2HSTA

Solution structure of the middle domain of human eukaryotic translation termination factor erf1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
136
structure length
136
Chain Sequence
b'LSDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic peptide chain release factor subunit 1
molecule tags Translation
source organism Homo sapiens
publication title Eukaryotic class 1 translation termination factor eRF1 - the NMR structure and dynamics of the middle domain involved in triggering ribosome-dependent peptidyl-tRNA hydrolysis
pubmed doi rcsb
total genus 24
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2006-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2hstA00
4AF1A 2HSTA 3OBYA 3MCAB 3OBWA 3VMFB 3AGKA 3WXMB 3E1YA 2VGNA 1DT9A 2QI2A 2VGMA
chains in the Genus database with same CATH superfamily
2UU9K 3CD6N 2B6AA 4JHDA 2OTJN 4LH5A 3L0QA 3TAFA 4WQ5C 2NRVA 2A3ZA 3TTCA 4NCBA 1WN7A 4H5WA 1SL0A 4NB4A 2XO7A 3BDPA 2Q2RA 3DMJA 4DV5K 4OGCA 3WXIA 4CJ4A 3J7AP 2YHXA 3BY5A 3A5OC 2IS3A 4ELUA 3LPTA 3C94A 2KW4A 4Q0BA 4DB3A 3GG4A 4BVOA 1NNEA 1KVBA 1JLEA 3CCUN 4BG9A 4DF8A 4BRLA 3M8QA 4B1ZA 4Z4GA 4BRAA 4FSVA 2E1ZA 2KFZA 3SK3A 2CH5A 2YHAA 1HYZA 4EP5A 3ZCMA 2P51A 4QAGA 1KAZA 3UIQA 3HPGA 1RFQA 1D9DA 4GY2B 4JKEA 4BROA 4CK1A 2QI2A 1RT3A 3THYB 3AO3A 5A2QO 5J2PA 4FPAA 4EHTA 2V7ZA 4CJTA 1LW0A 1N34K 4Z4EA 3O80A 2JGUA 1VSDA 5EXWA 3R1XA 4LF7K 1DTQA 4LY7A 4FJKA 1RBTA 2Z1IA 2F9TA 4CFBA 3M1FA 4CJ5A 4DQSA 1BISA 4YOTA 4N47A 1HPMA 2AA4A 5JS1A 4LF4K 3NE6A 1MWKA 4FJ7A 3EE9A 1W0HA 2AJQA 4JKDA 2ZJRL 3M8RA 3NGIA 2P5GA 5C2DA 1DT9A 1JCFA 4I7FA 1T6DA 3C65A 4BRCA 3C6AA 3PLAA 1TV6A 3LM9A 5HOOA 1Y97A 3ZX0A 4H0OA 4FM2A 4J2BA 4AM6A 2HHUA 1M90O 1U48A 1YI2N 3RSEB 2WBNA 1K8KA 3KLEA 1KSPA 2A5XA 2HB5A 1RT5A 3SPZA 3FR0A 3P83D 5EY4A 2V7YA 2PYLA 5BRDA 4BVPA 3U6FA 4ELVA 3MXMA 3E9PA 4YY3K 1U45A 1KFDA 4GKKK 4JKBA 4CF1A 4PKHA 2Z1GA 3O3GA 1SL1A 1RT6A 4FJHA 3VERA 1KFSA 1H1VA 5JVGL 3HSCA 2QTDA 4DF4A 5AQPA 2ETJA 2E88A 5M1KA 1L3SA 1NOYA 4KHNA 4I6MA 3L6QA 5C2FA 2OZMA 2BANA 1VQ5N 1B9FA 1D8YA 4K41A 3O3HA 5GIPA 1XNQK 2I5JA 3ENHA 2XY6A 4FWLA 1U4BA 5M1QA 2VCPA 3VQQA 1J5OA 5C15A 4OPKA 4G1QA 4GNIA 3THVA 3PSIA 1VQMN 2IAJA 4IOXA 5LJWA 4PL7A 3BEXA 4RW6A 3ZX3A 1WUAA 3VQ6A 1MA9B 1ZC6A 4LFAK 3ENOA 4K42A 5AQHA 3AVFA 4EIAA 2KZZA 4K43A 4JHDB 3ALYA 4G9ZA 4KHUA 4Z4IA 1CXQA 1CZAN 2WOMA 1RT1A 4X64K 4DS4A 5I42A 1YJNN 2FF3B 1XHXA 4FK2A 1ATNA 4FLYA 3SI6A 4DV2K 1IKYA 4B9UA 1WSEA 1QVGM 1XMOK 1RBVA 2O8DA 4JD2B 4CEFA 2P9IA 3LDNA 3CXCM 1BA1A 3BZKA 1N36K 4GV3A 4JI2K 1S6PA 1TYQA 1FXXA 2HW3A 2HHVA 3W3DA 3D2EA 1NBWA 5BN9A 1X9JA 2P9PB 3ZT1A 4FXDA 5AQWA 5GAHP 1TKDA 3FZKA 4E7KA 3HO1A 1HLUA 1LAWA 4FJIA 4CBXA 4OKEA 3CCSN 3LP1A 4FJLA 3OYHA 4B3MK 2ASOA 4WQ5A 2WONA 5H1SQ 2UXCK 4BE0A 4CW7B 1NJYA 2Z1JA 3DLRA 5EX5A 1RT2A 4CGHA 4FZZA 4H5TA 2P9UB 3AGRA 1CZ9A 5F1XA 2VQEK 2E2OA 1IKXA 5HL7L 5I3UA 3NBPA 1C0MA 3HTVA 3AO1A 3OYLA 1DLOA 3SQ0A 4ILGB 1ITGA 3RR8A 5KRTA 3LANA 4CEDA 3QFPA 2KKZA 3DRPA 3VQ7A 3CPWM 4QS9A 1Q9XA 1SKSA 4YORA 4CK2A 2A1SA 2QK9A 5AFUH 3SMPA 1NJWA 2P9LA 1NMNA 5M1OA 3L2VA 3QO9A 3AVIA 1NMDA 4YDUA 1TK0A 3C6HA 3SV3A 3LDOA 4JS5A 2F9WA 5JMVA 1FW6A 3J7ZO 3G4SN 3V9ZA 4DU3A 1O13A 2YNFA 5AQXA 4B3RK 3AVAA 4DV3K 2G8FA 1RDWX 5M1PA 4JAXA 4KKOA 3PX6A 4LFBK 3A5LC 4I2QA 3E9OA 3P39A 3RRGA 1XWLA 2O8CB 1EETA 4CZFA 2P9NB 2DFHA 3EKSA 4WCEL 1C1BA 1BOTO 4Z4FA 5M1NA 2Q31A 2QWPA 3O9UA 4HVJA 2YKNA 3OY9A 1BDGA 4A61A 1ASVA 4CERA 1VRUA 3E1YA 1P8ZA 1HQUA 1NGBA 3DLHA 1HKBA 1TAUA 2GV9A 1O1WA 4RWTA 1VQKN 1GLBG 3RTVA 1OH7A 1RT7A 3PIOL 2OANA 5AQYA 2ZJQL 3DI6A 1EP4A 4RW4A 2HHXA 3A5MC 3CFRA 5J1EA 2G8UA 4DTPA 4O44A 1U2VA 3IUCA 2HHHK 4DV1K 3WNEA 4E19A 3OYFA 1ZBUA 3O9SA 3CYMA 1NKBA 1MWMA 3GDQA 1NKCA 2DTUA 3K9JA 3M6GA 1D9FA 1S1XA 3CQXA 4FWKA 3Q7BA 1C0FA 2LSNA 4C23A 2A41A 4W5NA 4MFBA 3QEXA 1QSSA 3ZETA 1X3NA 2G8HA 4JKGB 4FJ9A 1DKGD 3FLCO 3J7YP 1KRPA 1VK0A 2V52B 1S1TA 2ASPA 5K14A 4KI4A 4QCLA 4IJNA 1U6ZA 3AVHA 1KAYA 2XY7A 4YOUA 2P9UA 4BE2A 2HVHA 3OJSA 2QKBA 3W0LA 4BRHA 3M8PA 1D5AA 3TWHA 4OVLA 3NAEA 1TKXA 2Z1HA 1DGKN 4F2SA 2G8KA 3MEDA 1G99A 3ATVA 3SYZA 1HR0K 3OS1A 4O0IA 1T7PA 2QA4N 5FRMA 3KK1A 3CMAN 2FBXA 4GV6A 3V9XA 2Q97A 4RCHA 3OYAA 3SJHA 4IOCL 3HI0A 3VGKA 2IVNA 1GLFO 5F0XA 4U67L 1X1PA 4JKAA 4I9LA 4LFCK 2O8FA 4AQYK 2X6NA 3I0SA 2QWMA 5LMNK 4JKGA 1SKRA 1KLNA 4FZYA 4FM0A 3AO5A 3MAQA 3TSUA 3MMVA 5KI6A 1HYSA 2HBMA 4KO0A 3HL8A 1RBSA 4B1YB 4NXMK 3D2FB 2XY8A 1REVA 3LDSA 1IKVA 4E7LA 1OH6A 3QIOA 4HCCA 2PAVA 4DSJA 2F7TA 3ZT0A 4Q5VA 3PX0A 4FJXA 4PQUA 4KAZA 2E6MA 4B8CA 4BWMA 3U9DA 1HNWK 3RMCA 4CGGA 3IKMA 3SCXA 1WBBA 2BGGA 1WB9A 4DR6K 4OLAA 1Q82O 1IBKK 4M7XA 3UKRA 3G71N 4PY5A 4BRPA 3HM9A 4CFCA 1C0UA 2GUIA 3L2WA 4NLBA 3TR8A 4NYFA 5J2QA 5EVZA 1IBLK 3U3GA 4OPAA 4QS8A 3L4IA 3OYBA 4GVEA 3KLGA 3CCLN 4CZGA 1C0TA 4FZXC 3NVMA 1I94K 1WSFA 3V1RA 1WLJA 4DKWA 4C8OA 1BIUA 1FKOA 1GLLO 4BR0A 4BGAA 3OS2A 3JYTA 4JK7A 2FC0A 3TARA 1TUYA 3S3MA 3IS9A 3ZSZA 1BIZA 4B08A 3M8SA 1T44A 4DTMA 1JCGA 4GKJK 3C6TA 3NGZA 4BR7A 3AO4A 3RVCA 4A57A 5DK5A 1NM1A 3Q7CA 3FZHA 3VOVA 2NZTA 3CCJN 2YX6A 3CM6A 3MN6A 3HPHA 4DTXA 3I33A 4HWIA 3MX2A 2J4RA 3WXKA 3VQ5A 1YHQN 5AJ3K 2ZGYA 4BR4A 4B9SA 4F8RA 3CC4N 4BDYA 4DR2K 4MLHA 1F21A 1IKWA 3SUQA 1ZBFA 4KTQA 4HTUA 4CIFA 4HUGA 3SZ2A 2NRTA 3DWLA 1X9MA 1HKGA 3NF7A 3ZETB 4YOYA 2B5JA 3DLEA 3P31A 4A59A 3R6MA 1MDUB 2QWRA 4KPYA 1XQSC 1DEJA 4Z94A 2HHWA 3NF9A 5C12A 2E8AA 3OYDA 1RNHA 4CJUA 3SUPA 3J81O 3CQ8A 3VQAA 4CEEA 4FK0A 5C0YA 3BP8A 2HF4A 1VSHA 4MQ3A 1IJJA 4ZHRA 1FKPA 4B3OA 3MDQA 2R7YA 4NXNK 2O8EB 3THXB 1V4SA 5BR9A 4FWPA 1Q86O 5TKYA 3TABA 2QEXN 3VF6A 4C1NK 2WUSA 4CJ3A 3VGLA 1KQSM 3T7ZA 3ZSXA 4DQ8A 3WT0A 4A5AA 2F8TA 4DTSA 1TYQB 4NCAA 1C0GA 3AVLA 3TAEA 3DLGA 3IG1A 1HNVA 1JLGA 4CE9A 2HNZA 4DTUA 1YUWA 3G0ZA 2VWJA 1X9WA 1B9DA 4CZHA 4HHTA 2AP1A 3PV8A 2F96A 1TL1A 3QB0A 5C10A 4I6MB 2P9NA 2ITMA 3E9LA 2E20A 4W5TA 1RT4A 2QWLA 1LOTB 3K5LA 4DQQA 3QFUA 3CC2N 3KJVA 1J53A 3OTOK 4CJVA 1S1VA 3HZ6A 4GVMA 4CJEA 3OYJA 4JI5K 4FVUA 4YHHK 4PKGA 5FPMA 4RG8A 2VQFK 4AH9A 3KKSA 3WQUA 5AZJA 4CECA 1TK8A 4FWQA 1VQ4N 1VQLN 2O4IA 3AAPA 3FFIA 1GLDG 4WFBL 4M3YA 5AR0A 1RBRA 4IBNA 4FVMA 4OPJA 1ASWA 4HUEA 3O9QA 3V81A 3P1GA 4ILJA 3SQ1A 2HHQA 1Q9YA 3KK3A 4IFVA 3SBGA 1ATRA 2XRIA 1U47A 5C42A 1N8RO 1L3VA 5FRNA 2KFNA 3DOKA 2FBYA 4N41A 4FW2A 3THWB 2YHBA 1RDUA 3L8BA 4AHRA 1SUQA 4DFMA 2HBKA 3ISNC 4CIGA 1JLQA 3G25A 4BRDA 1OVYA 2E2QA 3OYNA 1BG3A 3VQCA 3QETA 1KLMA 4YOXA 1BI4B 4CK3A 4IG0A 4YOVA 2YJFA 4FWSA 1NGGA 4TSXA 3NVKA 4WYBA 2FSNA 4JI1K 3TAPA 1W7AA 2DFFA 4BRIA 3T3FA 2FLOA 3VF2A 3RR7A 3SQ4A 1BQNA 2H3GX 4DR7K 3C0BA 4BR5A 2WC9A 4DV7K 3LWMA 2PBDA 3VQEA 4OKJA 3S9HA 1YTUA 4X66K 4JI8K 3E66A 3H6EA 3CMEN 1RBUA 1JL2A 3IFRA 1IBMK 3DXKA 4ILHA 4CZKA 3KVGA 3O9RA 3U4LA 4M3WA 2E2NA 4KB1A 1EQYA 1KVAA 1WSJA 3ATUA 4FPBA 3AVGA 5AQNA 1TL3A 3NH0A 2P9SB 3OA9A 4M7YA 2VG7A 3TI0A 1R0AA 4H0PA 3OYEA 2O8BB 4DSIA 4B1WB 3WQTA 3L4QA 4XH4A 4KH4A 3ZEUB 4XH1A 3I8BA 4B1XB 2UUCK 3AAQA 3VQDA 1K9MO 1U04A 3OVNA 3SAFA 3KZBA 1KAXA 4KH6A 4CJWA 4DQPA 4H0TB 3HSTB 4DV4K 4ISGA 3CIPA 4Z4CA 2RF2A 5LMUK 4FLVA 1YF5L 3LAMA 3VENA 3O6WA 5HROA 2Q36A 5CYMA 4X62K 1BCOA 4BWJA 3KK7A 1LW2A 1RILA 3DJCA 2Q0UA 2FSJA 1NGHA 3WXMB 1C1CA 1SL2A 2I7PA 3K5MA 1VSLA 2DY4A 1JL1A 1RDDA 4KTWA 3DXMA 2XY5A 3T1AA 2D1KA 2VG6A 5HP1A 1VRTA 2D0PA 3KD5E 4JK9A 4H5VA 2HNYA 2B4JA 5JVHL 3I0RA 4BY9C 1LWCA 4M3TA 3AA2A 1QTMA 4AHVA 2GWJA 3KTQA 1HRHA 3LP3A 4IXCA 2NRHA 5AQQA 2O8FB 2P9LB 1HQEA 2OPQA 3M3ZA 3DXMB 3SAGA 4WE1A 1VQNN 4CJPA 5KQDA 5CE3A 1MU2A 2JWLA 3NH1A 3OBYA 4CHQA 4CZJA 4AILC 1J6ZA 4KRFA 1S1UA 3VA0A 3S3NA 2BDPA 3WEEB 3PO4A 4O4GA 5CZ2A 4AHUA 3F2KA 2IGIA 1YITN 1VHXA 1NJZA 3TTFA 1OH8A 4YNQA 1SV5A 3QBXA 2HBJA 4CF9A 2A42A 4MLEA 2GX9A 2W42A 1S22A 5KPZA 4EAHD 3CJBA 1LCUA 3AA3A 1LWEA 3SQ2A 4DFKA 4GV9A 3PX4A 3K57A 2ZWHA 1WAJA 3MN7A 3HVRA 4KI6A 1V4TA 5KTQA 1QSYA 4OKKA 3VQ4A 3TTDA 2VG5A 1XC9A 2ZJPL 3HRGA 2NLXA 2X78A 3BUZB 3QEIA 3NMUA 1GLCG 1KXPA 3OW2M 1L3TA 2KHOA 4F4KA 4AM7A 3OYGA 3MX5A 3PY8A 3CCEN 2FBVA 4M41A 2FF6A 4Y1DA 4BR2A 4K0KK 3HK2A 1ZBLA 3ZSQA 3A2FA 4MO4A 3GL1A 4JI7K 4EHUA 3WUHA 2D0OA 3D2EB 3TSPA 3VETA 2EWSA 3FFKB 3R8EA 4CJLA 3TSQA 3ZT2A 3SUNA 1YTAA 5AQUA 2CGKA 1DTTA 4AF1A 5AQKA 2I7NA 2BTFA 4JD2A 2W6LA 5FROA 4DTRA 3HOSA 1S9EA 5DMRA 4JRPA 3N4QA 1GLJO 2Y1IA 4O0JA 4OLBA 3BZCA 3DLBA 1UOCA 2D4WA 3QBWA 3KD1E 3KLFA 4J2DA 3LZIA 5BPLA 4CI6A 1J54A 2YKMA 3NDKA 1NWKA 1VQPN 1NK9A 1HJOA 1VQ8N 5HRSA 1UWBA 1ILYA 2G8VA 4KHQA 1QE1A 2OPPA 2GEMA 1NK4A 3ZEUA 4BRGA 1KVCA 1XC3A 3AO2A 1RTIA 4ZTJA 4WQ4A 4CESA 3KWGA 3LDPA 1QVFM 1IV0A 1QZ6A 1M1KO 3SAHA 4QOZB 3EEQA 3F9MA 5EOYA 4E89A 2UYTA 3QNOA 5KPTA 3OBWA 4CZIA 5JLHA 2XHBA 1HX1A 4FO0A 4JRQA 4HCBA 4KHYA 2PZSA 4DSKA 4CHOA 5E26A 3O3FA 4FCYA 4JI6K 4B1UB 3R3LA 3FZMA 3NF6A 3T19A 5LJVA 4BC5A 3QEPA 1BI4A 4QS7A 4MDBA 3P38A 5FDLA 5BREA 1UA0A 4IOAL 3DM2A 3VTHA 2O8BA 1ZBSA 2HHSA 2NNWA 4OO1J 2YNIA 3ZSWA 4CJRA 4FK4A 4JEPA 4C8MA 3FE1A 1VQ7N 4BDZA 4CCHA 3V1OA 4M42A 1BGXT 4DUZK 1XMQK 3L2RA 1VSIA 1JLAA 1QQNA 3DOLA 2ZE2A 5AQMA 4A2BA 4E7IA 3JXUA 2D5RA 1TAQA 3KLIA 3ZT3A 3VESA 3NHGA 1BQMA 4M3UA 4DU4A 4DHYA 1TVRA 3ITHA 1YJ9N 2WTUA 2IVOA 4WFAL 3AA4A 3IAYA 4CIEA 3D45A 4IG3A 4MDAA 4B9NA 1P90A 4NYNA 3VTIA 4IDKA 4JI4K 1D4XA 2O8CA 3UKUB 2PFUA 2JWKA 3VEZA 4BRNA 3K58A 4DLEA 2E1YA 4KH5A 4BGBA 3OYKA 2O8EA 2HMIA 1HJRA 3NH2A 1I39A 2HHTA 3VQ8A 2DPNA 4CFAA 4DLGA 4PA1A 5DM6L 4FJ8A 4X65K 5ADXH 2YNGA 3QEWA 1T6CA 1UAXA 5J2MA 1NGEA 2GWKA 4BC3A 3QINA 3CC7N 3FGUA 5HRNA 3MWTA 4N56A 2Q3SA 1WSIA 3LPUA 3LWLA 4IEIA 3EYZA 3K5NA 3WNFA 3DAWA 3OYCA 4CGFA 1A5XA 3QEVA 3CM5A 1Z05A 3AVBA 3K5OA 1CZBA 4H0VB 4CHNA 1RDCA 2O4GA 4DTJA 3EZ5A 4E1NA 3D0PA 3TAQA 2OPSA 5MLCQ 5LY3A 4CZMA 3UKUA 3CFPA 4DCHA 3VF4A 4CD1A 1LV5A 1YJWN 1K6YA 3CG7A 5E41A 3V4IA 2YJEA 1QQOA 1NU0A 4FJJA 4JKFA 1VQ6N 2BUPA 5BPMA 1J9AA 3F73A 3BF1A 4BRQA 4JLHA 2Y1JA 3AVJA 3H3OB 4PKIA 2KTQA 3E01A 1SQKA 2YHWA 4LD0A 3G6EN 5HRRA 1XHZA 2RN2A 4E0DA 1W2BM 1NK8A 2VGNA 5KGWA 4I9QA 5ELZA 5JICA 4LSLA 3THXA 4AHSA 3B6PA 5FPEA 4DV6K 4U7BA 1EWRA 4DTNA 1VSMA 4HTLA 1C1AA 3MEGA 2ITGA 2IDOA 4BQLA 3PIPL 3QLHA 4B8AB 3AGKA 3CERA 3KWIA 3THWA 4K8XA 3FZLA 1TUUA 1EO1A 5KGXA 4FLWA 3SJJA 3RMDA 2OYQA 5KRSA 1ESVA 3HM8A 3O4WA 2Q0RA 4BRFA 3KLHA 4KHPK 3CJ9A 3CCQN 3C7NB 4OPHA 4V19S 2F8SA 1LWFA 1TK5A 2NRXA 3EN9A 3RMBA 4DFJA 2YV0X 1G15A 1NGFA 3D2FA 3S41A 3ID8A 3OS0A 2KQ2A 3MCPA 1S6QA 4C8LA 1K73O 2EHGA 3QIPA 4IO9L 3TAMA 3PSFA 4JNEA 5CZ1A 4FWNA 3MK6A 1NGDA 4DR4K 3RRHA 3MXIA 5BRFA 2JLEA 5CR4A 3OYIA 1HNXK 4L3QA 4BDPA 3CJCA 3V9SA 4M3XA 3WNGA 1W9HA 5J2NA 3K59A 2OTLN 4M3ZA 5CHIA 2X6SA 4J8FA 3CCRN 2P5OA 1Q18A 1VSEA 4H4OA 1HKCA 1GLAG 4NLCA 1RTHA 2NRZA 3EKUA 2V51B 4K25A 2HBLA 4OX9K 3MECA 3WEEA 1YAGA 2VYPA 4CVNE 4DS5A 5EU7A 4FLZA 3TAGA 2F4VK 5AQVA 4F3OA 3N4PA 1NGCA 3CCMN 5C24A 3KKRA 1EKEA 1WSGA 4O5FA 3CETA 3CJ7A 1YVUA 5IT9O 1NGIA 1RCHA 1OKJA 2YNHA 4B9LA 4LF5K 4CHZA 3H45C 4BREA 5GAEP 1YVNA 4KREA 5AQLA 4H03B 3SV4A 3NFAA 1U2VB 3UB5A 1ZYQA 1WAFA 1NOZA 1R59O 4FYDA 4PL8A 3U9ZA 3RSEA 1SZ2A 2QM1A 2HF3A 4CZLA 1VQ9N 3ULEA 3V9UA 3LALA 4OGEA 1NK5A 1J5EK 1RDAA 4BE1A 3DLLL 3DRSA 4FW1A 2D0BA 4E7JA 3VQPA 3V6DA 5AQSA 5LL6Z 4CFDA 4FOEA 5AZIB 3H1VX 2P9SA 1TKTA 1FJGK 4N5SA 5GADP 4C8KA 3SMSA 5BRHA 2IC3A 4CEAA 5AZJB 5JLFA 1EX4A 5E84A 2FXUA 1BO5O 4CJKA 4PWDA 4A5BA 2EX3A 4F9OA 2YI1A 3L3UA 5BN8A 3VEWA 4FJ5A 3HP6A 3G10A 3VEVA 3LDLA 3MCAB 1QHAA 2OZSA 2ATQA 4DR1K 3SBTA 3L2QA 4A62A 1UA1A 2QWNA 5BR8K 3WNHA 3K2PA 4JKHA 2O8DB 3VEYA 4CJFA 3PO5A 4XEIA 1HNIA 1NK0A 4WFNL 1OVQA 2G8IA 2GUPA 4YDUC 4ZTFA 2NRWA 2OPRA 4CJSA 3TU5A 4FOIA 3VEOA 2FSKA 3VPZA 2Q1NA 3QICA 2KZMA 3EY1A 1KTQA 4LF9K 3MEEA 4JI3K 3K0SA 4DFPA 4KFBA 1S72N 1WSHA 2RHKA 4CF2A 2A1RA 4KB0A 1BWFO 3J80O 5SZTA 2PY5A 4O5BA 2QWOA 3ZYYX 3NGYA 2E5LK 1HUXA 2IVPA 2P9IB 3F5TA 4J2AA 5KPRA 2CH6A 1N33K 2HSTA 5D3GA 1A5VA 3VGMA 2YHYA 3AV9A 5AQZA 3HXMA 1BU6O 1S3XA 4HUFA 2P9PA 3DRRA 2A6AA 1FK9A 1JKHA 3SNNA 1Q7YO 4B3SK 1LAVA 3L3VA 1QHTA 3CJAA 4KTZA 1RTDA 3H1QA 3CFOA 2NUBA 2ZQBA 4LH4A 1CXUA 1U49A 3O9TA 4R79A 4K8ZA 2HMPA 3VQ9A 3T1HK 4CBUA 4EFHA 5JS2A 3PUFA 1YT3A 3ZX2A 2W40A 3H3NO 5AQJA 4RW9A 3WXLA 2CGJA 3VN5A 5GAGP 4FLXA 1JJ2M 2NRRA 1X3MA 3ZSRA 3KK2A 5T7BA 2QKKA 4FWMA 2DFEA 1S5JA 3EL2A 3LP2A 2A40A 1YIJN 4WQ4C 3RMAA 1T03A 2UXBK 4MO5A 4BRMA 4BACA 3SLCA 4IJAA 5AQFA 2IIRA 2VWKA 1E4GT 4IZ9A 4CHPA 4L8RB 3RWUA 4UY8O 1NKEA 4UQGA 2ZGZA 4M63C 1QQCA 4YFUA 1JLCA 4DSLA 3D6RA 1GOBA 2QXFA 4IFYA 3ULDA 4O8KA 4CGIA 1RGIA 4PUOA 3MXJA 1C6VA 5AQIA 3QNNA 5CY4A 3ZLJA 2GBZA 3ZSOA 3K9KA 4CGDA 4W5QA 3HVTA 3O08A 1T3VA 4KHSA 2P1JA 3JS6A 1B92A 3DLKA 3CHWA 4Z4HA 3O4NA 2RPIA 3VMFB 4LF6K 1Z26A 1NG9A 1NLVA 3R9PA 2W6KA 3QDKA 4DMNA 1S9GA 1HMVA 3NF8A 3V9WA 3ENBA 3OJUA 1BUPA 1BCMA 4N76A 1N6QA 4CJ7A 3AARA 3D7EO 1GOCA 4FJNA 5SWMA 2D0CA 3LDQA 3CI5A 1K8AO 1RDBA 2UXDK 4FWRA 4RTFD 4NCGA 5DM7L 2BH1A 3V1QA 1HNZK 3QMLA 1E4FT 3WXJA 3EO3A 3CJ1A 4DR5K 1L5UA 4Y0WA 4DSEA 3GBTA 3F9KA 1YXQA 1IH7A 3LP0A 4JN4A 1IG8A 3TANA 3VA3A 1NK7A 1ZBIA 2ZF5O 3U8XA 4IKFA 3DYAA 4ICLA 3ZT4A 4F3TA 4IEEA 1K8KB 4GMJB 4FJMA 3B8AX 3TPQA 3CCVN 1XNRK 1ZBHA 3UE5A 3ZSYA 4XIUA 3FZFA 4JKCA 1GOAA 4E1MA 1GLEG 3JAMO 4BRKA 1Z25A 1JXBA 3A8YA 3C7NA 4IDHA 4BG8A 5KQ8A 1BL3A 3A0IX 1TGOA 2YCHA 3A5NC 3BGRA 2VGMA 2OA8A 3O1BA 4RW8A 1JCEA 2E2PA 5AQOA 1BHLA 4JYAK 3H08A 1L3UA 3QESA 4ISFA 3S3OA 3AY9A 4KBOA 3HJFA 4LSNA 3IRXA 4IWVA 2W41A 2D0AA 5BPNA 1NGAA 2KLAA 3DXKB 4FWOA 1NGJA 4OJRA 5AQTA 4B9TA 3AVKA 1CLQA 1ZXOA 4C1NI 2RKIA 4DSFA 5TKWA 4JI0K 3KIOA 4ID1A 3O8MA 3HYFA 1XI1A 2E4LA 4ID5A 3BF3A 3LAKA 5AQRA 3O5BA 2UUBK 3T69A 5AZIA 4DWIA 1IO2A 1VSKA 1W97L 4EP4A 1JLFA 4CF8A 3B6OA 1NJXA 4DU1A 5GIOA 2GELA 4B9MA 3ID6A 3ASMA 4DG1A 3QERA 4EZ9A 1QS4A 3I56N 3EZWA 3CPEA 4CBWA 3AVNA 3O4QA 4NO7A 1N5YA 4B9VA 1VSFA 4H5RA 4E3SA 1KD1O 4FJGA 4A2AA 2ASMA 5C25A 2E6LA 3HPOA 3SPYA 2X74A 3UKRB 1VAZA 3IDHA 4IO8A 4M3RA 1I3AA 4B9QA 4PHTX 2P9KB 3HT3A 3VEXA 4BR9A 3J8AA 2BE2A 3EE8A 3LM2A 5FLXO 1WOQA 1QQMA 3MN5A 1NJIO 3KHYA 4BC2A 4IFEA 4DQRA 3C6UA 3THYA 4I2PA 3NCIA 3VQBA 3HBTA 1WNSA 4AHTA 4B1VA 3HP9A 2ZM6K 1OH5A 5GINA 1T05A 4H4MA 4B3TK 1XUPO 5HLFA 4CEZA 1SAZA 5FPDA 4CJQA 3L2UA 4O55A 1VQON 3IMXA 3LZJA 4DTOA 4FLUA 5M1FA 2QWQA 3CF5L 3T1YK 2G8WA 4CEOA 5FPNA 3OYMA 5HRPA 4WF9L 4LF8K 4W5OA 1ASUA 3I8DA 1KC8O 4GW6A 4ISEA 4DQIA 4FL9A 3HOTA 4KV8A 3MWPA 2HNDA 3OHRA 2ZD1A 1JXEA 4DUYK 4CD3A 4RW7A 5AQGA 5HBMA 4Y1CA 3P5JA 5B8HA 1Q8IA 4W5RA 4H0XB 5CYQA 1KCFA 4CGJA 4AHCA 3GE1A 4C8NA 1E3MA 4FM1A 2UUAK 1SKWA 4H5NA 3ZSVA 4FLTA 4J2EA 2WFBA 1EXQA 2QXLA 4LC9B 5F2RA 4EZ6A 2RE2A 3AVCA 4JV5K 5I9EB 1HPZA 4BC4A 3SUOA 1SS6A 4CEQA 4F2RA 4O8UA 2OCEA 2GTDA 1NK6A 3AVMA 1WBDA 1QZ5A 3MN9A 3O1WA 4BQZA 3C95A 3I55N 1ATSA 1EWQA 3CQYA 4H8KA 2P9KA 3GOIA 4H0YB 4CZEA 1HYVA 3LL3A 1N32K 1BA0A 2IOCA 3U3YA 2PYJA 1JLBA 1S1WA 1VSJA 2HOEA 4E1JA 4E7HA 3JSMA 4DR3K 4CF0A 3P4IA 2VWBA 4JK8A 4ELTA 3ULEB 1T8EA 1X9SA 4CEBA 1Q81O 1IG9A 1RTJA 4KHWA 1TKZA 4CHYA 2QW9A 5ADXA 2FBTA 1Z6RA 5IWAK 4Z0UA 4XH5A 4JS4A 3AA5X 4M45A 4DV0K 2CGLA 4YOWA 1A5WA 2HVIA 5AFUA 3M5RA 3H46O 4R5PA 1Y64A 1QSLA
chains in the Genus database with same CATH topology
3TSPA 3VETA 1Q82O 4M7XA 3UKRA 2EWSA 3G71N 3FFKB 3R8EA 3CD6N 2QWOA 4JHDA 4BRPA 3TSQA 2OTJN 5AQUA 3ZYYX 2CGKA 4AF1A 3L0QA 5AQKA 2I7NA 4NLBA 1HUXA 2NRVA 2A3ZA 2BTFA 4JD2A 4WQ5C 2IVPA 2P9IB 3F5TA 3TTCA 4H5WA 5EVZA 5KPRA 2CH6A 3HOSA 4OPAA 4QS8A 2HSTA 3L4IA 4NB4A 3N4QA 4GVEA 1GLJO 3VGMA 3CCLN 2Q2RA 4CZGA 2YHYA 5AQZA 2D4WA 3WXIA 3NVMA 3QBWA 1BU6O 1S3XA 2P9PA 2YHXA 2A6AA 3A5OC 4CI6A 4DKWA 5BPLA 1NWKA 1VQPN 1VQ8N 1HJOA 1GLLO 1ILYA 4DB3A 3GG4A 4BVOA 4BGAA 4BR0A 4JK7A 1Q7YO 1TUYA 3CCUN 3CJAA 4BG9A 2GEMA 3H1QA 3ZEUA 4BRLA 3O9TA 1T44A 4BRGA 1JCGA 4R79A 4B1ZA 1XC3A 2HMPA 4BRAA 4FSVA 4BR7A 3RVCA 4A57A 2E1ZA 4WQ4A 3KWGA 3SK3A 4CBUA 4EFHA 3LDPA 1NM1A 2CH5A 1QVFM 3Q7CA 3FZHA 1QZ6A 3ZX2A 1M1KO 3SAHA 2W40A 3VOVA 2NZTA 3H3NO 1KAZA 5AQJA 3CCJN 2YX6A 3F9MA 3WXLA 5EOYA 1RFQA 2UYTA 2CGJA 4GY2B 4JKEA 3MN6A 5GAGP 5KPTA 4BROA 1JJ2M 2QI2A 3OBWA 4CZIA 2NRRA 3I33A 1X3MA 4HWIA 3MX2A 2J4RA 3WXKA 4FWMA 4FPAA 4EHTA 5JLHA 2V7ZA 1HX1A 1YHQN 2ZGYA 4FO0A 3EL2A 4BR4A 3O80A 2A40A 1YIJN 4WQ4C 3CC4N 5EXWA 4MO5A 3R1XA 4BRMA 5E26A 3SLCA 4IJAA 4B1UB 3R3LA 3FZMA 4MLHA 5AQFA 2IIRA 5LJVA 1E4GT 4IZ9A 2F9TA 4UY8O 3M1FA 4BC5A 2ZGZA 4QS7A 4M63C 4MDBA 3P38A 4YOTA 5BREA 3DWLA 2NRTA 1HKGA 4IOAL 3D6RA 3VTHA 1HPMA 2AA4A 3ZETB 1ZBSA 4YOYA 1MWKA 2NNWA 3P31A 4OO1J 4A59A 3EE9A 3R6MA 1MDUB 2QWRA 4JKDA 1XQSC 1DEJA 4JEPA 2ZJRL 3FE1A 4O8KA 1RGIA 5C2DA 1DT9A 1VQ7N 1JCFA 5AQIA 1T6DA 3C65A 4BRCA 3C6AA 4Z94A 3PLAA 3LM9A 5HOOA 3K9KA 3ZX0A 5C12A 2E8AA 4H0OA 3O08A 1T3VA 3JS6A 4AM6A 1QQNA 3CHWA 1M90O 5AQMA 5C0YA 4A2BA 3VMFB 1YI2N 3BP8A 3RSEB 3JXUA 2WBNA 2HF4A 3VESA 1K8KA 1IJJA 1NLVA 2A5XA 3R9PA 4DHYA 3MDQA 3FR0A 3QDKA 1YJ9N 2IVOA 4WFAL 5EY4A 2V7YA 1V4SA 3ENBA 4FWPA 5BR9A 5BRDA 4BVPA 5TKYA 1Q86O 2QEXN 4MDAA 1BUPA 3VF6A 4C1NK 2WUSA 3E9PA 3VGLA 1P90A 4CJ7A 3AARA 4JKBA 3VTIA 3D7EO 1KQSM 3T7ZA 1D4XA 3LDQA 3CI5A 4PKHA 1K8AO 4DQ8A 3UKUB 2PFUA 2JWKA 4FWRA 4RTFD 3VEZA 3WT0A 4A5AA 5DM7L 2BH1A 3VERA 4BRNA 1TYQB 3QMLA 1C0GA 1E4FT 1H1VA 5JVGL 3WXJA 3EO3A 3HSCA 2QTDA 5AQPA 2E1YA 3CJ1A 4KH5A 2E88A 4BGBA 5M1KA 1YUWA 4Y0WA 3GBTA 4I6MA 4CZHA 2AP1A 3L6QA 1YXQA 5C2FA 2DPNA 4JN4A 1IG8A 3QB0A 5DM6L 1VQ5N 5C10A 4K41A 4I6MB 2P9NA 5GIPA 2ITMA 5ADXH 3E9LA 2E20A 2ZF5O 3U8XA 1T6CA 3ENHA 4FWLA 5M1QA 1NGEA 2GWKA 2QWLA 2VCPA 1LOTB 5C15A 4BC3A 3CC7N 3QFUA 3CC2N 3FGUA 4IEEA 4GNIA 1K8KB 3MWTA 1VQMN 3HZ6A 4IOXA 4IEIA 3B8AX 5LJWA 3TPQA 4PL7A 3CCVN 3DAWA 3BEXA 3ZX3A 4FVUA 4PKGA 5FPMA 1WUAA 1Z05A 3UE5A 1MA9B 4H0VB 1ZC6A 3ENOA 4K42A 5AQHA 3FZFA 4EIAA 4K43A 4JKCA 3WQUA 5AZJA 4JHDB 4G9ZA 1GLEG 4FWQA 5MLCQ 5LY3A 1VQ4N 4CZMA 1VQLN 3AAPA 1CZAN 3UKUA 1GLDG 4BRKA 4DCHA 4WFBL 1YJNN 3A8YA 3C7NA 3VF4A 4IDHA 5AR0A 4CD1A 2FF3B 1YJWN 4BG8A 5KQ8A 3A0IX 3O9QA 2YCHA 4ILJA 3A5NC 2VGMA 3O1BA 1ATNA 2YJEA 1QQOA 1JCEA 2E2PA 5AQOA 4JKFA 3SBGA 1ATRA 1VQ6N 1QVGM 2BUPA 1N8RO 5BPMA 4JD2B 2P9IA 3BF1A 4ISFA 3LDNA 1RDUA 4BRQA 3CXCM 3AY9A 1BA1A 4KBOA 4GV3A 3H3OB 1TYQA 4IWVA 4PKIA 2HBKA 2W41A 5BPNA 1NGAA 2KLAA 3DXKB 3W3DA 3D2EA 1NBWA 1NGJA 1X9JA 4FWOA 1SQKA 5BN9A 2YHWA 2P9PB 3G25A 5AQTA 1OVYA 4BRDA 3G6EN 2E2QA 5AQWA 1BG3A 1ZXOA 4C1NI 3FZKA 5GAHP 1W2BM 2VGNA 4YOXA 5TKWA 5ELZA 1HLUA 5JICA 4CBXA 3O8MA 4YOVA 2YJFA 3CCSN 3BF3A 4FWSA 5AQRA 5FPEA 1NGGA 2ASOA 3O5BA 4U7BA 3NVKA 4WYBA 3T69A 2FSNA 4WQ5A 5H1SQ 5AZIA 4BRIA 1W97L 2FLOA 4HTLA 3VF2A 5EX5A 2H3GX 4H5TA 2P9UB 3AGRA 5F1XA 5GIOA 2E2OA 2GELA 3C0BA 4BR5A 2WC9A 4BQLA 5HL7L 3PIPL 3ID6A 3HTVA 3AGKA 3CERA 3KWIA 2PBDA 4ILGB 3I56N 3E66A 1TUUA 3EZWA 3CPEA 3FZLA 3H6EA 3CMEN 1EO1A 4CBWA 4NO7A 3IFRA 3QFPA 3DXKA 2KKZA 4ILHA 1ESVA 4CZKA 3KVGA 4QS9A 3CPWM 3HM8A 4YORA 3O4WA 3O9RA 5AFUH 2Q0RA 2E2NA 3SMPA 3U4LA 4H5RA 4BRFA 2P9LA 3CJ9A 1KD1O 5M1OA 3CCQN 3C7NB 4OPHA 1EQYA 4A2AA 1NMDA 4YDUA 3C6HA 3ATUA 2NRXA 3EN9A 4FPBA 5AQNA 2ASMA 3LDOA 2P9SB 3OA9A 4M7YA 2F9WA 5JMVA 3J7ZO 3G4SN 1NGFA 1O13A 3D2FA 4H0PA 3ID8A 5AQXA 3S41A 4B1WB 3UKRB 3MCPA 3WQTA 3L4QA 1VAZA 3IDHA 1RDWX 4IO8A 5M1PA 1K73O 4XH4A 4JAXA 4KH4A 3ZEUB 4XH1A 3I8BA 4B1XB 4B9QA 4PHTX 2P9KB 3AAQA 1K9MO 3A5LC 3SAFA 3KZBA 1KAXA 4IO9L 3VEXA 4BR9A 3J8AA 3E9OA 3EE8A 3LM2A 4FWNA 4JNEA 4KH6A 3MK6A 1NGDA 1WOQA 3P39A 1QQMA 3MN5A 5BRFA 4H0TB 1NJIO 5CR4A 3KHYA 4CZFA 4BC2A 2P9NB 3CIPA 4IFEA 4ISGA 4L3QA 3CJCA 3EKSA 1YF5L 4WCEL 1BOTO 3VENA 2OTLN 3O6WA 5M1NA 3HBTA 2Q36A 2Q31A 2QWPA 3O9UA 4B1VA 1BDGA 5GINA 3KK7A 4A61A 1XUPO 5CHIA 3E1YA 1P8ZA 1SAZA 4J8FA 5FPDA 1NGBA 1VQON 1HKBA 3DJCA 3IMXA 2Q0UA 3CCRN 1Q18A 2FSJA 1NGHA 1HKCA 3WXMB 1GLAG 4NLCA 4RWTA 2NRZA 2QWQA 3EKUA 2I7PA 2V51B 5M1FA 1VQKN 4K25A 1GLBG 2HBLA 3CF5L 3WEEA 2OANA 5AQYA 3PIOL 1YAGA 2VYPA 2ZJQL 5AQVA 3N4PA 3A5MC 3DXMA 1NGCA 5FPNA 3CCMN 4WF9L 1U2VA 2D1KA 3IUCA 1KC8O 2D0PA 3O9SA 4ISEA 1MWMA 3GDQA 4JK9A 4H5VA 3K9JA 3M6GA 4O5FA 3CETA 3CJ7A 3CQXA 4FL9A 5JVHL 3HOTA 4BY9C 4FWKA 1NGIA 3Q7BA 1C0FA 3MWPA 1OKJA 4C23A 2A41A 3OHRA 3H45C 3ZETA 2GWJA 1X3NA 4BREA 5GAEP 1YVNA 4CD3A 5AQGA 4IXCA 2NRHA 5B8HA 5AQQA 5AQLA 4H03B 4H0XB 2P9LB 1U2VB 3GE1A 3UB5A 4JKGB 1R59O 3M3ZA 3DXMB 4PL8A 1DKGD 3U9ZA 3SAGA 1VQNN 3RSEA 4H5NA 3FLCO 5KQDA 2WFBA 5CE3A 2QA4N 2V52B 1SZ2A 2QM1A 2ASPA 2JWLA 2HF3A 4CZLA 1VQ9N 2QXLA 4LC9B 4IJNA 1U6ZA 5F2RA 3OBYA 3ULEA 1KAYA 4CZJA 2RE2A 4YOUA 2P9UA 5I9EB 1J6ZA 3W0LA 3DLLL 3WEEB 4BRHA 4BC4A 5AQSA 1SS6A 4FOEA 3F2KA 5AZIB 3H1VX 1DGKN 1YITN 2P9SA 4O8UA 1G99A 2GTDA 3TTFA 5GADP 3ATVA 3SMSA 5BRHA 3QBXA 5AZJB 5JLFA 1QZ5A 3MN9A 3O1WA 4BQZA 2HBJA 2FXUA 1ATSA 5E84A 3I55N 1BO5O 2A42A 3CQYA 3CMAN 4GV6A 4MLEA 2Q97A 2GX9A 2P9KA 2YI1A 3GOIA 4H0YB 1S22A 4RCHA 4A5BA 4CZEA 4F9OA 3SJHA 3VEWA 5BN8A 5KPZA 4IOCL 3HI0A 3VEVA 3LL3A 3VGKA 2IVNA 4EAHD 1GLFO 3LDLA 3CJBA 5F0XA 4U67L 3MCAB 1QHAA 1BA0A 4JKAA 1LCUA 3SBTA 4GV9A 2HOEA 2ZWHA 4E1JA 2QWMA 4JKGA 4A62A 3WUHA 2QWNA 3MN7A 4JKHA 3P4IA 2VWBA 3VEYA 4XEIA 3TSUA 3MMVA 4JK8A 3ULEB 1V4TA 2HBMA 4WFNL 3TTDA 4B1YB 2GUPA 4YDUC 2ZJPL 3D2FB 3HRGA 1Q81O 2NLXA 3BUZB 2QW9A 5ADXA 3NMUA 2NRWA 1Z6RA 1GLCG 1KXPA 3OW2M 3TU5A 2KHOA 4FOIA 2PAVA 3VEOA 2F7TA 4XH5A 2FSKA 4AM7A 3VPZA 3MX5A 2Q1NA 3QICA 3CCEN 2CGLA 2FF6A 4BR2A 3U9DA 4YOWA 3IKMA 5AFUA 4MO4A 3GL1A 1S72N 3M5RA 2RHKA 3H46O 4EHUA 1Y64A 2D0OA 3D2EB 1BWFO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AF1 A;  2HST A;  3OBY A;  3MCA B;  3OBW A;  3VMF B;  3AGK A;  3WXM B;  3E1Y A;  2VGN A;  1DT9 A;  2QI2 A;  2VGM A; 
#chains in the Genus database with same CATH topology
 2UU9 K;  3CD6 N;  2B6A A;  4JHD A;  2OTJ N;  4LH5 A;  3L0Q A;  3TAF A;  4WQ5 C;  2NRV A;  2A3Z A;  3TTC A;  4NCB A;  1WN7 A;  4H5W A;  1SL0 A;  4NB4 A;  2XO7 A;  3BDP A;  2Q2R A;  3DMJ A;  4DV5 K;  4OGC A;  3WXI A;  4CJ4 A;  3J7A P;  2YHX A;  3BY5 A;  3A5O C;  2IS3 A;  4ELU A;  3LPT A;  3C94 A;  2KW4 A;  4Q0B A;  4DB3 A;  3GG4 A;  4BVO A;  1NNE A;  1KVB A;  1JLE A;  3CCU N;  4BG9 A;  4DF8 A;  4BRL A;  3M8Q A;  4B1Z A;  4Z4G A;  4BRA A;  4FSV A;  2E1Z A;  2KFZ A;  3SK3 A;  2CH5 A;  2YHA A;  1HYZ A;  4EP5 A;  3ZCM A;  2P51 A;  4QAG A;  1KAZ A;  3UIQ A;  3HPG A;  1RFQ A;  1D9D A;  4GY2 B;  4JKE A;  4BRO A;  4CK1 A;  2QI2 A;  1RT3 A;  3THY B;  3AO3 A;  5A2Q O;  5J2P A;  4FPA A;  4EHT A;  2V7Z A;  4CJT A;  1LW0 A;  1N34 K;  4Z4E A;  3O80 A;  2JGU A;  1VSD A;  5EXW A;  3R1X A;  4LF7 K;  1DTQ A;  4LY7 A;  4FJK A;  1RBT A;  2Z1I A;  2F9T A;  4CFB A;  3M1F A;  4CJ5 A;  4DQS A;  1BIS A;  4YOT A;  4N47 A;  1HPM A;  2AA4 A;  5JS1 A;  4LF4 K;  3NE6 A;  1MWK A;  4FJ7 A;  3EE9 A;  1W0H A;  2AJQ A;  4JKD A;  2ZJR L;  3M8R A;  3NGI A;  2P5G A;  5C2D A;  1DT9 A;  1JCF A;  4I7F A;  1T6D A;  3C65 A;  4BRC A;  3C6A A;  3PLA A;  1TV6 A;  3LM9 A;  5HOO A;  1Y97 A;  3ZX0 A;  4H0O A;  4FM2 A;  4J2B A;  4AM6 A;  2HHU A;  1M90 O;  1U48 A;  1YI2 N;  3RSE B;  2WBN A;  1K8K A;  3KLE A;  1KSP A;  2A5X A;  2HB5 A;  1RT5 A;  3SPZ A;  3FR0 A;  3P83 D;  5EY4 A;  2V7Y A;  2PYL A;  5BRD A;  4BVP A;  3U6F A;  4ELV A;  3MXM A;  3E9P A;  4YY3 K;  1U45 A;  1KFD A;  4GKK K;  4JKB A;  4CF1 A;  4PKH A;  2Z1G A;  3O3G A;  1SL1 A;  1RT6 A;  4FJH A;  3VER A;  1KFS A;  1H1V A;  5JVG L;  3HSC A;  2QTD A;  4DF4 A;  5AQP A;  2ETJ A;  2E88 A;  5M1K A;  1L3S A;  1NOY A;  4KHN A;  4I6M A;  3L6Q A;  5C2F A;  2OZM A;  2BAN A;  1VQ5 N;  1B9F A;  1D8Y A;  4K41 A;  3O3H A;  5GIP A;  1XNQ K;  2I5J A;  3ENH A;  2XY6 A;  4FWL A;  1U4B A;  5M1Q A;  2VCP A;  3VQQ A;  1J5O A;  5C15 A;  4OPK A;  4G1Q A;  4GNI A;  3THV A;  3PSI A;  1VQM N;  2IAJ A;  4IOX A;  5LJW A;  4PL7 A;  3BEX A;  4RW6 A;  3ZX3 A;  1WUA A;  3VQ6 A;  1MA9 B;  1ZC6 A;  4LFA K;  3ENO A;  4K42 A;  5AQH A;  3AVF A;  4EIA A;  2KZZ A;  4K43 A;  4JHD B;  3ALY A;  4G9Z A;  4KHU A;  4Z4I A;  1CXQ A;  1CZA N;  2WOM A;  1RT1 A;  4X64 K;  4DS4 A;  5I42 A;  1YJN N;  2FF3 B;  1XHX A;  4FK2 A;  1ATN A;  4FLY A;  3SI6 A;  4DV2 K;  1IKY A;  4B9U A;  1WSE A;  1QVG M;  1XMO K;  1RBV A;  2O8D A;  4JD2 B;  4CEF A;  2P9I A;  3LDN A;  3CXC M;  1BA1 A;  3BZK A;  1N36 K;  4GV3 A;  4JI2 K;  1S6P A;  1TYQ A;  1FXX A;  2HW3 A;  2HHV A;  3W3D A;  3D2E A;  1NBW A;  5BN9 A;  1X9J A;  2P9P B;  3ZT1 A;  4FXD A;  5AQW A;  5GAH P;  1TKD A;  3FZK A;  4E7K A;  3HO1 A;  1HLU A;  1LAW A;  4FJI A;  4CBX A;  4OKE A;  3CCS N;  3LP1 A;  4FJL A;  3OYH A;  4B3M K;  2ASO A;  4WQ5 A;  2WON A;  5H1S Q;  2UXC K;  4BE0 A;  4CW7 B;  1NJY A;  2Z1J A;  3DLR A;  5EX5 A;  1RT2 A;  4CGH A;  4FZZ A;  4H5T A;  2P9U B;  3AGR A;  1CZ9 A;  5F1X A;  2VQE K;  2E2O A;  1IKX A;  5HL7 L;  5I3U A;  3NBP A;  1C0M A;  3HTV A;  3AO1 A;  3OYL A;  1DLO A;  3SQ0 A;  4ILG B;  1ITG A;  3RR8 A;  5KRT A;  3LAN A;  4CED A;  3QFP A;  2KKZ A;  3DRP A;  3VQ7 A;  3CPW M;  4QS9 A;  1Q9X A;  1SKS A;  4YOR A;  4CK2 A;  2A1S A;  2QK9 A;  5AFU H;  3SMP A;  1NJW A;  2P9L A;  1NMN A;  5M1O A;  3L2V A;  3QO9 A;  3AVI A;  1NMD A;  4YDU A;  1TK0 A;  3C6H A;  3SV3 A;  3LDO A;  4JS5 A;  2F9W A;  5JMV A;  1FW6 A;  3J7Z O;  3G4S N;  3V9Z A;  4DU3 A;  1O13 A;  2YNF A;  5AQX A;  4B3R K;  3AVA A;  4DV3 K;  2G8F A;  1RDW X;  5M1P A;  4JAX A;  4KKO A;  3PX6 A;  4LFB K;  3A5L C;  4I2Q A;  3E9O A;  3P39 A;  3RRG A;  1XWL A;  2O8C B;  1EET A;  4CZF A;  2P9N B;  2DFH A;  3EKS A;  4WCE L;  1C1B A;  1BOT O;  4Z4F A;  5M1N A;  2Q31 A;  2QWP A;  3O9U A;  4HVJ A;  2YKN A;  3OY9 A;  1BDG A;  4A61 A;  1ASV A;  4CER A;  1VRU A;  3E1Y A;  1P8Z A;  1HQU A;  1NGB A;  3DLH A;  1HKB A;  1TAU A;  2GV9 A;  1O1W A;  4RWT A;  1VQK N;  1GLB G;  3RTV A;  1OH7 A;  1RT7 A;  3PIO L;  2OAN A;  5AQY A;  2ZJQ L;  3DI6 A;  1EP4 A;  4RW4 A;  2HHX A;  3A5M C;  3CFR A;  5J1E A;  2G8U A;  4DTP A;  4O44 A;  1U2V A;  3IUC A;  2HHH K;  4DV1 K;  3WNE A;  4E19 A;  3OYF A;  1ZBU A;  3O9S A;  3CYM A;  1NKB A;  1MWM A;  3GDQ A;  1NKC A;  2DTU A;  3K9J A;  3M6G A;  1D9F A;  1S1X A;  3CQX A;  4FWK A;  3Q7B A;  1C0F A;  2LSN A;  4C23 A;  2A41 A;  4W5N A;  4MFB A;  3QEX A;  1QSS A;  3ZET A;  1X3N A;  2G8H A;  4JKG B;  4FJ9 A;  1DKG D;  3FLC O;  3J7Y P;  1KRP A;  1VK0 A;  2V52 B;  1S1T A;  2ASP A;  5K14 A;  4KI4 A;  4QCL A;  4IJN A;  1U6Z A;  3AVH A;  1KAY A;  2XY7 A;  4YOU A;  2P9U A;  4BE2 A;  2HVH A;  3OJS A;  2QKB A;  3W0L A;  4BRH A;  3M8P A;  1D5A A;  3TWH A;  4OVL A;  3NAE A;  1TKX A;  2Z1H A;  1DGK N;  4F2S A;  2G8K A;  3MED A;  1G99 A;  3ATV A;  3SYZ A;  1HR0 K;  3OS1 A;  4O0I A;  1T7P A;  2QA4 N;  5FRM A;  3KK1 A;  3CMA N;  2FBX A;  4GV6 A;  3V9X A;  2Q97 A;  4RCH A;  3OYA A;  3SJH A;  4IOC L;  3HI0 A;  3VGK A;  2IVN A;  1GLF O;  5F0X A;  4U67 L;  1X1P A;  4JKA A;  4I9L A;  4LFC K;  2O8F A;  4AQY K;  2X6N A;  3I0S A;  2QWM A;  5LMN K;  4JKG A;  1SKR A;  1KLN A;  4FZY A;  4FM0 A;  3AO5 A;  3MAQ A;  3TSU A;  3MMV A;  5KI6 A;  1HYS A;  2HBM A;  4KO0 A;  3HL8 A;  1RBS A;  4B1Y B;  4NXM K;  3D2F B;  2XY8 A;  1REV A;  3LDS A;  1IKV A;  4E7L A;  1OH6 A;  3QIO A;  4HCC A;  2PAV A;  4DSJ A;  2F7T A;  3ZT0 A;  4Q5V A;  3PX0 A;  4FJX A;  4PQU A;  4KAZ A;  2E6M A;  4B8C A;  4BWM A;  3U9D A;  1HNW K;  3RMC A;  4CGG A;  3IKM A;  3SCX A;  1WBB A;  2BGG A;  1WB9 A;  4DR6 K;  4OLA A;  1Q82 O;  1IBK K;  4M7X A;  3UKR A;  3G71 N;  4PY5 A;  4BRP A;  3HM9 A;  4CFC A;  1C0U A;  2GUI A;  3L2W A;  4NLB A;  3TR8 A;  4NYF A;  5J2Q A;  5EVZ A;  1IBL K;  3U3G A;  4OPA A;  4QS8 A;  3L4I A;  3OYB A;  4GVE A;  3KLG A;  3CCL N;  4CZG A;  1C0T A;  4FZX C;  3NVM A;  1I94 K;  1WSF A;  3V1R A;  1WLJ A;  4DKW A;  4C8O A;  1BIU A;  1FKO A;  1GLL O;  4BR0 A;  4BGA A;  3OS2 A;  3JYT A;  4JK7 A;  2FC0 A;  3TAR A;  1TUY A;  3S3M A;  3IS9 A;  3ZSZ A;  1BIZ A;  4B08 A;  3M8S A;  1T44 A;  4DTM A;  1JCG A;  4GKJ K;  3C6T A;  3NGZ A;  4BR7 A;  3AO4 A;  3RVC A;  4A57 A;  5DK5 A;  1NM1 A;  3Q7C A;  3FZH A;  3VOV A;  2NZT A;  3CCJ N;  2YX6 A;  3CM6 A;  3MN6 A;  3HPH A;  4DTX A;  3I33 A;  4HWI A;  3MX2 A;  2J4R A;  3WXK A;  3VQ5 A;  1YHQ N;  5AJ3 K;  2ZGY A;  4BR4 A;  4B9S A;  4F8R A;  3CC4 N;  4BDY A;  4DR2 K;  4MLH A;  1F21 A;  1IKW A;  3SUQ A;  1ZBF A;  4KTQ A;  4HTU A;  4CIF A;  4HUG A;  3SZ2 A;  2NRT A;  3DWL A;  1X9M A;  1HKG A;  3NF7 A;  3ZET B;  4YOY A;  2B5J A;  3DLE A;  3P31 A;  4A59 A;  3R6M A;  1MDU B;  2QWR A;  4KPY A;  1XQS C;  1DEJ A;  4Z94 A;  2HHW A;  3NF9 A;  5C12 A;  2E8A A;  3OYD A;  1RNH A;  4CJU A;  3SUP A;  3J81 O;  3CQ8 A;  3VQA A;  4CEE A;  4FK0 A;  5C0Y A;  3BP8 A;  2HF4 A;  1VSH A;  4MQ3 A;  1IJJ A;  4ZHR A;  1FKP A;  4B3O A;  3MDQ A;  2R7Y A;  4NXN K;  2O8E B;  3THX B;  1V4S A;  5BR9 A;  4FWP A;  1Q86 O;  5TKY A;  3TAB A;  2QEX N;  3VF6 A;  4C1N K;  2WUS A;  4CJ3 A;  3VGL A;  1KQS M;  3T7Z A;  3ZSX A;  4DQ8 A;  3WT0 A;  4A5A A;  2F8T A;  4DTS A;  1TYQ B;  4NCA A;  1C0G A;  3AVL A;  3TAE A;  3DLG A;  3IG1 A;  1HNV A;  1JLG A;  4CE9 A;  2HNZ A;  4DTU A;  1YUW A;  3G0Z A;  2VWJ A;  1X9W A;  1B9D A;  4CZH A;  4HHT A;  2AP1 A;  3PV8 A;  2F96 A;  1TL1 A;  3QB0 A;  5C10 A;  4I6M B;  2P9N A;  2ITM A;  3E9L A;  2E20 A;  4W5T A;  1RT4 A;  2QWL A;  1LOT B;  3K5L A;  4DQQ A;  3QFU A;  3CC2 N;  3KJV A;  1J53 A;  3OTO K;  4CJV A;  1S1V A;  3HZ6 A;  4GVM A;  4CJE A;  3OYJ A;  4JI5 K;  4FVU A;  4YHH K;  4PKG A;  5FPM A;  4RG8 A;  2VQF K;  4AH9 A;  3KKS A;  3WQU A;  5AZJ A;  4CEC A;  1TK8 A;  4FWQ A;  1VQ4 N;  1VQL N;  2O4I A;  3AAP A;  3FFI A;  1GLD G;  4WFB L;  4M3Y A;  5AR0 A;  1RBR A;  4IBN A;  4FVM A;  4OPJ A;  1ASW A;  4HUE A;  3O9Q A;  3V81 A;  3P1G A;  4ILJ A;  3SQ1 A;  2HHQ A;  1Q9Y A;  3KK3 A;  4IFV A;  3SBG A;  1ATR A;  2XRI A;  1U47 A;  5C42 A;  1N8R O;  1L3V A;  5FRN A;  2KFN A;  3DOK A;  2FBY A;  4N41 A;  4FW2 A;  3THW B;  2YHB A;  1RDU A;  3L8B A;  4AHR A;  1SUQ A;  4DFM A;  2HBK A;  3ISN C;  4CIG A;  1JLQ A;  3G25 A;  4BRD A;  1OVY A;  2E2Q A;  3OYN A;  1BG3 A;  3VQC A;  3QET A;  1KLM A;  4YOX A;  1BI4 B;  4CK3 A;  4IG0 A;  4YOV A;  2YJF A;  4FWS A;  1NGG A;  4TSX A;  3NVK A;  4WYB A;  2FSN A;  4JI1 K;  3TAP A;  1W7A A;  2DFF A;  4BRI A;  3T3F A;  2FLO A;  3VF2 A;  3RR7 A;  3SQ4 A;  1BQN A;  2H3G X;  4DR7 K;  3C0B A;  4BR5 A;  2WC9 A;  4DV7 K;  3LWM A;  2PBD A;  3VQE A;  4OKJ A;  3S9H A;  1YTU A;  4X66 K;  4JI8 K;  3E66 A;  3H6E A;  3CME N;  1RBU A;  1JL2 A;  3IFR A;  1IBM K;  3DXK A;  4ILH A;  4CZK A;  3KVG A;  3O9R A;  3U4L A;  4M3W A;  2E2N A;  4KB1 A;  1EQY A;  1KVA A;  1WSJ A;  3ATU A;  4FPB A;  3AVG A;  5AQN A;  1TL3 A;  3NH0 A;  2P9S B;  3OA9 A;  4M7Y A;  2VG7 A;  3TI0 A;  1R0A A;  4H0P A;  3OYE A;  2O8B B;  4DSI A;  4B1W B;  3WQT A;  3L4Q A;  4XH4 A;  4KH4 A;  3ZEU B;  4XH1 A;  3I8B A;  4B1X B;  2UUC K;  3AAQ A;  3VQD A;  1K9M O;  1U04 A;  3OVN A;  3SAF A;  3KZB A;  1KAX A;  4KH6 A;  4CJW A;  4DQP A;  4H0T B;  3HST B;  4DV4 K;  4ISG A;  3CIP A;  4Z4C A;  2RF2 A;  5LMU K;  4FLV A;  1YF5 L;  3LAM A;  3VEN A;  3O6W A;  5HRO A;  2Q36 A;  5CYM A;  4X62 K;  1BCO A;  4BWJ A;  3KK7 A;  1LW2 A;  1RIL A;  3DJC A;  2Q0U A;  2FSJ A;  1NGH A;  3WXM B;  1C1C A;  1SL2 A;  2I7P A;  3K5M A;  1VSL A;  2DY4 A;  1JL1 A;  1RDD A;  4KTW A;  3DXM A;  2XY5 A;  3T1A A;  2D1K A;  2VG6 A;  5HP1 A;  1VRT A;  2D0P A;  3KD5 E;  4JK9 A;  4H5V A;  2HNY A;  2B4J A;  5JVH L;  3I0R A;  4BY9 C;  1LWC A;  4M3T A;  3AA2 A;  1QTM A;  4AHV A;  2GWJ A;  3KTQ A;  1HRH A;  3LP3 A;  4IXC A;  2NRH A;  5AQQ A;  2O8F B;  2P9L B;  1HQE A;  2OPQ A;  3M3Z A;  3DXM B;  3SAG A;  4WE1 A;  1VQN N;  4CJP A;  5KQD A;  5CE3 A;  1MU2 A;  2JWL A;  3NH1 A;  3OBY A;  4CHQ A;  4CZJ A;  4AIL C;  1J6Z A;  4KRF A;  1S1U A;  3VA0 A;  3S3N A;  2BDP A;  3WEE B;  3PO4 A;  4O4G A;  5CZ2 A;  4AHU A;  3F2K A;  2IGI A;  1YIT N;  1VHX A;  1NJZ A;  3TTF A;  1OH8 A;  4YNQ A;  1SV5 A;  3QBX A;  2HBJ A;  4CF9 A;  2A42 A;  4MLE A;  2GX9 A;  2W42 A;  1S22 A;  5KPZ A;  4EAH D;  3CJB A;  1LCU A;  3AA3 A;  1LWE A;  3SQ2 A;  4DFK A;  4GV9 A;  3PX4 A;  3K57 A;  2ZWH A;  1WAJ A;  3MN7 A;  3HVR A;  4KI6 A;  1V4T A;  5KTQ A;  1QSY A;  4OKK A;  3VQ4 A;  3TTD A;  2VG5 A;  1XC9 A;  2ZJP L;  3HRG A;  2NLX A;  2X78 A;  3BUZ B;  3QEI A;  3NMU A;  1GLC G;  1KXP A;  3OW2 M;  1L3T A;  2KHO A;  4F4K A;  4AM7 A;  3OYG A;  3MX5 A;  3PY8 A;  3CCE N;  2FBV A;  4M41 A;  2FF6 A;  4Y1D A;  4BR2 A;  4K0K K;  3HK2 A;  1ZBL A;  3ZSQ A;  3A2F A;  4MO4 A;  3GL1 A;  4JI7 K;  4EHU A;  3WUH A;  2D0O A;  3D2E B;  3TSP A;  3VET A;  2EWS A;  3FFK B;  3R8E A;  4CJL A;  3TSQ A;  3ZT2 A;  3SUN A;  1YTA A;  5AQU A;  2CGK A;  1DTT A;  4AF1 A;  5AQK A;  2I7N A;  2BTF A;  4JD2 A;  2W6L A;  5FRO A;  4DTR A;  3HOS A;  1S9E A;  5DMR A;  4JRP A;  3N4Q A;  1GLJ O;  2Y1I A;  4O0J A;  4OLB A;  3BZC A;  3DLB A;  1UOC A;  2D4W A;  3QBW A;  3KD1 E;  3KLF A;  4J2D A;  3LZI A;  5BPL A;  4CI6 A;  1J54 A;  2YKM A;  3NDK A;  1NWK A;  1VQP N;  1NK9 A;  1HJO A;  1VQ8 N;  5HRS A;  1UWB A;  1ILY A;  2G8V A;  4KHQ A;  1QE1 A;  2OPP A;  2GEM A;  1NK4 A;  3ZEU A;  4BRG A;  1KVC A;  1XC3 A;  3AO2 A;  1RTI A;  4ZTJ A;  4WQ4 A;  4CES A;  3KWG A;  3LDP A;  1QVF M;  1IV0 A;  1QZ6 A;  1M1K O;  3SAH A;  4QOZ B;  3EEQ A;  3F9M A;  5EOY A;  4E89 A;  2UYT A;  3QNO A;  5KPT A;  3OBW A;  4CZI A;  5JLH A;  2XHB A;  1HX1 A;  4FO0 A;  4JRQ A;  4HCB A;  4KHY A;  2PZS A;  4DSK A;  4CHO A;  5E26 A;  3O3F A;  4FCY A;  4JI6 K;  4B1U B;  3R3L A;  3FZM A;  3NF6 A;  3T19 A;  5LJV A;  4BC5 A;  3QEP A;  1BI4 A;  4QS7 A;  4MDB A;  3P38 A;  5FDL A;  5BRE A;  1UA0 A;  4IOA L;  3DM2 A;  3VTH A;  2O8B A;  1ZBS A;  2HHS A;  2NNW A;  4OO1 J;  2YNI A;  3ZSW A;  4CJR A;  4FK4 A;  4JEP A;  4C8M A;  3FE1 A;  1VQ7 N;  4BDZ A;  4CCH A;  3V1O A;  4M42 A;  1BGX T;  4DUZ K;  1XMQ K;  3L2R A;  1VSI A;  1JLA A;  1QQN A;  3DOL A;  2ZE2 A;  5AQM A;  4A2B A;  4E7I A;  3JXU A;  2D5R A;  1TAQ A;  3KLI A;  3ZT3 A;  3VES A;  3NHG A;  1BQM A;  4M3U A;  4DU4 A;  4DHY A;  1TVR A;  3ITH A;  1YJ9 N;  2WTU A;  2IVO A;  4WFA L;  3AA4 A;  3IAY A;  4CIE A;  3D45 A;  4IG3 A;  4MDA A;  4B9N A;  1P90 A;  4NYN A;  3VTI A;  4IDK A;  4JI4 K;  1D4X A;  2O8C A;  3UKU B;  2PFU A;  2JWK A;  3VEZ A;  4BRN A;  3K58 A;  4DLE A;  2E1Y A;  4KH5 A;  4BGB A;  3OYK A;  2O8E A;  2HMI A;  1HJR A;  3NH2 A;  1I39 A;  2HHT A;  3VQ8 A;  2DPN A;  4CFA A;  4DLG A;  4PA1 A;  5DM6 L;  4FJ8 A;  4X65 K;  5ADX H;  2YNG A;  3QEW A;  1T6C A;  1UAX A;  5J2M A;  1NGE A;  2GWK A;  4BC3 A;  3QIN A;  3CC7 N;  3FGU A;  5HRN A;  3MWT A;  4N56 A;  2Q3S A;  1WSI A;  3LPU A;  3LWL A;  4IEI A;  3EYZ A;  3K5N A;  3WNF A;  3DAW A;  3OYC A;  4CGF A;  1A5X A;  3QEV A;  3CM5 A;  1Z05 A;  3AVB A;  3K5O A;  1CZB A;  4H0V B;  4CHN A;  1RDC A;  2O4G A;  4DTJ A;  3EZ5 A;  4E1N A;  3D0P A;  3TAQ A;  2OPS A;  5MLC Q;  5LY3 A;  4CZM A;  3UKU A;  3CFP A;  4DCH A;  3VF4 A;  4CD1 A;  1LV5 A;  1YJW N;  1K6Y A;  3CG7 A;  5E41 A;  3V4I A;  2YJE A;  1QQO A;  1NU0 A;  4FJJ A;  4JKF A;  1VQ6 N;  2BUP A;  5BPM A;  1J9A A;  3F73 A;  3BF1 A;  4BRQ A;  4JLH A;  2Y1J A;  3AVJ A;  3H3O B;  4PKI A;  2KTQ A;  3E01 A;  1SQK A;  2YHW A;  4LD0 A;  3G6E N;  5HRR A;  1XHZ A;  2RN2 A;  4E0D A;  1W2B M;  1NK8 A;  2VGN A;  5KGW A;  4I9Q A;  5ELZ A;  5JIC A;  4LSL A;  3THX A;  4AHS A;  3B6P A;  5FPE A;  4DV6 K;  4U7B A;  1EWR A;  4DTN A;  1VSM A;  4HTL A;  1C1A A;  3MEG A;  2ITG A;  2IDO A;  4BQL A;  3PIP L;  3QLH A;  4B8A B;  3AGK A;  3CER A;  3KWI A;  3THW A;  4K8X A;  3FZL A;  1TUU A;  1EO1 A;  5KGX A;  4FLW A;  3SJJ A;  3RMD A;  2OYQ A;  5KRS A;  1ESV A;  3HM8 A;  3O4W A;  2Q0R A;  4BRF A;  3KLH A;  4KHP K;  3CJ9 A;  3CCQ N;  3C7N B;  4OPH A;  4V19 S;  2F8S A;  1LWF A;  1TK5 A;  2NRX A;  3EN9 A;  3RMB A;  4DFJ A;  2YV0 X;  1G15 A;  1NGF A;  3D2F A;  3S41 A;  3ID8 A;  3OS0 A;  2KQ2 A;  3MCP A;  1S6Q A;  4C8L A;  1K73 O;  2EHG A;  3QIP A;  4IO9 L;  3TAM A;  3PSF A;  4JNE A;  5CZ1 A;  4FWN A;  3MK6 A;  1NGD A;  4DR4 K;  3RRH A;  3MXI A;  5BRF A;  2JLE A;  5CR4 A;  3OYI A;  1HNX K;  4L3Q A;  4BDP A;  3CJC A;  3V9S A;  4M3X A;  3WNG A;  1W9H A;  5J2N A;  3K59 A;  2OTL N;  4M3Z A;  5CHI A;  2X6S A;  4J8F A;  3CCR N;  2P5O A;  1Q18 A;  1VSE A;  4H4O A;  1HKC A;  1GLA G;  4NLC A;  1RTH A;  2NRZ A;  3EKU A;  2V51 B;  4K25 A;  2HBL A;  4OX9 K;  3MEC A;  3WEE A;  1YAG A;  2VYP A;  4CVN E;  4DS5 A;  5EU7 A;  4FLZ A;  3TAG A;  2F4V K;  5AQV A;  4F3O A;  3N4P A;  1NGC A;  3CCM N;  5C24 A;  3KKR A;  1EKE A;  1WSG A;  4O5F A;  3CET A;  3CJ7 A;  1YVU A;  5IT9 O;  1NGI A;  1RCH A;  1OKJ A;  2YNH A;  4B9L A;  4LF5 K;  4CHZ A;  3H45 C;  4BRE A;  5GAE P;  1YVN A;  4KRE A;  5AQL A;  4H03 B;  3SV4 A;  3NFA A;  1U2V B;  3UB5 A;  1ZYQ A;  1WAF A;  1NOZ A;  1R59 O;  4FYD A;  4PL8 A;  3U9Z A;  3RSE A;  1SZ2 A;  2QM1 A;  2HF3 A;  4CZL A;  1VQ9 N;  3ULE A;  3V9U A;  3LAL A;  4OGE A;  1NK5 A;  1J5E K;  1RDA A;  4BE1 A;  3DLL L;  3DRS A;  4FW1 A;  2D0B A;  4E7J A;  3VQP A;  3V6D A;  5AQS A;  5LL6 Z;  4CFD A;  4FOE A;  5AZI B;  3H1V X;  2P9S A;  1TKT A;  1FJG K;  4N5S A;  5GAD P;  4C8K A;  3SMS A;  5BRH A;  2IC3 A;  4CEA A;  5AZJ B;  5JLF A;  1EX4 A;  5E84 A;  2FXU A;  1BO5 O;  4CJK A;  4PWD A;  4A5B A;  2EX3 A;  4F9O A;  2YI1 A;  3L3U A;  5BN8 A;  3VEW A;  4FJ5 A;  3HP6 A;  3G10 A;  3VEV A;  3LDL A;  3MCA B;  1QHA A;  2OZS A;  2ATQ A;  4DR1 K;  3SBT A;  3L2Q A;  4A62 A;  1UA1 A;  2QWN A;  5BR8 K;  3WNH A;  3K2P A;  4JKH A;  2O8D B;  3VEY A;  4CJF A;  3PO5 A;  4XEI A;  1HNI A;  1NK0 A;  4WFN L;  1OVQ A;  2G8I A;  2GUP A;  4YDU C;  4ZTF A;  2NRW A;  2OPR A;  4CJS A;  3TU5 A;  4FOI A;  3VEO A;  2FSK A;  3VPZ A;  2Q1N A;  3QIC A;  2KZM A;  3EY1 A;  1KTQ A;  4LF9 K;  3MEE A;  4JI3 K;  3K0S A;  4DFP A;  4KFB A;  1S72 N;  1WSH A;  2RHK A;  4CF2 A;  2A1R A;  4KB0 A;  1BWF O;  3J80 O;  5SZT A;  2PY5 A;  4O5B A;  2QWO A;  3ZYY X;  3NGY A;  2E5L K;  1HUX A;  2IVP A;  2P9I B;  3F5T A;  4J2A A;  5KPR A;  2CH6 A;  1N33 K;  2HST A;  5D3G A;  1A5V A;  3VGM A;  2YHY A;  3AV9 A;  5AQZ A;  3HXM A;  1BU6 O;  1S3X A;  4HUF A;  2P9P A;  3DRR A;  2A6A A;  1FK9 A;  1JKH A;  3SNN A;  1Q7Y O;  4B3S K;  1LAV A;  3L3V A;  1QHT A;  3CJA A;  4KTZ A;  1RTD A;  3H1Q A;  3CFO A;  2NUB A;  2ZQB A;  4LH4 A;  1CXU A;  1U49 A;  3O9T A;  4R79 A;  4K8Z A;  2HMP A;  3VQ9 A;  3T1H K;  4CBU A;  4EFH A;  5JS2 A;  3PUF A;  1YT3 A;  3ZX2 A;  2W40 A;  3H3N O;  5AQJ A;  4RW9 A;  3WXL A;  2CGJ A;  3VN5 A;  5GAG P;  4FLX A;  1JJ2 M;  2NRR A;  1X3M A;  3ZSR A;  3KK2 A;  5T7B A;  2QKK A;  4FWM A;  2DFE A;  1S5J A;  3EL2 A;  3LP2 A;  2A40 A;  1YIJ N;  4WQ4 C;  3RMA A;  1T03 A;  2UXB K;  4MO5 A;  4BRM A;  4BAC A;  3SLC A;  4IJA A;  5AQF A;  2IIR A;  2VWK A;  1E4G T;  4IZ9 A;  4CHP A;  4L8R B;  3RWU A;  4UY8 O;  1NKE A;  4UQG A;  2ZGZ A;  4M63 C;  1QQC A;  4YFU A;  1JLC A;  4DSL A;  3D6R A;  1GOB A;  2QXF A;  4IFY A;  3ULD A;  4O8K A;  4CGI A;  1RGI A;  4PUO A;  3MXJ A;  1C6V A;  5AQI A;  3QNN A;  5CY4 A;  3ZLJ A;  2GBZ A;  3ZSO A;  3K9K A;  4CGD A;  4W5Q A;  3HVT A;  3O08 A;  1T3V A;  4KHS A;  2P1J A;  3JS6 A;  1B92 A;  3DLK A;  3CHW A;  4Z4H A;  3O4N A;  2RPI A;  3VMF B;  4LF6 K;  1Z26 A;  1NG9 A;  1NLV A;  3R9P A;  2W6K A;  3QDK A;  4DMN A;  1S9G A;  1HMV A;  3NF8 A;  3V9W A;  3ENB A;  3OJU A;  1BUP A;  1BCM A;  4N76 A;  1N6Q A;  4CJ7 A;  3AAR A;  3D7E O;  1GOC A;  4FJN A;  5SWM A;  2D0C A;  3LDQ A;  3CI5 A;  1K8A O;  1RDB A;  2UXD K;  4FWR A;  4RTF D;  4NCG A;  5DM7 L;  2BH1 A;  3V1Q A;  1HNZ K;  3QML A;  1E4F T;  3WXJ A;  3EO3 A;  3CJ1 A;  4DR5 K;  1L5U A;  4Y0W A;  4DSE A;  3GBT A;  3F9K A;  1YXQ A;  1IH7 A;  3LP0 A;  4JN4 A;  1IG8 A;  3TAN A;  3VA3 A;  1NK7 A;  1ZBI A;  2ZF5 O;  3U8X A;  4IKF A;  3DYA A;  4ICL A;  3ZT4 A;  4F3T A;  4IEE A;  1K8K B;  4GMJ B;  4FJM A;  3B8A X;  3TPQ A;  3CCV N;  1XNR K;  1ZBH A;  3UE5 A;  3ZSY A;  4XIU A;  3FZF A;  4JKC A;  1GOA A;  4E1M A;  1GLE G;  3JAM O;  4BRK A;  1Z25 A;  1JXB A;  3A8Y A;  3C7N A;  4IDH A;  4BG8 A;  5KQ8 A;  1BL3 A;  3A0I X;  1TGO A;  2YCH A;  3A5N C;  3BGR A;  2VGM A;  2OA8 A;  3O1B A;  4RW8 A;  1JCE A;  2E2P A;  5AQO A;  1BHL A;  4JYA K;  3H08 A;  1L3U A;  3QES A;  4ISF A;  3S3O A;  3AY9 A;  4KBO A;  3HJF A;  4LSN A;  3IRX A;  4IWV A;  2W41 A;  2D0A A;  5BPN A;  1NGA A;  2KLA A;  3DXK B;  4FWO A;  1NGJ A;  4OJR A;  5AQT A;  4B9T A;  3AVK A;  1CLQ A;  1ZXO A;  4C1N I;  2RKI A;  4DSF A;  5TKW A;  4JI0 K;  3KIO A;  4ID1 A;  3O8M A;  3HYF A;  1XI1 A;  2E4L A;  4ID5 A;  3BF3 A;  3LAK A;  5AQR A;  3O5B A;  2UUB K;  3T69 A;  5AZI A;  4DWI A;  1IO2 A;  1VSK A;  1W97 L;  4EP4 A;  1JLF A;  4CF8 A;  3B6O A;  1NJX A;  4DU1 A;  5GIO A;  2GEL A;  4B9M A;  3ID6 A;  3ASM A;  4DG1 A;  3QER A;  4EZ9 A;  1QS4 A;  3I56 N;  3EZW A;  3CPE A;  4CBW A;  3AVN A;  3O4Q A;  4NO7 A;  1N5Y A;  4B9V A;  1VSF A;  4H5R A;  4E3S A;  1KD1 O;  4FJG A;  4A2A A;  2ASM A;  5C25 A;  2E6L A;  3HPO A;  3SPY A;  2X74 A;  3UKR B;  1VAZ A;  3IDH A;  4IO8 A;  4M3R A;  1I3A A;  4B9Q A;  4PHT X;  2P9K B;  3HT3 A;  3VEX A;  4BR9 A;  3J8A A;  2BE2 A;  3EE8 A;  3LM2 A;  5FLX O;  1WOQ A;  1QQM A;  3MN5 A;  1NJI O;  3KHY A;  4BC2 A;  4IFE A;  4DQR A;  3C6U A;  3THY A;  4I2P A;  3NCI A;  3VQB A;  3HBT A;  1WNS A;  4AHT A;  4B1V A;  3HP9 A;  2ZM6 K;  1OH5 A;  5GIN A;  1T05 A;  4H4M A;  4B3T K;  1XUP O;  5HLF A;  4CEZ A;  1SAZ A;  5FPD A;  4CJQ A;  3L2U A;  4O55 A;  1VQO N;  3IMX A;  3LZJ A;  4DTO A;  4FLU A;  5M1F A;  2QWQ A;  3CF5 L;  3T1Y K;  2G8W A;  4CEO A;  5FPN A;  3OYM A;  5HRP A;  4WF9 L;  4LF8 K;  4W5O A;  1ASU A;  3I8D A;  1KC8 O;  4GW6 A;  4ISE A;  4DQI A;  4FL9 A;  3HOT A;  4KV8 A;  3MWP A;  2HND A;  3OHR A;  2ZD1 A;  1JXE A;  4DUY K;  4CD3 A;  4RW7 A;  5AQG A;  5HBM A;  4Y1C A;  3P5J A;  5B8H A;  1Q8I A;  4W5R A;  4H0X B;  5CYQ A;  1KCF A;  4CGJ A;  4AHC A;  3GE1 A;  4C8N A;  1E3M A;  4FM1 A;  2UUA K;  1SKW A;  4H5N A;  3ZSV A;  4FLT A;  4J2E A;  2WFB A;  1EXQ A;  2QXL A;  4LC9 B;  5F2R A;  4EZ6 A;  2RE2 A;  3AVC A;  4JV5 K;  5I9E B;  1HPZ A;  4BC4 A;  3SUO A;  1SS6 A;  4CEQ A;  4F2R A;  4O8U A;  2OCE A;  2GTD A;  1NK6 A;  3AVM A;  1WBD A;  1QZ5 A;  3MN9 A;  3O1W A;  4BQZ A;  3C95 A;  3I55 N;  1ATS A;  1EWQ A;  3CQY A;  4H8K A;  2P9K A;  3GOI A;  4H0Y B;  4CZE A;  1HYV A;  3LL3 A;  1N32 K;  1BA0 A;  2IOC A;  3U3Y A;  2PYJ A;  1JLB A;  1S1W A;  1VSJ A;  2HOE A;  4E1J A;  4E7H A;  3JSM A;  4DR3 K;  4CF0 A;  3P4I A;  2VWB A;  4JK8 A;  4ELT A;  3ULE B;  1T8E A;  1X9S A;  4CEB A;  1Q81 O;  1IG9 A;  1RTJ A;  4KHW A;  1TKZ A;  4CHY A;  2QW9 A;  5ADX A;  2FBT A;  1Z6R A;  5IWA K;  4Z0U A;  4XH5 A;  4JS4 A;  3AA5 X;  4M45 A;  4DV0 K;  2CGL A;  4YOW A;  1A5W A;  2HVI A;  5AFU A;  3M5R A;  3H46 O;  4R5P A;  1Y64 A;  1QSL A; 
#chains in the Genus database with same CATH homology
 3TSP A;  3VET A;  1Q82 O;  4M7X A;  3UKR A;  2EWS A;  3G71 N;  3FFK B;  3R8E A;  3CD6 N;  2QWO A;  4JHD A;  4BRP A;  3TSQ A;  2OTJ N;  5AQU A;  3ZYY X;  2CGK A;  4AF1 A;  3L0Q A;  5AQK A;  2I7N A;  4NLB A;  1HUX A;  2NRV A;  2A3Z A;  2BTF A;  4JD2 A;  4WQ5 C;  2IVP A;  2P9I B;  3F5T A;  3TTC A;  4H5W A;  5EVZ A;  5KPR A;  2CH6 A;  3HOS A;  4OPA A;  4QS8 A;  2HST A;  3L4I A;  4NB4 A;  3N4Q A;  4GVE A;  1GLJ O;  3VGM A;  3CCL N;  2Q2R A;  4CZG A;  2YHY A;  5AQZ A;  2D4W A;  3WXI A;  3NVM A;  3QBW A;  1BU6 O;  1S3X A;  2P9P A;  2YHX A;  2A6A A;  3A5O C;  4CI6 A;  4DKW A;  5BPL A;  1NWK A;  1VQP N;  1VQ8 N;  1HJO A;  1GLL O;  1ILY A;  4DB3 A;  3GG4 A;  4BVO A;  4BGA A;  4BR0 A;  4JK7 A;  1Q7Y O;  1TUY A;  3CCU N;  3CJA A;  4BG9 A;  2GEM A;  3H1Q A;  3ZEU A;  4BRL A;  3O9T A;  1T44 A;  4BRG A;  1JCG A;  4R79 A;  4B1Z A;  1XC3 A;  2HMP A;  4BRA A;  4FSV A;  4BR7 A;  3RVC A;  4A57 A;  2E1Z A;  4WQ4 A;  3KWG A;  3SK3 A;  4CBU A;  4EFH A;  3LDP A;  1NM1 A;  2CH5 A;  1QVF M;  3Q7C A;  3FZH A;  1QZ6 A;  3ZX2 A;  1M1K O;  3SAH A;  2W40 A;  3VOV A;  2NZT A;  3H3N O;  1KAZ A;  5AQJ A;  3CCJ N;  2YX6 A;  3F9M A;  3WXL A;  5EOY A;  1RFQ A;  2UYT A;  2CGJ A;  4GY2 B;  4JKE A;  3MN6 A;  5GAG P;  5KPT A;  4BRO A;  1JJ2 M;  2QI2 A;  3OBW A;  4CZI A;  2NRR A;  3I33 A;  1X3M A;  4HWI A;  3MX2 A;  2J4R A;  3WXK A;  4FWM A;  4FPA A;  4EHT A;  5JLH A;  2V7Z A;  1HX1 A;  1YHQ N;  2ZGY A;  4FO0 A;  3EL2 A;  4BR4 A;  3O80 A;  2A40 A;  1YIJ N;  4WQ4 C;  3CC4 N;  5EXW A;  4MO5 A;  3R1X A;  4BRM A;  5E26 A;  3SLC A;  4IJA A;  4B1U B;  3R3L A;  3FZM A;  4MLH A;  5AQF A;  2IIR A;  5LJV A;  1E4G T;  4IZ9 A;  2F9T A;  4UY8 O;  3M1F A;  4BC5 A;  2ZGZ A;  4QS7 A;  4M63 C;  4MDB A;  3P38 A;  4YOT A;  5BRE A;  3DWL A;  2NRT A;  1HKG A;  4IOA L;  3D6R A;  3VTH A;  1HPM A;  2AA4 A;  3ZET B;  1ZBS A;  4YOY A;  1MWK A;  2NNW A;  3P31 A;  4OO1 J;  4A59 A;  3EE9 A;  3R6M A;  1MDU B;  2QWR A;  4JKD A;  1XQS C;  1DEJ A;  4JEP A;  2ZJR L;  3FE1 A;  4O8K A;  1RGI A;  5C2D A;  1DT9 A;  1VQ7 N;  1JCF A;  5AQI A;  1T6D A;  3C65 A;  4BRC A;  3C6A A;  4Z94 A;  3PLA A;  3LM9 A;  5HOO A;  3K9K A;  3ZX0 A;  5C12 A;  2E8A A;  4H0O A;  3O08 A;  1T3V A;  3JS6 A;  4AM6 A;  1QQN A;  3CHW A;  1M90 O;  5AQM A;  5C0Y A;  4A2B A;  3VMF B;  1YI2 N;  3BP8 A;  3RSE B;  3JXU A;  2WBN A;  2HF4 A;  3VES A;  1K8K A;  1IJJ A;  1NLV A;  2A5X A;  3R9P A;  4DHY A;  3MDQ A;  3FR0 A;  3QDK A;  1YJ9 N;  2IVO A;  4WFA L;  5EY4 A;  2V7Y A;  1V4S A;  3ENB A;  4FWP A;  5BR9 A;  5BRD A;  4BVP A;  5TKY A;  1Q86 O;  2QEX N;  4MDA A;  1BUP A;  3VF6 A;  4C1N K;  2WUS A;  3E9P A;  3VGL A;  1P90 A;  4CJ7 A;  3AAR A;  4JKB A;  3VTI A;  3D7E O;  1KQS M;  3T7Z A;  1D4X A;  3LDQ A;  3CI5 A;  4PKH A;  1K8A O;  4DQ8 A;  3UKU B;  2PFU A;  2JWK A;  4FWR A;  4RTF D;  3VEZ A;  3WT0 A;  4A5A A;  5DM7 L;  2BH1 A;  3VER A;  4BRN A;  1TYQ B;  3QML A;  1C0G A;  1E4F T;  1H1V A;  5JVG L;  3WXJ A;  3EO3 A;  3HSC A;  2QTD A;  5AQP A;  2E1Y A;  3CJ1 A;  4KH5 A;  2E88 A;  4BGB A;  5M1K A;  1YUW A;  4Y0W A;  3GBT A;  4I6M A;  4CZH A;  2AP1 A;  3L6Q A;  1YXQ A;  5C2F A;  2DPN A;  4JN4 A;  1IG8 A;  3QB0 A;  5DM6 L;  1VQ5 N;  5C10 A;  4K41 A;  4I6M B;  2P9N A;  5GIP A;  2ITM A;  5ADX H;  3E9L A;  2E20 A;  2ZF5 O;  3U8X A;  1T6C A;  3ENH A;  4FWL A;  5M1Q A;  1NGE A;  2GWK A;  2QWL A;  2VCP A;  1LOT B;  5C15 A;  4BC3 A;  3CC7 N;  3QFU A;  3CC2 N;  3FGU A;  4IEE A;  4GNI A;  1K8K B;  3MWT A;  1VQM N;  3HZ6 A;  4IOX A;  4IEI A;  3B8A X;  5LJW A;  3TPQ A;  4PL7 A;  3CCV N;  3DAW A;  3BEX A;  3ZX3 A;  4FVU A;  4PKG A;  5FPM A;  1WUA A;  1Z05 A;  3UE5 A;  1MA9 B;  4H0V B;  1ZC6 A;  3ENO A;  4K42 A;  5AQH A;  3FZF A;  4EIA A;  4K43 A;  4JKC A;  3WQU A;  5AZJ A;  4JHD B;  4G9Z A;  1GLE G;  4FWQ A;  5MLC Q;  5LY3 A;  1VQ4 N;  4CZM A;  1VQL N;  3AAP A;  1CZA N;  3UKU A;  1GLD G;  4BRK A;  4DCH A;  4WFB L;  1YJN N;  3A8Y A;  3C7N A;  3VF4 A;  4IDH A;  5AR0 A;  4CD1 A;  2FF3 B;  1YJW N;  4BG8 A;  5KQ8 A;  3A0I X;  3O9Q A;  2YCH A;  4ILJ A;  3A5N C;  2VGM A;  3O1B A;  1ATN A;  2YJE A;  1QQO A;  1JCE A;  2E2P A;  5AQO A;  4JKF A;  3SBG A;  1ATR A;  1VQ6 N;  1QVG M;  2BUP A;  1N8R O;  5BPM A;  4JD2 B;  2P9I A;  3BF1 A;  4ISF A;  3LDN A;  1RDU A;  4BRQ A;  3CXC M;  3AY9 A;  1BA1 A;  4KBO A;  4GV3 A;  3H3O B;  1TYQ A;  4IWV A;  4PKI A;  2HBK A;  2W41 A;  5BPN A;  1NGA A;  2KLA A;  3DXK B;  3W3D A;  3D2E A;  1NBW A;  1NGJ A;  1X9J A;  4FWO A;  1SQK A;  5BN9 A;  2YHW A;  2P9P B;  3G25 A;  5AQT A;  1OVY A;  4BRD A;  3G6E N;  2E2Q A;  5AQW A;  1BG3 A;  1ZXO A;  4C1N I;  3FZK A;  5GAH P;  1W2B M;  2VGN A;  4YOX A;  5TKW A;  5ELZ A;  1HLU A;  5JIC A;  4CBX A;  3O8M A;  4YOV A;  2YJF A;  3CCS N;  3BF3 A;  4FWS A;  5AQR A;  5FPE A;  1NGG A;  2ASO A;  3O5B A;  4U7B A;  3NVK A;  4WYB A;  3T69 A;  2FSN A;  4WQ5 A;  5H1S Q;  5AZI A;  4BRI A;  1W97 L;  2FLO A;  4HTL A;  3VF2 A;  5EX5 A;  2H3G X;  4H5T A;  2P9U B;  3AGR A;  5F1X A;  5GIO A;  2E2O A;  2GEL A;  3C0B A;  4BR5 A;  2WC9 A;  4BQL A;  5HL7 L;  3PIP L;  3ID6 A;  3HTV A;  3AGK A;  3CER A;  3KWI A;  2PBD A;  4ILG B;  3I56 N;  3E66 A;  1TUU A;  3EZW A;  3CPE A;  3FZL A;  3H6E A;  3CME N;  1EO1 A;  4CBW A;  4NO7 A;  3IFR A;  3QFP A;  3DXK A;  2KKZ A;  4ILH A;  1ESV A;  4CZK A;  3KVG A;  4QS9 A;  3CPW M;  3HM8 A;  4YOR A;  3O4W A;  3O9R A;  5AFU H;  2Q0R A;  2E2N A;  3SMP A;  3U4L A;  4H5R A;  4BRF A;  2P9L A;  3CJ9 A;  1KD1 O;  5M1O A;  3CCQ N;  3C7N B;  4OPH A;  1EQY A;  4A2A A;  1NMD A;  4YDU A;  3C6H A;  3ATU A;  2NRX A;  3EN9 A;  4FPB A;  5AQN A;  2ASM A;  3LDO A;  2P9S B;  3OA9 A;  4M7Y A;  2F9W A;  5JMV A;  3J7Z O;  3G4S N;  1NGF A;  1O13 A;  3D2F A;  4H0P A;  3ID8 A;  5AQX A;  3S41 A;  4B1W B;  3UKR B;  3MCP A;  3WQT A;  3L4Q A;  1VAZ A;  3IDH A;  1RDW X;  4IO8 A;  5M1P A;  1K73 O;  4XH4 A;  4JAX A;  4KH4 A;  3ZEU B;  4XH1 A;  3I8B A;  4B1X B;  4B9Q A;  4PHT X;  2P9K B;  3AAQ A;  1K9M O;  3A5L C;  3SAF A;  3KZB A;  1KAX A;  4IO9 L;  3VEX A;  4BR9 A;  3J8A A;  3E9O A;  3EE8 A;  3LM2 A;  4FWN A;  4JNE A;  4KH6 A;  3MK6 A;  1NGD A;  1WOQ A;  3P39 A;  1QQM A;  3MN5 A;  5BRF A;  4H0T B;  1NJI O;  5CR4 A;  3KHY A;  4CZF A;  4BC2 A;  2P9N B;  3CIP A;  4IFE A;  4ISG A;  4L3Q A;  3CJC A;  3EKS A;  1YF5 L;  4WCE L;  1BOT O;  3VEN A;  2OTL N;  3O6W A;  5M1N A;  3HBT A;  2Q36 A;  2Q31 A;  2QWP A;  3O9U A;  4B1V A;  1BDG A;  5GIN A;  3KK7 A;  4A61 A;  1XUP O;  5CHI A;  3E1Y A;  1P8Z A;  1SAZ A;  4J8F A;  5FPD A;  1NGB A;  1VQO N;  1HKB A;  3DJC A;  3IMX A;  2Q0U A;  3CCR N;  1Q18 A;  2FSJ A;  1NGH A;  1HKC A;  3WXM B;  1GLA G;  4NLC A;  4RWT A;  2NRZ A;  2QWQ A;  3EKU A;  2I7P A;  2V51 B;  5M1F A;  1VQK N;  4K25 A;  1GLB G;  2HBL A;  3CF5 L;  3WEE A;  2OAN A;  5AQY A;  3PIO L;  1YAG A;  2VYP A;  2ZJQ L;  5AQV A;  3N4P A;  3A5M C;  3DXM A;  1NGC A;  5FPN A;  3CCM N;  4WF9 L;  1U2V A;  2D1K A;  3IUC A;  1KC8 O;  2D0P A;  3O9S A;  4ISE A;  1MWM A;  3GDQ A;  4JK9 A;  4H5V A;  3K9J A;  3M6G A;  4O5F A;  3CET A;  3CJ7 A;  3CQX A;  4FL9 A;  5JVH L;  3HOT A;  4BY9 C;  4FWK A;  1NGI A;  3Q7B A;  1C0F A;  3MWP A;  1OKJ A;  4C23 A;  2A41 A;  3OHR A;  3H45 C;  3ZET A;  2GWJ A;  1X3N A;  4BRE A;  5GAE P;  1YVN A;  4CD3 A;  5AQG A;  4IXC A;  2NRH A;  5B8H A;  5AQQ A;  5AQL A;  4H03 B;  4H0X B;  2P9L B;  1U2V B;  3GE1 A;  3UB5 A;  4JKG B;  1R59 O;  3M3Z A;  3DXM B;  4PL8 A;  1DKG D;  3U9Z A;  3SAG A;  1VQN N;  3RSE A;  4H5N A;  3FLC O;  5KQD A;  2WFB A;  5CE3 A;  2QA4 N;  2V52 B;  1SZ2 A;  2QM1 A;  2ASP A;  2JWL A;  2HF3 A;  4CZL A;  1VQ9 N;  2QXL A;  4LC9 B;  4IJN A;  1U6Z A;  5F2R A;  3OBY A;  3ULE A;  1KAY A;  4CZJ A;  2RE2 A;  4YOU A;  2P9U A;  5I9E B;  1J6Z A;  3W0L A;  3DLL L;  3WEE B;  4BRH A;  4BC4 A;  5AQS A;  1SS6 A;  4FOE A;  3F2K A;  5AZI B;  3H1V X;  1DGK N;  1YIT N;  2P9S A;  4O8U A;  1G99 A;  2GTD A;  3TTF A;  5GAD P;  3ATV A;  3SMS A;  5BRH A;  3QBX A;  5AZJ B;  5JLF A;  1QZ5 A;  3MN9 A;  3O1W A;  4BQZ A;  2HBJ A;  2FXU A;  1ATS A;  5E84 A;  3I55 N;  1BO5 O;  2A42 A;  3CQY A;  3CMA N;  4GV6 A;  4MLE A;  2Q97 A;  2GX9 A;  2P9K A;  2YI1 A;  3GOI A;  4H0Y B;  1S22 A;  4RCH A;  4A5B A;  4CZE A;  4F9O A;  3SJH A;  3VEW A;  5BN8 A;  5KPZ A;  4IOC L;  3HI0 A;  3VEV A;  3LL3 A;  3VGK A;  2IVN A;  4EAH D;  1GLF O;  3LDL A;  3CJB A;  5F0X A;  4U67 L;  3MCA B;  1QHA A;  1BA0 A;  4JKA A;  1LCU A;  3SBT A;  4GV9 A;  2HOE A;  2ZWH A;  4E1J A;  2QWM A;  4JKG A;  4A62 A;  3WUH A;  2QWN A;  3MN7 A;  4JKH A;  3P4I A;  2VWB A;  3VEY A;  4XEI A;  3TSU A;  3MMV A;  4JK8 A;  3ULE B;  1V4T A;  2HBM A;  4WFN L;  3TTD A;  4B1Y B;  2GUP A;  4YDU C;  2ZJP L;  3D2F B;  3HRG A;  1Q81 O;  2NLX A;  3BUZ B;  2QW9 A;  5ADX A;  3NMU A;  2NRW A;  1Z6R A;  1GLC G;  1KXP A;  3OW2 M;  3TU5 A;  2KHO A;  4FOI A;  2PAV A;  3VEO A;  2F7T A;  4XH5 A;  2FSK A;  4AM7 A;  3VPZ A;  3MX5 A;  2Q1N A;  3QIC A;  3CCE N;  2CGL A;  2FF6 A;  4BR2 A;  3U9D A;  4YOW A;  3IKM A;  5AFU A;  4MO4 A;  3GL1 A;  1S72 N;  3M5R A;  2RHK A;  3H46 O;  4EHU A;  1Y64 A;  2D0O A;  3D2E B;  1BWF O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...