2HTKD

Structure of the escherichia coli clc chloride channel y445a mutant and fab complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synergism between halide binding and proton transport in a CLC-type exchanger
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2htkD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2htkD01
3EDEA 1DBJH 1Y18A 1SJEB 4JRXA 4WEBH 5F9JB 5K9QG 3QUZA 1S9WB 1Z9MA 5DVKA 3NMEA 1OHQA 1FPTH 2BK8A 4HDIA 4XP9L 4BELD 1RVFH 4QXWA 2IMMA 3OG4B 3V6OC 3ZDYF 5HBBA 1LO2L 1H3PH 4LLQB 4PGEB 4NT6B 1KPRA 4U6VL 4J3TA 1LHZA 3SDCA 1WTLA 3MLYL 4WFHD 2VLRE 1K4DA 4APQC 5DD5H 4HWZA 3ROOB 3O6FD 2YPVH 2YPLA 2VKXA 5TDPB 2X4NA 4YQXL 3I84A 2ICWA 5B39A 4QHUB 3IJSB 2YXFA 3FB6B 2FR4A 5DD6A 2GAZB 1DLHB 1YPZB 1DUYA 2Y06L 1OAXH 5I8KH 1AHWA 2DLHA 3C5JB 5GGTA 5BXFB 3P9MB 3VFNB 4CW1B 1ADQL 1I1AC 2HTKC 5DRWA 5EU6B 1JZ4A 4XPBH 4PJ9C 4Y89A 1DDHA 5CEXB 5EBWB 5IB1A 5FFLA 1WVZA 4MSWB 3PP3H 4RFNB 2NXZB 4Y16C 4RAUA 5F7WC 4PJAB 2VQ1B 4LNRB 1A7QL 4U6YA 5DWUL 4Z95L 4IMLB 3WE6A 3IJYB 5IB2A 1YY9D 3CVIH 2IADA 2P49B 2H6PA 4LSQL 4QRPB 2NY1B 1FBIH 1FG2A 5MI0C 1N59A 1DE4B 2JJTC 3VD4A 2I60H 2P48B 5IHBA 2DS4A 4PRPE 4XPAL 2AJVL 4NO5B 2OM5A 3QR2A 5TGBB 1KELH 3MTRA 4M5YL 3QHTC 1IFHH 3T0VA 3MRCB 3IGAB 4MD5B 4RISH 5IHZB 4MLIA 1NGPH 2DQDL 4ETQB 3NZ8A 1JE6A 1J7VR 3FQXA 3V6BR 1P7KA 1V8HA 4XNQB 1A9BA 3MV01 1INEH 2R2BA 3PDGA 4XAWL 2YC1A 3TCLA 4YIQB 3RZCA 3LQMA 2J4WH 3RWDB 3UJJH 2NR6C 1MY5A 5T1MB 2WMPA 2CR3A 5DF0A 3U0WH 4XNQA 3MRIB 4P4KC 3KPMA 3O6KH 1RUPH 3D39E 5IFAL 2AK1L 1U3ZA 1X7QA 4I0KA 4GSDL 1T1ZA 1AGDA 1INEL 3RVVC 2EYSA 3DVNB 4ZO9A 3QRFM 3CUPA 3IGAA 4MD5A 4EQ2A 3ARGC 3FQRB 3AB0C 4LDEB 3HG1E 1AQKH 4MAYD 4ORGA 3B9DA 4IOFD 2EYTB 3LN4A 1MCWW 2WBKA 3AMKA 4X6DE 3BPLC 3QDJA 1FN4B 2BSTB 1FDLL 1I4FB 3C5SB 2BVEA 1J0KA 4WO4C 5D96B 3HAEH 5JIKA 3WO3B 4LARH 1SYSB 4Q97A 3GBNH 2ARJA 3QFJA 1P84J 5FYLL 3S37H 1JZ6A 2BVPB 1GZPB 1OAUL 1F97A 3DX9A 4YIQA 4PIRF 3UAJD 3Q1SH 5IVZA 3UTZB 5KZCB 5LXGH 3H8NA 5KANI 3S37L 5F7UA 4YHLL 1GGIL 3SQOH 5IBLC 1QACA 4B50A 4F8QA 4MXWH 2PF6A 4ODTH 5L7XH 1UM6L 4LPVA 3I50H 1NDMB 5T33H 3EO1A 5CKAA 2HJKA 5EBLB 2I5YH 3HPJB 3H9YA 3TBWA 1AH1A 4L4JA 4OM1L 3MV8E 2Q7NA 3MV8B 1BOYA 1ZLWH 1A22B 5E1HB 4M7JL 4PJ7B 1MCLA 4JM4L 5BRZB 3HLAB 3GRWL 4MJID 5ID0A 1GAFH 2O26U 4G3YH 3O9WB 4FNLH 1DR9A 1GGYA 1NJ9B 1QHOA 4XCNA 2COQA 3G6JB 3O6ML 1A7NL 4HUMB 3VD9A 1MCOH 4MYWB 3QIWC 5B4MD 4Y88A 4RZCA 5DJ8A 3T09A 1J1OH 3B83A 2X4UA 3NIFE 1IE5A 2YPLB 3MCKB 3U4EB 1J0HA 4K3EH 4ELKA 3UTSE 2C4FU 5I1HL 2YRLA 3MCLL 1XGTA 1J12A 1PSKL 3IT8D 5E6ZA 2GTZB 3K8KA 3VXRD 4CN6A 3HZMB 3IDGB 3HHRB 1K8DB 5GSRA 3SOBL 2X05A 1R5WB 1GYAA 4KRPC 2HTKD 5FA3A 2X4RB 4Q6IB 3RVTC 1T0NB 4FABL 4G42B 4JQVC 3GKZA 1S9WA 1SBSH 1RUAH 1MFCL 2ZUWA 1MCSA 1CXIA 1EPFA 5DEGA 4ODXB 5HDOA 2F58L 4R2GC 3DO7B 5C0RL 1PX3A 1T1WB 3HZKB 4MA7H 4XC3L 2CO7B 3WIIH 4N1CA 3L6FB 4D0BB 4LLQA 3BDYL 1L9MA 4J3XA 1FL6A 4C56A 1T22A 2FJGA 5IJKC 3CH1B 5GGVL 2JB6B 1J05A 4G43B 4GO6B 1ZVSB 4KROB 1SJEA 5TPWL 2X1XR 1EUUA 4JFHE 2CMRL 1D5XB 3PG2A 5C08E 4QGYA 2MTPA 3MFGB 3KPQA 2XZQH 3VXSA 1MCFA 4WO4A 1Q9OB 4OFKA 1JZ3A 2C1PB 1T89C 4LVOC 5KVDL 3HFML 4YX2L 3RNQB 3WS3A 1DUYB 3P40A 1ZV5A 1SM3L 5ETUA 3FCTB 4QT5A 2DD8H 2HT3D 5D1XA 3D18B 4O5LL 5LCVL 4FQ2H 4Z7VB 1EHLH 5CZKA 3V0AC 3UPCA 1RHHA 2GSIA 3L6FA 1RUQH 5DMIH 1R5WA 4JN1L 5SV3A 3QXTA 3MJ9H 2FJHA 5TE4H 5ICZA 1AC6A 4XHQA 4FQ2L 3VRLE 4WGVB 1FDLH 4JHBA 1E4KA 3WEXA 1S7UB 4F58H 1MJ8H 1JGDB 5C0CB 3LRSB 3JSSA 1NAMH 1CLOL 5EUOE 3REWB 3T8XB 3OX8A 1TCRA 3ECBB 4JFPB 4M1GL 1PAMA 2EC9U 4HCRL 4ZAKA 2B1AH 4PJ9B 4QO1A 2XOTA 3D25B 3WDJA 1PDKA 3KPTA 5MP6L 5DURD 5E08L 3GM8A 4Z0BH 5DHXB 4PLOB 1TNMA 2AAVA 3UTTB 2D31B 1WAAA 1S5HB 1T7VA 1VEOA 4EDXB 1OLLA 3U36A 4KHTH 2D0FA 2IFFH 4JDTL 1J8HD 3INUL 1BQHB 1WQVT 3DPBA 3AREA 4AIXA 5F7DA 2KDGA 3AS3A 4QXUL 4KRNA 5FYJL 2P5EE 4PGJA 1DBMH 3MRRB 5IEHB 4N0UA 4J4PA 1UA6L 4GRLA 5FEBA 4FQPA 1T22B 4GKSB 3A6CL 3WFCH 4EN3A 5CP7A 3F12B 2XTJB 4NHUB 5CCKH 1LMKA 1BQUA 2D0HA 3QDHA 3DTXB 2R2EA 3RL1B 3PWLA 3UTZA 2Z31C 1IAKB 3K1KC 5TF1L 1U6AL 1MOEA 4GS7B 5DEFA 3D39B 4ZQKB 3K4ZA 2Y7QA 1P4LA 1BJ1J 4OFYA 2MJWA 5KVGL 2F5BL 3DXAB 3ULSB 1JYXA 4ZUSA 4Y8DC 5JW4M 3MC0A 2BNQA 4K8RL 2ADGB 1RZGA 1T7WA 2H2SC 4MQ7B 4MXWL 5GS1C 1NCAL 3C60A 1WFTA 4GG6B 3NTCH 3KLAB 2PR4L 4GG6E 3V0WL 4ZODA 1UKSA 3RIFK 1NLDL 5I1KH 5J6HB 1F6FB 2A74B 1FG2B 4ODBD 5D5ME 4PRDB 4Z7UE 5C0ND 1DCLA 1LDPL 2N7AA 3LN4B 3ILPA 1JV5B 3KDMA 4RGMB 5DFVD 3DIFB 5SWZB 3TA3C 3BPCB 3OKEA 2BVYA 2NY5L 1HXYA 1ODAA 2HRPL 4P2OC 5I75B 1VB9A 4FP8L 3RY6C 4NN6C 5E8PA 1F3JA 4NKIH 5MEQB 5AEAA 1BAFL 4XRCA 2G2RA 2X7LB 2R2BB 3NPZB 4Q2ZA 1A9EA 1T5WB 2X9YA 4F33B 1ACYL 3HC4H 1IZKA 1UM4L 2BMKA 1A4KA 3HUJE 3B9EA 4TNWF 5DGRA 1G7MB 1CL7H 3QXWA 2ITCB 4PJCA 5DMKB 1DZBA 5BV7L 1JF5A 1HHJB 4TUKH 3EGSB 1A9BB 4JANB 1O7VA 3HG1A 4HULB 4Y4KC 5B4MC 5EC1B 2BMKB 3RVUC 4LCWE 1W0VB 1QVOB 1UT9A 2YD2A 1L6XA 3X17A 2F19H 3TFKC 5HVFB 2DKUA 3X14B 1MIEL 3DVFA 5BV7C 5BO1H 4HDIB 1TJIL 1NSNL 3QO1B 2PYFB 3PL6A 4P0DA 1KCSH 4XNXH 4HLZG 5D71L 1DFBL 4HUWB 4HUXB 3H9HB 2YD3A 3BZ4B 4ZOAA 1T7YA 5A2FA 2DQHH 4U49A 4PRNB 3ARBB 4KJQD 2FBOJ 1CU4H 3X14A 5I66B 4JREB 3F7VA 2GTWB 3BW9B 1ED3B 2HLFC 5A3IC 3MBEB 4X6EB 3V5HB 1UA6H 4G6FB 1IT9L 2CKBA 2YSSA 1CTOA 4L4TD 1ZA3A 5A16A 4X7DC 4JGMA 3T0BA 5F1NB 1UJ3A 4KKNA 5EH1A 1KJMB 4M1CC 2HFEB 2Q76B 3D69A 2BZDA 3MV8D 2CLVB 4PRAA 1J87A 4H1LB 3SKOB 4TUJA 1LE5B 3GSVA 2CXGA 3R4DA 3OGOE 4UDUA 2WP3T 2BFVL 1EZVX 1CD8A 4XBGB 3LPGA 2V2XB 1O0VA 2P7TA 1QLFB 1WCQA 5C7XH 4TSAL 3LEVL 1K4DB 4GAJH 4AQOA 2P5WD 5IQ7L 4KK6C 4P46B 1WBYB 4P23B 3NGBB 3QB7C 1KN4H 2DLGA 5JXEA 4OV5B 1IGYB 2VZSA 5D6CB 2PTUA 1ZVHA 3CFDA 1MHEA 1UFUA 3GMNA 4NYLA 4L9LC 4LNRA 3MRGB 1FFRA 4HEPG 1E4JA 3QEQB 3V4PH 1C8PA 3KNBB 1PYWB 5FF6B 5EZLB 3FTGA 2J8UB 4F7TA 4WI9A 1DVFD 4NFCA 5FO8B 2HVJB 3CLFH 3KLSA 3FHAA 1I3RB 1XEDA 3U0PB 3DRTA 4OGAD 3L3JB 1FLRH 3OG6B 3ARDC 3BP5B 3WXWH 1UEMA 1MCBA 3NFNA 3V52L 4X6DF 3FB6A 4ONOA 3WUZA 4WW2C 2B8OT 1CG9B 4FZ8H 3T77B 1EBPA 4RNRB 1AGBB 5LQBH 1I9IL 3T3PF 3PABB 1CFVL 2EE9A 2HWZH 2ED8A 5KTEL 1JWSA 3QEUA 4RGNE 4G7YH 1ZHKA 3LKNB 3GM0A 4JZOB 5TE6H 1NBYA 1U8NB 2H45A 2D2OA 2NY6B 5IOPA 1EEQA 4IRZH 4KMTH 1C5DA 5F44A 3OB0K 4PJFE 4AT6B 2O61A 4YUEL 3HE7B 5GGTH 4JGUA 1AIFA 4D94A 3IRZA 5C0AB 4R7NA 1J0JA 3S97C 4X7TA 4HV8A 3U0PA 5DO2C 3TGXA 2P5EB 1IGIH 1YYLH 1VCAA 3IXTA 5E2JA 4LSSH 2B2XL 2VC2H 3TN0D 3S88H 5A43C 2RFXA 1YYML 2VAAB 5DD0H 2IBGA 4R7NB 1XGRB 4N90E 1W72L 4FFWC 5FCUH 1S7UA 4W68A 2HJLA 4OV5A 4OD2A 3S4SB 2CDGA 5IOPB 2X70B 4JO3L 5FHAH 2ICEB 3WYRA 2WW8A 1FYTA 2VLJA 3MO1B 1ZLUH 3LEXB 1FNSL 5LAXA 5AZ2L 5IQ9B 4MCYB 3PWUA 3KWWB 4EQ3A 1AO7E 1KIPB 3BSZH 4YWGH 2W60B 1BFSA 3BN3B 5E2TL 3QUMB 2UV3A 1RJYA 4LMQI 2VDPH 1GCFA 4MNGA 1T0PB 4ZD3L 1QBMH 5HGBA 1R3IH 5DJ6B 4PGDA 1FL5B 2DIBA 1U91B 1CFSA 2DWDA 3I02B 5C0AA 4KTYA 4MJIA 3EYUL 4NNXA 3S35L 1HWGB 4C4KT 1FIEA 4X4XA 2Q3ZA 4LPTA 3K3QA 1NDMA 1P7QB 5JOPD 5E4EB 3ABZA 1JPGA 4IRSA 3C6LA 5I76A 4EJ1C 1DQQB 5JPNA 4LSDA 2A6DB 2X4QB 5JW4N 1BD2E 1OL0A 2HKHH 2IPTH 2VLRD 1JF1A 3D87B 1MH5B 3MLXH 2AVGA 1I9RL 2B4CL 3VFSB 1RAMA 2RHEA 3O8XC 2D4FA 5ISZD 4U33A 4Z7UB 2MKLC 1G9NC 4AK1A 3OF6A 4RDQG 1UEYA 4PJAF 3CVHH 3LQAH 2D03H 3MCLH 3QUKB 5ISZB 4XMKH 5T5NG 3H7BA 1QRND 2VQUA 2EH7H 4LCIL 3KYMA 4U1LA 4KK5C 3IJHB 4AEEA 1AR1C 2DLFH 5C0CE 2GJZB 1ES0A 1FNHA 3M8OL 3O6KL 5H94B 4MNHA 3VMOA 2HA1A 4OB5L 1OAXL 5I8KL 1CDYA 2F19L 1AGCB 3BPNC 1FCGA 5IFHL 3O4LE 1FFPA 3QBTB 4Y4HD 4WEUD 5BS0D 1ND0B 1JNHA 3LKSB 4I48B 1JK8B 3OJDB 1WBYA 4P23A 4LSTL 1AGCA 1U8PA 1H3UA 4IS6A 5DTFB 2FLRT 2FL5B 4JFDA 3FRUA 4LLWA 4NNYB 1OAKH 2YWZA 4MAUH 1TJGL 3GUTA 4NNPH 4WHTA 5I9QB 5ALCH 4GLRH 5HI5C 3FQNB 3WMSA 3KS0J 5ELIA 1KTRL 4F37K 5DUBA 3BZEA 4ODTL 2Q87A 1IGTB 4UDUB 3V6OA 5C0NC 1T21A 3QG6B 4XH2A 2HLFD 5A3ID 3O6FA 4PRAB 1C16B 4JB9L 2X42A 5HI4C 5LXGL 5FHBL 5EU5B 2WUCH 4KDVA 4JPVL 3PGDB 1BJ1H 2P24A 5BVJA 1ZA3B 4JN2A 5IB3B 2B7DT 2B2XH 2SEBA 5C0FA 2CIIA 4LCUB 3C6LB 2MCPL 5I1EL 3QUYD 3KPNB 4KKCC 1BVKA 3B5TA 4HS6B 1KELL 2Y06H 5D7JC 2AXFB 5DS8A 2ARJQ 5L88L 4R4BB 1U3HA 3G5VB 2BVQB 5HYSB 3FQNA 1X4XA 1CD0A 2W92A 3LKPB 1QLEH 4YXKH 8FABA 4YDJB 1CLOH 5CGYC 2VLMD 3UTPD 2J8UE 5E00B 3REVB 3QDGD 2XNAB 1MJ7H 2YK1L 5AZEL 1FH5L 4XXDA 3UJIH 3IVKA 1CFBA 2YUWA 3AU1B 1HHGB 2AV1A 4G8IB 1G9MH 3QXUA 4GH7B 1NCWH 3RVTD 3T0EA 4PJAA 1IGMH 3OBAA 1CDBA 1KCKA 3DVNA 2X09A 3A6BH 1FZKA 4UTBL 4OT1L 1EJOL 4IRSC 1UKQA 2MPAL 4S1QH 4GG6F 1HYRC 3CDCA 4H88H 2IWGA 4PPTA 3QUYC 4WTWA 1YNLL 2AXJA 2DQEL 5DRXA 5EB9A 2YC1B 5C0JB 4P49A 4WV1A 1N0XL 3KYKH 4HWZB 4NC0B 4GMTH 1DBML 2W60A 4BK5A 5D70H 1Y6KR 3U30B 4N8VB 4MXQC 2OQJB 3LRSA 1UYWH 3EOBA 3RHWK 3RAJL 1A1OA 1F02I 2EDTA 5AZ2H 1NMAH 4LGSB 3M1BA 1GSMA 4XHJD 3IKKA 1I7ZB 3RL1A 2C7UB 4JKPH 5T3XH 1L0QA 5F88A 3RWJA 4OI9A 4P4KA 3WBDA 4Z8FH 1ITCA 4H0IA 1FFOB 3HUJF 3PGFL 4QNPF 3WHXB 1MI5B 4P2RD 3VCLA 1KB5L 1OVZA 4JFXB 3W11D 1EBAA 5L2JA 4ZD3H 2WK2A 4YR6B 1UB5B 5F7DB 4KHXL 2B0SH 3Q6GL 1QR1B 4LHUA 2G9HA 5HGAA 3G9VA 3MV9B 4JM2F 2E9IA 4N0YL 4BSVB 1EAJA 3CZJA 2YXMA 5FOBB 4D2NA 4Z7WA 3UBXI 2Q86A 1S7SA 1YEIL 4ZDHA 4FN0A 4AL8L 1KUMA 2P5WB 5C86A 1KTLA 2DD8L 2E7CA 4UBDC 4U3CA 1IGCH 1KIPA 2ZUYA 1B2WL 2FCBA 3BD3A 4WFFD 3LS5H 1IKNA 1H3GA 4EI5D 4ODVH 1JPSH 2ZG2A 3RPKA 4HWBL 5ICYA 1PX4A 2X44D 3E6FA 4KJPC 4ENEC 1BZ9B 5IB4B 1WUNT 3ARSA 5DYOA 2UVFA 4NQSA 2OTWA 2OL3B 2XACC 1MFCH 2HP4A 1QSFB 7FABL 1K4CA 5KW9L 2IC2A 3DVIA 1ETZB 2OJZH 2F8VA 4DZ8B 2G60H 4NN7B 5J3HD 3JXAA 1I8IB 3MX0A 3BAEL 4J3UA 5KSAC 4OLXL 1NFDF 5AYUL 1FNFA 1QBBA 5CIPB 1UENA 1HCFX 2XWJB 2P8MA 5TPWH 2X4UB 3U7YL 1BZQK 1WZ1H 3N1GC 3LSOA 4P4KD 3FOMA 1RULL 2LFGA 3B2VH 2DM4A 3GMPB 4ZUVB 4KUZH 5F1OB 4DEPB 1AD9A 1IQWL 1QFPA 1PQZA 5TH2B 3R8QA 1B88A 5D6DA 3CXHJ 3O9WA 5IB4A 4CN1A 3VFGH 5FGBC 3ZTNL 1UZ6F 1NCCL 5T1DH 1N7ML 5CZVL 5DRZB 1KJMA 3HI1A 4UB0H 2MQ3A 2V9RA 4MJ5A 4K23L 2BY1A 3OGCB 4UILL 2VDLL 4QXGL 5F7LB 5K9QI 1KCSL 2J8UF 4R97C 5GRJH 1WT5C 2R1YB 2X1WL 3GGWB 4X5XB 4OLUL 5H35B 4FFZL 4PGBB 4ZDHB 3CFEB 4NBYB 3T2PA 3D3VE 1LP9F 3HUJB 2W9DH 3O3BA 5C0IA 4KY1H 5F71A 2VWEC 3MV11 1IC5L 3K4AA 4PJBA 3A6OA 3HAEG 2WQ8A 3IF1A 5E03A 2J8UA 5IJKA 2WV3A 4D0DB 1JRHH 5IW1A 1YEHL 5LGJB 4Y8AA 4ONFL 1J05B 3U4BH 1XIWB 4QEGA 3FO9A 1WWBX 3S96B 3S36L 3L3IA 3DX7A 2EIDA 3MRPB 1K2DB 1YMHB 2YR3A 3WXVH 1Y0LB 4N0YH 5F6HI 4YFEA 5FYLD 4ZFGL 1RUMH 3QIUB 4XNZB 4QTIH 4G8GB 5T1LA 3Q1SL 1FGVL 1T83A 1NDGA 4N0CD 4YE4L 3MXVH 5DK2B 3WFEL 4JFQA 3MOBL 3U0TB 2XQYK 1L7IL 3EDKA 4HBQA 2UZIL 2Z4QA 4A6YB 5MERB 4KV5F 3F62A 5HHQB 2P47B 3ARVA 3TA3D 3L7EA 3ZE0F 2ERJC 4X7CC 4QTIL 4XZUA 3QI9B 2Z93A 5D2NC 4QNPE 3VGAB 1FCCA 4OFPA 4OUUB 5FGRA 1VFBB 3IDXL 1OP5K 2EDJA 2F53A 3MUGB 4NQVB 3L3KA 3HI5L 1OP5H 1FYHB 3MPCA 1S7QB 2GIYA 2NY2C 4FXGA 4XP5H 2CLRA 4YDKH 5E99H 3LH2H 4K71C 1EEYB 4NQVA 4M61B 4XBPA 3TT3H 1FE8H 2E27H 4R0LB 4ZXBD 3ZYIA 4GXUN 1S7TB 5J11C 1PG7X 1FSKB 3ARUA 3W5MA 2AQ3A 4MJ6B 5BO1L 1HQ4B 2AJSH 2OTUB 5I71C 4K2UH 5FGSA 4DAGH 1KBGH 3QWRA 4P2OD 3C09B 3DARA 3T0ED 1U6AH 2I9LA 5DR5L 2AEPL 2FD6H 3FB5B 4E5XB 3TZVA 3CXDL 4MX7B 5DZLA 5GQBA 5F6IB 1CGWA 1DE4A 5HYSA 4M02A 2O5ZL 4NSKB 4O5LH 5KOVC 5LCVH 2IQ9H 2P8PA 3WIFA 5B8CC 1WC7B 2DICA 3FB5A 4PP1C 3HS0B 3VGEA 3BH9B 4JO2L 1YEEL 3OKYA 2EH8L 3DUUA 4PR5B 4IMKC 3OKLA 5FB8B 3BMVA 2CIIB 3PJSB 3UJJL 2EYSB 4M7KH 5J6HA 5INDA 3C5ZD 4NZRH 4MNQB 4I3SH 2BXYA 4JQIL 3DVGB 1EV2E 3F7YA 3QA3B 1PLGL 5DRWB 1FFQA 3ZL4L 2V5YA 2HAZA 3BWAA 2C26A 1OOAA 3GSUB 3FN9A 3AUVA 4JFFB 2XICA 4J6RL 3R8BB 5DJCA 4Z6AT 3WIHA 1MHPL 1RK0A 2JB5H 2WBJC 3TEUA 4ZXBB 2BCKA 5EU4A 2X7LA 3U6RB 4NIKB 5DDHB 3V5DA 5EO9A 4H5SA 4XPFL 2H8PA 3GI8H 4GRLB 5FYLH 1MCNA 3QXAA 1INDL 5E9DE 4I0PC 2BXZA 2C1OB 1A6AA 1QO3B 1K6QL 1MFNA 1WV7T 4H8WC 3BZFA 1JZ8A 4JVPA 2ESVA 5C71A 4RFOL 5MEND 3BPCA 1IGFL 1QFWH 5FKAB 1F4YH 1NCDL 1IEHA 5F9DC 3RY6A 4FZEH 4JJHA 2XFXA 3CSYB 3MQIA 5DD5L 5JPMB 1G6RA 1N3NB 3D25A 3MJ9L 2EDBA 1RZGB 1QLRA 4OGXL 1HH6A 2BHYA 2AK1H 4LSRH 1LP9E 1JHLL 1J11A 3MR9B 4Q58C 4DUVA 1XCQB 4NZJA 3ZT6A 1A6ZA 3JBG7 4YPGB 4RAVA 5D5MA 3TIEB 3FT2B 2IJ0C 3G04A 1OWRM 4QHNB 5KBNC 5IKCA 3WFHB 4JKLA 2L7JA 4Y2DD 1CT8A 1DQQA 5JPNB 1KJ2H 5BVPH 1NMBL 1LGVA 3D9AH 1D5ZB 1JYNA 2R0ZL 4R26L 1SYVA 2CDFB 4M43L 2P5WE 3DSFL 1GC1H 1VEPA 3P9LB 3NPSB 1DBKL 4ZFOL 3JWDL 2OJZL 1KTLB 3BP4B 4X6DB 3FOMB 1T03H 3GSRA 4U2ZA 4QRQB 3G5ZB 1FJ1A 5DMGC 3GMOA 3WHE0 3P9MA 4EUPA 2FSEA 4JRXE 4HG4J 4JRXB 3BPLB 4YHLH 5HYQA 5HHOD 4XCCH 2OZ4H 3MNZB 5I8EA 1KLGB 4HF5H 4R6UA 4JAMA 4R4FL 1ZT1B 1Q8MA 4OZFB 5T1KA 4NC1E 3O4OC 5SWSD 4XBEL 4GKZA 4CVXA 1OD7A 2VLKD 3IAGC 1JGUL 5FO7A 5D70L 1S7RA 2OL3A 4ZS7L 5LWYH 1CDCA 4PTTA 5T3XD 4H26B 3TWCL 2MCG1 1RZ8B 4NRYB 4M7LL 1X5XA 4XCEB 2LAAA 3T0EE 3M17A 3GRWH 1K85A 5ENWB 2FIKB 1M7DA 3U7WL 4F57L 4K3JH 4JFZL 2FJFA 1DSFH 5L9DL 1WISA 1HHKA 2VUOA 1B0GA 1MUJA 2CUIA 3IAQA 4CNIA 4PGZA 1F11A 25C8L 4XP5L 4YDKL 1B4JL 3JVGA 3KYNB 4L3ED 5I74B 4DZBA 3DMMB 2VTFA 2CDEB 3GI8L 4WVRA 5E8EA 3U4EA 4PJ7A 2Y1VA 1ZLSH 4P5TB 3WV0A 4X7SH 4LCWD 3SDCC 2VLME 5ADOH 3PWPB 1BBJA 3GSRB 5IK3A 1VACB 2J8OA 1TDQA 1UWXH 1WJ3A 5C3TA 3DOSA 2GKIA 1IGFH 1QFWL 5DJZA 1HSBA 1TVBA 2VISB 4M00A 4UIKL 3V2AR 4M6NH 3GHBH 2AJZA 3QQ9D 3GB7B 2VC2L 4KK9D 3VFOA 1BGXH 5E8NB 4ZFGH 3GSNB 1E6OH 1S8DB 1B4RA 3EJYD 1HNGA 4JFEE 4LFHG 2GJ6D 3RGVD 3OAZK 3U4BL 4TOYL 2QQLL 1CK0L 4NJAH 1I1AA 2XN9B 4M7KL 2D3VA 4NM4H 5D2NB 5CWSA 5FDWA 3MLRL 5K33A 1PJ9A 4PB9L 3ULUD 3HNSH 3SDXF 1A0QH 5DC0A 2GITA 4GW1B 4Y16A 4OCMC 5HGDA 2MQ0A 2NY3C 4FXKB 1I8KA 3LZFL 5ESAB 1L7IH 4GW4B 4LASH 4FFWD 2ID5A 2FEDC 3EFFA 4LOUC 2JJTA 4X6BA 4HLZH 1UM5H 4ZYKB 3E6HA 4NCC1 3O11A 1KJ2B 4JHWL 4O2EB 2NY4C 4KZEL 3GEWB 1TLKA 1JHLH 1VGKB 3C09C 1MQKL 2R69H 1XR8A 1YEFL 1ZHBA 2XWTA 4L5FL 3OZ9H 4U0QB 3RWFA 1ZWIA 1T20B 3OJVC 1KSRA 4JZJA 4PP2B 1X5JA 1AXTH 2FH6A 3LH2L 3VRLF 4BK4A 4JVUA 2I5YL 4NBZB 2J6EA 2B5IC 2A0LC 2HKFL 2CKBL 4GXUM 1QSED 4N0CC 4ZXBA 5ADPH 4P3WA 3TNNB 1QFOA 3RZCC 3SO3B 2AKRA 4QY8B 2ADJA 5E6IA 2EDNA 1QSEB 2VQTA 4YEEA 1NFDE 3T2NL 4LVEA 3L95B 1KLUA 3QRGL 2IH1A 1KIRA 4UNVA 2R2CA 3PIQA 1MCPH 3WSQL 43C9B 3VJ6B 4JM2D 2R29L 2XWBB 3OKMA 5CEZE 3RWGB 4Z78B 1WWAX 5D7IF 3L3GA 1B90A 4M4PA 3DX9B 5JZ7C 2VXSH 5T1LD 1ZTXH 1OARL 2DM3A 4P5KA 2H32H 4R0LC 4ONFH 4PRNA 3HS0A 4ODWB 3VE0B 3VFSA 4H88L 4NRZB 3LQAC 3EYOB 5L2KA 2YN5A 3VXMA 4Y19B 1J9CT 2IAMC 3B2UC 2BOCB 4YFLF 3TIDB 1HXMB 3QJFA 3Q0HA 3HTLX 5I16A 3T0DA 2DLFL 5HVWA 2I26N 4GKNB 2ZSVB 4LCWA 4R9HA 4POUB 1AGDB 1NBQA 5C0BA 1T3FA 4ODSH 3HZVB 4IOIA 4D0CA 1NC4B 2QSCL 4JPWH 5D5MF 4H8WH 3SKJL 5FO9B 2YUZA 5IVXA 4OZGB 4TOYH 4UOW0 4EXKA 1S7XB 1H15A 2FH8A 4NQXB 4BQCA 2KZ1B 3HFMH 4JQXA 2GEEA 1ZLUK 5KJRL 3MRDA 4TRPH 1I85C 2VDOL 3HC0B 3GK8L 1AFVH 1KTDA 1WICA 5IP4A 5CHNA 5C8JA 2DQGL 3TESA 2EDYA 1FP5A 1JRHI 1CZ8H 4KV5E 1A14L 2GSGB 4HWNA 1BX2B 3ZE0E 1II4E 1T04A 1OQOA 4HIJB 4AENA 1EEZA 2A73A 3KPRB 4K7PL 3V0VB 1NEUA 1NUDA 3KYOA 4KK5D 5I30L 1TZIB 1BREA 5HHOA 3K80A 3Q6GH 2DRUA 1MJ8L 1E27A 4MS8C 4OLWL 3X13B 3P4NB 2XKNB 2ZOLA 4NGHL 4HGMA 4XMPL 1FO0L 5I1LA 3VFRB 5CEYB 1TJHL 5EPMA 4UDTB 3N9GH 3BDBA 1KEGH 4XI5C 1MAML 3FFDA 4KGJA 4OT1H 1CR9L 4NZDA 2WWMD 2LTQB 2HN7A 1WIUA 3TFKD 5I1AB 5E6IC 3D6GA 5BJTB 5D8JL 5F93C 2YD8A 3TBSB 3K8MA 1T66C 5IVXB 4PV8A 2HMID 1WZKA 1MAMH 3EHBD 4R8WH 4ZS7H 1YUHB 4L1DA 4P2QE 1ZS8A 3ULVF 4YHKH 4P2QB 5IMLB 2YZ8A 1OCWL 4OZIE 3HR5A 2F54D 3N50A 5JDJA 1NGXA 4WUUE 4NC2B 5C70A 4HCRA 3BDYH 5JO5A 1LO2H 5GZND 1N0XH 5IG7A 5I1EH 1FVEA 2VXSL 2GUOB 2FX7L 1RK1B 5DHVH 1BQHA 4F7PB 1MIML 4O2FB 2P45B 1SMOA 3L3JA 4BA8A 3SDDC 3TVMA 2B20A 3TT3L 1U3HC 2VAAA 1QPPA 1WWWX 2LV4A 4JO4L 3VWKB 4X99A 2ZWLT 3VFGL 4MA3B 4HS6A 5ACMA 2I07A 3QSKB 3RGVB 4Z5RB 3IXTB 1C08B 1X5LA 4S1SL 5DUPL 2DTSA 4YXLH 4LNVA 4ZS6D 5JUEL 4MQXD 3TVMB 5DJYB 4NYLB 3VD3A 1NEZB 2H2PD 3WN5C 4BQ9A 1YNTA 2XN9E 3ILQC 2FX9H 5D7IB 4Q9QL 5EU6D 4HXAL 3RVUD 4JPWL 5E2VH 3L3HB 2MCPH 1T2QH 2XZCH 1QSEA 2MKWA 5IVOA 3H6JA 3QEUB 4OUOA 1CBVH 1HI6B 4ZFFA 3CCHA 1A1NA 3F7RA 4TTGA 3G5YB 4HS8L 4FMFA 2NY7L 1RIUH 2BJMH 2X2YA 3HE6A 3WLBB 4QYOA 1OP3H 4F9LA 1FO0B 2IPKB 5CD3A 3V4PL 4G3YL 2DQFA 1HE7A 5A2IH 3SO3C 1TJIH 4JZJB 3V0WH 5I1AA 2EDOA 3OKNB 1X5FA 2X4TB 4G8FA 1AY1L 4JDVA 5DJAA 3BP7A 1CDIA 1FNAA 5FO8A 4Z8FL 3EOAB 1ZTXL 2NY4B 4MJ4A 4WWKA 3TA3B 3MV9A 3TYGH 1V3JA 1U8IA 3LEVH 3PHSA 4HF5L 4YFDB 4PJEB 4U6HA 5L88H 5IF0B 4E41A 1FZMB 3RDTD 1EGJL 4LVHC 1TENA 5JA9A 2GITB 4GW1A 4ZPTB 3DX6B 1UZ8B 3VXPB 2IAMD 3B2UD 3QUMH 1R3LB 5DURB 5IHUL 2NTFB 1ZANL 2GK0A 3S5LB 4FS0A 3BE1H 5IWLC 4N0RA 1JF1B 3DX6A 3SCMC 4PJ8B 4BH7A 3TPUA 3LZFH 5AG9A 3IDUA 5CILL 1EJOH 4F7MB 1CDJA 5IR1A 5FV2A 1A47A 2PNDA 2ATKA 5DI8B 1KTKE 1H3WM 1XF5B 2AK4E 3VGFA 5I1IL 1HKLH 2CPCA 1JZ2A 3UZQA 1IM9B 1S5IH 3LRGA 5MI0B 2Q76A 1MQKH 2R69L 4FQJL 2FGWL 4WU7B 4QLRA 4KJWD 3UCRA 3CPLB 5C0BB 4XXCA 5JZ7D 4JY5L 1U8MA 5ESVB 4WU7A 1TFHA 3SDDA 3C6SA 5D93B 4MMZC 2VDKL 3BW9A 5LVEA 5IBLD 2CGRL 1NGPL 2DQDH 2I9TA 3ULUE 3V4UL 3VFPA 4P4RA 1P2CB 4ZFZB 3DROB 4OLUH 5JHDE 3H9HA 4JREC 4G6AC 3EOTH 3UDWA 3ORJA 3ULVE 1MWAL 3O3DB 3S34H 3NZHH 2DYPA 2HH0L 4P3CL 3CFBA 3WSQH 1S7WA 4GSDH 4RBPK 2ESVE 4ODUA 1UZ8A 1D5MB 1NUFA 1DQLH 2CXKA 2OCFD 5C6TL 1ZGLM 5AD0B 5DUMH 5CJXC 4MWFA 2VOTA 1XGQB 3KJ6H 4LL9A 5HI3D 4M6OL 3MLSL 5DMKA 3ZKMD 1OGTB 5C09D 1MRDL 4HK3N 4JO3H 1PG7H 5FHAL 4F9LC 4FG6D 4ODHH 4Z77A 4FTVE 5AYUH 1LP9B 4APQB 1C12A 5IUSA 4Y1AE 3ALPA 2IFFL 4JDTH 5C0EB 3INUH 3W0WA 3EYVB 2Y72A 5E6ID 4RMQA 4R3SB 5DJXA 2E9WA 3RTQD 4FA8A 1JBJA 4NNYA 5IW6A 1UVQB 3QXDB 3TBYA 3TYGL 5KAQG 3DI3B 4JY6B 2R15A 5EA0L 5H2BA 5MEOA 5I17A 1A6VL 4U1JB 1OT2A 3QHFL 3N1QC 4OLYH 1T2JA 4MAYA 4HUVA 1BEYH 1SBBA 4JZNA 1KG0A 4J1UB 2J5LB 4Y4KB 4UUJA 4S2SB 3E6HB 1C5BH 4KU1A 3GJFB 3AXLB 1MVUA 3J7HA 3M45A 3OR7B 5FYJE 5E56A 4Z0XB 1MREL 2X1QA 1RFDL 1F13A 1M1SA 1X4ZA 1JFQH 3GBLA 3ET9F 4K07A 1AO7B 1A6TA 1YECL 1EMTH 3IFOB 1QSEE 4HKZB 1D9KC 2AP2A 4H20H 4XGZA 3O41A 1MI5E 2I25N 4Y19D 3E0GA 1N64H 2DJ4A 3T65A 4PRHE 4R8WL 4HXBL 4LLDB 5DD0L 4EVNB 2P8LB 3L5XH 3U2SA 1J0ZA 3L3OB 4GAYB 4MD4B 1MVUB 5KAQF 4UT7H 2CLZB 3NH7L 1T5XB 3MOAH 3SDAB 4RQQA 5E8DL 4HUVB 5D6CA 3R06B 4XAKE 4OFIA 2HT2C 3Q3GA 5FYJU 1DEEA 2OJEA 2UWEA 4U6YB 3IRPX 1NGYA 2C3HA 3T2OA 4MA7L 4XC3H 4X9HA 1SY6A 2CD0A 2DWEB 2FEEL 3BE1L 3QIWD 4QT5B 5KVMC 4M9OA 1JGEB 5D1ZC 4JFHD 4U1MB 5C9KA 3ZLQC 1RULH 1BJMA 1HSBB 2NZIA 4IDJH 1X5HA 4F7CA 2DJUA 2OMBA 4GRWF 3WKNA 2QKIA 4MA1C 1F58L 2DQUH 3S88L 4IRJC 4X8JB 2P7TB 4NPYB 2AJUH 4FQQA 4Z7NE 2EIZB 3V4VH 3ZSTA 4QRTA 1ZGLB 2F53E 2OK0H 4BH8A 1DLHA 2BNUB 2G75A 2LVEA 2GI7A 5JTWA 1CLZL 3REWA 4FABH 3VI4F 4KDWA 2CKNA 3KPSB 4ZNEE 2PKDA 2ZUUA 4B53A 2A38A 3X11B 1UXSA 2VJXA 1XIWC 5HVHC 2VLJB 4NWTH 5KTEH 3DSNA 1EJ6A 3GIVA 3OKOA 5FK9A 3CDGA 3K4DA 1HHIB 3RVWD 1Q38A 4NQTA 2E7LA 5KVDH 2VLJD 3BSZL 4TSCL 3LS4H 4NQCB 3OKDB 5JIIA 4PY8J 2P8PB 3MROB 4PBVC 3FO1A 1VSCA 2R4RH 1CN4A 2J88H 5DZNA 5EOCJ 5CCKL 1I3GL 3E2HB 3MRFB 2OYPA 1U93A 1NC2A 4LIQE 4JM4H 1BJ8A 4OLWH 4PJGF 3KVQA 3TBTA 2EKSA 5TE6L 1N6QL 4LCYB 1S9VA 1CD1A 3U46A 2O5XL 1YJDL 4OM1H 5I6XC 3BIKB 5GS0C 1B3JA 1AIFB 4U1IB 3SJVE 4POZC 1MWAA 3AFLA 3TT1L 3HNSL 3PHQB 2F53D 1OWWA 2YA2A 3ZL4H 2YN3A 4K2UL 1VGEL 4DAGL 5HHXH 3IDNA 3WNMA 1UB6B 3R1GL 5KSBF 5JMRA 4HG4K 3CMOL 3DHMA 3QIWA 4OCSL 1ZT4B 1MHPH 3MLTA 3QI9D 4YJZL 3DO7A 1CIDA 4M8QA 1DUZB 4PRIA 1Z0MA 4YO0A 5JDSA 4CVZA 1NBVL 4KKLC 2F74A 4U0RB 4MVBC 4F58L 2X5PA 5I16B 4K3EL 4PS4L 5E4IA 2RBLA 3GMQA 1MCJA 5B8CB 1OPGL 1S7VA 3L7FB 4U05A 3PGCB 2A2QT 1KJ3L 4GMSL 2CJUL 4J23A 1MLCB 3L5JA 2ZCKH 5HHMB 1CE6A 1F4WH 3T08A 1Z3GL 3QFJD 3BRDA 2QQKH 2YEZB 4AEIH 4XWGL 4EI6A 1SEBB 5D1ZA 3IF1B 4Z7OE 5FYKL 1YNKH 2BDNL 5EWIL 3OZ9L 1PY4A 4D3CL 4JFZH 4JFED 1RURH 3KJ4C 4BZYA 5EZJA 3Q6FA 1GGCL 3WFCL 5J7CC 3I6GA 3CFJB 3K0WA 5GHWL 2VXUH 5GS1B 3DETD 4XPGL 3NACH 2V7NA 1CFQB 3F5WB 4URTB 1LO0L 3VU2A 5EUOF 4AG4L 4EN3D 2HJKB 1BOGA 4G6JL 2EYRB 3MLTB 5DT1H 1T89A 5D7SH 2D4DA 3R0MA 4W4OA 3HKFA 2ILLA 5LKNA 3AGVA 1SHMA 3BAEH 3KPOA 4U1SA 5H8DA 2VZTA 5GISL 1KJVB 2DQHL 3H9ZA 3WIHL 3WNPA 5DZOA 3OAZH 3WCYA 3NZHL 3U9UA 1NGQH 3RZWA 4G7VH 3QFDA 3RDTA 1DQLL 4Z7NF 2V17H 2WQRA 3WFDH 1CVSC 2P42B 3I6GB 4H1LG 3RGVA 1MHCB 3PWVA 3RI5F 1MCRA 4XNUL 1P4BH 1E4KC 1UZ6E 4Y5XA 4L8SC 5GS3A 5HI4D 3FQTA 2EDKA 5C0GA 4UV4L 3CDYA 1KJ2L 5BVPL 1OAKL 5GGUB 4UOJA 1C7TA 4TYUA 2BNQD 1F4AA 3SKNA 3K1DA 3MRKA 1P1ZB 3VW3H 2NYYD 1AD0B 4YBLB 5IG7B 3RRQA 1N8ZB 3HI5H 1ZEAH 3UEZA 3G9AB 2VQ1A 4ERSH 1EERB 1MFDL 3KHQA 3QAZB 4V1DB 1FZJB 1R5VB 4XVTH 3OKKA 4ZTOH 3MRQA 4NRXB 4AH2A 1YEJH 1RV6X 5I2IA 4FXGB 1AP2A 1HKLL 1S7QA 3P2TA 1EO8H 3LY6A 4J4PD 4WTZA 2AJSL 3ME0A 1OW0C 4HIEB 3GFUA 3ISWA 2AK4B 4WIQA 2YMXH 5I0DA 3CH8A 2FR4B 4HX1A 2ITDA 2EIZA 3SO5A 3O3EB 3CX5J 1FRGL 3P4OB 2F15A 5DLMH 4OAWA 4KAQH 1HQRA 5HGAB 1RIUL 2BJML 2DN7A 3KYNA 1B0WA 5E2UL 3QCUH 3PQYA 3MRHB 1LDPH 4QTHA 4U1MA 3E2HC 1JGEA 4Z0BL 4G8GA 1JTPA 2M2DA 1CI5A 1UQSA 2XA3A 4KMQA 1ZK9A 4GS7C 1UM4H 1CGUA 1NC2D 1EEUA 4AMKH 3OXRB 1OGAE 2V2TA 4OD3L 3WS6A 3F7PC 5C09B 5DK3A 5CUSL 5I6XB 3WNOA 4L3EE 1UWEL 1VERA 2HWZL 2HJFA 4ZPVB 3Q5YA 1ORQB 2OSLB 1AXTL 4IBLT 1Y18B 1XCQA 3GNML 1Q0XH 4P46D 5CEXA 4YPJA 1JPFA 1YEGH 3KPSA 5E9DB 1SEQL 1S78D 2VZVA 1YQ2A 2ITDB 4HMEA 1F4WL 1QZ1A 1M7IB 1AKJA 1TVHA 4Q9BA 1M05A 2R0WH 5E9DA 4XVUD 3GSQB 3ULUF 3CLFL 5EULV 3MGOB 4WI4A 5DVMA 2BX5A 4LASL 1ONQA 2A0LD 4OTXH 3TJEL 1JJUA 5I8OL 1IQWH 4YHYB 3U9PH 1XF1A 4Z7OF 4BZ1H 1AGFB 3H3PL 4XPTL 4PS4H 3HB3C 1XF2B 3MRBB 4HIXH 2NY3B 2FYYA 3RWCB 3G5XB 5J1TC 2C4FT 5FCUL 1IAOB 2BNRA 1FSKC 3TIDA 1A7OH 3O81A 5EA0H 3TO4A 9CGTA 2CK0L 4YNYB 5IBTL 2RQ8A 1MLBB 4PJBF 3SGEH 4KZDL 5L2KB 2JIXA 3V79C 3ARWA 4PJFA 3P30L 4RCAA 5CIPA 1BGXL 1BM3H 4JJ5B 5EBGA 2Y07H 2O5XH 3QZWB 1KB5H 1T80A 1HCVA 3BD5A 1ZA6A 1MQ8A 1TJHH 1RZ7H 1IEAA 3LHPH 4N90D 5BOZG 1MFEL 1Q9KA 2X4OB 5DHYA 5KS9A 1P5UA 1J18A 1A6TB 3B9KA 3MFFA 3W5NA 1EXUB 1UJTA 2AERT 3AB0B 1AXSB 2DTML 2A6IA 2I27N 5DK0B 3ROLA 4HPYL 5D8JH 4G7YL 4MB4A 4HMDA 4M1GH 4OZIA 1OAZH 1NFDB 1SYSA 4KK9C 2NY2D 4UT7L 3P0YH 3GDBA 1FVDA 3FONB 3RPIA 1A6AB 3MUJA 1TPXC 3MRLA 2DQCL 3MNVB 3LB6C 3P11L 3DV4A 1WIOA 3D0LA 2VDOH 1FRGH 1XZ0A 4QRSA 5BS0A 3VXUB 1NCWL 1K5NA 4JFEA 4YHPA 5HPMB 5TDOA 5I1JL 2XRAH 1KOAA 1J5OL 3F58H 5KSAD 4UTBH 2DMKA 4ZMAT 2Y23A 1BF8A 5ESQA 4HS3A 4GRLC 1U8OA 4JPIA 4EN3C 2ORBL 5EOCH 5IW6B 3O2DA 3BUYB 1L0YA 4GAJL 5DA0B 1BQHG 1IM9A 2GJZA 2H26B 4XC1H 5CGTA 4OCRL 3T3PE 2HT4C 3OKKB 5JOFA 1RMFH 1PVHA 2K1MA 4OF5A 1OGAA 4APQA 2VIRB 4DK6A 2J3SA 3RKDD 1KC5L 2NXZC 4Y16B 3CU1A 3DHJA 3VFTB 5HHME 1HHHA 5MERA 3GMRB 5DC4B 2WP3O 3KPSE 2ZCHL 4GRWE 4FQ1H 2VDRL 1R3JA 3ZKND 2BFVH 2O5YH 1PFCA 3MLWH 5C0GB 3KXFA 1MHCA 2H32B 5IIEA 3IFPA 4O2CA 1ADQA 3SPVB 7CGTA 4OCWL 4GRWH 4JY5H 4EI5C 3BXNB 4FP8H 5HGHA 1R24B 5DJ8B 4NHCH 1MAKA 4PJBB 3SOBH 3GMMA 2PCPA 3HUJA 5DR5H 1M6OA 2DQTH 5K9KA 2AEWA 4LCYA 2IH3B 3K81A 1WFNA 3GSNL 1E4WL 1G7HB 1LO0H 3ZKMC 4QHUA 1SY6L 2NQCA 4ODVL 5E5UB 3WNKA 1V05A 4KVCL 3G5VA 4Z7VF 1BD2D 1M7DB 4LP4A 1U8QB 1LO4L 5GISH 1JPTL 1LK2B 4P2YA 4PJGE 2AJ3A 3LN5A 4AIZA 3RTQB 5B22A 5JQ6H 4X9FA 3GBNL 2HG5A 4HWEH 3FZUC 4RGOL 5K9JL 2C5DC 2OI9C 5JNYA 4JY4A 2DL2A 4LEXH 4OCLC 3CZFA 3H9SD 2IGFH 2EXWD 3CC5B 4I5BA 3QEQE 5TQ2H 5D7LB 2RFXB 2ZCKL 4L29A 4FQXC 4L3AA 5ICXA 4F37F 2I07B 5KSBE 3RX8A 1KIQA 1U8LB 3NIGE 3S98A 3EJJX 1VKXB 2ZUXA 4NO2A 3EJZD 1FIGH 1OTUC 1AO7D 3B2VL 1MJJB 4M1DL 5HYJE 2XZAH 2AABL 3S35H 3E1F1 1KCRL 2VNCA 4MJIE 4TN9A 4I4WB 4LDLB 1S9KC 3OKDA 2ADIB 3MREA 4G6FD 3SDXE 4PJAE 3SCMD 1BZ9A 4N1HB 3W39B 2HT3C 3CCHB 1EVUA 4KDTC 1XF2A 1VADB 3HE6D 1G7PA 2VDKH 4HH9B 3C08L 2EDLA 1NC4D 3NFNB 5GRXG 3MRLB 3ZTJH 3TH4T 3SE3A 1IC1A 3D85B 3QPXH 1GC1C 1A6WL 5IM7B 3U7WH 2VITA 3I3BA 1YPZE 1INQA 3HMXL 5BZWA 4FQQB 3QUKA 2Y5TA 5IFAH 2HLAA 3HMWH 1GOGA 5DFWH 2H2SD 1CK0H 4N8VG 5IFJB 4LHUB 4G8GE 3O0RH 3OR6B 4FQIL 1YEGL 3W0WE 2BVOA 3OF6D 4YX2H 4L9LA 3C5ZB 5EN2B 1T7ZA 1ZAGA 4JFXA 1J86A 5ADOL 5J1AB 3BZFB 5FA4B 3QEQD 1TQBB 4LIQL 2FZ3A 1QTYT 3ZT5A 4BSWA 5IMMA 1F8TL 1LILA 4JJ5A 5E1AB 1WFUA 1B0RA 1ZVYA 1CXEA 4WWID 1MPAL 3U30C 1QRNE 5AAMA 1TZGL 1X6LA 3QUML 4Y5YB 4G9FE 4KZDH 1F3DH 5A40E 4NNXB 1TTFA 4UQ3A 1A7RL 5ANME 4JR9L 4J12A 4YBQD 5BZWB 2OK0L 3BPNB 4I9WE 4Y4FA 4HK0A 3EFDL 4BKLB 3OXSA 1OSPL 4V1DE 5DO2D 1M7IA 3TWCH 3ARFC 5J6GA 4MDJA 5HHPB 3MRJA 4GXVH 1T1XA 2WIMA 3PV7A 3W2DL 1CGSL 3LKQB 5IB5B 4DKEL 3MBEA 1UC6A 3UO1H 4B0MM 1MCKA 2W0FB 4YHYC 1RUQL 5DMIL 4YHMH 5GS2D 1L6ZA 4XXDB 1MEXL 1S7WB 3BYTA 5ID1A 3JTSA 1MRFL 4NDMB 4WTXA 4QHLB 5IFHH 2L4OA 3NGBC 4HUWA 3QI9C 3T4YB 1JI1A 1U3HB 4WEMB 4NO0D 4TSAH 4P2RA 1E27B 2QSQA 3QO1A 4X80L 4P5MA 5F9OH 1HILA 3FZUD 4NUGH 5E1AA 4Y5XB 2BSSA 3UYPA 4NO0B 3TO2A 4D9QE 4R90H 3D0VB 1FG9C 5J12C 1Q0XL 3K74B 1H15B 4NUGL 1YQVL 4HPOH 4TQEL 1LO5B 1OB1A 3NFSL 5DGQA 5HHOE 4NKIL 3FT3B 1KTDB 2K7QA 2DQGH 3C87A 3ZZ1A 2NZ9C 5JXAH 4ESKA 3DX8B 2YWYA 4MB3A 4HX1B 3K2MC 1ZSDA 2AI0L 2FX7H 2PXYA 3SE3C 1I9EA 2EZ0C 3QULB 4JZNB 3S6CA 5KSAB 4RIRB 3UTTD 3UP1A 3IB4A 4NJ9H 1KCLA 1K8IB 4LHUG 3DECA 4UT6L 4WV1C 4A6YA 1SVCP 1OTSC 3RVXD 1NMCC 4ZAKC 1F2XK 1A5FL 1Q1JH 3QQ9C 2RJMA 3BH8A 1PZ5B 4YHOH 4RWYH 3ALWA 3RWFB 2BY3A 2QADB 3RKDC 4RFOH 5GHWH 2AXFA 1G1YA 5DS8B 3FQTB 5CSZA 3IKCB 4X0KB 5JW5A 1KN2L 5CSGA 2Z31B 4HKBB 2CRMA 3IDMA 4KK8C 5FF6A 1XGPB 4I9WD 3L3GB 4DOHE 4Z9KB 5EWIH 5F7NC 1I7RB 1CD9B 4UILH 3A6BL 5IW3A 2H3NB 5KG9B 1CDHA 5I1GL 4ZUTA 3O8XA 4OZGE 3SE9H 4IRJA 2HG5B 3P4MA 2OMNA 3V8OA 4UV7H 3SHSA 3QP3A 5E94A 2DLEA 4KHXH 1FO0H 4HSQA 4I3RH 2Y9RT 3W9EA 1J0YA 4XAWH 5CWSB 3RX5A 4MLSA 2DLTA 4K7FA 1HHHB 2NW2B 1NPUA 5JNYB 1QLFA 1DBBL 2JELL 5ITBL 3MLRH 4S11A 1KBGL 4OLEA 1R5IB 5E2UH 5E8OB 3VFWA 1HOCB 4I3RL 3OB0H 1KLUB 5CP7B 1UWXK 4ZUTB 3BEWA 4QOKB 1HEZB 1XF3B 5GGRY 2VL5B 3ARED 3VFOB 3AREB 1RIHH 3DYPA 3TA3A 1MFAH 1D9KD 2CR6A 5HGHB 3O2VH 4Y4HA 1A7PL 2OBGA 1RD6A 5I1HH 5EU3A 2W59A 5ESAA 4WY7H 4JFOB 3GO1L 5FYJH 4MA3A 1JNNL 1X5KA 1XZ0B 4QRSB 3O6FC 3GIZL 4LVNB 3MA7B 4PYHA 4ISVB 4K3DL 2LU3A 1CXLA 5F6IC 4BFIB 4U1HA 4HJJH 5C9JA 3CZFB 5E94B 2CRYA 4ZO8A 5CSZB 1YEFH 3WN5B 5EBMB 3VH8B 1CTNA 1FC1A 2PO6B 5KSUB 3PWNA 2HJLB 4M6ML 5I19L 2PXYC 3MFFB 5KVGH 4FQCL 2JLLA 4WCYL 3TPKA 1MHHA 5D7JA 1IBGH 1G9MC 2ENSA 5IMOB 4Q9QH 5F96H 3UROR 5F1IB 5LGHH 3MZTA 5KS9F 2W9LA 4UT6H 1KF9B 2AJVH 3OTTA 3T04D 2BSRA 4YHIA 3U1SL 1LD9B 1CLZH 5CBEB 4X7SL 4NO3B 3DBXB 2P5EA 1Y6MR 3DXAE 2YKLH 1KNOA 3N06B 2D7QA 2Y07L 5SWQA 3L1OL 3OB8A 2G2RB 1FGVH 1T0MB 2Q8BL 3GHBL 5BS0B 1AI1L 3QUMA 5DFTA 4JDZB 3V9FA 2KZWA 4AJ0A 3GSXB 3LKRB 3HR6A 3EO0B 3N85H 2YRPA 1R3HA 4FTVB 2CRZA 3C2AL 1MPAH 2BNQE 3BIBX 4MB5A 2Q7YB 4NO0A 3O45A 2WBJD 4ODXA 3DX8A 4IIQB 3FFCD 2NPLX 2VDPL 2YBRA 5D9SA 4N0FA 2GCYA 1KCUL 4LAQL 5E5MB 2AGJH 3RX7A 5IB5A 3H3PH 4XPTH 1WK0A 2NNAB 1OTSD 3PWJB 4WHYH 1ZGLP 3HNTH 1IC7H 4M7ZB 3MR9A 3EYSH 2ADGA 2OTPA 4KRLB 5ID1B 1ZA6B 3RNKB 3VFTA 1ZT1A 1XGTB 4U31A 2APTA 5GGVY 3FHQA 4RDQF 4BKLA 1EFXA 3BKML 3PDOB 1EXUA 3MCKA 5EO1B 1Y6NR 4O9HH 5FO7B 4YDVB 4HC1A 2DDQH 4G9FB 5AWNH 4OI8A 5J6GB 4S2SA 4GUPA 2B0SL 2IALB 4GQ9L 4YBQC 3UO1L 1YYMH 3CFDB 3LD8B 1LEGA 5E24E 3ZTJG 4PV9A 1NBVH 1KLGA 1NKRA 1XMWA 5DHVA 1Z9OA 1LEIA 2G5BB 2W91A 4Y4HC 4I18C 4HS3B 1BX2A 1U58B 5DHVB 1LEIB 4HCRH 1RVFL 5D93C 3RFZC 4Y5XC 4NCC2 3PDDA 4A6YH 1JWUB 3TP4A 3BGFC 2X89A 2VLLB 3QEHA 3MRDB 3MLZH 1DBKH 4QKXB 3B43A 3ARBC 4NO3A 3GSVB 4KAQL 1HWHB 4PTUA 3QRGH 5KSBA 4PV9B 4LSRL 3D9AL 3TZVC 12E8L 2APXA 3HB3D 43CAA 2DF3A 1AJ7H 4TQEH 4QHNA 3NH7H 4PJIF 5D2NE 3VXOA 5F9OL 3WEXB 4EVNA 2JE8A 4LQFL 2XKNA 5LBSH 4ZTOL 4C83B 3VXTA 4UQ2A 4B41A 2N1KA 4LPCA 3TN0B 2R0KH 1MHEB 1B6DA 3QH3A 4OZ4B 1I3UA 1Q72L 5MEPA 3SKMA 2IPUG 1S78C 3P9WB 1JWMB 2NNAA 4WFFE 2VN7A 5DLML 2I9LB 2VERN 1D6EA 3IDIA 5HXMA 4R2GD 5C6WH 5KVEL 2EXYD 2YPLE 6CGTA 2ZKHH 5DA4A 5TE4L 3NIDE 3BGMA 1B9ZA 3FO2B 4RMVA 4XCFL 4OI7A 2XIDA 2FB4H 1T1ZB 5C0RH 5EUKA 2D03L 5DJCB 1A0QL 4H8WL 2OXGA 3HPLB 3W0WD 4QTHB 1I3VA 4BJLA 4N8CH 1NMAL 2IG2H 3FN0L 4I0PA 3MBXL 3JTTB 2BCKB 5KS9E 4LEXL 1FYTE 3FT4A 2VL5A 1A6VH 5DEZA 5F9AC 3QHFH 1IGJA 1JNJA 1I8KB 2A6KB 5I1DB 1VADA 5I73C 3VDBA 2GJ6E 2BSRB 4JFFA 5EBMA 3VH8A 2DKMA 4DN4H 5FYKE 4X5WA 3BQUB 1A7BA 5IHLB 2O5YL 3MRKB 4M1DH 3W9EB 4IRZL 4KMTL 5IBUB 3SGJA 5GJTH 2FWOB 2NY0B 4RA0C 1FNEA 1UGNA 4UIMA 1ZWIB 1QP1A 4OIIH 5JORB 4JG0L 3VE0A 4BZ2H 4HFUH 4LLUA 1RIVH 2DKSA 1A8JH 1GAFL 2VLRB 4U7MA 3WXVL 2HMIC 4JRYD 4OKDA 3BD4A 4I18A 4OM0H 3NPSC 4I2XA 2ICWI 4KQ4L 4HKBA 3DI2B 4ISVA 3OPZL 5HY9B 1T83C 2PW2A 3SY0B 4OJFH 2F5AH 2YPVL 5HGDB 4UIMB 5GIRA 1NGZA 4XNMB 5TDOB 3G08B 3O3AB 5DD1H 3S34L 3C2AH 2CIKA 2ATKB 1FAKT 4RFEB 1TTUA 4HFWA 4L5FH 4UU9B 4FQXD 3NAAL 5HY9A 4DCQB 3O2VL 4CVZB 4HLJA 4HW6A 5E99L 5MEQA 4OKVB 1JN6A 1U8HB 1NFDA 4PG2C 4EN3B 2AEQH 4AEHH 4PJHB 3UZEA 4WUKL 5C1MB 4PP2A 3DRQB 1EFQA 3BO8B 3BP6A 5EU7E 3P0GB 3B9AA 3B9KB 4UB0L 2PTTB 2AJYH 4FQJH 5LGHL 2C3VB 4YAQB 5JOFB 3KDMB 2HKFH 1KN2H 3EDFA 1QKZH 4KKBC 1UXWA 1GC1L 4Y1AA 3ZT7A 4JFDE 4QGTA 1PKQA 2QBWA 1RZJC 4K9EL 2BHZA 4QRRE 2IEPA 4CMHC 1OM3H 3MNWB 4NKDA 5MENB 1I7RA 4YGVB 2Z92B 2FWOA 4X5XA 5E70A 4NQDB 5DQ9A 4M6NL 2W07A 2C3GA 2HRPH 1KLFA 1T7XA 3D0LB 5I1KL 4X0KA 3G5XA 4MNGE 4X4ME 2B4CC 3MV7A 5F1KC 4UT9L 2HT2D 1JHKL 1BZ7B 3FONA 3RPIB 1RMFL 3V6ZA 5FYJD 4PJXF 4PJGA 5EC2A 4WRLA 4KVCH 1U42A 2Q20A 4OZFG 3D18A 2YPLD 3EJYC 2DQTL 1T1YA 4HPOL 4CADB 43CAB 2A6IB 2A77H 4LCIH 3HI6H 2F74B 3LEYH 1NAKL 4RAVB 5D5MB 1JWMA 1L0XA 4O58L 4XP9H 3F7QA 1AY1H 1WAAF 4OV6F 4OZGF 1FNGA 1VFAB 4JFFE 4QHMB 4RIRA 3QQ3A 4K3JL 3TLRA 3IDXH 1ITBB 4KJYA 4IJ3B 25C8H 4DZBB 4NM4L 4DVBA 1EO7A 1UKTA 2GT9A 1QQDB 2DTMH 5SWSA 3VXUA 2XG4A 2MWCA 3CLEL 5GRUH 1A7RH 4RMRA 4J2XA 5KW9H 2JB6A 1I8MA 4QCIB 1QSFA 4OGZA 2VABB 4HAGA 4NQCA 3PHOA 1G7IA 5I1CH 4RA3A 3VXNB 3PGFH 1U2HA 3QHZL 1KXTB 4HJGA 5T3ZH 5JLZB 1U2CA 2GT9B 2VLKB 3NFPB 3E3QC 3I6LD 4F7PA 3P4OA 1TTGA 3ARGB 1J8KA 3GMLB 4M5ZH 3BQUA 5D7IE 3SE8H 3C5JA 2ORBH 5EOCL 4OIBA 5HHVH 5JO5B 4ZO6A 4QWWC 2BNUA 3QJHB 5HSFA 3VXTB 1A7QH 1S9YA 4HIEA 3QFJE 1BPVA 1N64L 1YPZA 4QRRB 3MRBA 1CR9H 1Q9OA 4WO4B 3IJSA 3P3YA 3QWOB 1J88A 2WUBH 3O2DH 3NTCL 3GMLA 2NR6D 2NY3D 2AK4D 3DSFH 4X6CE 2IANA 3AVEA 5DJDA 2NY1C 5BW7C 1F45A 2VZ3A 3OAUL 4PGCA 5D1QD 3F58L 1TCMA 4GQPH 1RJLA 3DUUB 3X3FL 3LN9A 4OF6A 1JGVL 3CVHB 1OF2B 5CBAB 1XR9A 5J13B 5I74C 3NFPA 4JFYA 5F3HB 2IANB 5DJDB 5KN5B 3L5XL 1T5XA 1RUKL 5LBSL 1U93B 4PJ9D 3VXME 3BHBA 4AZ8A 3DBXA 2YD6A 3ULVH 1YEIH 5ABDE 3O45B 3GSUA 3SJVD 4I77L 3CVHA 5F89A 4JRXD 4OLXH 3SE4C 5D7JB 4DGYL 4JN2B 5IB3A 1IKNC 3ULVL 2F58H 3FAWA 3PWJA 3MLSH 4D9QD 3P0VL 5IROA 4PJ5E 1GH7A 2EEBA 5T33L 3CFIC 4ZSOB 3VXOB 4FHBD 4V2CB 3KLDA 3MRQB 1GOFA 4NRXA 4F80A 1P4IL 4ZSOE 3L95A 4DW2H 4ETYA 1MFDH 5GRWA 1GGIH 3ZKQD 4EUPG 5E5RB 5FGCB 5LQBL 4F33A 1NCNA 2PETA 2WZPD 4G7VL 1FVCA 4NKMB 4XTRD 1DL7L 1CFQA 3QUYA 1I4FA 3C5SA 3FOLA 5F1IA 1AE6L 2OR7A 5HDBE 5DRXB 4OCYL 4KJWC 4HFWB 1SJVA 4AG4H 4ORGB 5ALCL 3S3SA 1WIPA 2V7HA 4XNMA 1HSAA 4NZRL 3FJTA 2R8SH 5J56B 2A1WH 2DBLH 3MXWH 4IM8A 1S3KL 4U2YA 4FNLL 3QT2A 3OJ2C 1UCBH 3OAYH 4ONGH 1H8OA 2AV7A 5DSCA 2M26A 4I2XB 2Z92A 1JUFB 1X4YA 4IIQC 4HJ0D 4RMTA 5DI8A 1S5IL 4OZIF 3O3BB 2VZUA 2XN9D 3QUXC 4E42A 3MSPA 4RAHA 3MV7B 3RL2B 4KH2A 5DVOA 4M7ZC 3GHEH 4OIIL 2LE9A 1NCUA 2HRLA 1VEMA 2VUYA 3MV7D 1KXQE 4LPXA 3ZHDA 4PJBE 5HI3C 3NCJL 4JM2B 3VJ6A 3CJJA 4ZUWA 3MOBH 4N0FB 1QEWA 1XGUB 4S0SD 3GUTB 3WIHH 5AD0A 1VHPA 2IMNA 2ZCLH 5A1AA 5GS1A 4P57A 3UXFA 3ESVF 5C9JB 5H37G 1NGQL 4Y1AB 4Q9CA 3JV0A 1JNHB 5IVXF 1JP5A 3BMWA 3QPXL 3U7AA 5ESVA 4M48L 2E7MA 3DMMD 1PZUB 1TETH 4V2BA 4WUUD 4P23D 4UU9A 1R24A 4MNHB 2BC4B 1E6JL 4NQDA 4XVSH 4DKAA 3NCMA 3ULUH 1H3VA 4GMTL 5C07D 1J8HB 4PRHA 1MF2L 4P9ML 3IJHA 5SWQB 5K9KB 1FFPB 3T0XA 4DQOL 4IJ3C 1FHGA 4YHOL 1VFUA 3TVMC 4G8EB 4ZUWB 2V7NB 3UZVB 1G7JB 3V4UH 1OGTA 4QF1A 1QBAA 4HK3J 5KSAA 4DGVL 4K23H 5IROC 1FAIH 1KENH 3CFJA 3IKCA 3H7BB 2A9ML 3PL6D 3RIAF 3LS4L 2E6PA 2PYEE 5EOQL 3H9SB 1QOKA 4PUBH 5IEKB 1MEXH 1LO3L 4LMQE 4JM2A 3BRFA 4EDWL 3CVHL 3LQAL 5SV4A 4HXAH 2AJXH 3VGGA 4U1NA 4MDIB 3D0VA 1HYSD 4N9GB 4XBEH 4P4RB 4KTDL 4X99B 1JPST 5M7QA 3CIQA 1NAMA 1BBDL 1AHWB 1SJXA 2IH3A 1FLTX 5HVHB 1RU9L 2VISA 1XR9B 1JMXA 2PW2B 3SY0A 2Y36L 3F65A 3EOTL 2VDMH 3BI9X 1BIIA 1NAML 4KHTL 3QDMB 3R0NA 4Z76B 5FECA 4P5TA 2OJEB 2DIJA 4LLYA 4XCYB 5MEPB 5F7HA 5IMKA 1OW0A 2DQFB 1RI8A 3BEWB 4QOKA 4XCEA 1EHAA 4RGMC 4PJ5A 5AUMA 5IR1B 5E8DH 4I0PB 4GW5A 1LK3H 1CFVH 4PGEA 4L1HA 1DN2A 1ZLSL 3BESR 1AKJB 4EBQL 3VXUE 1IGCL 1CXFA 1CD1B 3KYAA 3QUZB 4PLNC 2E3VA 4M7LH 2QHRL 3S4SA 4WV1B 2RAMA 3MRFA 3QEGL 5C2BL 4F57H 1A3LL 2QEJA 4ZG1A 3OAYK 5KG9A 4JG1H 2GK2A 1LEKB 3U48A 4U7KA 5CMAB 4XMPH 1DEEB 2UWEB 3Q48A 5J3HC 3VWJB 5F89B 2UWEE 3ARDB 4HPYH 4JG0H 1YN7A 1TQBC 3KPSD 1IAOA 1UQSB 5ID0B 4E41E 4UQ2B 1ZHKB 1DJSA 4L4VE 2PXYD 5C0AD 3JWNC 1B2WH 3HZYA 3KS0H 3STLA 2NX5A 1M71A 1QG3A 4X8XA 4UIKH 1R0AH 3S35X 5MP6H 3HE6B 5GRVK 2YA0A 4ZFOA 1SMAA 3D85A 3NIGF 2AJUL 5IESH 3I3DA 3ARDA 3LKQA 4N9OB 4F3FA 2VXTH 4KRMB 1R0AL 3RIFF 2F8XC 3ULVC 4WW2A 1TZHA 3VXUD 1N5AA 4AEFA 3OAUH 5IKCB 3UYRL 1JIBA 3WKML 4JM2C 5E2TH 4OCXH 3MMEB 3SKJH 3HCVB 2ZUQC 3MGOA 3QDME 2VXTL 3ULUC 4LCWB 1UB5A 1QBML 1G7QA 5KS9B 5CEZH 3F7VB 3BN9C 4WDIB 3OKLB 4XB7A 4ODHL 3TO4D 2Q1EA 2Q6WA 3BKMH 3PXHA 1JNLL 2HVJA 1I1YB 5EOTB 2ADFL 3DJ9A 2IQAB 3STLB 4HMCA 5CEZL 2Z91A 4J8RA 2AJYL 3QXAB 1MJJA 3UJTH 1P6FA 4JO1L 4I1NB 3I6KA 3DROA 4HHAA 3T4YA 4KC3B 5DFVC 4BUGA 2Z91B 1XFPA 5D71H 4P5KB 2XQBH 2VDQL 3V0VA 4WJ5A 2R2HB 1NLBL 1YPZF 1I1YA 3RHWF 1SQ2N 1IKFL 3WO4C 3EO0A 2Q6WB 4NFDA 3S3JA 1MF2H 4P9MH 5IM7A 1HYSC 5FGCE 3B5HA 4NZTH 1KACB 1A3QA 2CLVA 3P73B 5CHNB 1U92B 2RB8A 4W6XB 2XI9A 3FN3A 2ERJB 4G9FA 4MDJB 3WNNA 5HYJD 2OS7A 3KJ6L 1FZOA 3GZKA 5EC2B 2DYPB 4Q9RH 1MJUH 1FH5H 3V5HA 4F7MA 3BZEB 4EBQH 1R3HB 2KQMA 4FTVA 4HC1H 3PWPD 4GKNA 5MEOB 3QCUL 4CU6A 1I8LC 1KCVL 1MRDH 4Z7UA 2O93L 4JDZA 3WL9B 4DTGL 4DWHA 1UJ3B 1A2YA 1NCBL 1P1ZA 4IOIB 4X7EC 3C6LD 4G9DA 1KPUB 4NZUH 1A3LH 2CRIA 1WEJL 3Q6FB 3UC0H 1U8KB 5C0DA 5EZJB 1HXYB 2QADC 5EIQA 3LDBC 4WCYH 4F2MB 1ADQH 5F72S 2OL3H 3VFMB 3FRPG 4HKJA 3O8XB 3WD5L 4NQED 1H3XA 5CSBA 1H5BB 2VR9A 5D1ZB 3BXNA 4PJDE 1UH3A 5C92A 4JHAH 1MAJA 1YMMD 3VI4E 1DLFH 3QFDB 3RDTB 1H5BA 1FNLA 4G8EA 2MMXA 4M6AA 4UINL 3DV6B 2PTTA 3KXFB 1KB5B 1NBZB 3B3IA 3VD7A 5IWLA 2AEPH 2FD6L 1G7HA 3SCMA 4QOKE 4DVBB 2A9NH 4U1SB 5DMJB 1UXWB 1YY9C 1PZ5A 1AC0A 1PBYA 5H35A 1UCTA 1JFQL 2Z93B 3N85L 2N4IA 3U9UB 3OGCA 1TJGH 3ZKXC 1IFHL 1DQTA 4NKOA 4HD9A 4AIOA 2W0LA 2VXUL 4K7FB 4MXQD 5IT2L 5BV7H 5A2LH 3RTQA 1YEDB 4V1DA 4ELME 1ND0A 4FQXB 3H9SA 3CX2A 5DJZB 15C8L 5HHQA 8CGTA 1BIIB 3DV6A 5EUKB 1XIWA 1DQDH 1HZHL 2R9HC 4PY8I 1FIGL 1RIVL 1ES0B 4HGKC 3QDGB 4P23C 4OF7A 5D7SL 1AQKL 2E9JA 4PJHF 2UVEA 3NABH 1N6QH 2YPKB 4MS8D 4L8SB 1YMMB 3MRPA 4XWOC 3VFWB 5C6TH 1CU4L 2NX5E 5BCAA 1B0GB 4KFZC 1JUFA 1W0YT 1H9VA 4X6BB 5LGJA 4P9HC 1A1NB 4G9DB 3S37X 3SKMB 1Z0NA 3IDMB 5IIEB 3LMJL 4OFVA 4XP1L 2ICES 2R0LH 3EBAA 3FO0L 4R90L 5J1SC 4CAGA 2ED7A 5SX4I 4FQXA 1RUPL 3HR5B 1HI6A 3WFBH 2Z8VC 3DMMC 5CFHA 4RFNC 2Y7QB 3RY4A 1JWSB 4U6HB 2BRRH 4GKSA 5B38A 4NOBA 1NFKA 4IEFB 1DQMH 5LG1A 4WW2B 1QEWB 1XGUA 2UYLB 3AS2A 2V5TA 3TBSA 3WUWG 1N6UA 2ICWJ 2YUXA 1YNTB 5TQ0H 2RR3A 3GI9H 3QNXB 3ILQD 5DJAB 3E3QE 3VD5A 3I9GH 3C5ZC 4XCCL 3L3HA 2R2HA 1CGVA 4O02L 1F4XH 4JG1L 4F7TB 3VGBA 1FO0A 3AAZA 2FGWH 4W70A 2DI8A 4PD4K 1MSPA 4DOHB 4U1IA 4JFFD 3BIKA 2VXVH 3FOLB 2XA8L 3TBVB 5EU7C 2A83B 2I24N 2FZ3B 3LKNA 4NDMA 4M7LT 3HNVL 4OZ4A 1IJ9A 2VLRA 3CXHK 2Y6SD 2ZSWB 1JCKA 1IRAY 1CG9A 1X9QA 4FQ1L 1BFVH 3K7UA 4OD1L 5DRNB 2BDNH 2JCCE 5IFJA 4JLRB 3TO4B 4R4FH 4XT1C 5IJVB 3TM6A 3D3VA 1HH6B 4EIZC 4XP4L 1KB9K 4OLVL 2K3TA 3RL2A 3W81A 3MJ8A 4PG2A 1FVCB 1G7QB 4NKMA 3UAJC 4H1LA 4NWUL 4J3SA 4MVBD 2R8SL 3MBXH 4YBHA 4Y4FB 2Q86B 2WLZA 5I18L 4PJDF 4Z7WB 5AG8A 1IL1A 1CQKA 5I8CA 2JIXB 3MLPA 5MHSD 1Z6JT 1N5AB 3JTTA 1IEAB 3VXRB 4YHNB 3IXAB 1BBDH 3ARFD 4PJIA 4I77H 3DYMA 4A2LA 5CAYB 1M05B 4OIAA 2UY6A 3GSXA 3LKRA 5CINL 3ARXA 4ZTPH 4R96B 5DMGD 3EUUA 1INDH 4X6DA 1ZS8B 3N9GL 4LRIC 5DQJB 4P5MB 3P9LA 4DFIA 4XBGA 5FV1L 2FYYB 3RWCA 1ZEAL 1FVDB 5I0ZA 3QHZH 2JJWA 3ZYJA 4P4KB 1U36A 2N56A 2EDEA 4LFHD 4YUEH 3TN0A 4CBPA 3JWDH 3OKMB 4BSJA 5IJVA 3ZDXF 1YN6A 2ZJSL 1AO7A 1OAYL 4M4RA 4PTTB 1RZ7L 3LHPL 4D8PB 4HJGB 2DAVA 2EE2A 4OAWB 4KI5C 3MJ8B 1AI1H 4S1RL 5F3BB 4L3CB 3AS1A 2NY0D 1KV3A 3KYOB 5T1KB 1W0WA 4PJHE 3U82B 5E4EC 2VABA 1HN1A 3BN9D 2VE6A 2DQJL 4YHML 1FNGB 1VFAA 4QHMA 4F7EB 2EE6A 4QF1B 4O00A 1S9YB 4PTUB 1QNZL 1I8MB 3NA9L 4L4TA 4WHTB 4W6YB 2JCCB 1WSST 2CK0H 4PJFB 3QXDA 1QSFD 3AXLA 2QSVA 4GXVL 5FKPA 1O5DT 3QIBA 4Y5VA 35C8H 5KOMC 4N8PA 3VXNA 5HVGB 4OQTH 2YMXL 1ZXQA 4ZNCD 3MACL 4JPKH 1ZLVH 4H20L 3V6ZB 4R96A 2OI9B 3ZKNC 1A7NH 3FAXA 2NCMA 1KYOK 3VA2C 1E28A 3Q3GB 3PHOB 3O2WH 5T1MA 4MDIA 1RSFA 4OZGA 3VWJA 4YDJA 3IXAA 4L29B 2SEBB 5C0FB 3WO4B 2R29H 4HUUB 3W0WB 4G6KH 1UG9A 3ZYOA 4HUNB 2UWEF 4ETQA 5JW3H 4D9RE 2XYCA 2JTDA 1MJ7L 1UWEH 2YK1H 3UJIL 5GGVH 3FFCA 5KZCD 4G80A 4MNQD 1RJZB 3JWOH 4GMSH 4NM8H 1KJ3H 1DLFL 5FDWB 4PJDB 4OCNC 2YUVA 3IDYB 2HTLC 4XPHL 1R5VA 4KI5F 5I15H 2UZIH 3HRZB 1L7TL 4MWFB 3PQYE 5JLZA 4GW5B 4LIQH 3WIIL 3KXFE 1E4XI 2H6PB 4K3HA 1CQYA 4IOSD 4P99A 4RGNC 3STZB 4DKFH 4WWKC 3RY5A 4UI2A 5J8OA 1G1CA 4LGRB 2ADJB 5T3ZD 4WHDA 1XGPA 4RAUB 3O4LA 1EMTL 3LDBB 1JPTH 1XGYL 3CC5A 4I5BB 4PJIE 5IT2H 3PF2A 4O02H 4MJIB 4GG6A 1VACA 2CKBH 1NANI 1G9NL 1S5HA 2AW2A 4JFOA 4ZAKD 2X4TA 3NABL 4G8FB 4UNTA 2XKSA 3QDGA 4KJYB 2V7HB 1KGCD 1P7KB 5DEFB 3GGWA 1WITA 2MFNA 2VL4A 4ZAKB 3HA0A 3QNXA 1VKXA 3BKJH 3O11B 3MRIA 4M7JH 4KQ3L 4OB5H 4JHWH 3QUYB 4KGLA 4M8VA 5GJSH 1I3GH 1I9JL 4NHCL 1NL0H 3NCCB 2NY7H 4OFYD 5D2NA 1NDGB 5E8NA 2W0PA 4QXTB 3HC3L 3NZ8B 2ICEA 3NIDF 4ONGL 4AYFA 1CL7L 1U8HA 2JB5L 5CP3H 5E7BA 3BX7C 3C60D 5ISZA 1BWWA 1I9JH 3RGVC 1YMHA 3ZDZE 1P4BL 3WN5A 3HRZA 3B9KC 1CE1L 3P11H 4LF3A 4OQTA 1JI2A 1SY6H 2UZYB 4X5WB 4PJCE 4UBDD 2VKWA 5ETUB 4BUHA 4BFIA 3OWEA 4LRNL 3BUYA 2LU7A 4DCQA 3QCVL 2N7BA 5FM5M 4QRPA 3WHE1 2NXZD 1P2CA 5FHBH 4ZFZA 3MACH 4JPKL 4KVNH 4DJMA 2QQNH 3PGCA 1NGZB 5EU3B 1A4JA 4P2OB 3SDCD 5B8CA 1FFNB 3V6FB 4MD0A 4NCDA 3AM8C 2CUMA 2H9GB 1RJYB 4S1RH 4WHCA 3HPLA 4OCRH 1PW3A 1F58H 2DQUL 4GLRI 3PWLB 5T1DL 3VA6A 5L9DH 4HKJB 2QQNL 3DV4B 4TNVF 1NBYB 1EA9C 3CVIL 1CFSB 4LSVH 4C56B 3I6LE 1G6VK 1I1FA 1MCHA 2V2WA 2X89D 1F3RB 4NN7C 4PLJD 3VWJD 4N8CL 2J6EH 1QSFE 3IDJB 2PN5A 2GQHA 1ZHNB 1A5FH 1AXSA 1Q1JL 2C4XA 2G75B 4NM8L 3VDCA 3MNVA 4PJ8C 5D7KE 5FYKH 3CU7A 4MCYA 3JV6A 5A2KH 2JJSC 2VWEE 3QIWB 2UUDK 1KC5H 3RUGF 4NN6B 1XT5A 2P8MB 1B4JH 5GRJL 4OJFL 5DMYA 2VDQH 3SKUD 2GJJA 1V3MA 1G6RL 1I1AD 3BRGC 5T3XE 1QR1A 3V7AE 1CICD 2WM0A 5FUZH 5EZIH 3L3IB 4PJEA 1QNZH 4FQLH 2K9UA 3C8DA 4Z7VE 4GBXA 4M9PA 3MROA 4BSWB 4BZ2L 4CMMB 5CINH 3G6JA 5EOTA 4D0BA 2R0KL 5DYOB 1U8OB 2X40A 1NC2B 4LHUD 4ELMF 5DK0A 2FSEB 2B39A 5HD8D 2IBZY 1F2QA 1K4CB 4NP4H 1RZIA 2ARWA 1D5IL 5J06A 1RHFA 4C56D 4DUWA 3LKOB 4GKZB 4CVXB 4GOSA 1U58A 3DNKA 4RWHA 5FM5O 1NGYB 2DBJA 2GHWB 4DW2L 5BJTA 2CO6B 1VESA 2Z9TA 4TTDD 3MV7E 1W0WB 1T1XB 2LQRA 1I3RA 3OR7A 2Q3AA 2FATL 3FT4B 3NCEB 4QRRD 1TZGH 4RMWA 1BQSA 5I8CB 1C5CH 5JMOC 1BF2A 2YSSB 1A6ZB 3ZMRA 1NEZA 4F9PC 3O4OB 2FIRT 1B0RB 5F8QC 1NCCH 4LP5A 3IVKB 3ARBA 4PJXE 3QDJD 1LEGB 1FFOA 3WHXA 3BISA 3VG0L 2OP4H 1RZIB 4JO1H 5ILTL 3WIFB 2YD7A 1WLHA 3B5GA 2NLJB 2XPGA 1SM3H 4IDLA 5BQ7A 1D6EB 3IDIB 2GSGA 5FOJA 3V5KA 3VWKA 4TRPL 1CFTB 2Y4SA 5EO1A 4TULL 3AM8A 5DQJA 2NLJA 2XPGB 2A77L 1JWUA 1BFVL 1KG0B 3KPRA 4WFGE 3RJDA 2IALA 5T1KD 1YECH 1W0VA 2YHGA 5F3BA 3F7YB 3QQ3B 5E9DD 2G5BA 3BKCH 3C08H 3V5DB 1CGXA 4YC2B 4LAJH 3LMJH 4NWUH 4XP1H 4CADA 3CLEH 4MZ3A 5IESL 3LN5B 3FMGH 5ISZE 1IT9H 2ATPB 2VXQH 4ALAH 4FRWA 3RUGB 2JJSA 3IDYC 3BGFB 3D2UD 3UTSA 4LLYB 4PB0H 2J8HA 4J6RH 4Z95H 1HHGA 5C7XL 4UAOB 1AP2B 1OCWH 1ACYH 3HC4L 3U9PL 1G7PB 2LAGB 4YHZL 4K94C 1D9KA 5E6YA 5IMKB 4XPGH 1NAMB 4EDWH 2XQYG 5KSUA 4XVTL 4CUCA 2XKUA 3F8UB 4CVUA 2D9QB 4EEEA 1FLRL 2R0WL 3QCVH 2ZUQB 3BH9A 1V5JA 2J2ZA 2W65A 1G7IB 4LDOB 1MI5A 1M7XA 2BOCA 4OTXL 1FQ9C 1JL8A 1A4JB 1CYGA 2A83A 3QWRD 4P2OA 5JOPE 4WI6A 1UM5L 4X6CF 2ZPKL 2FLBT 1OAUH 2X9XA 4JY4B 3PQYB 3WJLC 3FFCE 4WHYG 1UWGL 5C6PB 5E0QA 2Y6SC 4YDLC 3MLVL 1IC5H 4D3CH 1C16A 5D72H 5EZOH 4QWWD 2EDHA 1NAKH 2ARJB 3QFJB 1INQB 1CGTA 5HDQL 2NTFA 5GJSL 4DN3L 1EH9A 4GRWB 4M93B 3PE9A 4NSKA 1N26A 3HN3A 5IBUG 1ZHNA 3I50L 43C9A 4HBCL 4Y4FC 3VXMD 5F21B 4QRPD 2CIKB 4RFEA 1JHKH 3FL7A 5B38B 3DXAD 1P7QA 1JN6B 4F9PA 35C8L 4OF0A 5L0QC 3VW3L 1G9NH 1DTUA 4K8RC 4AY0A 3PHQA 1RU9H 2NW2A 2EDFA 4XRCB 1BIHA 4WWKB 3UC0L 1MCCA 5E00A 2D31A 5GJTL 4P3DB 4U1KB 2H9GA 2VN4A 4R3SA 4MD0B 1CXHA 4WI8A 5D1QC 5DJXB 2XXMB 3OKNA 4PGDB 3M07A 5K93A 2AXGA 1QR4A 4H0GA 1F00I 3C6SB 4F8TA 5HHXL 5D2LB 4XMLH 4UV7L 4PB9H 3CSBA 3FRPA 2NXYB 1DN0A 1MUJB 3LV3A 4HQQH 1I1CA 4ZXBC 5HDBF 1NCTA 4RGND 4YWGL 5K9JH 4I18B 4XC1L 4JRYE 2C3VA 3JWOL 4PRPD 4LF3B 1HHIA 1JVKA 2OR8A 3PP3K 1OTTD 2X9WA 2VZ1A 3HMXA 3BVNB 5INCB 4YO0B 1MCWM 3BYYA 3CDFA 3FMGL 3GO1H 4PGBA 3D39A 3D39D 3U0WL 3DX7B 4N0UE 4YH6A 1U8JA 3MODL 2RIKA 2LU4A 3E8UH 4K3DH 3NAAH 4AM0A 2WWKT 1BOGB 2F54B 1ORSB 2KBGA