3KIOA 5F1XA 1C1CA 4FJIA 5AQKA 3SLCA 3LDNA 2UUBK 1VQ6N 3JS6A 3CJ9A 3NGZA 3G71N 4DU3A 5I3UA 1S5JA 1MU2A 2LSNA 3AVGA 1O13A 1J5OA 3QEPA 3CC2N 2ZQBA 4PKGA 5FROA 3TAFA 4AQYK 2XO7A 1T03A 4E1NA 3VEVA 1L3UA 5LMUK 3UE5A 5KPTA 2RHKA 5C0YA 4KB1A 2UU9K 3V9WA 3MCAB 2HHTA 4M41A 1VQ9N 5JS2A 4BRLA 5HOOA 3BDPA 1KRPA 3RMCA 4CK1A 4H5WA 3O4QA 4CZIA 4U7BA 3PUFA 2IIRA 4FOIA 4E19A 3OJUA 1NMDA 4B9SA 2YI1A 1CXUA 3DYAA 4E1MA 5J2NA 4GV9A 4DWIA 4RW8A 4DQQA 2WC9A 3EEQA 3DLRA 1NGCA 3EL2A 3G0ZA 5C25A 4HCCA 1Q8IA 3CCJN 2KFZA 1RT4A 4RG8A 3NH1A 3VQAA 3SBTA 3E9LA 2GUPA 1RT2A 3A5OC 3U4LA 4DR2K 2X78A 3THYA 2QA4N 1IH7A 5H1SQ 4JK8A 4E89A 3PIPL 3OYJA 3THYB 4DTJA 2AA4A 3W3DA 4B9NA 3G25A 2Z1JA 3BF1A 5KPRA 4FM1A 4E7JA 3DOKA 4DTMA 3LL3A 3R1XA 3KZBA 4J2DA 4AHSA 1BIZA 1XI1A 1N6QA 3NFAA 3H1VX 1JL2A 4IBNA 4FK0A 3VQCA 1ZYQA 1EQYA 3TAPA 3AAQA 3SYZA 5BREA 4CK2A 4EZ9A 2J4RA 3KK1A 1S6PA 1J54A 4CEOA 1EKEA 4CHNA 4Z94A 5C42A 2HOEA 3N4PA 1NG9A 5F2RA 3O8MA 1TL3A 3EKSA 4CIFA 4Z4FA 1B92A 2CH5A 3MN9A 4EAHD 3NVMA 4X66K 1BU6O 3WNGA 5J2MA 1VSJA 3BF3A 4GY2B 4JKGA 2IVOA 3FFIA 1JJ2M 3TSPA 2ITMA 3LAKA 4DSLA 2XY8A 3D2EA 4CGIA 4GMJB 5C2DA 1OKJA 2JLEA 1KSPA 4JK9A 3ZT4A 3KKSA 4BQZA 1SAZA 1NBWA 4KAZA 4LF5K 5AQIA 4FWQA 1VQKN 1FK9A 4WCEL 4H5RA 3WXIA 1JCGA 1VHXA 4BGBA 4IXCA 5CY4A 1DGKN 1Z26A 4I9QA 1CZBA 4FO0A 3TAGA 4IFYA 4RW4A 1LW2A 1WAFA 1YVNA 3QIPA 5LJVA 3TAEA 3M1FA 2NUBA 5FPEA 4YOXA 4I6MA 1RDUA 3I0SA 3L3UA 4M63C 4FJ9A 3T69A 2ZD1A 4O44A 4CF0A 1HKCA 3OYLA 3O4WA 3DXKA 2YHXA 3KWIA 2AJQA 4RWTA 2P1JA 1ASVA 3HM9A 3P1GA 4R5PA 1VRTA 4DS4A 4JS4A 2E20A 1Z25A 1NGIA 1NGHA 4KH4A 1JLQA 3C6HA 4E0DA 1VSMA 1FW6A 1ZBHA 5DM7L 3K58A 3HTVA 3V1QA 5CZ1A 1RFQA 4OO1J 4I7FA 3H08A 2VWJA 2E6LA 1S6QA 2ZGZA 3I8BA 1JLEA 4O8KA 4CJUA 4DTUA 1RT1A 1W2BM 3CCEN 2A42A 4MFBA 4JKGB 3HP6A 3L2VA 3AVKA 4DSEA 3ZLJA 1QQOA 4LSNA 1Q86O 4JI7K 1RBRA 3LDQA 1REVA 3VQPA 5EX5A 4JS5A 1C1AA 4RTFD 4PKHA 1SL2A 3IAYA 4X65K 2HVHA 1X9MA 2HNDA 3MDQA 4DFKA 1YTAA 1QTMA 1J5EK 3QERA 3VF6A 1N32K 5M1PA 1VK0A 3CPWM 1VQNN 4B9QA 2P9KB 3IKMA 3D0PA 4CEEA 1XWLA 3CCSN 3L4QA 5B8HA 4N56A 2OZMA 1KLMA 2ZGYA 2VQEK 4H0OA 2CH6A 3O9SA 4A2BA 4FK4A 4YORA 4WQ5A 5I42A 3C7NA 3I33A 4FM0A 4EZ6A 1MWKA 1NKCA 3IUCA 2A3ZA 3RMBA 3TWHA 4DV2K 3QIOA 3LZIA 1GLFO 1NKBA 3V9SA 3VTHA 4JEPA 4Z4EA 2DFFA 4B1UB 3AVBA 3FZFA 1Q81O 3AVNA 3AVLA 4EIAA 2XY5A 1ZBSA 2E2NA 4ZHRA 3PSIA 4PQUA 1N8RO 1IV0A 4CF9A 3V4IA 3PO4A 3EE8A 1BISA 4M42A 4GVEA 1U49A 4CBWA 5C15A 4JKAA 4M7XA 1SUQA 2KZMA 3QNOA 4H4OA 3FZHA 2P9PA 5BN8A 3MMVA 5GIOA 2CGKA 2WTUA 3S3NA 4H8KA 3OYGA 3ENBA 4CJ4A 1J6ZA 2P9LB 4K41A 3PSFA 4FLWA 4JI8K 1BCMA 5E41A 4CZJA 5LY3A 2UUCK 2I7PA 3MN6A 3GBTA 3T3FA 3IS9A 4BRQA 3MN7A 1RTIA 3MXJA 3PX4A 1FJGK 4PWDA 4IOCL 4B08A 1U47A 3D45A 2YNGA 4CZFA 4CESA 3T1YK 3AA4A 3A5MC 4FPAA 4QCLA 2PAVA 2I5JA 3ALYA 1HMVA 1KCFA 3AA3A 2KQ2A 5BRHA 4YOYA 2W42A 1IG9A 1YTUA 3FZLA 3LP3A 3HVTA 2HBJA 4H5VA 3O1BA 2G8VA 3DLGA 5BPLA 1KAZA 4BWJA 1HYSA 5AQTA 5AQOA 3I8DA 4WQ4A 1XMOK 3RWUA 3TTCA 4H4MA 4H03B 3ULEB 3ZSOA 1RBVA 3CJ1A 1E4GT 1MWMA 3CJ7A 3FZKA 4FLVA 5AZIA 4O0IA 5AQVA 4JI1K 3OYEA 3CFOA 2P9NA 5GAHP 3BUZB 5DM6L 4BRKA 1YHQN 1C0FA 4ELUA 2Q0UA 2FLOA 4RCHA 4KHPK 3ZT0A 4B3RK 1JCEA 1BL3A 3GOIA 5C10A 3WT0A 1HYZA 1YT3A 1GLEG 2EWSA 4KH5A 4LF7K 4F3TA 4BC4A 2IOCA 4PL7A 2WUSA 3THWB 2O8CB 4B9MA 1N36K 2QW9A 1SKRA 3B8AX 1NM1A 1ASWA 3VENA 2WBNA 3MXMA 1KLNA 4KHWA 1LW0A 5C12A 5HRNA 2YHWA 3E9OA 4WFBL 4NO7A 2OPPA 4CVNE 5HRPA 1VSDA 2V52B 4OPHA 5GADP 3ULEA 3QFPA 2E2QA 5AQYA 3J7YP 4B1XB 1UA1A 3ID8A 3LM2A 4AHVA 1KTQA 4ID1A 4OX9K 1P90A 2VG7A 4FW1A 4DUZK 1JXEA 1M90O 4BRCA 4DR6K 4Y0WA 1KC8O 4FWKA 3M5RA 3QESA 3OVNA 3VQ5A 3EO3A 2GELA 1D8YA 4YDUA 1P8ZA 4KO0A 4LY7A 4KH6A 2NRXA 1TUUA 4N76A 3F73A 4BRGA 4DR7K 1H1VA 4CJ5A 3A0IX 3QB0A 4H5NA 4F2SA 4KRFA 5KPZA 3OS0A 4DR4K 4DTNA 3K9KA 2ETJA 3THVA 1V4SA 2ZJQL 5M1NA 5JMVA 2Q3SA 5IT9O 1WSJA 2AP1A 4CGHA 3M6GA 3VGMA 1HKBA 2GV9A 1WSIA 1VQ8N 4KFBA 3AVFA 4DKWA 3JSMA 4FM2A 3VF2A 3MK6A 3O9RA 4PUOA 1C6VA 4JYAK 3SK3A 4DTSA 4B3OA 4NXNK 4OPJA 4E7IA 1QSSA 3HVRA 4DR3K 4CZGA 2HHUA 1V4TA 4XH5A 3U6FA 1EP4A 1FKPA 1TV6A 4CK3A 1K9MO 4DV5K 4ZTJA 4JHDB 2QWNA 4OKKA 2DFEA 4DF8A 5TKYA 2KZZA 1SKSA 1HPZA 1QZ6A 3NGYA 3LZJA 5AQHA 2P5OA 4FLZA 3EN9A 3SV3A 4DQPA 2VG5A 3CM5A 2HSTA 4R79A 1U2VB 3CHWA 4FJMA 5JS1A 4AM7A 3V81A 3K0SA 3NAEA 2P51A 2ITGA 1JLCA 4IZ9A 2F9TA 1IKYA 4B8AB 2DTUA 1W97L 3VQ6A 1EETA 4CERA 4IEIA 2E1YA 1GLCG 4OGEA 1Z6RA 3DLEA 3GE1A 4LF8K 4BG9A 1UA0A 4FLUA 4KHYA 1TK0A 3E1YA 1RBTA 1GOAA 4CCHA 1Y64A 5BPNA 4A5BA 4DUYK 5AQMA 1BDGA 3U8XA 5BR8K 4BG8A 4N41A 3QBWA 4O55A 1YIJN 4BWMA 1C0TA 3SQ2A 3L2QA 3AVIA 4B9UA 3SMPA 2NRWA 2BDPA 4C1NI 4JI6K 4JKCA 1XMQK 1ZBLA 3DI6A 4GKJK 1I39A 4O8UA 3JYTA 3OYHA 3VPZA 1N5YA 2O8CA 4O0JA 4Q0BA 3KD5E 1S1TA 3OYBA 4B9LA 3J8AA 4H0VB 3W0LA 2OTJN 2O8DA 3O3FA 3VQBA 4FWLA 3L8BA 4DHYA 4CJLA 2ASOA 3P83D 3QDKA 3DRPA 4O5BA 2QI2A 2P9PB 1A5WA 2O4IA 2O8DB 1YAGA 4FZYA 1TKXA 1VSIA 1RDDA 2HHQA 3M8SA 1RTHA 3UKUB 3KLGA 4IOXA 4G1QA 1U4BA 3NE6A 4MO4A 2A41A 3OYFA 4LFCK 3JAMO 4DR5K 5C2FA 2O8BA 5DMRA 1W9HA 1U04A 3HL8A 4OVLA 5K14A 2JGUA 4DTOA 2GBZA 4DQSA 4DMNA 4DG1A 2FXUA 3ASMA 4L8RB 4M3XA 2QXLA 4CEZA 4RW7A 3CJAA 1VSEA 3SMSA 4F4KA 4HCBA 3VN5A 2QWRA 3AA5X 3FGUA 4ZTFA 2NRRA 2P5GA 3QO9A 1QZ5A 5AQWA 4BR9A 2V7YA 2X6SA 3QBXA 4IG0A 4IDKA 3T1HK 1BQNA 4CGGA 1JXBA 4BRNA 1ZBIA 1VRUA 4U67L 3C6AA 4DV1K 4V19S 3T7ZA 4EP5A 1HYVA 5AQUA 1EXQA 5BN9A 3CCRN 3CD6N 3H3NO 3VEXA 2P9UB 4FPBA 2HBMA 2A5XA 3S9HA 2BE2A 4O5FA 3WUHA 2GUIA 1WOQA 3L3VA 2FF3B 2YHAA 3WQUA 4FVMA 3CG7A 1HR0K 3O08A 4AF1A 3SQ4A 2O8EA 2BUPA 4Z4GA 4YOWA 5BRFA 1DT9A 3WEEA 4WE1A 2E88A 3IRXA 4Z0UA 4HVJA 3VEZA 2HB5A 3L0QA 1QE1A 1HX1A 3AGKA 3S3OA 4BRDA 2UXCK 1T44A 2ASPA 4RW6A 4Y1DA 3U9DA 4BY9C 5EVZA 4H0XB 1NGDA 1SQKA 3SV4A 3KVGA 1NGFA 3LPTA 2KHOA 1RILA 5CHIA 2FSNA 4CFCA 5AQPA 4B8CA 2A40A 3MEGA 3DXKB 3HRGA 3MN5A 2W41A 4F8RA 1LAWA 4LF4K 3CC7N 1JLGA 5C24A 3C7NB 1I3AA 4DTXA 3VMFB 2ZJRL 3O80A 3D6RA 4JI5K 1NLVA 5EU7A 3MEDA 5BPMA 3IDHA 4PL8A 2YJEA 3RSEB 3U3YA 4DFPA 1WAJA 2F7TA 4C8KA 1TUYA 1F21A 4CZMA 3TR8A 5AQRA 1NGEA 3J81O 3NF9A 1BOTO 1Y97A 5AZIB 3AVJA 2NRTA 3AO4A 3SI6A 5HL7L 3G4SN 1LV5A 3PX6A 2P9LA 2GWKA 1GOCA 5J1EA 1NJYA 4CJSA 1QHTA 1ASUA 4C8OA 3H6EA 4EHTA 2D0PA 4KPYA 4B1YB 5JICA 3VQQA 1KVBA 1VQ7N 3T1AA 3Q7CA 3GL1A 4CE9A 3KLHA 1CLQA 4FLXA 5KGXA 4GV6A 1NMNA 1NGBA 1A5XA 1VQPN 5I9EB 4QS8A 4ILGB 2ZE2A 1NK6A 2FBYA 3TABA 3NBPA 4LSLA 2F96A 1QQMA 3MX5A 4CHPA 3MXIA 3MAQA 3QICA 1VQON 3KK7A 4KI4A 1OH5A 4CBUA 4BE2A 2JWKA 3GDQA 5IWAK 3CPEA 1XNRK 5J2PA 3QEVA 3O3HA 4NLCA 3VA0A 4XH4A 4EFHA 5AFUH 3V9UA 4FW2A 1T05A 4KHQA 2P9SB 3C65A 3WNEA 4I6MB 5FPMA 4NXMK 4WYBA 2VWKA 1GLLO 4NLBA 4CJ3A 1N34K 4JI4K 1SV5A 5JVHL 5J2QA 5JLFA 3H1QA 4FZZA 4CJQA 3CFRA 4FWRA 5GAGP 1QVGM 2IAJA 4GNIA 3TSQA 3F2KA 3VEWA 4EP4A 1RCHA 3ZSVA 4DCHA 3VERA 3CIPA 1S3XA 4JK7A 1UOCA 4C8LA 3IG1A 3CM6A 3T19A 2OYQA 1G15A 4OJRA 5KQ8A 3SPYA 4ELTA 2O8FA 5AQFA 4QOZB 3DLKA 2IVNA 4DTPA 3CJBA 4JKHA 3ZETA 1B9DA 3EYZA 1LWCA 3RR8A 3PV8A 4F9OA 3SJJA 1FXXA 2RE2A 3G6EN 3HO1A 5ADXA 2ZWHA 4DLGA 1L3SA 3QEWA 4Q5VA 2PYJA 3ZX3A 1JLAA 3ZCMA 3K5NA 1G99A 2I7NA 2QWLA 3QEIA 3HPHA 3VETA 1NGAA 4WF9L 4A5AA 4FZXC 3DOLA 4CD3A 4MDBA 2YNFA 1OH8A 1HRHA 3DRSA 1GLBG 1K6YA 1TL1A 4QS7A 3LDSA 4KBOA 1RT6A 4KV8A 5AJ3K 2E5LK 1LOTB 2F9WA 3V1OA 4W5TA 4CJTA 5AQXA 2GTDA 2HVIA 3A5LC 4XIUA 4CEFA 3MCPA 3K9JA 2YV0X 3KLEA 1NJIO 2QKKA 2OPQA 3LP0A 4BRFA 2UYTA 1NNEA 3U3GA 2UUAK 4UQGA 4DLEA 3CQYA 4NYNA 4NB4A 4YDUC 1NK5A 1VQ5N 5KQDA 4GKKK 4IOAL 4WFNL 3OA9A 1B9FA 4FLTA 4CEAA 3QFUA 1GLAG 4JLHA 2FBVA 3FE1A 4KTZA 1ZXOA 3PY8A 4KHNA 3OY9A 4BQLA 4CZKA 3BZKA 4IDHA 3LWMA 3MECA 4CFDA 3ZSRA 5CE3A 3SZ2A 2RPIA 3F5TA 3VEOA 1NJZA 2BGGA 3WEEB 4FCYA 2F8TA 1QS4A 2NRHA 4B9VA 1JCFA 2KFNA 2YX6A 3F9KA 4BC5A 4Z4IA 4IG3A 4ID5A 4QS9A 4CBXA 4HTUA 3MWPA 3P31A 1NKEA 4OGCA 4YOUA 3UKRA 4FWMA 1VAZA 3Q7BA 2P9KA 2YHYA 1VQLN 2Q97A 4C8MA 2HF3A 3CCUN 1L3TA 1EWRA 3R3LA 5KI6A 4K42A 4IEEA 3SQ1A 2W40A 4B1ZA 1Q9YA 4JV5K 2VGMA 4FWPA 4JKEA 4CEQA 1KXPA 1IKVA 4CFBA 3AO5A 4BE0A 3WNHA 1YUWA 2OPSA 1RNHA 2QXFA 4BACA 4CF2A 4LF6K 3MX2A 3CF5L 3AO3A 3K57A 3ZETB 2B6AA 1DTQA 4A62A 3J7ZO 1RGIA 3AV9A 3V1RA 1NK4A 1I94K 2G8WA 4JI3K 3VOVA 4IKFA 1TKZA 3CMEN 4F2RA 3CQXA 3NH2A 2Q1NA 3OBWA 2Y1JA 4BDZA 3DLHA 3TSUA 1ZBUA 2XRIA 2YKNA 4AHCA 3O3GA 5CYQA 5D3GA 4OLAA 5KRSA 1S9GA 2X74A 1LAVA 1C0UA 4DR1K 1L3VA 1KQSM 1IJJA 3THXB 2O8BB 4BGAA 4FJXA 5M1FA 2Q0RA 3E66A 3LDOA 3DAWA 1VQ4N 2UXDK 1BI4B 3HOSA 1MDUB 2E2PA 1WN7A 1RDWX 4JKDA 3NMUA 2KW4A 3VTIA 4Z4CA 2FC0A 2PBDA 1C0MA 3MWTA 2WONA 5KGWA 1DKGD 1BQMA 2P9SA 2BH1A 1K8AO 4CD1A 3ZX0A 1NK7A 3NF7A 1BI4A 3ATUA 1NGJA 1X9JA 1RT3A 3C6UA 3ZT3A 5GAEP 2YNIA 1HNVA 3CQ8A 4C1NK 4GW6A 3ZSQA 3VQ4A 3NF8A 1WB9A 4E1JA 1IG8A 1TK8A 3NF6A 2D0BA 1FKOA 4YFUA 3G10A 4H0PA 1WSEA 3SPZA 3FFKB 2FBXA 1E4FT 2E2OA 4DSKA 1JLFA 3C94A 4CEBA 1T6DA 1WSFA 1X3NA 3WXLA 4B1VA 4M45A 3AARA 4YHHK 2PZSA 5E84A 1TKDA 4FXDA 1U48A 3AO1A 3V9XA 1RTDA 4OKEA 2Z1IA 1NGGA 3TI0A 3M8PA 4I2QA 4CEDA 2ASMA 3O9QA 4DU1A 1WSGA 3HYFA 3NHGA 4M3RA 3VQ8A 2R7YA 4KREA 1W7AA 1O1WA 4N5SA 2G8KA 3HI0A 2QTDA 4AHUA 4K43A 1QQCA 5GIPA 3OHRA 4AHRA 2IGIA 3VGKA 4KB0A 3QLHA 4IFVA 3AA2A 4CF1A 1GLDG 3OTOK 1YF5L 2KTQA 4KKOA 4DV7K 5HRSA 4BRMA 3ZT1A 4CJ7A 4FJNA 3HP9A 3RMAA 3RSEA 1ATRA 3SUPA 2A1SA 1BGXT 1GOBA 1J53A 3SNNA 1U45A 4BREA 3TTFA 4CJPA 4BDYA 3RTVA 2HHWA 4ICLA 1CZ9A 3HM8A 2P9IB 3D2FB 3SCXA 2HNZA 5SWMA 4X64K 2VQFK 3CCMN 3J80O 1ZC6A 1TVRA 2GEMA 2IS3A 4B3SK 2ZF5O 3N4QA 4I2PA 3TU5A 4IJAA 5KTQA 3A8YA 2BTFA 3K5MA 4CJFA 4B3MK 5FPNA 1T6CA 2OPRA 4CJEA 1T8EA 4CHOA 4BVOA 1SL1A 2A1RA 1LCUA 5CZ2A 2D5RA 3F9MA 2Q31A 4B1WB 2E6MA 3O9TA 3UKUA 1EX4A 3IFRA 3ISNC 4IO8A 1KAXA 2HW3A 3ZSWA 1TKTA 3RVCA 4XEIA 1D4XA 2O8EB 4DQIA 3HSTB 3P4IA 4K8ZA 2EHGA 5JVGL 3I55N 4C8NA 2F8SA 3E01A 1IO2A 2E8AA 3M8RA 4GV3A 3B6OA 3LPUA 3KLFA 3NVKA 3WXJA 4LFBK 2P9UA 3HZ6A 5AR0A 3CC4N 4E7LA 3OYDA 3AVMA 4XH1A 3EKUA 1K8KB 3PIOL 2W6KA 3DJCA 4E7KA 3J7AP 5AFUA 4FJLA 4A61A 3HPOA 3EY1A 5E26A 4IJNA 3K59A 4ELVA 1OVQA 4QAGA 3VF4A 4M3YA 2O8FB 4OKJA 3D7EO 3OW2M 4CZHA 1GLJO 3BP8A 4M3WA 3TPQA 3K2PA 4MO5A 3O9UA 3DM2A 4CFAA 1IBLK 2G8HA 1BCOA 2Y1IA 4DTRA 3L6QA 1OH7A 3OBYA 4OPAA 4PKIA 4FJJA 3E9PA 4DSFA 3DXMB 5HROA 2B4JA 1EWQA 3HSCA 1SKWA 1HLUA 3QNNA 4JI2K 1SZ2A 4M3ZA 1CXQA 4DQ8A 3QEXA 1T7PA 2XY6A 2QWOA 2DPNA 1HQEA 2WOMA 3LP1A 1SL0A 2UXBK 4RW9A 3VQ7A 1JKHA 1HKGA 1SS6A 1S22A 1D5AA 3NH0A 4ILHA 1ZBFA 2HMPA 2HHSA 2D1KA 4BR5A 3CYMA 4DB3A 4BE1A 1QHAA 3IMXA 4BRAA 4OLBA 5AQNA 4NCBA 2RF2A 3SUQA 4M3UA 3CMAN 2X6NA 3KK2A 4BRHA 3PO5A 4NCAA 2VGNA 1U6ZA 1YXQA 1RDCA 4K0KK 3H3OB 1MA9B 4ISGA 4DF4A 1JLBA 3ZSXA 3DRRA 5AQGA 1ILYA 2FSKA 1DTTA 1XUPO 3AVCA 3L4IA 4YOVA 4J2BA 4JRQA 2FBTA 3EE9A 3A5NC 3HJFA 3V6DA 4CGJA 1KFSA 4H5TA 4IWVA 4HHTA 1R0AA 3ZEUB 3EZ5A 4CECA 1XQSC 4FWNA 3ZX2A 4LH4A 3QETA 4CGDA 4A59A 4J8FA 5M1KA 2NRZA 3LP2A 3RMDA 1RT5A 3SUNA 4PY5A 3VEYA 3CI5A 1TAQA 5FPDA 1TYQB 3P5JA 4CIEA 4L3QA 3P39A 1C0GA 5EXWA 1ESVA 1S72N 3UIQA 3LALA 3VQ9A 4AILC 3HOTA 4DU4A 2DY4A 2OTLN 4LFAK 4W5NA 3WQTA 5AZJB 4HUFA 2VG6A 3CCQN 2JWLA 3M8QA 2HBLA 2V51B 1WBBA 4YNQA 5HLFA 2FSJA 1A5VA 4FLYA 2Q36A 1NU0A 2P9NB 1E3MA 5AQJA 2Z1GA 2HMIA 4UY8O 1YI2N 1NWKA 4M7YA 4WQ4C 5DK5A 4DV4K 3ITHA 1L5UA 3OYCA 1QVFM 1VSKA 4FJGA 4MLEA 2QKBA 4JN4A 4HUEA 1YJWN 4K25A 4BC3A 3H45C 3ZSYA 4CGFA 3RRGA 1HNWK 1X3MA 3L2WA 2P9IA 3D2FA 5KRTA 1D9DA 1WUAA 3QINA 3WXMB 4DS5A 1C1BA 2E4LA 5JLHA 3CXCM 4FJHA 4K8XA 4FJ5A 5AZJA 1QSLA 3P38A 4BC2A 1M1KO 4BVPA 4IO9L 3CERA 3VA3A 1NOYA 4Z4HA 4CHYA 2EX3A 2RKIA 4DV6K 1Q7YO 4CJRA 4MLHA 5AQZA 3V9ZA 3TANA 3VGLA 3DLBA 4HTLA 3R8EA 4DV0K 3LM9A 1TYQA 1XC9A 1NK9A 2HHHK 3DXMA 3OYMA 4A57A 2QWPA 1NK0A 1R59O 4O4GA 3ULDA 4E7HA 3R6MA 1RT7A 1X9WA 1S1XA 3WNFA 2YJFA 4CHZA 3AVHA 2QM1A 2PYLA 4CF8A 4KHUA 3KWGA 4JKBA 1UWBA 5ADXH 2XHBA 3VQEA 3B6PA 3ZEUA 5HBMA 4PA1A 1NOZA 3SJHA 4ISFA 1XNQK 4JHDA 4BR0A 4CZLA 4X62K 4DSJA 1HNIA 4JAXA 1EO1A 3WXKA 4AHTA 4WQ5C 3LWLA 1HJRA 1BA0A 1XHZA 4H0YB 4AM6A 4FWSA 1YJ9N 1ATNA 2HBKA 4YY3K 3TTDA 2KLAA 3THWA 1HQUA 3HPGA 5AQLA 3BEXA 3TAMA 3KJVA 2WFBA 3JXUA 5FRMA 4BROA 1X1PA 1IBMK 5EOYA 1U2VA 2VWBA 4JD2A 4I9LA 1IBKK 5BR9A 2IVPA 3VESA 5M1OA 1RTJA 4C23A 4H0TB 1WSHA 4JD2B 1VSHA 2F4VK 3O4NA 3HBTA 5LJWA 1QQNA 1VSLA 2HHXA 4FL9A 5SZTA 3TAQA 2YCHA 4BR7A 3L2UA 3ZSZA 2CGLA 2YHBA 5TKWA 4LF9K 4BRPA 2IDOA 3ENOA 2NNWA 1BA1A 5LMNK 1RBSA 4DFJA 3U9ZA 4B9TA 1S1WA 1LWFA 3R9PA 1NJXA 1HNZK 2OA8A 3HXMA 1BHLA 4CZEA 3CFPA 4CIGA 1CZAN 5FLXO 3BZCA 3D2EB 4DV3K 1QSYA 1WLJA 1J9AA 4OPKA 3QMLA 3DMJA 5A2QO 5HRRA 2O4GA 2VYPA 3CETA 4FVUA 4FOEA 4M3TA 2NRVA 3L2RA 3ZYYX 3SAFA 3RR7A 4BDPA 1UAXA 4CJVA 2ZJPL 1X9SA 2G8UA 1N33K 3SBGA 2ATQA 1WNSA 3SQ0A 3GG4A 3UB5A 1KAYA 3ZT2A 4BRIA 5EY4A 1S1VA 3UKRB 2HF4A 4W5RA 3FR0A 4B3TK 1T3VA 3KKRA 4WFAL 1TAUA 1D9FA 2ZM6K 2Q2RA 1Q82O 1Z05A 4LC9B 1OVYA 4J2AA 4F3OA 3AGRA 3H46O 1YITN 1Q18A 1NK8A 1KVCA 4E3SA 2OZSA 4W5QA 4A2AA 5MLCQ 1S9EA 1KD1O 4JI0K 4AH9A 1BIUA 4KTQA 3ENHA 4KHSA 4N47A 3AY9A 1TGOA 3DLLL 4FYDA 2Z1HA 4CHQA 2PY5A 5GINA 3AO2A 3LAMA 5FDLA 4FK2A 2NZTA 2DFHA 4KTWA 1KVAA 4NYFA 2IC3A 1XHXA 3HT3A 1XC3A 3LANA 5M1QA 1OH6A 3C0BA 4NCGA 1WBDA 3OYKA 4FWOA 3EZWA 3CJCA 1DEJA 2V7ZA 4W5OA 2KKZA 2G8IA 1JL1A 1RDBA 1HUXA 2HHVA 2D0OA 1IKWA 1S1UA 4HUGA 3M3ZA 3BY5A 5AQSA 4MDAA 5BRDA 1K8KA 3NGIA 4LD0A 2W6LA 3SAGA 4DSIA 3OYAA 4CJKA 2YNHA 3O5BA 2QK9A 3AVAA 4FSVA 3LDPA 2A6AA 4J2EA 2XY7A 3THXA 3O1WA 3RRHA 5ELZA 1IKXA 5AQQA 3LDLA 3A2FA 2GWJA 3CCVN 3NCIA 1LWEA 4IFEA 1ATSA 4EHUA 3OYIA 2QWQA 1Q9XA 3OYNA 1KFDA 3PLAA 3OS1A 2RN2A 4DFMA 2QWMA 5F0XA 1TK5A 3SUOA 1DLOA 2HNYA 5CR4A 4CI6A 2G8FA 1K73O
chains in the Genus database with same CATH topology
1KAZA 3GL1A 4MO5A 3O9UA 4GV6A 5AQTA 1NGBA 2E1ZA 5AQOA 4WQ4A 1VQPN 4ILJA 3TTCA 4QS8A 4ILGB 4H03B 5I9EB 3ULEB 3CJ1A 1E4GT 3L6QA 2D4WA 3OBYA 1MWMA 4OPAA 3CJ7A 2NLXA 1QQMA 3MX5A 4PKIA 4G9ZA 3E9PA 1BUPA 3FZKA 3DXMB 3QICA 4YOTA 1VQON 3KK7A 4ISEA 5AZIA 3HSCA 3FLCO 5AQVA 3SAHA 4CBUA 1HLUA 1SZ2A 2P9NA 5GAHP 2JWKA 4PHTX 3GDQA 3ATVA 3BUZB 3CPEA 4DQ8A 5DM6L 4BRKA 1YHQN 1C0FA 1BG3A 4NLCA 1YJNN 4XH4A 4EFHA 2Q0UA 2QWOA 2DPNA 2FLOA 2FF6A 4RCHA 3O6WA 5AFUH 2QEXN 2PFUA 2GX9A 2P9SB 1HKGA 1SS6A 1S22A 3C65A 4I6MB 5FPMA 2H3GX 3CCLN 1JCEA 1HJOA 4ILHA 3GOIA 4WYBA 2HMPA 3ID6A 1GLLO 4NLBA 5C10A 2D1KA 4BR5A 1HPMA 4HWIA 2CGJA 3S41A 3WT0A 5JVHL 1GLEG 2EWSA 4KH5A 4BR2A 4DB3A 3FZMA 2OANA 1QHAA 4BC4A 3IMXA 4BRAA 4PL7A 5JLFA 1BWFO 3H1QA 2WUSA 5AQNA 1BO5O 4FWRA 5GAGP 2QW9A 3B8AX 3CMAN 1NM1A 3VENA 3AAPA 1QVGM 2WBNA 4BRHA 3I56N 1VQMN 4GNIA 3TSQA 3F2KA 5C12A 3VEWA 2VGNA 1U6ZA 2YHWA 3E9OA 4WFBL 3KHYA 1YXQA 4NO7A 2VCPA 3DWLA 4DCHA 2V52B 3VERA 3H3OB 1MA9B 4ISGA 3CIPA 4OPHA 3ULEA 5GADP 4JKFA 5AQGA 4JNEA 1S3XA 4BR4A 2FSKA 4JK7A 1XUPO 1ILYA 3QFPA 2E2QA 5AQYA 4B1XB 5F1XA 3L4IA 4YOVA 5AQKA 3ID8A 3LM2A 3SLCA 3LDNA 3EE9A 3A5NC 1VQ6N 3JS6A 3CJ9A 5KQ8A 1P90A 3G71N 4H5TA 4IWVA 5AQFA 3ZEUB 1O13A 1M90O 3CC2N 2IVNA 3CJBA 4JKHA 4PKGA 3ZETA 1XQSC 4FWNA 3ZX2A 4BRCA 4Y0WA 1KC8O 3VEVA 4F9OA 2RE2A 4FWKA 3G6EN 3M5RA 4J8FA 3UE5A 2ZWHA 4A59A 5ADXA 5M1KA 3EO3A 2GELA 2NRZA 2RHKA 5KPTA 5C0YA 3ZX3A 4YDUA 3VEYA 3CI5A 1P8ZA 1G99A 5FPDA 2I7NA 1TYQB 2QWLA 3MCAB 4KH6A 2NRXA 1TUUA 4L3QA 4BRGA 3P39A 3VETA 1H1VA 1C0GA 1NGAA 4WF9L 4A5AA 3A0IX 3QB0A 4H5NA 5EXWA 1ESVA 1VQ9N 4CD3A 4MDBA 4BRLA 5HOOA 1S72N 5KPZA 4H5VA 1GLBG 4H5WA 4CZIA 4U7BA 3HOTA 2IIRA 4FOIA 3K9KA 4QS7A 1NMDA 4KBOA 2YI1A 2OTLN 1V4SA 2ZJQL 1LOTB 2F9WA 5M1NA 3WQTA 5JMVA 5AZJB 5AQXA 2GTDA 2AP1A 3A5LC 3M6GA 3MCPA 3K9JA 1HKBA 3VGMA 3CCQN 2JWLA 4GV9A 1VQ8N 2HBLA 2V51B 1NJIO 4DKWA 2WC9A 3VF2A 4BRFA 2FSJA 2UYTA 3MK6A 1NGCA 3O9RA 3EL2A 2Q36A 3CCJN 2P9NB 5AQJA 3CQYA 3SK3A 4NB4A 3SBTA 4YDUC 3E9LA 5KQDA 1VQ5N 2GUPA 3A5OC 3U4LA 4IOAL 4WFNL 4UY8O 1YI2N 1NWKA 3OA9A 4M7YA 4WQ4C 2QA4N 4CZGA 3QFUA 1GLAG 5H1SQ 4JK8A 3PIPL 1V4TA 4XH5A 2AA4A 3FE1A 3W3DA 1QVFM 1ZXOA 3G25A 4MLEA 4BQLA 4JN4A 4CZKA 1YJWN 4IDHA 3BF1A 4K25A 5KPRA 1K9MO 3LL3A 3R1XA 3H45C 3KZBA 4BC3A 5CE3A 4JHDB 3F5TA 2QWNA 3H1VX 1X3MA 3VEOA 2P9IA 3D2FA 5TKYA 3WEEB 1WUAA 1EQYA 2NRHA 1JCFA 1QZ6A 3WXMB 2YX6A 3AAQA 4BC5A 5JLHA 3CXCM 5AQHA 3EN9A 5AZJA 3P38A 4QS9A 4BC2A 4CBXA 3MWPA 2HSTA 3P31A 5BREA 4R79A 4BVPA 1M1KO 4IO9L 3CERA 4YOUA 1U2VB 3UKRA 4FWMA 3CHWA 2J4RA 1VAZA 3Q7BA 1Q7YO 2P9KA 4AM7A 2YHYA 4MLHA 5AQZA 1VQLN 3VGLA 2Q97A 2HF3A 3CCUN 3R3LA 4HTLA 4K42A 3R8EA 3LM9A 4IEEA 4IZ9A 2F9TA 2W40A 4B1ZA 4Z94A 1W97L 1TYQA 2VGMA 3DXMA 4FWPA 4IEIA 2E1YA 1KXPA 4JKEA 4A57A 2HOEA 2QWPA 3N4PA 1GLCG 1R59O 5F2RA 3O8MA 3R6MA 3EKSA 1YUWA 1Z6RA 3GE1A 2YJFA 4BG9A 2CH5A 3MN9A 3MX2A 2QM1A 3NVMA 4EAHD 1BU6O 3CF5L 3E1YA 3ZETB 3KWGA 4JKBA 1Y64A 3BF3A 4GY2B 4JKGA 4A62A 1RGIA 2IVOA 5ADXH 3J7ZO 3ZEUA 4CI6A 5BPNA 1JJ2M 3TSPA 4A5BA 3SJHA 5AQMA 2ITMA 4ISFA 1BDGA 3U8XA 3VOVA 3CMEN 4JHDA 4BG8A 4BR0A 4CZLA 3D2EA 3CQXA 2Q1NA 3OBWA 3QBWA 5C2DA 1YIJN 3TSUA 1OKJA 4JAXA 1EO1A 3WXKA 4WQ5C 4JK9A 1BA0A 4BQZA 4H0YB 2NRWA 1SAZA 3SMPA 1NBWA 1KQSM 1IJJA 4AM6A 4FWSA 4C1NI 4JKCA 1YJ9N 1ATNA 5AQIA 4BGAA 4FWQA 5M1FA 4O8UA 2Q0RA 2HBKA 1VQKN 3TTDA 3E66A 2KLAA 3LDOA 4H5RA 4WCEL 3VPZA 3WXIA 1JCGA 5AQLA 3BEXA 3DAWA 2WFBA 4IXCA 4BGBA 3JXUA 1VQ4N 1DGKN 3HOSA 3J8AA 1MDUB 2E2PA 4H0VB 1RDWX 4JKDA 3W0LA 4BROA 2OTJN 3NMUA 4FO0A 3VTIA 4FWLA 1U2VA 2VWBA 5EOYA 1YVNA 4JD2A 2PBDA 4DHYA 2IVPA 5BR9A 5LJVA 3MWTA 3M1FA 5M1OA 3VESA 2ASOA 3QDKA 4C23A 5FPEA 1DKGD 4H0TB 4YOXA 4I6MA 4JD2B 2P9SA 2QI2A 1RDUA 2BH1A 3HBTA 5LJWA 4CD1A 2P9PB 1QQNA 1K8AO 3ZX0A 4M63C 1YAGA 4FL9A 3T69A 3ATUA 1NGJA 1HKCA 1X9JA 2YCHA 4BR7A 3UKUB 3O4WA 4IOXA 5GAEP 3DXKA 2YHXA 3KWIA 4MO4A 2CGLA 2A41A 4C1NK 4RWTA 1K73O 5TKWA 4E1JA 1IG8A 5C2FA 4BRPA 2E20A 1NGIA 3ENOA 2NNWA 1BA1A 1NGHA 4KH4A 4H0PA 3U9ZA 3C6HA 5DM7L 2FXUA 3FFKB 3R9PA 3HTVA 2QXLA 1E4FT 2E2OA 1RFQA 4CZEA 4OO1J 1CZAN 1T6DA 1X3NA 3CJAA 3SMSA 3WXLA 4B1VA 3AARA 3D2EB 5E84A 2ZGZA 4O8KA 3I8BA 1W2BM 3CCEN 2A42A 1NGGA 2QWRA 3QMLA 4JKGB 3FGUA 2NRRA 1QZ5A 5AQWA 2ASMA 2V7YA 2VYPA 1QQOA 3O9QA 3QBXA 4BR9A 3CETA 4FVUA 1Q86O 4FOEA 2NRVA 3LDQA 3ZYYX 3SAFA 5EX5A 4BRNA 4RTFD 4PKHA 4U67L 3C6AA 3T7ZA 5AQUA 2ZJPL 5BN9A 3CCRN 3CD6N 3HI0A 3MDQA 2QTDA 3H3NO 4K43A 5GIPA 3OHRA 3SBGA 3VEXA 2P9UB 4FPBA 2HBMA 3VF6A 3VGKA 2A5XA 5M1PA 3CPWM 3GG4A 1VQNN 4O5FA 3UB5A 3WUHA 1KAYA 4B9QA 1WOQA 1GLDG 2P9KB 2FF3B 3IKMA 1YF5L 4BRIA 3WQUA 5EY4A 4BRMA 3CCSN 3UKRB 2HF4A 4CJ7A 3L4QA 3O08A 1ATRA 3RSEA 4AF1A 5B8HA 3FR0A 2ZGYA 2BUPA 1T3VA 4H0OA 4WFAL 4BREA 3TTFA 2CH6A 3O9SA 4A2BA 4YOWA 2Q2RA 4YORA 5BRFA 1Q82O 1Z05A 4LC9B 4WQ5A 3C7NA 3I33A 1OVYA 3HM8A 1DT9A 1MWKA 3AGRA 2P9IB 3D2FB 2E88A 3H46O 3IUCA 3WEEA 2A3ZA 1YITN 3VEZA 1Q18A 3L0QA 3CCMN 3AGKA 1HX1A 1ZC6A 1GLFO 4A2AA 2GEMA 5MLCQ 4BRDA 2ZF5O 3VTHA 4JEPA 1KD1O 1T44A 2ASPA 3N4QA 4IJAA 3TU5A 3U9DA 4B1UB 4BY9C 3ENHA 5EVZA 3A8YA 3FZFA 1Q81O 3AY9A 4EIAA 4H0XB 1NGDA 3DLLL 1SQKA 2BTFA 3KVGA 1ZBSA 5FPNA 1NGFA 1T6CA 2E2NA 2KHOA 5CHIA 5GINA 2FSNA 2NZTA 4BVOA 1N8RO 5AQPA 1LCUA 2A40A 3F9MA 3DXKB 3HRGA 3MN5A 2W41A 2Q31A 3EE8A 3O9TA 3UKUA 1XC3A 4B1WB 3IFRA 4GVEA 4CBWA 5M1QA 5C15A 4IO8A 3C0BA 3CC7N 4JKAA 4M7XA 3C7NB 3VMFB 2ZJRL 1KAXA 3FZHA 3O80A 4FWOA 2P9PA 3D6RA 5BN8A 1NLVA 3EZWA 3MMVA 3CJCA 5GIOA 2CGKA 3RVCA 5BPMA 4XEIA 1DEJA 3IDHA 1D4XA 2V7ZA 2KKZA 4PL8A 2YJEA 3RSEB 3P4IA 1HUXA 3ENBA 2D0OA 1J6ZA 2F7TA 2P9LB 3M3ZA 4K41A 5JVGL 5AQSA 1TUYA 3I55N 4CZJA 4MDAA 4CZMA 1K8KA 5BRDA 5LY3A 2E8AA 4GV3A 2I7PA 3MN6A 1NGEA 5AQRA 3SAGA 3GBTA 3NVKA 3WXJA 4BRQA 2P9UA 3O5BA 3MN7A 3HZ6A 1BOTO 5AR0A 3CC4N 4FSVA 3LDPA 5AZIB 2A6AA 4IOCL 4XH1A 3EKUA 2NRTA 1K8KB 3O1WA 3PIOL 5ELZA 5HL7L 5AQQA 3G4SN 3LDLA 3DJCA 2GWJA 2P9LA 3CCVN 2GWKA 4IFEA 4CZFA 1ATSA 4EHUA 5AFUA 4A61A 2QWQA 3A5MC 4FPAA 5E26A 4IJNA 3PLAA 2PAVA 3H6EA 4EHTA 2D0PA 3VF4A 2QWMA 4B1YB 3D7EO 5F0XA 5BRHA 5JICA 3OW2M 1VQ7N 4YOYA 4CZHA 3FZLA 3O1BA 2HBJA 1GLJO 5CR4A 3BP8A 3Q7CA 3TPQA 5BPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MCA B;  1DT9 A;  2VGN A;  3E1Y A;  2VGM A;  3WXM B;  3VMF B;  2HST A;  4AF1 A;  3OBY A;  2QI2 A;  3OBW A;  3AGK A; 
#chains in the Genus database with same CATH topology
 4DQR A;  2E1Z A;  4ILJ A;  1W0H A;  1HNX K;  3C95 A;  3TAR A;  2D4W A;  4G9Z A;  2OCE A;  2NLX A;  3NDK A;  3OS2 A;  1BUP A;  3MEE A;  4CJW A;  4YOT A;  4ISE A;  3SAH A;  3FLC O;  2YKM A;  4PHT X;  3ATV A;  4JRP A;  3BGR A;  1BG3 A;  5CYM A;  1YJN N;  3OJS A;  3PX0 A;  2BAN A;  5HP1 A;  2FF6 A;  3O6W A;  2QEX N;  2PFU A;  2GX9 A;  3KLI A;  3KD1 E;  2H3G X;  3CCL N;  2D0A A;  1HJO A;  4MQ3 A;  5LL6 Z;  3ID6 A;  3K5O A;  1YVU A;  3I0R A;  4FJ8 A;  4FJK A;  1HPM A;  4HWI A;  2CGJ A;  3S41 A;  4BR2 A;  3FZM A;  2OAN A;  1RDA A;  3VQD A;  1BWF O;  1VSF A;  4Y1C A;  4CW7 B;  1BO5 O;  3K5L A;  1RBU A;  5T7B A;  3KTQ A;  3HK2 A;  3AAP A;  3I56 N;  4LH5 A;  1VQM N;  3KK3 A;  2B5J A;  2D0C A;  3C6T A;  3KHY A;  1NJW A;  2VCP A;  3DWL A;  3S3M A;  4KI6 A;  4FJ7 A;  4TSX A;  5FRN A;  4GVM A;  4JKF A;  4JNE A;  4BR4 A;  1ITG A;  3KIO A;  5F1X A;  1C1C A;  4FJI A;  5AQK A;  3SLC A;  3LDN A;  2UUB K;  1VQ6 N;  3JS6 A;  3CJ9 A;  3NGZ A;  3G71 N;  4DU3 A;  5I3U A;  1S5J A;  1MU2 A;  2LSN A;  3AVG A;  1O13 A;  1J5O A;  3QEP A;  3CC2 N;  2ZQB A;  4PKG A;  5FRO A;  3TAF A;  4AQY K;  2XO7 A;  1T03 A;  4E1N A;  3VEV A;  1L3U A;  5LMU K;  3UE5 A;  5KPT A;  2RHK A;  5C0Y A;  4KB1 A;  2UU9 K;  3V9W A;  3MCA B;  2HHT A;  4M41 A;  1VQ9 N;  5JS2 A;  4BRL A;  5HOO A;  3BDP A;  1KRP A;  3RMC A;  4CK1 A;  4H5W A;  3O4Q A;  4CZI A;  4U7B A;  3PUF A;  2IIR A;  4FOI A;  4E19 A;  3OJU A;  1NMD A;  4B9S A;  2YI1 A;  1CXU A;  3DYA A;  4E1M A;  5J2N A;  4GV9 A;  4DWI A;  4RW8 A;  4DQQ A;  2WC9 A;  3EEQ A;  3DLR A;  1NGC A;  3EL2 A;  3G0Z A;  5C25 A;  4HCC A;  1Q8I A;  3CCJ N;  2KFZ A;  1RT4 A;  4RG8 A;  3NH1 A;  3VQA A;  3SBT A;  3E9L A;  2GUP A;  1RT2 A;  3A5O C;  3U4L A;  4DR2 K;  2X78 A;  3THY A;  2QA4 N;  1IH7 A;  5H1S Q;  4JK8 A;  4E89 A;  3PIP L;  3OYJ A;  3THY B;  4DTJ A;  2AA4 A;  3W3D A;  4B9N A;  3G25 A;  2Z1J A;  3BF1 A;  5KPR A;  4FM1 A;  4E7J A;  3DOK A;  4DTM A;  3LL3 A;  3R1X A;  3KZB A;  4J2D A;  4AHS A;  1BIZ A;  1XI1 A;  1N6Q A;  3NFA A;  3H1V X;  1JL2 A;  4IBN A;  4FK0 A;  3VQC A;  1ZYQ A;  1EQY A;  3TAP A;  3AAQ A;  3SYZ A;  5BRE A;  4CK2 A;  4EZ9 A;  2J4R A;  3KK1 A;  1S6P A;  1J54 A;  4CEO A;  1EKE A;  4CHN A;  4Z94 A;  5C42 A;  2HOE A;  3N4P A;  1NG9 A;  5F2R A;  3O8M A;  1TL3 A;  3EKS A;  4CIF A;  4Z4F A;  1B92 A;  2CH5 A;  3MN9 A;  4EAH D;  3NVM A;  4X66 K;  1BU6 O;  3WNG A;  5J2M A;  1VSJ A;  3BF3 A;  4GY2 B;  4JKG A;  2IVO A;  3FFI A;  1JJ2 M;  3TSP A;  2ITM A;  3LAK A;  4DSL A;  2XY8 A;  3D2E A;  4CGI A;  4GMJ B;  5C2D A;  1OKJ A;  2JLE A;  1KSP A;  4JK9 A;  3ZT4 A;  3KKS A;  4BQZ A;  1SAZ A;  1NBW A;  4KAZ A;  4LF5 K;  5AQI A;  4FWQ A;  1VQK N;  1FK9 A;  4WCE L;  4H5R A;  3WXI A;  1JCG A;  1VHX A;  4BGB A;  4IXC A;  5CY4 A;  1DGK N;  1Z26 A;  4I9Q A;  1CZB A;  4FO0 A;  3TAG A;  4IFY A;  4RW4 A;  1LW2 A;  1WAF A;  1YVN A;  3QIP A;  5LJV A;  3TAE A;  3M1F A;  2NUB A;  5FPE A;  4YOX A;  4I6M A;  1RDU A;  3I0S A;  3L3U A;  4M63 C;  4FJ9 A;  3T69 A;  2ZD1 A;  4O44 A;  4CF0 A;  1HKC A;  3OYL A;  3O4W A;  3DXK A;  2YHX A;  3KWI A;  2AJQ A;  4RWT A;  2P1J A;  1ASV A;  3HM9 A;  3P1G A;  4R5P A;  1VRT A;  4DS4 A;  4JS4 A;  2E20 A;  1Z25 A;  1NGI A;  1NGH A;  4KH4 A;  1JLQ A;  3C6H A;  4E0D A;  1VSM A;  1FW6 A;  1ZBH A;  5DM7 L;  3K58 A;  3HTV A;  3V1Q A;  5CZ1 A;  1RFQ A;  4OO1 J;  4I7F A;  3H08 A;  2VWJ A;  2E6L A;  1S6Q A;  2ZGZ A;  3I8B A;  1JLE A;  4O8K A;  4CJU A;  4DTU A;  1RT1 A;  1W2B M;  3CCE N;  2A42 A;  4MFB A;  4JKG B;  3HP6 A;  3L2V A;  3AVK A;  4DSE A;  3ZLJ A;  1QQO A;  4LSN A;  1Q86 O;  4JI7 K;  1RBR A;  3LDQ A;  1REV A;  3VQP A;  5EX5 A;  4JS5 A;  1C1A A;  4RTF D;  4PKH A;  1SL2 A;  3IAY A;  4X65 K;  2HVH A;  1X9M A;  2HND A;  3MDQ A;  4DFK A;  1YTA A;  1QTM A;  1J5E K;  3QER A;  3VF6 A;  1N32 K;  5M1P A;  1VK0 A;  3CPW M;  1VQN N;  4B9Q A;  2P9K B;  3IKM A;  3D0P A;  4CEE A;  1XWL A;  3CCS N;  3L4Q A;  5B8H A;  4N56 A;  2OZM A;  1KLM A;  2ZGY A;  2VQE K;  4H0O A;  2CH6 A;  3O9S A;  4A2B A;  4FK4 A;  4YOR A;  4WQ5 A;  5I42 A;  3C7N A;  3I33 A;  4FM0 A;  4EZ6 A;  1MWK A;  1NKC A;  3IUC A;  2A3Z A;  3RMB A;  3TWH A;  4DV2 K;  3QIO A;  3LZI A;  1GLF O;  1NKB A;  3V9S A;  3VTH A;  4JEP A;  4Z4E A;  2DFF A;  4B1U B;  3AVB A;  3FZF A;  1Q81 O;  3AVN A;  3AVL A;  4EIA A;  2XY5 A;  1ZBS A;  2E2N A;  4ZHR A;  3PSI A;  4PQU A;  1N8R O;  1IV0 A;  4CF9 A;  3V4I A;  3PO4 A;  3EE8 A;  1BIS A;  4M42 A;  4GVE A;  1U49 A;  4CBW A;  5C15 A;  4JKA A;  4M7X A;  1SUQ A;  2KZM A;  3QNO A;  4H4O A;  3FZH A;  2P9P A;  5BN8 A;  3MMV A;  5GIO A;  2CGK A;  2WTU A;  3S3N A;  4H8K A;  3OYG A;  3ENB A;  4CJ4 A;  1J6Z A;  2P9L B;  4K41 A;  3PSF A;  4FLW A;  4JI8 K;  1BCM A;  5E41 A;  4CZJ A;  5LY3 A;  2UUC K;  2I7P A;  3MN6 A;  3GBT A;  3T3F A;  3IS9 A;  4BRQ A;  3MN7 A;  1RTI A;  3MXJ A;  3PX4 A;  1FJG K;  4PWD A;  4IOC L;  4B08 A;  1U47 A;  3D45 A;  2YNG A;  4CZF A;  4CES A;  3T1Y K;  3AA4 A;  3A5M C;  4FPA A;  4QCL A;  2PAV A;  2I5J A;  3ALY A;  1HMV A;  1KCF A;  3AA3 A;  2KQ2 A;  5BRH A;  4YOY A;  2W42 A;  1IG9 A;  1YTU A;  3FZL A;  3LP3 A;  3HVT A;  2HBJ A;  4H5V A;  3O1B A;  2G8V A;  3DLG A;  5BPL A;  1KAZ A;  4BWJ A;  1HYS A;  5AQT A;  5AQO A;  3I8D A;  4WQ4 A;  1XMO K;  3RWU A;  3TTC A;  4H4M A;  4H03 B;  3ULE B;  3ZSO A;  1RBV A;  3CJ1 A;  1E4G T;  1MWM A;  3CJ7 A;  3FZK A;  4FLV A;  5AZI A;  4O0I A;  5AQV A;  4JI1 K;  3OYE A;  3CFO A;  2P9N A;  5GAH P;  3BUZ B;  5DM6 L;  4BRK A;  1YHQ N;  1C0F A;  4ELU A;  2Q0U A;  2FLO A;  4RCH A;  4KHP K;  3ZT0 A;  4B3R K;  1JCE A;  1BL3 A;  3GOI A;  5C10 A;  3WT0 A;  1HYZ A;  1YT3 A;  1GLE G;  2EWS A;  4KH5 A;  4LF7 K;  4F3T A;  4BC4 A;  2IOC A;  4PL7 A;  2WUS A;  3THW B;  2O8C B;  4B9M A;  1N36 K;  2QW9 A;  1SKR A;  3B8A X;  1NM1 A;  1ASW A;  3VEN A;  2WBN A;  3MXM A;  1KLN A;  4KHW A;  1LW0 A;  5C12 A;  5HRN A;  2YHW A;  3E9O A;  4WFB L;  4NO7 A;  2OPP A;  4CVN E;  5HRP A;  1VSD A;  2V52 B;  4OPH A;  5GAD P;  3ULE A;  3QFP A;  2E2Q A;  5AQY A;  3J7Y P;  4B1X B;  1UA1 A;  3ID8 A;  3LM2 A;  4AHV A;  1KTQ A;  4ID1 A;  4OX9 K;  1P90 A;  2VG7 A;  4FW1 A;  4DUZ K;  1JXE A;  1M90 O;  4BRC A;  4DR6 K;  4Y0W A;  1KC8 O;  4FWK A;  3M5R A;  3QES A;  3OVN A;  3VQ5 A;  3EO3 A;  2GEL A;  1D8Y A;  4YDU A;  1P8Z A;  4KO0 A;  4LY7 A;  4KH6 A;  2NRX A;  1TUU A;  4N76 A;  3F73 A;  4BRG A;  4DR7 K;  1H1V A;  4CJ5 A;  3A0I X;  3QB0 A;  4H5N A;  4F2S A;  4KRF A;  5KPZ A;  3OS0 A;  4DR4 K;  4DTN A;  3K9K A;  2ETJ A;  3THV A;  1V4S A;  2ZJQ L;  5M1N A;  5JMV A;  2Q3S A;  5IT9 O;  1WSJ A;  2AP1 A;  4CGH A;  3M6G A;  3VGM A;  1HKB A;  2GV9 A;  1WSI A;  1VQ8 N;  4KFB A;  3AVF A;  4DKW A;  3JSM A;  4FM2 A;  3VF2 A;  3MK6 A;  3O9R A;  4PUO A;  1C6V A;  4JYA K;  3SK3 A;  4DTS A;  4B3O A;  4NXN K;  4OPJ A;  4E7I A;  1QSS A;  3HVR A;  4DR3 K;  4CZG A;  2HHU A;  1V4T A;  4XH5 A;  3U6F A;  1EP4 A;  1FKP A;  1TV6 A;  4CK3 A;  1K9M O;  4DV5 K;  4ZTJ A;  4JHD B;  2QWN A;  4OKK A;  2DFE A;  4DF8 A;  5TKY A;  2KZZ A;  1SKS A;  1HPZ A;  1QZ6 A;  3NGY A;  3LZJ A;  5AQH A;  2P5O A;  4FLZ A;  3EN9 A;  3SV3 A;  4DQP A;  2VG5 A;  3CM5 A;  2HST A;  4R79 A;  1U2V B;  3CHW A;  4FJM A;  5JS1 A;  4AM7 A;  3V81 A;  3K0S A;  3NAE A;  2P51 A;  2ITG A;  1JLC A;  4IZ9 A;  2F9T A;  1IKY A;  4B8A B;  2DTU A;  1W97 L;  3VQ6 A;  1EET A;  4CER A;  4IEI A;  2E1Y A;  1GLC G;  4OGE A;  1Z6R A;  3DLE A;  3GE1 A;  4LF8 K;  4BG9 A;  1UA0 A;  4FLU A;  4KHY A;  1TK0 A;  3E1Y A;  1RBT A;  1GOA A;  4CCH A;  1Y64 A;  5BPN A;  4A5B A;  4DUY K;  5AQM A;  1BDG A;  3U8X A;  5BR8 K;  4BG8 A;  4N41 A;  3QBW A;  4O55 A;  1YIJ N;  4BWM A;  1C0T A;  3SQ2 A;  3L2Q A;  3AVI A;  4B9U A;  3SMP A;  2NRW A;  2BDP A;  4C1N I;  4JI6 K;  4JKC A;  1XMQ K;  1ZBL A;  3DI6 A;  4GKJ K;  1I39 A;  4O8U A;  3JYT A;  3OYH A;  3VPZ A;  1N5Y A;  2O8C A;  4O0J A;  4Q0B A;  3KD5 E;  1S1T A;  3OYB A;  4B9L A;  3J8A A;  4H0V B;  3W0L A;  2OTJ N;  2O8D A;  3O3F A;  3VQB A;  4FWL A;  3L8B A;  4DHY A;  4CJL A;  2ASO A;  3P83 D;  3QDK A;  3DRP A;  4O5B A;  2QI2 A;  2P9P B;  1A5W A;  2O4I A;  2O8D B;  1YAG A;  4FZY A;  1TKX A;  1VSI A;  1RDD A;  2HHQ A;  3M8S A;  1RTH A;  3UKU B;  3KLG A;  4IOX A;  4G1Q A;  1U4B A;  3NE6 A;  4MO4 A;  2A41 A;  3OYF A;  4LFC K;  3JAM O;  4DR5 K;  5C2F A;  2O8B A;  5DMR A;  1W9H A;  1U04 A;  3HL8 A;  4OVL A;  5K14 A;  2JGU A;  4DTO A;  2GBZ A;  4DQS A;  4DMN A;  4DG1 A;  2FXU A;  3ASM A;  4L8R B;  4M3X A;  2QXL A;  4CEZ A;  4RW7 A;  3CJA A;  1VSE A;  3SMS A;  4F4K A;  4HCB A;  3VN5 A;  2QWR A;  3AA5 X;  3FGU A;  4ZTF A;  2NRR A;  2P5G A;  3QO9 A;  1QZ5 A;  5AQW A;  4BR9 A;  2V7Y A;  2X6S A;  3QBX A;  4IG0 A;  4IDK A;  3T1H K;  1BQN A;  4CGG A;  1JXB A;  4BRN A;  1ZBI A;  1VRU A;  4U67 L;  3C6A A;  4DV1 K;  4V19 S;  3T7Z A;  4EP5 A;  1HYV A;  5AQU A;  1EXQ A;  5BN9 A;  3CCR N;  3CD6 N;  3H3N O;  3VEX A;  2P9U B;  4FPB A;  2HBM A;  2A5X A;  3S9H A;  2BE2 A;  4O5F A;  3WUH A;  2GUI A;  1WOQ A;  3L3V A;  2FF3 B;  2YHA A;  3WQU A;  4FVM A;  3CG7 A;  1HR0 K;  3O08 A;  4AF1 A;  3SQ4 A;  2O8E A;  2BUP A;  4Z4G A;  4YOW A;  5BRF A;  1DT9 A;  3WEE A;  4WE1 A;  2E88 A;  3IRX A;  4Z0U A;  4HVJ A;  3VEZ A;  2HB5 A;  3L0Q A;  1QE1 A;  1HX1 A;  3AGK A;  3S3O A;  4BRD A;  2UXC K;  1T44 A;  2ASP A;  4RW6 A;  4Y1D A;  3U9D A;  4BY9 C;  5EVZ A;  4H0X B;  1NGD A;  1SQK A;  3SV4 A;  3KVG A;  1NGF A;  3LPT A;  2KHO A;  1RIL A;  5CHI A;  2FSN A;  4CFC A;  5AQP A;  4B8C A;  2A40 A;  3MEG A;  3DXK B;  3HRG A;  3MN5 A;  2W41 A;  4F8R A;  1LAW A;  4LF4 K;  3CC7 N;  1JLG A;  5C24 A;  3C7N B;  1I3A A;  4DTX A;  3VMF B;  2ZJR L;  3O80 A;  3D6R A;  4JI5 K;  1NLV A;  5EU7 A;  3MED A;  5BPM A;  3IDH A;  4PL8 A;  2YJE A;  3RSE B;  3U3Y A;  4DFP A;  1WAJ A;  2F7T A;  4C8K A;  1TUY A;  1F21 A;  4CZM A;  3TR8 A;  5AQR A;  1NGE A;  3J81 O;  3NF9 A;  1BOT O;  1Y97 A;  5AZI B;  3AVJ A;  2NRT A;  3AO4 A;  3SI6 A;  5HL7 L;  3G4S N;  1LV5 A;  3PX6 A;  2P9L A;  2GWK A;  1GOC A;  5J1E A;  1NJY A;  4CJS A;  1QHT A;  1ASU A;  4C8O A;  3H6E A;  4EHT A;  2D0P A;  4KPY A;  4B1Y B;  5JIC A;  3VQQ A;  1KVB A;  1VQ7 N;  3T1A A;  3Q7C A;  3GL1 A;  4CE9 A;  3KLH A;  1CLQ A;  4FLX A;  5KGX A;  4GV6 A;  1NMN A;  1NGB A;  1A5X A;  1VQP N;  5I9E B;  4QS8 A;  4ILG B;  2ZE2 A;  1NK6 A;  2FBY A;  3TAB A;  3NBP A;  4LSL A;  2F96 A;  1QQM A;  3MX5 A;  4CHP A;  3MXI A;  3MAQ A;  3QIC A;  1VQO N;  3KK7 A;  4KI4 A;  1OH5 A;  4CBU A;  4BE2 A;  2JWK A;  3GDQ A;  5IWA K;  3CPE A;  1XNR K;  5J2P A;  3QEV A;  3O3H A;  4NLC A;  3VA0 A;  4XH4 A;  4EFH A;  5AFU H;  3V9U A;  4FW2 A;  1T05 A;  4KHQ A;  2P9S B;  3C65 A;  3WNE A;  4I6M B;  5FPM A;  4NXM K;  4WYB A;  2VWK A;  1GLL O;  4NLB A;  4CJ3 A;  1N34 K;  4JI4 K;  1SV5 A;  5JVH L;  5J2Q A;  5JLF A;  3H1Q A;  4FZZ A;  4CJQ A;  3CFR A;  4FWR A;  5GAG P;  1QVG M;  2IAJ A;  4GNI A;  3TSQ A;  3F2K A;  3VEW A;  4EP4 A;  1RCH A;  3ZSV A;  4DCH A;  3VER A;  3CIP A;  1S3X A;  4JK7 A;  1UOC A;  4C8L A;  3IG1 A;  3CM6 A;  3T19 A;  2OYQ A;  1G15 A;  4OJR A;  5KQ8 A;  3SPY A;  4ELT A;  2O8F A;  5AQF A;  4QOZ B;  3DLK A;  2IVN A;  4DTP A;  3CJB A;  4JKH A;  3ZET A;  1B9D A;  3EYZ A;  1LWC A;  3RR8 A;  3PV8 A;  4F9O A;  3SJJ A;  1FXX A;  2RE2 A;  3G6E N;  3HO1 A;  5ADX A;  2ZWH A;  4DLG A;  1L3S A;  3QEW A;  4Q5V A;  2PYJ A;  3ZX3 A;  1JLA A;  3ZCM A;  3K5N A;  1G99 A;  2I7N A;  2QWL A;  3QEI A;  3HPH A;  3VET A;  1NGA A;  4WF9 L;  4A5A A;  4FZX C;  3DOL A;  4CD3 A;  4MDB A;  2YNF A;  1OH8 A;  1HRH A;  3DRS A;  1GLB G;  1K6Y A;  1TL1 A;  4QS7 A;  3LDS A;  4KBO A;  1RT6 A;  4KV8 A;  5AJ3 K;  2E5L K;  1LOT B;  2F9W A;  3V1O A;  4W5T A;  4CJT A;  5AQX A;  2GTD A;  2HVI A;  3A5L C;  4XIU A;  4CEF A;  3MCP A;  3K9J A;  2YV0 X;  3KLE A;  1NJI O;  2QKK A;  2OPQ A;  3LP0 A;  4BRF A;  2UYT A;  1NNE A;  3U3G A;  2UUA K;  4UQG A;  4DLE A;  3CQY A;  4NYN A;  4NB4 A;  4YDU C;  1NK5 A;  1VQ5 N;  5KQD A;  4GKK K;  4IOA L;  4WFN L;  3OA9 A;  1B9F A;  4FLT A;  4CEA A;  3QFU A;  1GLA G;  4JLH A;  2FBV A;  3FE1 A;  4KTZ A;  1ZXO A;  3PY8 A;  4KHN A;  3OY9 A;  4BQL A;  4CZK A;  3BZK A;  4IDH A;  3LWM A;  3MEC A;  4CFD A;  3ZSR A;  5CE3 A;  3SZ2 A;  2RPI A;  3F5T A;  3VEO A;  1NJZ A;  2BGG A;  3WEE B;  4FCY A;  2F8T A;  1QS4 A;  2NRH A;  4B9V A;  1JCF A;  2KFN A;  2YX6 A;  3F9K A;  4BC5 A;  4Z4I A;  4IG3 A;  4ID5 A;  4QS9 A;  4CBX A;  4HTU A;  3MWP A;  3P31 A;  1NKE A;  4OGC A;  4YOU A;  3UKR A;  4FWM A;  1VAZ A;  3Q7B A;  2P9K A;  2YHY A;  1VQL N;  2Q97 A;  4C8M A;  2HF3 A;  3CCU N;  1L3T A;  1EWR A;  3R3L A;  5KI6 A;  4K42 A;  4IEE A;  3SQ1 A;  2W40 A;  4B1Z A;  1Q9Y A;  4JV5 K;  2VGM A;  4FWP A;  4JKE A;  4CEQ A;  1KXP A;  1IKV A;  4CFB A;  3AO5 A;  4BE0 A;  3WNH A;  1YUW A;  2OPS A;  1RNH A;  2QXF A;  4BAC A;  4CF2 A;  4LF6 K;  3MX2 A;  3CF5 L;  3AO3 A;  3K57 A;  3ZET B;  2B6A A;  1DTQ A;  4A62 A;  3J7Z O;  1RGI A;  3AV9 A;  3V1R A;  1NK4 A;  1I94 K;  2G8W A;  4JI3 K;  3VOV A;  4IKF A;  1TKZ A;  3CME N;  4F2R A;  3CQX A;  3NH2 A;  2Q1N A;  3OBW A;  2Y1J A;  4BDZ A;  3DLH A;  3TSU A;  1ZBU A;  2XRI A;  2YKN A;  4AHC A;  3O3G A;  5CYQ A;  5D3G A;  4OLA A;  5KRS A;  1S9G A;  2X74 A;  1LAV A;  1C0U A;  4DR1 K;  1L3V A;  1KQS M;  1IJJ A;  3THX B;  2O8B B;  4BGA A;  4FJX A;  5M1F A;  2Q0R A;  3E66 A;  3LDO A;  3DAW A;  1VQ4 N;  2UXD K;  1BI4 B;  3HOS A;  1MDU B;  2E2P A;  1WN7 A;  1RDW X;  4JKD A;  3NMU A;  2KW4 A;  3VTI A;  4Z4C A;  2FC0 A;  2PBD A;  1C0M A;  3MWT A;  2WON A;  5KGW A;  1DKG D;  1BQM A;  2P9S A;  2BH1 A;  1K8A O;  4CD1 A;  3ZX0 A;  1NK7 A;  3NF7 A;  1BI4 A;  3ATU A;  1NGJ A;  1X9J A;  1RT3 A;  3C6U A;  3ZT3 A;  5GAE P;  2YNI A;  1HNV A;  3CQ8 A;  4C1N K;  4GW6 A;  3ZSQ A;  3VQ4 A;  3NF8 A;  1WB9 A;  4E1J A;  1IG8 A;  1TK8 A;  3NF6 A;  2D0B A;  1FKO A;  4YFU A;  3G10 A;  4H0P A;  1WSE A;  3SPZ A;  3FFK B;  2FBX A;  1E4F T;  2E2O A;  4DSK A;  1JLF A;  3C94 A;  4CEB A;  1T6D A;  1WSF A;  1X3N A;  3WXL A;  4B1V A;  4M45 A;  3AAR A;  4YHH K;  2PZS A;  5E84 A;  1TKD A;  4FXD A;  1U48 A;  3AO1 A;  3V9X A;  1RTD A;  4OKE A;  2Z1I A;  1NGG A;  3TI0 A;  3M8P A;  4I2Q A;  4CED A;  2ASM A;  3O9Q A;  4DU1 A;  1WSG A;  3HYF A;  3NHG A;  4M3R A;  3VQ8 A;  2R7Y A;  4KRE A;  1W7A A;  1O1W A;  4N5S A;  2G8K A;  3HI0 A;  2QTD A;  4AHU A;  4K43 A;  1QQC A;  5GIP A;  3OHR A;  4AHR A;  2IGI A;  3VGK A;  4KB0 A;  3QLH A;  4IFV A;  3AA2 A;  4CF1 A;  1GLD G;  3OTO K;  1YF5 L;  2KTQ A;  4KKO A;  4DV7 K;  5HRS A;  4BRM A;  3ZT1 A;  4CJ7 A;  4FJN A;  3HP9 A;  3RMA A;  3RSE A;  1ATR A;  3SUP A;  2A1S A;  1BGX T;  1GOB A;  1J53 A;  3SNN A;  1U45 A;  4BRE A;  3TTF A;  4CJP A;  4BDY A;  3RTV A;  2HHW A;  4ICL A;  1CZ9 A;  3HM8 A;  2P9I B;  3D2F B;  3SCX A;  2HNZ A;  5SWM A;  4X64 K;  2VQF K;  3CCM N;  3J80 O;  1ZC6 A;  1TVR A;  2GEM A;  2IS3 A;  4B3S K;  2ZF5 O;  3N4Q A;  4I2P A;  3TU5 A;  4IJA A;  5KTQ A;  3A8Y A;  2BTF A;  3K5M A;  4CJF A;  4B3M K;  5FPN A;  1T6C A;  2OPR A;  4CJE A;  1T8E A;  4CHO A;  4BVO A;  1SL1 A;  2A1R A;  1LCU A;  5CZ2 A;  2D5R A;  3F9M A;  2Q31 A;  4B1W B;  2E6M A;  3O9T A;  3UKU A;  1EX4 A;  3IFR A;  3ISN C;  4IO8 A;  1KAX A;  2HW3 A;  3ZSW A;  1TKT A;  3RVC A;  4XEI A;  1D4X A;  2O8E B;  4DQI A;  3HST B;  3P4I A;  4K8Z A;  2EHG A;  5JVG L;  3I55 N;  4C8N A;  2F8S A;  3E01 A;  1IO2 A;  2E8A A;  3M8R A;  4GV3 A;  3B6O A;  3LPU A;  3KLF A;  3NVK A;  3WXJ A;  4LFB K;  2P9U A;  3HZ6 A;  5AR0 A;  3CC4 N;  4E7L A;  3OYD A;  3AVM A;  4XH1 A;  3EKU A;  1K8K B;  3PIO L;  2W6K A;  3DJC A;  4E7K A;  3J7A P;  5AFU A;  4FJL A;  4A61 A;  3HPO A;  3EY1 A;  5E26 A;  4IJN A;  3K59 A;  4ELV A;  1OVQ A;  4QAG A;  3VF4 A;  4M3Y A;  2O8F B;  4OKJ A;  3D7E O;  3OW2 M;  4CZH A;  1GLJ O;  3BP8 A;  4M3W A;  3TPQ A;  3K2P A;  4MO5 A;  3O9U A;  3DM2 A;  4CFA A;  1IBL K;  2G8H A;  1BCO A;  2Y1I A;  4DTR A;  3L6Q A;  1OH7 A;  3OBY A;  4OPA A;  4PKI A;  4FJJ A;  3E9P A;  4DSF A;  3DXM B;  5HRO A;  2B4J A;  1EWQ A;  3HSC A;  1SKW A;  1HLU A;  3QNN A;  4JI2 K;  1SZ2 A;  4M3Z A;  1CXQ A;  4DQ8 A;  3QEX A;  1T7P A;  2XY6 A;  2QWO A;  2DPN A;  1HQE A;  2WOM A;  3LP1 A;  1SL0 A;  2UXB K;  4RW9 A;  3VQ7 A;  1JKH A;  1HKG A;  1SS6 A;  1S22 A;  1D5A A;  3NH0 A;  4ILH A;  1ZBF A;  2HMP A;  2HHS A;  2D1K A;  4BR5 A;  3CYM A;  4DB3 A;  4BE1 A;  1QHA A;  3IMX A;  4BRA A;  4OLB A;  5AQN A;  4NCB A;  2RF2 A;  3SUQ A;  4M3U A;  3CMA N;  2X6N A;  3KK2 A;  4BRH A;  3PO5 A;  4NCA A;  2VGN A;  1U6Z A;  1YXQ A;  1RDC A;  4K0K K;  3H3O B;  1MA9 B;  4ISG A;  4DF4 A;  1JLB A;  3ZSX A;  3DRR A;  5AQG A;  1ILY A;  2FSK A;  1DTT A;  1XUP O;  3AVC A;  3L4I A;  4YOV A;  4J2B A;  4JRQ A;  2FBT A;  3EE9 A;  3A5N C;  3HJF A;  3V6D A;  4CGJ A;  1KFS A;  4H5T A;  4IWV A;  4HHT A;  1R0A A;  3ZEU B;  3EZ5 A;  4CEC A;  1XQS C;  4FWN A;  3ZX2 A;  4LH4 A;  3QET A;  4CGD A;  4A59 A;  4J8F A;  5M1K A;  2NRZ A;  3LP2 A;  3RMD A;  1RT5 A;  3SUN A;  4PY5 A;  3VEY A;  3CI5 A;  1TAQ A;  5FPD A;  1TYQ B;  3P5J A;  4CIE A;  4L3Q A;  3P39 A;  1C0G A;  5EXW A;  1ESV A;  1S72 N;  3UIQ A;  3LAL A;  3VQ9 A;  4AIL C;  3HOT A;  4DU4 A;  2DY4 A;  2OTL N;  4LFA K;  4W5N A;  3WQT A;  5AZJ B;  4HUF A;  2VG6 A;  3CCQ N;  2JWL A;  3M8Q A;  2HBL A;  2V51 B;  1WBB A;  4YNQ A;  5HLF A;  2FSJ A;  1A5V A;  4FLY A;  2Q36 A;  1NU0 A;  2P9N B;  1E3M A;  5AQJ A;  2Z1G A;  2HMI A;  4UY8 O;  1YI2 N;  1NWK A;  4M7Y A;  4WQ4 C;  5DK5 A;  4DV4 K;  3ITH A;  1L5U A;  3OYC A;  1QVF M;  1VSK A;  4FJG A;  4MLE A;  2QKB A;  4JN4 A;  4HUE A;  1YJW N;  4K25 A;  4BC3 A;  3H45 C;  3ZSY A;  4CGF A;  3RRG A;  1HNW K;  1X3M A;  3L2W A;  2P9I A;  3D2F A;  5KRT A;  1D9D A;  1WUA A;  3QIN A;  3WXM B;  4DS5 A;  1C1B A;  2E4L A;  5JLH A;  3CXC M;  4FJH A;  4K8X A;  4FJ5 A;  5AZJ A;  1QSL A;  3P38 A;  4BC2 A;  1M1K O;  4BVP A;  4IO9 L;  3CER A;  3VA3 A;  1NOY A;  4Z4H A;  4CHY A;  2EX3 A;  2RKI A;  4DV6 K;  1Q7Y O;  4CJR A;  4MLH A;  5AQZ A;  3V9Z A;  3TAN A;  3VGL A;  3DLB A;  4HTL A;  3R8E A;  4DV0 K;  3LM9 A;  1TYQ A;  1XC9 A;  1NK9 A;  2HHH K;  3DXM A;  3OYM A;  4A57 A;  2QWP A;  1NK0 A;  1R59 O;  4O4G A;  3ULD A;  4E7H A;  3R6M A;  1RT7 A;  1X9W A;  1S1X A;  3WNF A;  2YJF A;  4CHZ A;  3AVH A;  2QM1 A;  2PYL A;  4CF8 A;  4KHU A;  3KWG A;  4JKB A;  1UWB A;  5ADX H;  2XHB A;  3VQE A;  3B6P A;  3ZEU A;  5HBM A;  4PA1 A;  1NOZ A;  3SJH A;  4ISF A;  1XNQ K;  4JHD A;  4BR0 A;  4CZL A;  4X62 K;  4DSJ A;  1HNI A;  4JAX A;  1EO1 A;  3WXK A;  4AHT A;  4WQ5 C;  3LWL A;  1HJR A;  1BA0 A;  1XHZ A;  4H0Y B;  4AM6 A;  4FWS A;  1YJ9 N;  1ATN A;  2HBK A;  4YY3 K;  3TTD A;  2KLA A;  3THW A;  1HQU A;  3HPG A;  5AQL A;  3BEX A;  3TAM A;  3KJV A;  2WFB A;  3JXU A;  5FRM A;  4BRO A;  1X1P A;  1IBM K;  5EOY A;  1U2V A;  2VWB A;  4JD2 A;  4I9L A;  1IBK K;  5BR9 A;  2IVP A;  3VES A;  5M1O A;  1RTJ A;  4C23 A;  4H0T B;  1WSH A;  4JD2 B;  1VSH A;  2F4V K;  3O4N A;  3HBT A;  5LJW A;  1QQN A;  1VSL A;  2HHX A;  4FL9 A;  5SZT A;  3TAQ A;  2YCH A;  4BR7 A;  3L2U A;  3ZSZ A;  2CGL A;  2YHB A;  5TKW A;  4LF9 K;  4BRP A;  2IDO A;  3ENO A;  2NNW A;  1BA1 A;  5LMN K;  1RBS A;  4DFJ A;  3U9Z A;  4B9T A;  1S1W A;  1LWF A;  3R9P A;  1NJX A;  1HNZ K;  2OA8 A;  3HXM A;  1BHL A;  4CZE A;  3CFP A;  4CIG A;  1CZA N;  5FLX O;  3BZC A;  3D2E B;  4DV3 K;  1QSY A;  1WLJ A;  1J9A A;  4OPK A;  3QML A;  3DMJ A;  5A2Q O;  5HRR A;  2O4G A;  2VYP A;  3CET A;  4FVU A;  4FOE A;  4M3T A;  2NRV A;  3L2R A;  3ZYY X;  3SAF A;  3RR7 A;  4BDP A;  1UAX A;  4CJV A;  2ZJP L;  1X9S A;  2G8U A;  1N33 K;  3SBG A;  2ATQ A;  1WNS A;  3SQ0 A;  3GG4 A;  3UB5 A;  1KAY A;  3ZT2 A;  4BRI A;  5EY4 A;  1S1V A;  3UKR B;  2HF4 A;  4W5R A;  3FR0 A;  4B3T K;  1T3V A;  3KKR A;  4WFA L;  1TAU A;  1D9F A;  2ZM6 K;  2Q2R A;  1Q82 O;  1Z05 A;  4LC9 B;  1OVY A;  4J2A A;  4F3O A;  3AGR A;  3H46 O;  1YIT N;  1Q18 A;  1NK8 A;  1KVC A;  4E3S A;  2OZS A;  4W5Q A;  4A2A A;  5MLC Q;  1S9E A;  1KD1 O;  4JI0 K;  4AH9 A;  1BIU A;  4KTQ A;  3ENH A;  4KHS A;  4N47 A;  3AY9 A;  1TGO A;  3DLL L;  4FYD A;  2Z1H A;  4CHQ A;  2PY5 A;  5GIN A;  3AO2 A;  3LAM A;  5FDL A;  4FK2 A;  2NZT A;  2DFH A;  4KTW A;  1KVA A;  4NYF A;  2IC3 A;  1XHX A;  3HT3 A;  1XC3 A;  3LAN A;  5M1Q A;  1OH6 A;  3C0B A;  4NCG A;  1WBD A;  3OYK A;  4FWO A;  3EZW A;  3CJC A;  1DEJ A;  2V7Z A;  4W5O A;  2KKZ A;  2G8I A;  1JL1 A;  1RDB A;  1HUX A;  2HHV A;  2D0O A;  1IKW A;  1S1U A;  4HUG A;  3M3Z A;  3BY5 A;  5AQS A;  4MDA A;  5BRD A;  1K8K A;  3NGI A;  4LD0 A;  2W6L A;  3SAG A;  4DSI A;  3OYA A;  4CJK A;  2YNH A;  3O5B A;  2QK9 A;  3AVA A;  4FSV A;  3LDP A;  2A6A A;  4J2E A;  2XY7 A;  3THX A;  3O1W A;  3RRH A;  5ELZ A;  1IKX A;  5AQQ A;  3LDL A;  3A2F A;  2GWJ A;  3CCV N;  3NCI A;  1LWE A;  4IFE A;  1ATS A;  4EHU A;  3OYI A;  2QWQ A;  1Q9X A;  3OYN A;  1KFD A;  3PLA A;  3OS1 A;  2RN2 A;  4DFM A;  2QWM A;  5F0X A;  1TK5 A;  3SUO A;  1DLO A;  2HNY A;  5CR4 A;  4CI6 A;  2G8F A;  1K73 O; 
#chains in the Genus database with same CATH homology
 1KAZ A;  3GL1 A;  4MO5 A;  3O9U A;  4GV6 A;  5AQT A;  1NGB A;  2E1Z A;  5AQO A;  4WQ4 A;  1VQP N;  4ILJ A;  3TTC A;  4QS8 A;  4ILG B;  4H03 B;  5I9E B;  3ULE B;  3CJ1 A;  1E4G T;  3L6Q A;  2D4W A;  3OBY A;  1MWM A;  4OPA A;  3CJ7 A;  2NLX A;  1QQM A;  3MX5 A;  4PKI A;  4G9Z A;  3E9P A;  1BUP A;  3FZK A;  3DXM B;  3QIC A;  4YOT A;  1VQO N;  3KK7 A;  4ISE A;  5AZI A;  3HSC A;  3FLC O;  5AQV A;  3SAH A;  4CBU A;  1HLU A;  1SZ2 A;  2P9N A;  5GAH P;  2JWK A;  4PHT X;  3GDQ A;  3ATV A;  3BUZ B;  3CPE A;  4DQ8 A;  5DM6 L;  4BRK A;  1YHQ N;  1C0F A;  1BG3 A;  4NLC A;  1YJN N;  4XH4 A;  4EFH A;  2Q0U A;  2QWO A;  2DPN A;  2FLO A;  2FF6 A;  4RCH A;  3O6W A;  5AFU H;  2QEX N;  2PFU A;  2GX9 A;  2P9S B;  1HKG A;  1SS6 A;  1S22 A;  3C65 A;  4I6M B;  5FPM A;  2H3G X;  3CCL N;  1JCE A;  1HJO A;  4ILH A;  3GOI A;  4WYB A;  2HMP A;  3ID6 A;  1GLL O;  4NLB A;  5C10 A;  2D1K A;  4BR5 A;  1HPM A;  4HWI A;  2CGJ A;  3S41 A;  3WT0 A;  5JVH L;  1GLE G;  2EWS A;  4KH5 A;  4BR2 A;  4DB3 A;  3FZM A;  2OAN A;  1QHA A;  4BC4 A;  3IMX A;  4BRA A;  4PL7 A;  5JLF A;  1BWF O;  3H1Q A;  2WUS A;  5AQN A;  1BO5 O;  4FWR A;  5GAG P;  2QW9 A;  3B8A X;  3CMA N;  1NM1 A;  3VEN A;  3AAP A;  1QVG M;  2WBN A;  4BRH A;  3I56 N;  1VQM N;  4GNI A;  3TSQ A;  3F2K A;  5C12 A;  3VEW A;  2VGN A;  1U6Z A;  2YHW A;  3E9O A;  4WFB L;  3KHY A;  1YXQ A;  4NO7 A;  2VCP A;  3DWL A;  4DCH A;  2V52 B;  3VER A;  3H3O B;  1MA9 B;  4ISG A;  3CIP A;  4OPH A;  3ULE A;  5GAD P;  4JKF A;  5AQG A;  4JNE A;  1S3X A;  4BR4 A;  2FSK A;  4JK7 A;  1XUP O;  1ILY A;  3QFP A;  2E2Q A;  5AQY A;  4B1X B;  5F1X A;  3L4I A;  4YOV A;  5AQK A;  3ID8 A;  3LM2 A;  3SLC A;  3LDN A;  3EE9 A;  3A5N C;  1VQ6 N;  3JS6 A;  3CJ9 A;  5KQ8 A;  1P90 A;  3G71 N;  4H5T A;  4IWV A;  5AQF A;  3ZEU B;  1O13 A;  1M90 O;  3CC2 N;  2IVN A;  3CJB A;  4JKH A;  4PKG A;  3ZET A;  1XQS C;  4FWN A;  3ZX2 A;  4BRC A;  4Y0W A;  1KC8 O;  3VEV A;  4F9O A;  2RE2 A;  4FWK A;  3G6E N;  3M5R A;  4J8F A;  3UE5 A;  2ZWH A;  4A59 A;  5ADX A;  5M1K A;  3EO3 A;  2GEL A;  2NRZ A;  2RHK A;  5KPT A;  5C0Y A;  3ZX3 A;  4YDU A;  3VEY A;  3CI5 A;  1P8Z A;  1G99 A;  5FPD A;  2I7N A;  1TYQ B;  2QWL A;  3MCA B;  4KH6 A;  2NRX A;  1TUU A;  4L3Q A;  4BRG A;  3P39 A;  3VET A;  1H1V A;  1C0G A;  1NGA A;  4WF9 L;  4A5A A;  3A0I X;  3QB0 A;  4H5N A;  5EXW A;  1ESV A;  1VQ9 N;  4CD3 A;  4MDB A;  4BRL A;  5HOO A;  1S72 N;  5KPZ A;  4H5V A;  1GLB G;  4H5W A;  4CZI A;  4U7B A;  3HOT A;  2IIR A;  4FOI A;  3K9K A;  4QS7 A;  1NMD A;  4KBO A;  2YI1 A;  2OTL N;  1V4S A;  2ZJQ L;  1LOT B;  2F9W A;  5M1N A;  3WQT A;  5JMV A;  5AZJ B;  5AQX A;  2GTD A;  2AP1 A;  3A5L C;  3M6G A;  3MCP A;  3K9J A;  1HKB A;  3VGM A;  3CCQ N;  2JWL A;  4GV9 A;  1VQ8 N;  2HBL A;  2V51 B;  1NJI O;  4DKW A;  2WC9 A;  3VF2 A;  4BRF A;  2FSJ A;  2UYT A;  3MK6 A;  1NGC A;  3O9R A;  3EL2 A;  2Q36 A;  3CCJ N;  2P9N B;  5AQJ A;  3CQY A;  3SK3 A;  4NB4 A;  3SBT A;  4YDU C;  3E9L A;  5KQD A;  1VQ5 N;  2GUP A;  3A5O C;  3U4L A;  4IOA L;  4WFN L;  4UY8 O;  1YI2 N;  1NWK A;  3OA9 A;  4M7Y A;  4WQ4 C;  2QA4 N;  4CZG A;  3QFU A;  1GLA G;  5H1S Q;  4JK8 A;  3PIP L;  1V4T A;  4XH5 A;  2AA4 A;  3FE1 A;  3W3D A;  1QVF M;  1ZXO A;  3G25 A;  4MLE A;  4BQL A;  4JN4 A;  4CZK A;  1YJW N;  4IDH A;  3BF1 A;  4K25 A;  5KPR A;  1K9M O;  3LL3 A;  3R1X A;  3H45 C;  3KZB A;  4BC3 A;  5CE3 A;  4JHD B;  3F5T A;  2QWN A;  3H1V X;  1X3M A;  3VEO A;  2P9I A;  3D2F A;  5TKY A;  3WEE B;  1WUA A;  1EQY A;  2NRH A;  1JCF A;  1QZ6 A;  3WXM B;  2YX6 A;  3AAQ A;  4BC5 A;  5JLH A;  3CXC M;  5AQH A;  3EN9 A;  5AZJ A;  3P38 A;  4QS9 A;  4BC2 A;  4CBX A;  3MWP A;  2HST A;  3P31 A;  5BRE A;  4R79 A;  4BVP A;  1M1K O;  4IO9 L;  3CER A;  4YOU A;  1U2V B;  3UKR A;  4FWM A;  3CHW A;  2J4R A;  1VAZ A;  3Q7B A;  1Q7Y O;  2P9K A;  4AM7 A;  2YHY A;  4MLH A;  5AQZ A;  1VQL N;  3VGL A;  2Q97 A;  2HF3 A;  3CCU N;  3R3L A;  4HTL A;  4K42 A;  3R8E A;  3LM9 A;  4IEE A;  4IZ9 A;  2F9T A;  2W40 A;  4B1Z A;  4Z94 A;  1W97 L;  1TYQ A;  2VGM A;  3DXM A;  4FWP A;  4IEI A;  2E1Y A;  1KXP A;  4JKE A;  4A57 A;  2HOE A;  2QWP A;  3N4P A;  1GLC G;  1R59 O;  5F2R A;  3O8M A;  3R6M A;  3EKS A;  1YUW A;  1Z6R A;  3GE1 A;  2YJF A;  4BG9 A;  2CH5 A;  3MN9 A;  3MX2 A;  2QM1 A;  3NVM A;  4EAH D;  1BU6 O;  3CF5 L;  3E1Y A;  3ZET B;  3KWG A;  4JKB A;  1Y64 A;  3BF3 A;  4GY2 B;  4JKG A;  4A62 A;  1RGI A;  2IVO A;  5ADX H;  3J7Z O;  3ZEU A;  4CI6 A;  5BPN A;  1JJ2 M;  3TSP A;  4A5B A;  3SJH A;  5AQM A;  2ITM A;  4ISF A;  1BDG A;  3U8X A;  3VOV A;  3CME N;  4JHD A;  4BG8 A;  4BR0 A;  4CZL A;  3D2E A;  3CQX A;  2Q1N A;  3OBW A;  3QBW A;  5C2D A;  1YIJ N;  3TSU A;  1OKJ A;  4JAX A;  1EO1 A;  3WXK A;  4WQ5 C;  4JK9 A;  1BA0 A;  4BQZ A;  4H0Y B;  2NRW A;  1SAZ A;  3SMP A;  1NBW A;  1KQS M;  1IJJ A;  4AM6 A;  4FWS A;  4C1N I;  4JKC A;  1YJ9 N;  1ATN A;  5AQI A;  4BGA A;  4FWQ A;  5M1F A;  4O8U A;  2Q0R A;  2HBK A;  1VQK N;  3TTD A;  3E66 A;  2KLA A;  3LDO A;  4H5R A;  4WCE L;  3VPZ A;  3WXI A;  1JCG A;  5AQL A;  3BEX A;  3DAW A;  2WFB A;  4IXC A;  4BGB A;  3JXU A;  1VQ4 N;  1DGK N;  3HOS A;  3J8A A;  1MDU B;  2E2P A;  4H0V B;  1RDW X;  4JKD A;  3W0L A;  4BRO A;  2OTJ N;  3NMU A;  4FO0 A;  3VTI A;  4FWL A;  1U2V A;  2VWB A;  5EOY A;  1YVN A;  4JD2 A;  2PBD A;  4DHY A;  2IVP A;  5BR9 A;  5LJV A;  3MWT A;  3M1F A;  5M1O A;  3VES A;  2ASO A;  3QDK A;  4C23 A;  5FPE A;  1DKG D;  4H0T B;  4YOX A;  4I6M A;  4JD2 B;  2P9S A;  2QI2 A;  1RDU A;  2BH1 A;  3HBT A;  5LJW A;  4CD1 A;  2P9P B;  1QQN A;  1K8A O;  3ZX0 A;  4M63 C;  1YAG A;  4FL9 A;  3T69 A;  3ATU A;  1NGJ A;  1HKC A;  1X9J A;  2YCH A;  4BR7 A;  3UKU B;  3O4W A;  4IOX A;  5GAE P;  3DXK A;  2YHX A;  3KWI A;  4MO4 A;  2CGL A;  2A41 A;  4C1N K;  4RWT A;  1K73 O;  5TKW A;  4E1J A;  1IG8 A;  5C2F A;  4BRP A;  2E20 A;  1NGI A;  3ENO A;  2NNW A;  1BA1 A;  1NGH A;  4KH4 A;  4H0P A;  3U9Z A;  3C6H A;  5DM7 L;  2FXU A;  3FFK B;  3R9P A;  3HTV A;  2QXL A;  1E4F T;  2E2O A;  1RFQ A;  4CZE A;  4OO1 J;  1CZA N;  1T6D A;  1X3N A;  3CJA A;  3SMS A;  3WXL A;  4B1V A;  3AAR A;  3D2E B;  5E84 A;  2ZGZ A;  4O8K A;  3I8B A;  1W2B M;  3CCE N;  2A42 A;  1NGG A;  2QWR A;  3QML A;  4JKG B;  3FGU A;  2NRR A;  1QZ5 A;  5AQW A;  2ASM A;  2V7Y A;  2VYP A;  1QQO A;  3O9Q A;  3QBX A;  4BR9 A;  3CET A;  4FVU A;  1Q86 O;  4FOE A;  2NRV A;  3LDQ A;  3ZYY X;  3SAF A;  5EX5 A;  4BRN A;  4RTF D;  4PKH A;  4U67 L;  3C6A A;  3T7Z A;  5AQU A;  2ZJP L;  5BN9 A;  3CCR N;  3CD6 N;  3HI0 A;  3MDQ A;  2QTD A;  3H3N O;  4K43 A;  5GIP A;  3OHR A;  3SBG A;  3VEX A;  2P9U B;  4FPB A;  2HBM A;  3VF6 A;  3VGK A;  2A5X A;  5M1P A;  3CPW M;  3GG4 A;  1VQN N;  4O5F A;  3UB5 A;  3WUH A;  1KAY A;  4B9Q A;  1WOQ A;  1GLD G;  2P9K B;  2FF3 B;  3IKM A;  1YF5 L;  4BRI A;  3WQU A;  5EY4 A;  4BRM A;  3CCS N;  3UKR B;  2HF4 A;  4CJ7 A;  3L4Q A;  3O08 A;  1ATR A;  3RSE A;  4AF1 A;  5B8H A;  3FR0 A;  2ZGY A;  2BUP A;  1T3V A;  4H0O A;  4WFA L;  4BRE A;  3TTF A;  2CH6 A;  3O9S A;  4A2B A;  4YOW A;  2Q2R A;  4YOR A;  5BRF A;  1Q82 O;  1Z05 A;  4LC9 B;  4WQ5 A;  3C7N A;  3I33 A;  1OVY A;  3HM8 A;  1DT9 A;  1MWK A;  3AGR A;  2P9I B;  3D2F B;  2E88 A;  3H46 O;  3IUC A;  3WEE A;  2A3Z A;  1YIT N;  3VEZ A;  1Q18 A;  3L0Q A;  3CCM N;  3AGK A;  1HX1 A;  1ZC6 A;  1GLF O;  4A2A A;  2GEM A;  5MLC Q;  4BRD A;  2ZF5 O;  3VTH A;  4JEP A;  1KD1 O;  1T44 A;  2ASP A;  3N4Q A;  4IJA A;  3TU5 A;  3U9D A;  4B1U B;  4BY9 C;  3ENH A;  5EVZ A;  3A8Y A;  3FZF A;  1Q81 O;  3AY9 A;  4EIA A;  4H0X B;  1NGD A;  3DLL L;  1SQK A;  2BTF A;  3KVG A;  1ZBS A;  5FPN A;  1NGF A;  1T6C A;  2E2N A;  2KHO A;  5CHI A;  5GIN A;  2FSN A;  2NZT A;  4BVO A;  1N8R O;  5AQP A;  1LCU A;  2A40 A;  3F9M A;  3DXK B;  3HRG A;  3MN5 A;  2W41 A;  2Q31 A;  3EE8 A;  3O9T A;  3UKU A;  1XC3 A;  4B1W B;  3IFR A;  4GVE A;  4CBW A;  5M1Q A;  5C15 A;  4IO8 A;  3C0B A;  3CC7 N;  4JKA A;  4M7X A;  3C7N B;  3VMF B;  2ZJR L;  1KAX A;  3FZH A;  3O80 A;  4FWO A;  2P9P A;  3D6R A;  5BN8 A;  1NLV A;  3EZW A;  3MMV A;  3CJC A;  5GIO A;  2CGK A;  3RVC A;  5BPM A;  4XEI A;  1DEJ A;  3IDH A;  1D4X A;  2V7Z A;  2KKZ A;  4PL8 A;  2YJE A;  3RSE B;  3P4I A;  1HUX A;  3ENB A;  2D0O A;  1J6Z A;  2F7T A;  2P9L B;  3M3Z A;  4K41 A;  5JVG L;  5AQS A;  1TUY A;  3I55 N;  4CZJ A;  4MDA A;  4CZM A;  1K8K A;  5BRD A;  5LY3 A;  2E8A A;  4GV3 A;  2I7P A;  3MN6 A;  1NGE A;  5AQR A;  3SAG A;  3GBT A;  3NVK A;  3WXJ A;  4BRQ A;  2P9U A;  3O5B A;  3MN7 A;  3HZ6 A;  1BOT O;  5AR0 A;  3CC4 N;  4FSV A;  3LDP A;  5AZI B;  2A6A A;  4IOC L;  4XH1 A;  3EKU A;  2NRT A;  1K8K B;  3O1W A;  3PIO L;  5ELZ A;  5HL7 L;  5AQQ A;  3G4S N;  3LDL A;  3DJC A;  2GWJ A;  2P9L A;  3CCV N;  2GWK A;  4IFE A;  4CZF A;  1ATS A;  4EHU A;  5AFU A;  4A61 A;  2QWQ A;  3A5M C;  4FPA A;  5E26 A;  4IJN A;  3PLA A;  2PAV A;  3H6E A;  4EHT A;  2D0P A;  3VF4 A;  2QWM A;  4B1Y B;  3D7E O;  5F0X A;  5BRH A;  5JIC A;  3OW2 M;  1VQ7 N;  4YOY A;  4CZH A;  3FZL A;  3O1B A;  2HBJ A;  1GLJ O;  5CR4 A;  3BP8 A;  3Q7C A;  3TPQ A;  5BPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...