2HTKD

Structure of the escherichia coli clc chloride channel y445a mutant and fab complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Synergism between halide binding and proton transport in a CLC-type exchanger
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2htkD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2htkD01
4Z18A 3O3DA 5E8DL 4PJBB 3BD3A 5JZ7D 4XCEA 1NGZB 4CU7A 1F02I 1N59B 4PLNC 4ODXB 1WBXB 5DXWA 3RPIA 1XH3B 1WWAX 1RUML 3PNWB 4LP4A 2R56L 4KMLB 1S78D 1CBVL 1TJHH 1J8HB 5C70A 3WHE1 3DI3B 5HI5C 2DQHH 1Q94A 1SYVA 4L8BB 2EE2A 4RMWA 1QFWM 3VD9A 4NQDE 2MKLC 1QEWA 3DX9A 4Q6IB 4HF5H 5CD3A 3KYNB 3BXNB 1R5WB 1T0NA 1A3LH 2CXGA 3H9YA 4J3OC 5CWSA 4R26H 1DVFC 3BIBX 3FQTA 1OSZB 3VMPA 2ADIB 3GMPB 4ORGA 3IFLL 1RI8A 4OM1L 3WIIL 5IEHA 2UUDH 3QHFH 4IIQB 4Q74A 3KXFE 2IAMA 3Q3GA 5HGAB 3MNVB 4PUBL 3NCJL 3GHEH 3EYUH 3IKKA 4YO0A 3T2OA 3EBAA 4U6XA 3D39D 4JM4H 3U30C 3QULB 3ARBD 4K2UL 5JZ7C 3AXLA 3HRZB 3FO1B 4TVPD 4MNQE 5DHYA 2OSLB 1S78C 2VAJA 2WP3O 2ADJA 4OQ1A 2D31A 2ZJSL 4KH2A 1FFNA 4DN4H 3MLXH 2CLVB 2W0KA 2H6PB 2VERN 1CF8L 4A6YL 4HUWB 4F37F 3LEYH 5IW1B 2ZNXA 3EHBD 4R2GC 4OCXL 3N85L 4P3CL 3LS5L 1F90L 3RVUD 5C0DB 5D5ME 1KIPA 2W9LA 4L4JA 2XQBL 3I9GL 5TQ0L 5IMLA 3MLRH 3WE6B 1GGCL 4Y19E 5DJ6A 5CMAA 2CIIA 3HHRB 1YMME 2DYPB 5KAQG 4HUXA 1OD9A 2LU7A 2FSEA 3PWUA 3TPUB 5FKPB 2V7HB 4KKLD 5KOMC 5D96B 4ZFGH 3ARBC 4DCQA 5AZEH 1A3RH 1HEZA 4I3SL 4O02H 2A73A 3OKDA 2YD9A 4NM8H 2V17L 3B8SA 3H9ZA 4QY8A 4R7NB 5IK3B 3HC4H 2AK4B 3AGVA 3RWEA 1F11A 2CO7B 1E4WL 2CQVA 2I5YH 5F1SA 4BZ1H 2VR5A 3DO7B 3QFDB 4G3YH 1CE1L 5E6ZA 4JFOB 2HT3D 4BFIA 4ZNEE 1T5WB 3E1F1 2DQTL 1AH1A 4X6FB 4C83A 3SGKC 1RHHA 1QUNA 3EHBC 5TE4L 2R8SH 5E00A 1IT9H 1QEWB 3DX9B 4XCCH 2EDJA 1I8KA 3QXDA 2G5RA 3JTSB 4S1SH 3RVUC 1IM3B 5D2NC 1T0NB 4QRPD 3FFCD 4KQ3L 1QLEH 1BF2A 5CEXB 5IEHB 1LO0H 5IT2L 3FB5B 4UIMA 1XCQA 3GBLA 3QXUA 2IAMB 3L5IA 2IPUK 3UDWC 4OZIB 3TA3A 4GLRH 4X5WA 5T3ZE 1MF2L 2GYSA 4U6XB 4CNIB 1DJSA 5KVDL 2WLYA 5I1GH 5AZ2L 5IVXA 3KG5A 1DR9A 3TNMB 3TVMA 4HMEA 5D9SB 2VJXA 2VR4A 4XH2A 3AXLB 4I18A 5HHQA 4HUUA 1I8MA 3VDBA 4OLZH 5DHYB 3CDCA 5H2BB 4PB9L 5HHOE 4JO2L 4PTTB 1TDQA 2MSPA 2HT3C 2YD3A 2BRRH 1KNOA 2WIIA 3MMEB 3ULVE 4RISL 5DF0A 5GS0L 1DP0A 3RX8A 3LQAH 3DYPA 2HTLC 2Q20A 2DLEA 1MAML 2YN3A 5F8RC 1S8DA 1IEHA 5GS1B 3GFUA 3RGHA 3WUWA 4NN7B 4E42B 1KIPB 4TQEL 3X3GH 4Y1AA 1EDQA 4CJ0A 4X0KB 3PV6A 3IS0X 2FATL 5CMAB 5EZLA 3OKLA 5BV7C 1KELL 4HUXB 2ZCHL 4CUCA 4PTUA 5DD5L 3VXOB 4FQJH 4G42B 5A16B 5E08L 3QIBA 1T7VA 4LEOA 4PJEA 4QY8B 1S7UA 4AT6A 1YNTA 3EOYG 3VD4A 2QSTA 3MBEC 4XP1H 2PKDA 3CSYB 3VRLE 5TE6L 1JL8A 4PJ5D 4BFIB 2P44B 3M8OL 3ZO0A 3MODH 4IEFB 1I9EA 4U6VL 2Q8AL 2NX5D 4P3WA 2QADB 3MYJA 4HCRL 2X1WL 3NCCB 1CFTA 3NZ8A 3ZT6A 2G60L 4KZEH 3CFJA 3SE4C 3N9GH 3B9AA 3ARED 4Y4KB 2A9MH 2ZP0T 1SVCP 1FDLH 2A9NL 1I9IL 1UENA 3TO4A 5ESQB 2OZ4A 4Q9RL 1FPTH 5E99L 3IDJB 5JOFB 2AI0H 4LPUA 3RL2B 1P2CB 2HH0L 3ZKND 1BWMA 3D85B 3NFPB 3MGOA 3KAAA 4N8VG 35C8H 5J6GB 3QO1A 2HLAA 4LK4A 4IM8A 3GZKA 1YEKL 2UV3A 4X6CF 3TCLB 5EIIA 4L8CB 3QUMA 5C8JB 1UEYA 3RWDB 5EZIH 1T1YA 3VXRD 5EUKA 1JPGB 4D0DA 1TQBB 2VN4A 1UCBL 4HUUB 3SE9H 3C6LA 2BDNL 3ZYJA 2DMBA 4JKMA 5C0EA 3Q6FA 2VLME 5IVOA 1AHWA 1MELA 5FHBH 1KNOB 2UZXB 4WW1B 4KGLA 4LP5A 1MHCB 4OV5B 5CJ5A 1YQ2A 2YUWA 1P7HL 3Q5TA 5A2LH 5IG7B 4JAMA 4HV8B 4JJ5B 5ADOL 1JPTH 4JKPH 4D9LH 2Z91A 4RAUA 3AREC 1WEJH 1CTOA 4OM0H 5KBNC 4EN3B 3GB7B 2R0WL 1T1XA 4XI5D 1RURL 4GS7B 1DTUA 4HMDA 2ICES 3QNZB 4DVRH 4ELME 1P5VA 1UWEL 3ZKNC 5JO5A 4JJHA 2H41A 1XGQB 1QSZA 1CD1B 1TENA 1ZK9A 4LSTH 4PTUB 4P5KB 1J18A 2O5ZH 1DBJL 1G7HB 4M6OL 2X4RA 3SQOL 4JFFD 2OMNA 1NAMH 4PJEB 4RIRB 2OK0L 1S7UB 5HPOA 4KJYA 4DGYH 3BIKA 4HH9B 3S5LG 3O81A 4U7MA 1FNSH 4J3TA 3HI6H 3PJSA 5LQBL 4GRLC 3EOAA 4MHHG 1MCNA 5AAWA 3FRPG 4RMVA 1SJHA 1AE6L 4DKAA 4GAJL 4JDTL 5D7IB 3IJSB 4P5TC 4NDMB 4JDVA 4ZAKB 4XPGL 2LTQC 3NZ8B 3NCJH 4J6RH 1V3JA 4LDEB 3WHXA 4HQQL 4JHZA 4XHJC 2F9BT 3IDIB 3J8F7 4LLMB 4XI5C 5GRXG 3ZDYE 4AG4L 4WW2A 5GGVY 4PIRF 2GJ6B 4XMKL 3TO4B 4HC1L 2K7PA 4G8IB 3QR2A 3TO2B 1NGQL 1EEZB 3MGOB 1QKZH 1BBJA 2MJWA 4M7ZB 1MEXL 2A6IA 4X80L 3THMH 4B41A 4P3DB 3CH8A 2Q7NA 4XP9H 1TETL 3LKSB 4ZSOE 4KAQL 4CVXB 3KPQB 1K4DB 4M48L 3C6LB 5IWLA 1NAMB 4CKVX 2ESVE 4X83A 3FQUB 2ZCKH 1ZVYA 5F93C 3QNYA 3MRNA 5C0EB 3Q6FB 2FL5B 5E94A 5C0FA 3LEXA 2A0LD 2X7LB 3BKJH 3MRJB 1NSNL 1AD9A 4X4XA 2EC8A 4FMKA 1FZMB 3CVHH 5AG9A 4DAGH 1JVKA 1FCGA 3D0VB 1JZ5A 3KR3H 4YIQA 4O51B 3TJEL 5LVEA 3S34H 2W0FB 2B5IC 1DBML 1GZQB 5B38B 1ULVA 2RQ8A 2RIKA 4LSPL 1QSFA 5FFLA 4XVJH 3MOBL 4I3SH 2Q3AA 3QUKB 2V17H 3I84A 1NUNB 1Q0XL 4G9FB 3DRQA 3GMRB 5DVMA 3LN9A 2VR9A 2J6EH 5C86A 3OHXA 3K4ZA 1A6AA 2X4RB 2BVPB 5D2LF 3UPAA 5TDNA 4KMQA 4P2RE 2Q76A 4HGKC 3BGFC 4KJYB 3T0EA 1A6WL 4XP4L 4DVBA 1MFDL 2C3WA 3LSOA 3BT2L 4GT7A 1PZ5B 3WN5C 4G6JL 1JNLL 4M6AA 2A0LC 5FB8B 3IXAA 5J1SC 2R23A 4KC3B 4PGJA 3IJHA 3MA7B 3TYFB 2F74A 3D6GA 1KPUA 5C0ND 3AVEA 2GTZA 4QRTA 5JDJA 4LPWA 5IT2H 1J0YA 3CVHB 4Z0XA 3X12A 5J1AA 4MXWL 4FS0A 3TYGL 3H9SE 4FXKA 2W92A 1UWGL 1QFOA 3D2UD 5AWNH 5GGTA 2WZPD 1A21A 3VG0H 4IMLA 3C87A 1BVLA 2VKXA 1KEGL 4PJIF 1H5BB 2NY7L 1L9MA 3CFKA 4LSRL 5DJDB 3F5WB 1NL0H 2A6IB 2HKHH 4YHLL 4X99B 4S0SD 1NUDA 1IGML 4OUUB 4OD1H 4GAGH 4PJBF 1FIGL 4AIZA 4KXZI 4GW4A 2CLRB 4I3RH 1XF4A 4N0RA 5IFJA 4HJ0D 1H3UA 1CLYL 3PL6A 4IHOA 5DDHA 1IARB 3B6SB 4LVHB 5C9JB 1YEGH 2E7LC 3MRNB 4HKZA 4PJ7B 2F8XC 4AEIL 2F5BL 3D18B 1JWMA 1TZGL 2BNQB 3BPOB 5C0NC 5DJ0B 3CCHA 3P3YA 5IVNA 3VA6A 1QYGH 1ROWA 3MV7A 6FABL 5EZOL 4U4BA 5C6TH 1WT5C 4YDJB 1A4JB 5J6HB 4UB0H 5ALBL 4QRQB 5CJBA 3O4LA 3G08A 1B4RA 1HHGB 4RX4A 5E24E 3FB8A 1CI5A 3HZMB 1XGPB 2LVEA 2X70A 3FT4B 3FAXA 1U3ZA 5DTFA 4RWYL 2B2XH 4HBQA 3OKEB 4Z5RA 5DQJA 1ND0A 4WI3A 4YHML 4U6VH 4GXUM 3DXAA 5TDNB 1DEEB 3V0AC 3EYFA 4HJ0C 5I1IL 1T7XA 1YNKL 12E8L 5KSBE 5HHVL 5HYJA 1YPZE 1QO3A 2AVGA 3LSOB 3QDJD 4JVPA 3RWIA 2JLLA 2AEWA 1OGAD 3IXAB 2R23B 2Y7QA 2DF3A 1PW3A 4Y8DC 1KPUB 3HE6D 4GG6B 2VISA 4QRTB 4Y4HA 2N7AA 3UTTD 3UJTL 2D7MA 1ES0A 4NUJB 1QBBA 4IDJH 3U0TA 3NH7L 2QL1A 1D6VL 3O8XD 4U1LA 2GTWB 3VFSA 3UTSA 1MLBA 4DW2H 5LWYH 3D39E 3F6LA 4CW1B 4V2BA 5EOCH 1S7XA 3OG6B 2OL3L 1J1PH 3NCBB 3D9AL 5EOQH 3H42L 1LD9A 1AGBA 4TVPE 3VXQB 3QCVL 3IRPX 4JZJC 2BY2A 4QT5A 1A5FL 1HSAB 1J1OH 3VDCA 1AGFA 1P7QD 4M6NH 2IFGA 4JFDD 5F7YC 4ZUVB 3VFRA 2Z93A 3RNQB 1BMGA 2QTEA 4NBXB 1VCAA 4LHUB 2RAMA 3NIGE 4GW4B 4DGVH 1ADQA 5H35B 4KDTA 5K9QG 4IHOB 5DDHB 4Q9CA 4P9ML 3I2CH 3TBTA 1XF5A 4KK6D 5D2NE 2XY1A 5T1LB 2BOBA 3HE6C 5E9DD 1G7IB 1FLTX 4JM2A 3TBSA 4C54A 5LXGL 4GRMA 3VXMD 4Z7WB 1U95B 1LNUA 2GSGB 3O8XC 5EU4A 5LGKA 1YJDH 3NIFF 3EO0A 3NCFB 2H1PL 4L9LC 4IDLA 1X5GA 4Z7UA 1BBDL 5IB2A 2VDKL 4AMKL 1CU4L 5E0QA 3UXFA 1UJ3A 1F2QA 4JCMA 1K85A 1UXSA 1CFVH 3X11A 1J05A 1LO5A 3VFVB 1RIVL 5HDQL 5BJTB 3HR6A 3UO1L 3RNKB 5CJXA 4OCSH 4OZIF 1N26A 1MJ7L 4Y4FD 5HXMA 4NRXB 1GGTA 4JFED 4Z5RB 4KVNH 2IH3A 1OP5H 3C9NA 2WUBH 4I0PB 1RZJC 1MCBA 2VABA 5B39B 1DANU 3JVGA 4FQXD 1OAYL 3FQRB 1EUTA 4NWUH 3Q6GL 4OD3H 5HYJB 2HLFD 3RWIB 1RJYB 2AEPL 4KK6C 5SWSD 1AIFA 1R5IA 3VWJD 1MJ8L 2EIZA 1I3GL 3MLUH 4XBEH 4HH8A 1JZ7A 32C2B 1ZHBA 4NQSA 5MERB 4QRPE 3FFCE 3IU4L 1G7QA 1C08B 1UB5B 3MRQA 3PV7A 4O2CB 4XAKD 1NBYB 4XCNA 3AMKA 3VFSB 5KS9A 4O9HH 2E9JA 3KPSD 2YPLB 4K7PH 1KLUB 3WUWG 4WO4D 1D5MB 3GKZA 4MQXD 2EE6A 3GBMH 3DETD 2P5WB 5J06A 4Y4FC 5GGRA 3KYKH 5AYUL 4PRIB 1JNHA 5GZOD 1FO0L 4FQXC 1QSVA 4PRHD 2EYRB 1NSNH 3HE7D 4MYWB 1CZ8H 4IOFD 1U91A 5IR1A 4YR6B 5DWUL 4RRPA 2HJFA 4YDKH 1C7TA 4U1IB 1INDH 1BFVL 4YGVA 4YX2L 2HLFC 1MJJB 3VWJC 4KRPB 2MHAB 1KJ2L 4XX1E 5SV4A 1BLNA 1JP5A 3R06A 2Q3ZA 5DVKA 2QSCH 2IBZX 3ZKXB 4FQPA 3TBSB 1RIHL 2G5BA 1X5XA 4L3EA 2NXYD 4NKDA 1NANI 5MENA 1LNUB 5EU4B 1HINL 2ITDA 1G7JA 4NGHL 1EMTL 4MNGE 4Z95L 5GHWH 1W0WB 2AXGA 4HKBA 4MQXC 1UJ3B 1KGCD 3DETC 4NCC1 4LSDA 1MWAL 4XBGB 2GITB 1A1OA 1U8KA 2E7BA 4HPOL 1KYOK 1J05B 3PDOB 3SE3C 1H3WM 2ITCB 1U8PB 3MJGX 1A6WH 5ABDE 1MFDH 2XZCL 5ENWA 3VFMB 3L3JA 4YLQT 4J4PD 5GZOC 4GKNA 4PJ5E 1Q72H 3HE7C 4C55A 2V5YA 4IOFC 5CZVL 4J3XA 4U0QB 5SX4I 2NX5E 3RI5F 1HILA 4OFYA 4UINL 5EA0L 4OZGA 3GSNH 3B2VH 4APQD 4UUJB 4P4RB 3RA7H 4ZXBD 4N8CL 2OQJB 2IAND 4TUKL 4FZ8L 5F6IB 4DQOL 5DMGD 3LV3A 1LHZA 2CIKB 3KJ4C 3HUJE 1K3IA 1AGCA 3LRSA 2MPAL 2NXYC 3ELAT 3UBXI 5HI3D 4HWBH 4J3UA 1PY4A 5CFHA 1GJIA 4LSQL 2DI8A 4WV1C 3ZE1E 1UFUA 4LSSL 4BH8B 3WXWH 1I3UA 1IL1A 4XCNB 5KS9B 1A6UH 2CGRL 1HKLH 4EOWH 4P2OA 1QHOA 4G6KL 4DWHA 3VXRE 3QCTH 3EIFA 4ZS6D 1A1NA 2QV2A 3WJLA 1HIMH 5GGUA 4UMGA 4I4WA 3EFDH 4J4PC 4NWTH 2DD8H 2DQUH 4JPVL 2QR0B 5DEZA 3RVXD 4JFQB 3LZFL 2QQNH 2WWKO 4UIKL 4PJEF 2HJFB 4LBEA 1I85A 4LU5L 4APQC 4QEGA 1MPAH 5JIKA 1UM5L 3WNNA 4ZXBC 2Q6WB 3MJ9H 4L4TB 1U2CA 5ALBH 3UTPD 4GXUN 5DMGC 4BQ6A 1BD2D 2X4NB 3GSNB 2WBKA 5CD5D 2VITA 4XC1H 4F15B 5ICYA 5DUMH 4L3EB 4NKDB 5DJ2B 3UJIL 3OXSA 2R2BB 5MENB 5D7IF 3RUGE 1GH7A 5CZKA 5J12B 4HXBL 3QBTB 4MJ6A 2IF7A 3NPSB 1SEQL 3UTQA 4WU7A 1F4YL 4HZLA 4JFFE 4WU5A 4ZS6C 3G5ZA 1U8KB 1MFEH 1RV6X 2YZ8A 4MD0B 5F3BA 3WO3B 4KI1A 4X9HA 5IMOA 1T2QH 1Q1JH 5F9WB 5FOBA 1B4JL 1TCMA 3RVXC 1K2DA 2X1QA 4ZFZB 1GGIH 3DYOA 3C5SA 2WINB 1N5AA 3QFJB 4JEGB 1MLCA 4PGCB 1HILB 2YD7A 3IJYA 4OZGB 3SY0A 3SGEI 4P23A 5C0AA 1XF3A 3SDAA 4NHCL 4MA1B 1KB5A 1P7KB 4HDIA 3BWAA 1HNFA 4HBCH 3JWOH 3LV3B 4I2XE 5CD5C 2NTFB 3HZVA 1VEPA 2JELH 4MA8H 5DFWH 2JJSC 2V9QA 4O58H 3WUZA 3BZEA 3AS3A 1A47A 1G9EA 4OLXL 2SEBB 4PB0H 3WSQL 4K3EH 1TJIL 1KF9B 3W81A 2OXGA 1KB9J 4MSWB 3FCTA 4Y2DA 4GSDL 3TF7C 3VFUA 5CS7A 4D8PB 4RMUA 1A7QL 5FYLL 4OLEA 3OB8A 4GMSL 5CHNA 1MCJA 4BM7A 3U7YL 3VFGL 2ORBH 2XN9B 4I4WB 1MIEH 2VDRL 3UBXG 4E9LA 2NZ9D 1F3JA 4PJ9A 1YDPB 2OJEB 1T3FB 1DEDA 2XQYK 3BPNC 4PREA 1ZLSL 4BFGA 3ZDXE 4NQXB 4OFVA 3EO1A 2I25N 3MBXH 1AI1L 3C5JA 4Y0GA 3BE1H 2NMSA 1NCTA 3PHOB 5F88B 3Q2CA 1INQA 1BBDH 5JR1H 4NQDA 1CU4H 1MRFL 2E9BA 1TJGH 5DD1L 5IB3B 4ODVH 3U46A 5B8CB 3D69B 4NQED 1DE4B 3BPLB 1NLDH 3L3KA 3U0PA 3HR5A 4LLYA 3FB6B 4NC1C 2R4SH 4YHNA 1MJ7H 2BSTB 4MJ6B 2EXYD 4X5XA 1QOKA 1T04A 4HXAH 4G6ML 3KXFA 2N56A 3P4NA 4WU5B 5EZJB 1OOAA 2DLFH 4R4FL 4NZRH 1XGTB 3GO1H 4MJ5A 3FQWB 1A7PL 3TC9A 3N1PC 5FOBB 5BCAA 3LB6D 3B9KB 3DOSA 2NZ9C 4XVTH 1IGCH 3IAGC 2X1PA 2EKSA 2WAHA 3OR6B 4MNQA 5F71A 4GUPA 4OCRH 4S10A 1OW0A 2JIXA 2A6JA 1V8HA 2PW2B 4LKCB 1LMKA 2ADGA 4MDJB 3SY0B 4D9RD 1MNUL 2DBJA 2VXTL 4HDIB 4FQHB 1FYHB 4PJ7F 4CN1A 1QD0A 4LEXH 1ZHNB 5B22A 1T5XB 1CK0H 1YMHA 4LKXA 4F7MB 4TOYH 3QXTA 4PJFE 2EDYA 2BSRA 2NR6D 5D5MA 5EIVA 5E5MA 2OZ4L 2HFEA 1AKJB 1IAOA 2EXYC 2ZUXA 3O2VH 5IQ7H 3B5HA 4EDXB 5AUMA 1YMMA 3LCYA 1X4ZA 4WHTA 3BDYH 3VFUB 2QHRL 4PGDA 4KVCH 5FGCB 1AY1L 2VO5A 5J0BA 2IBBA 3SJVD 3QUML 4HHAA 5CJOH 1BFVH 1YYLL 2J5LC 2OR7A 1EHAA 1ZSDA 3U2SB 1ODAA 3NFNA 1ZXQA 3UZEA 3LB6C 3RAJL 4NT6A 4J3WA 3MPCA 1YEJH 1G0DA 1SHMA 4PJ9B 1T83C 1F4XH 4KK9C 3VGBA 1J8HD 2KPNA 1EZVY 5C7XL 3FRUA 5BQ7B 2HJKB 3RJQB 4ZNEA 3F7YA 3GNMH 3U7WH 2ZG3A 4Z77B 5FIEA 1UA6L 5FCSH 1BM3L 4ZFOA 4Z95H 1XT5A 1OHQA 3CGTA 4W68A 1FFRA 2APFA 3NABH 1Q9KA 3QNXA 4HFWB 2E9IA 4GG6F 4F2MB 5I1EL 3QWRA 2NR6C 3HR5B 3I75B 3QUZA 1T89C 4BSJA 1RMFH 1T21B 1PD6A 5DRWB 1DL7L 3P4NB 2A83A 2ICWI 1BEYH 1HQRA 1EJOH 3DX6A 2CMRL 2EDOA 3IFOA 4GO6B 4L4VD 4F8QA 3CIQA 4EI5B 1CGYA 2AXFB 3E2HB 4PV8B 3QDJE 3R0NA 3NAAL 3O3EA 1E6JL 4QLRA 3MXWH 4G43B 3MUHL 1FLRH 1Q9OA 2P45B 1ZEAL 4S1QH 2EKSB 2Q86A 3F7VA 5HHOA 3V6OC 2VDLH 4DKDC 3UTTE 1RAMA 4UDUB 4HIXH 5CGMA 3TNNB 5CBAA 1NCWH 4Q6IC 4AEHH 2B1AL 1BP3B 1T20A 4TSCH 2WIMA 3JXAA 3L5XL 3U9UA 4BSWA 4LKXB 3MLSL 5CINL 3MXVL 1RZGB 1U58A 3U1SH 4PRNA 4Z7WF 3HMXH 4G8EB 1T4KA 4IIQC 3VH8B 1QVOA 4WEUD 3U36B 2HFEB 5A1AA 2VAAA 2WBWB 5CBEA 5BS0B 4JFDE 3DVNA 4WHTB 1RJCA 1C5BL 4I13B 3VFPB 3OKMA 1QQDA 1F6LL 2FJGB 2EDLA 3TT1H 4K94L 3N1MC 1CFNB 1EBPA 1IAII 1NMBL 3DPBA 5TQ2L 5E9DE 3RKPA 4O2FB 5I1AB 3EAKA 5F96L 3VXME 4W6WB 1MCQA 1CICD 2FX9H 5AAMA 1ZHKA 3MRLB 2NYYD 5D6DC 4XC3L 1WZ1L 3E6HA 1M7IA 1EEUA 1T6VN 3L7EA 1JF6A 5DT1H 3H0TA 5GJSH 3FAWA 4OGYL 3TIDA 1FFOA 4JB9L 5F7DA 4QRSB 1CXEA 4F57H 3LKQB 3ROOB 2J88L 1CDGA 1WAAF 4F7CA 5ACZB 3EOTH 4M93B 2DTMH 4UT7L 1ACYL 2PCPA 8FABA 4DKFH 3FFDA 4JFEE 1JGVL 5GGQH 1JHTA 1XR9A 5F7EL 4HZAA 2A83B 3GMNA 1BQLL 4NO5B 3REWA 4N9GA 5T5FL 3IFOB 2QKIB 2DI7A 3OAUL 3BKCH 2BVYA 4OF3A 4P9HL 1OVZA 5BO1L 3ZTJH 2Q86B 2YPKA 1BQSA 1P6AB 3MUY1 2EE3A 3SBWA 3VXTB 1CICC 3GSRA 4ODWA 3ILPA 4MQSB 4RCAA 4RRPG 2NYYC 3EYOA 5CSBA 1KPRA 4XAKE 5IF0B 1IE5A 5DI8B 5JMRA 5GGSB 3KPSE 4ZODA 3QUYD 2FEDD 4BSWB 1FP5A 2E3VA 1NGWB 2W9EH 3VXNA 3QJHA 5GGTL 3MJ8A 3ILQD 3OZ9H 1JBJA 3ECBB 1ZAGA 2XFXA 4Z7NF 5ITBL 1WFNA 4ELMA 3H3PH 2VAAB 5IFHH 1CQKA 3DVNB 4PRHE 2YN5A 4NKMA 3T0WA 3U4AA 4R97B 3KPLB 5DJZB 1WC7A 1YQVH 2PF6A 3OB0K 3O0RH 1TITA 2VDPL 4WWKA 4KTEL 5ETUA 1RJZA 4NBYB 4OV6F 3TJHD 4JN2B 1I4FB 2XTJB 1AR2A 5EBMB 4POUB 2NY6B 5D7JB 5ITFB 1U41A 1VADA 1YEHH 4H8WL 2DWDB 1WF5A 1FL6B 1HCVA 3M17A 5HDLA 5E56A 4NNYB 1REIA 1XGYL 3PG2A 1YA5A 1ZHKB 4OJFL 1P84J 2VXUL 3HG1D 3M45A 3ORJA 5GS1C 2VXVH 1CL7L 1V7NL 3QUYC 2FEDC 4XXDB 3JWDC 5F89B 3D5OF 4NN7C 4Q2ZB 4DEPB 4UV4H 4XWGH 2D9CA 4IS6B 3WDHA 4D0CA 5C6WH 3TIDB 4Y4KD 5F7DB 2DWEB 3SKJL 1CGUA 3ILQC 4YHOL 4MLIA 4JY6B 4U31A 3WNMA 3IDYB 4Z8FL 2UZIH 1EERB 2IQAA 3W9DB 4NNPH 3MC0A 3D85D 3V0WL 5KS9F 2YC1A 1CGTA 4OCWH 4XCYA 3GMNB 1AO7B 3GEWB 1NKRA 4WFHE 1ZWIB 4NRZA 1ZLVH 4RMSA 1OCWH 3FO2A 4OF5A 3WKMH 2VSCA 3WIFB 3TJHC 5F3HB 2ERJB 4FXGB 3ARPA 4ZSOA 1LEIA 4S2SB 4XNUL 2ESVA 5H94B 1NDMB 4K9EL 2MOVA 3GSRB 3QG6A 3ILPB 5DVLA 5I1JH 3OSKA 3JV4A 3VD7A 2GY5A 5FV2A 3MV8D 4KY1L 4L3CA 1S3KL 4UTAL 4EDWL 3PGCB 5BW7C 2EKJA 4NRYB 4ALAH 4Y8AA 4XP6L 1YEEL 1KCUH 5I16B 3GSOA 2Q8BH 4Y4KC 3K0WA 4JY4B 4LVNB 2A74B 3C60A 3ULUH 4DUVA 1NEZA 3LY6A 4L1HA 4NNXB 4LCCA 2X4OA 3MRCB 4ELMB 3B9DA 4ZTPH 3L95B 5CSZB 4U6YB 3FQNB 5ERWA 1I7RA 4M9OA 2JF1A 1ERNA 5J13B 3H3KA 1KPVB 3BVNB 1A02N 3G9VA 3OGCA 2H32A 4W70A 1I3VA 1TQBC 3ESUF 4YE4L 4LPXA 3UJJL 3D1MC 3UTPE 1S5HA 2W59A 1ADQL 2DTSA 2ZPKH 5D7LB 1BD2E 4P2RA 5K9OA 1S7RA 3HC0B 1KBGH 4BUHA 2VIRB 1VADB 5DUBA 4DFIA 2FBJH 4HKJA 3O45B 1T0MB 4G5ZH 4OZGF 3TZVB 4KROB 3G5VA 5CEZL 4ZAKD 1UGNA 2D03H 1DQML 5I1LB 3AB0B 1S9YB 3VW3H 2I07B 4D0CB 3PIQA 4WVRA 2K7QA 3LVEA 3VGEA 1JJUA 1I7ZA 1NCDL 3H9SA 2GJ6D 4Y5VA 5TF0A 4ZD3H 1FQ9C 1K6QL 4MMXC 1A64A 2YXMA 1BQUA 1DQDL 1NAKH 4CBPA 4MVBD 1YY8B 5F9OH 4OAWA 3GUTA 4FQIH 1MCOL 4GKZB 3FO2B 4OCNC 4QNPF 4C59B 1B3JA 4XZUB 3WFEH 4FMFA 5DYOB 1FVCA 5I1DA 4XMPH 5SX5H 3SDCB 4KMTL 1SY6H 5CIPH 1T7ZA 4PJCB 1ZGLB 2D9QB 3PP4L 3CNKA 1GPOH 5KVGH 3J7HA 4X98A 1DVFA 2CJUL 1N64H 4ZAKC 5C2BL 5HVWA 5D1QA 4NC1E 4W4OA 5JW3H 4R90H 2WBJB 1OPGL 4X8XA 1NC2A 3ZL4L 2BK8A 4OD2A 4J2XA 4JCLA 4QOKD 2NNAB 2J8OA 1NANH 3NVQA 1R3HB 1EXUB 3U4BL 2QQLH 4JE4B 1QG3A 4LSVL 1AD0B 2X4OB 5CP3A 3SKOA 4S1RH 4G9FD 2FCBA 4NYLA 1CGVA 3TV3H 1NDGA 2O5YH 1F2XK 4M7ZC 4YHKH 5SWQA 4MNHB 3WFBH 3G04A 4MVBC 4EUPH 5JORA 3DV4A 2OYPA 3MRBA 5HVHC 3S37H 4HD9A 1AQDA 2Z31D 3LKRB 2PN5A 5HD8D 1ZT4A 4G80A 4H25A 4IMKC 4M6MH 3RGVB 5TDPB 4X7TB 3UCRA 3UTZB 2P8LB 1E27B 3O9WD 5K9OB 3KPMA 1E6OH 1EO5A 5KSBA 2LABA 5SX4H 4YQXL 1YPZA 1I75A 4YPGA 2CLZB 3SDDD 2HFFA 4HT1H 4NQEE 5CIPB 4E41D 3KJ6L 1FJ1A 4X7SH 1FL3A 4WCYL 3BGAA 4ETQA 2P8MB 4LRIC 4PRBB 3TM6A 5HTSA 2HRLA 3G5VB 1IC5L 5F9JB 3EO9L 4O2EA 5TF1H 3EJYD 3ET9F 1YYMH 1SBSH 1OP3K 4X6DB 3O4OC 1FSKB 3RTQB 3BISA 3BRFA 3D39A 4FQCH 1A9BB 3ARBA 4KJQD 5DA4A 2ZUQB 5HVFB 1GGBH 4UOJA 4Z7OE 3CFEB 5F1NA 5AD0A 3N0PB 1DDHA 5HHPA 4CMMA 2Z31C 2VNCA 5HD8C 2WSKA 5ALCH 4D9RE 2XNAB 4G7YL 4EUPB 4E5XB 3UX9B 3O9WC 1FVCB 5I1DB 5F1IA 2B4CH 4WDIA 1NC4B 3BP4A 4PS4L 25C8H 3KPRD 3SCMB 2BNQD 3SDDC 1O7VA 3T08A 1R3KA 2PTTA 5FK9B 1UXWA 2A2QT 3QEGL 2GT9A 3MRKA 5D2NA 4PJIE 2CD0A 2P1YA 4X98B 3ZTNH 5SV3A 4UNVA 2HVKA 4I9WD 4JFPA 3P77A 5GGVH 3EJYC 3U4EA 2R69H 4YHYC 4OD2B 1JWSA 2HT4D 5EBLB 1ORSA 3SJVE 3UDWA 2VDNH 2XWTB 2DI9A 1YEIH 4AYFA 4XPTH 3PE9A 5FA4A 4KJQC 3HNTL 4TVPH 1FZOA 3K7UA 3SKOB 3NTCH 4MLSA 3LEVH 5GSRA 3R8QA 4YZFE 3LN5B 2VLLB 4NM4L 1T7WA 3NBNA 3G04B 1I9RH 4HS3A 4JVWA 1J8HE 1TPXC 5JORB 2R2HA 2W0PA 1QSEB 1W0VB 3V6OE 2LAGB 4H1LA 4MA7H 2Z92A 1RZ7L 4KUZH 1J1XH 3ISWA 4H25B 4HIIA 4XMLL 2AGJH 5GS0D 4QCIB 3MA9L 2BNUA 3LMJH 4HUVA 4HKXA 3VG9B 1YPZB 3BPOC 1FAIH 2PUQT 3HPLA 4JG0H 3EGSB 4R2GB 2HFFB 1TTUA 3VWKB 1FJ1B 2VZOA 4LFHD 5EOCJ 2IADA 4QRPA 1YNLH 2Y06L 1F4WH 3FFCA 3RRQA 5T5NF 2GJZB 2JJWA 5C0JA 3DECA 3F12B 2HT4C 5TH2A 3HNVH 4L4VE 2W60B 4ERSH 5K9KA 1BOYA 4AM0B 3DIFA 3D39B 5I30H 2MNUA 3ARBB 1TTFA 3PHQB 4M5YH 2JTDA 4I5BB 1ZGLP 4XWOD 3NZHL 5F7NC 2VXSL 4QHUA 2DQCH 3MLYH 2IPTH 3REVB 4R3SA 5IOPB 1WICA 5DRNB 1A6TA 1DQJA 2YKLL 2ZG1A 3NOIA 4LHUD 1HXYB 1KEML 3KLSA 4P49A 3IDXH 1IVLA 4XGZA 4Y5XC 5GS0C 1U6AL 1RK1A 1NBQA 2AABL 4LQFH 5C0IA 2X6MA 4KZDL 3BP4B 1KB5L 2X4QA 5T1LD 1UKTA 5IHUH 2R4RH 1NGYB 1MRDH 3P9MA 2PTTB 2HVJA 3FB7B 2YRLA 4PGEB 3CFCL 2OS7A 1CIUA 2GT9B 3SE4A 4ZUSA 2PETA 3P77B 1QLRA 2LVCA 4MD4B 1JNNH 3BESR 5BV7H 3U4EB 4V1DB 4Y5YC 3WFZA 4CJ1A 1B0GB 3ZE2E 1JWSB 2JJTC 3QQ4B 4MNGA 3ARGC 1JFQL 5KSAB 2AK4E 2J4WL 2UYLB 3AM8C 5H37G 2AJZA 1R3LA 4XWOC 2EO9A 4R6UA 1HDMB 1QBLL 4I0PD 3T77A 3BW9A 1J9CT 5FA3A 1MFAL 4PJ5A 3P0VL 3TGXA 2XRAH 4IOIB 2Z92B 2P24B 2NX5A 5F1KC 4HIIB 4LF3A 1RULH 1UB6A 3GI8H 3BPCA 5KN5A 4HUVB 3AU1A 4G9DA 1KJ3H 2PO6B 3LHPH 3ALPA 4G8FA 4KPHH 5DFTA 3I02A 3OPZL 3QPQC 4D0BA 3AREA 3HUJA 1JPSH 2OTUB 4RFNB 4Y16B 5DVOA 4WJ5B 2IADB 3V52H 5D4QA 3T4YB 4DZ8B 1QFWL 4OZIE 1LK3L 3P30L 3LD8B 2CDEB 2D0GA 2HRPL 3KPNA 3SN6N 2MQ0A 2YPLD 3MV11 5TH2B 2DDQH 4FQLL 5BV7B 1I7TB 3CVIL 4K3DL 1MCWW 4OSUL 3TH4T 2P5WD 3O6ML 3DIFB 4WY7H 4F9PC 1NKOA 5DS8B 3WL9A 4JDZA 4QXGL 2DJSA 1IGIL 4XCFH 5D72L 3VXRA 1IGJB 1WUNT 5CCKL 2BCKB 4KMTH 3EDFA 1J5OL 4I0PC 4PRID 3MBEB 5FYKH 5IV2B 1CGSH 3D3VB 2NTSP 4XNZC 3BSZH 1CLZL 1DQJB 2PTUA 5F70A 2Y25A 5H8DA 4NHUB 1FC2D 3QDHA 1U3HD 1PQZA 1X5AA 1II4E 4YHZH 1RK1B 3DVFA 3VGHA 5EC1A 4KRPD 1BIHA 5E95B 1C5CH 4YHPB 4MQTB 3ZL4H 3I3DA 3P0YL 1T03L 5ECJE 5GRZA 4PY7A 3P9MB 5ICXA 4DZBA 1DBBH 5E2UL 5K9JL 2I9LA 3BH8B 2DQEH 2LFGA 1PAMA 1RK0B 5BZWB 3GMQA 2X4TA 4UTBH 4U05A 1DQLL 1IC1A 1QLRB 4TPRH 4XNXL 3BZ4A 3QZWB 3DSFH 2PR4H 4X6BB 4GKSA 1P4LA 4I77H 5I8CA 4NN5B 1C5DA 1UACH 5I8KH 3OG4B 3RUGA 1I9JL 5BMFH 5DQ9B 3DWTA 4MNGB 1R3JA 1J7VR 1HHKA 2MWCA 4MWFA 1FIEA 3QJFA 1QFUL 3ARRA 3KHOA 4JFFA 5DMIL 3RHWK 4FA8A 1Z9LA 5C0RH 4KI5F 4IOSD 3WFDL 4Z76A 4HPYL 1MREH 3TESA 4GAYA 3JV6A 1QNZL 2BSED 3RI5K 1BIIB 4YQXH 5MP6H 3RL1A 5KJRL 1OB1A 5FA3B 4PJ5B 1PEZA 1U3HC 3T3PF 1UZ8A 4OTXL 5EH1A 1PBYA 2NX5B 3HFML 1IM9B 2AJYL 2O5XL 3U9PL 1JRHL 1UB6B 3IF1B 1G7PA 2JJVA 3BPCB 5KN5B 1WJ3A 4LLQA 4WNQA 3AU1B 4ZQKB 1INEL 4G9DB 3CFDB 1KCSL 3GIZH 4ZFOL 4G8FB 5GRUL 4I2XA 3AREB 4J3VA 3KLHD 4NCDA 4ONGH 1AFVL 2AK1L 1FGVH 2V6HA 4QRRD 2NY1B 3VRJA 2AV1B 2RFXB 3DBXB 2KZ1B 1SMOA 5ESVA 4B7LA 3DLQR 4N5UA 1BFSA 1NBZB 3GJFA 2IJ0C 5JLZB 4H20L 4YC2C 5D7SL 1WV7T 1NEZG 3FT2A 4HIEB 5T3ZL 3AS0A 5DZOA 4M43H 4ELMF 4K8RL 4NCC2 4WFFD 3R0MA 3O3AB 1P1ZB 3WN5A 5FCUH 3QEGH 5HGDB 4GRLB 2D4DA 3BH9B 3H6JA 3ES6A 4L4TD 3L3IB 1IAIH 1MFNA 1BVZA 3FT3A 5F6IC 4HX1A 1SVZA 3ULVL 3MRMB 3MOAL 4P5TB 5CAYB 2I26N 4PY7B 2LTQB 3CH1B 2VTFA 3KLHC 4G8GD 4TSBH 5IB1A 4PP1D 1WFUA 1KCVL 1PG7H 5IKCB 1ZVSA 3STLA 1GOGA 1J8KA 3ZHDA 3B43A 1T1ZA 3GI9L 5EPMB 4MWFB 2Y23A 5IEKB 5A2FA 3HB3D 3S97C 3ULUF 2BC4A 2FR4B 2EZ0D 3GMMA 1OAZL 3V5KA 4LAQH 2C7UA 3RIAF 4AIXA 3R1GL 5EO1A 5CUSH 2E7LA 3PWLB 3QFJD 4MD5B 5IHZA 3OJ2C 1XMWA 4B53A 3BEVA 3S3JA 1DLFL 5D7IE 4HK3N 2AKRB 2EDBA 1G7PB 1VGEL 4OT1H 2D7QA 1BREA 1WT5A 4PJCF 1CXIA 4F15C 1H0DB 4ODUA 1F8TL 3FQXB 4JLRA 1W2KT 3MR9B 5T1MB 2GJ6E 3GGWB 4QHLB 5JW4R 3D2UA 4FFVD 4Q9QL 2XZAH 2DBLH 2FD6H 4PP1C 4PJFA 5J12C 3E6FA 4FN0A 3LAFA 3HMWL 2GIYA 2YPVL 2IFFL 2FGWL 3NPSC 5ELIA 2VXSH 1LDPH 4M7LH 2GFBA 1GZPB 4KTDL 4QHMB 3MRHB 3RIFF 1CR9H 1N0LA 4UQ3A 3QA3A 1IAKA 4OZFA 1C7SA 3DHMA 2YKLH 4QHNA 1CLCA 3FT2B 1IQWH 2YMXH 3HB3C 4AL8L 3B4NA 5F9WC 5I1HL 4PBVC 2VLKB 1Z3GH 3IETB 2VWEC 3O2DA 2XN9D 3WFHB 4KZDH 3WNLA 1NLBH 4WEBH 3C08L 1G9NL 1A0QH 3KYOA 1A8JH 1DFBH 5J11C 2IWGA 2JB6B 1NQBA 3V4UL 5GJTH 4LNRB 1F97A 3C6SB 2ATKA 4BQ9A 5A40E 1OM3L 1L0XA 4MA1C 1CE6A 3FT3B 1KC5H 5I1CH 4HX1B 4P46B 5ACLA 3FOMB 4OGXL 4QOKE 3NA9H 2RCSL 4JQVC 1GC1L 2H26B 4JPIA 4FFVC 3VXPB 1ZHLB 2IG2H 1OAXH 3QHTC 5JPMB 2IH1B 3TBVA 1AXIB 2FJHA 4G9FE 3X14A 4JZNB 2F19L 4HWEH 3KS0J 4F58H 3HNSH 1J12A 3V4VL 4S0TD 3STLB 5C6PB 3BDBA 4JPKH 4JZJA 1T1ZB 3D25B 3CU7A 4X6DF 1JPFB 4QTIL 4LPVA 1TVHA 1VPOL 4MCYB 1X5LA 2FX8H 5MEOA 4DOHB 2HG5A 3B9KD 3GMMB 2Z35A 1BQHB 3QDJA 1FC1A 5DEFA 3GSWB 1OGAA 5F8QC 1ETZA 2X41A 4E41E 1LO2L 2E6JA 3S36X 2EH7L 3BEVB 4LCYA 1UYWL 3HE6A 1JNJA 5HGHA 2VH5L 3MNZB 4TN9A 4PJ8D 1JGDA 3UTTA 2AJSH 2HRPH 1MHHB 5IMMB 2X4SB 4HIJB 4P2QB 4QXUH 4KKCD 3KYMA 1OAKL 4EI6A 3JWOC 5B8CC 4I48A 1FE8H 4EVNB 4L9LA 3D2UB 2ZZUT 3FL7A 2YEZB 3CLEL 3E6FB 3GSUB 4RMQA 3QYCA 7FABL 1AKJD 2KQNA 4NZUL 3MRRA 3FMGL 2GFBB 4LCUB 1OQXA 5KW9H 3HS0A 1P7QA 1GYAA 3QA3B 1IAKB 1J86A 1U2HA 2EICA 4JFDA 1MJUH 4I0CC 2RJMA 5KSUB 5GRJL 3MJ7B 3P4MA 5ESAA 1NUGA 3RDTC 1DBKH 3B9KC 5FYJL 1Q8MA 4PJ7E 3KPRE 5IB5A 1MHPH 5FM5O 2BNQE 2UVFA 4ZOCA 4PGBA 1MCEA 5JHLL 1P53A 1VB9A 5E9DA 4H1LG 4I9WE 2XICA 4PJ8C 5HHMB 5EN2A 4M7LT 1U8IB 4JRXB 2R2EA 4JFYB 4N0FA 3VXMA 2AJXL 4JQIH 3RWJB 5F21B 3VDAA 1PG7W 3V6FB 2WUCH 3K4DA 4KKCC 1YPZF 1MFBH 2H3NB 4JPIB 1CDBA 3D0LB 3T1FA 1QFHA 4NKOA 1IILE 4NJ9L 1QFUH 5DMIH 2YWZA 3DUHA 2C3XA 3O3BA 5M95B 3IDMA 2C3HA 5DD3L 1A6ZA 1Y6KR 1FZKA 5J89A 4PRAA 1RZJH 4QYOA 4Y4FA 4F7TA 4JRYB 5KJRH 3OKNB 4JFEA 1S7SA 4XNMA 4Z0BH 5FECB 5ILTH 4FQXA 5TGBA 3W2DL 1TVHB 2A6DA 2E6PA 1XGRB 4ODSL 4BK4A 1EGJH 3HFMH 3RWGA 2HG5B 4P0DA 1MCPH 5IB4A 5FDWA 3LN4B 1RJLA 2Z35B 3PWPD 5HYSB 5DEFB 5FKAA 3GK8H 1OGAB 3OL2A 5SWSA 1G7MA 3VWJA 4GG6E 1IC7L 2UY7A 4PJAB 4OLVL 4XPFH 3IVKA 5CILH 1A7NH 4JR9L 4XVSH 2F15A 4LCYB 3PGFH 3DMMD 3HE6B 1I8IA 1PYWB 3W9EB 4YDLB 3C2AH 4JG1H 2YUXA 3O11A 3RX5A 3G5XA 4JO4H 4HLZH 2BFVH 5HY9B 3O8XB 5D6CA 4CMHB 2AJUH 4EI6B 1HWHB 1D5BB 1MY7A 3KPSA 4L9LB 3PGDB 2NPLX 4WO4A 4IRSB 3OKYA 2B1HL 4YDIL 1OAUH 1MCCA 3P0GB 1S7VA 3SE3A 3BKML 5HI4C 5BS0D 1IC4H 2HJLB 1HKFA 1IGYB 1P7QB 3P9LA 3L1OH 4GW1B 4JFDB 4OLYL 4PRHA 1FGNH 3WD5L 3E2HC 3HE7A 4HULB 3CLFH 3DRTB 4FQQA 5E8PA 3P4MB 3BEWA 4JFHD 2XA3A 2XZQL 2Y36H 3GHBH 4YUEL 3K2UH 3E8UH 4EXKA 4AENB 3OF6D 2BVQB 2VSDA 4Z7WE 3DMMC 1BZ9A 1F58H 1YECL 3VGAB 4WUUB 3IT8D 3H9HA 2W65B 1RFDH 2R2EB 4X4ZA 3QDGB 4K55A 3PWJB 4WHYH 1G7LA 4YXKL 4GJTB 4NPYB 5ID1B 3W39B 3IXTA 2XKNA 3AS1A 3T1FB 2O61A 1KJVA 4PJGB 1IBGL 4HLJA 1IGFH 3G5YA 4Z7VB 2FHFA 5GXBB 3FOLA 3PP3H 5T1DH 5HPMB 3JTTA 1FZKB 3NCYS 1K8IB 3KDMB 3HZKA 5CP7B 2X05A 3LPFA 3WS6A 4J4PA 4F7TB 2OJZH 4KK8D 5HGBB 4XNMB 1FH5H 2Z4QB 4PV9A 3ARVA 5TGBB 1DLFH 1TCRA 5JTWA 1T22A 1CT8B 1K5NA 3RWHB 3P73B 3RU8H 5IM7A 3S4SG 3GSXA 4ZXBA 3EZ8A 2IANA 5SWSB 4RFOH 4BH7A 1G7MB 3OKOA 5ISZB 1QLFA 5DJ8A 2MQ3A 1WAAE 3IVKB 1RUKL 3QEQB 1HI6B 4YAQB 1L9NA 4BFBD 1X7QB 5I15L 3O11B 1AXSB 1AJ7H 5ADPL 3INUH 1JHLH 2YPLE 2I60H 3EYQD 4L29A 4O4YH 5D6CB 3MUGA 3KPSB 1KCRH 2GCYB 2P5WE 2HKFL 1A7RL 3Q1SH 4RDQG 4P59H 4M93C 4XB7A 1L6ZA 3MLWH 1YN7A 1S7VB 3BYYA 1ONQA 1KN2L 2VLJB 1QR1A 4PRIE 5D71L 1B2WH 4H26B 2NY2B 4GXVH 1DLHA 3OMZA 3F8UB 4KK8C 3A6BL 1I7UA 3SPVA 4PRHB 4UT9H 2KH2B 4TTDD 3HE7B 3BKYH 4FFYL 3WIHH 5DD0L 4UQ2B 1U8NB 4J8RB 2BXZA 3IFPB 4U6HB 3LIZL 2XTJD 1WBYB 5D7JD 4WI8A 1BD2A 3PQYB 1KTDA 2NY5L 1AGEA 5TFSL 4BKLB 2NXZD 4Z7NE 5FO9B 2R1YB 3QEUA 2JJSA 1K4CA 1PJ9A 5IIEA 3DV6A 5ANMB 1IFHL 3EYQC 3BQUB 4WV1B 2HFGH 1ZLUH 1DSFH 1G7LB 2A77H 3CX5J 2OMBA 3DARA 4YNYB 4MAUH 4QTIH 1SM3L 4KDVA 5C07B 1NEUA 1RZKL 4PP2B 4KI5D 5FYLD 3MLTA 1SYSB 1BFOA 1PEWA 2HMID 4TTDC 1AO7D 4K3JL 4APQB 2XTJC 3HZYA 3QHZL 3S88L 2DICA 2IANB 3L9RB 2C4FT 5AEAA 2CDFA 2EDEA 2HAZA 4WTXA 2NXZC 5E2VL 3AY4C 4MAYB 2EC9T 3LRHA 3DGGA 2GUOB 2QQKL 5CGYD 4I3GA 3V5HB 1FNGB 4DEPC 1A1MA 4ZPVB 4U1KA 3I6LD 3KNBA 4JN1H 3MUGB 4GG8A 2BZDA 1P4IL 3K8MA 4GQ9H 3B83A 4LLUA 3IDYC 4FP8L 4ZS7H 4ZPTA 4TNVF 4MA3B 4KI5C 5DQDL 2IGFL 5E2TL 1ONQB 5FYJH 3GRWA 1BOGA 3SO5A 3TVMC 5L9DH 3QIBD 1G9ML 2XG4A 4WFFE 3P4OB 4ODBD 3MSPA 5E6IB 2HMIC 4HJJH 1I7UB 3PABA 2EDTA 4JHAH 1MCFA 5IUSA 4CRPA 4ZTOH 4L4TE 3PWVB 1TZHA 2ERJC 3O6KH 4UILL 1C1EH 4AEFA 4R8WL 2JB5H 5MEQA 4HS6A 1QRND 2CK0H 1FBIL 1NMAH 5FHAL 2ZOLA 2XQYG 1U8MA 2XA8L 3G6JB 1OSPL 3CUPA 1B0RA 3IDGB 5I0ZA 3P11L 1AGEB 2CKBA 3MRIA 2I27N 3TZVD 5AG8A 43CAB 1RZ8B 5CGYC 4KROD 4D9QD 4NQEA 4JRWA 4L5FH 5IJVA 3DV6B 4HIHA 2RHEA 4JO3L 1S9VB 3OX8A 4P5MB 1XGUA 2D7TH 1KIRB 1HHHA 1BGXL 3STZB 5JUEH 3EDJA 4O5LH 1HOCA 1NBVH 4NO0B 3VCLB 2AQ3A 4JY5H 5JXAL 3MLZL 3ULUD 1RU9L 2W38A 2VWEE 4NSKA 3QIBC 1KULA 1JN6B 1O7SA 3M1BA 4M7JL 3QT2A 5FF6A 5J13C 3QFJE 2W9DL 3QSKB 4DUWA 4OZFG 2WM0A 3CX2A 5IBUG 1T83A 1EFXD 5IFAH 4OB5L 4M1DL 4YDVB 3DURA 4FZEL 3SDCD 5L2JB 1HHIA 4KTYA 1RZFH 3H3BC 1RUQH 4PJHB 1N2RA 5L8KB 1U8HA 5D70H 2EDXA 4G7VL 4TULH 2Y07L 3TZVC 4JANB 1DN0B 1GHFH 4KROC 4BZ2L 1X5YA 3DROB 4FABL 2AXHA 1FNEA 4R4BA 1NH6A 5FM4A 3U0WH 1S9KC 3VE0A 4PJIA 4WI9A 3VFNA 2WBJD 2FJFA 2FX7L 5T33H 3TBYA 1GAFL 1C16B 2OR9H 3BP6A 5D93C 1T89A 4HS8H 4FQ1H 4ZPTB 1KFAL 4QTHA 4QNPE 1UQSB 4AH2B 3SJVA 1A3QA 2XN9E 3QCUH 1NPUA 1NCNA 1NGZA 4B5EA 1MFCL 1N59A 4ODXA 3QDMB 1WBXA 4P99A 3SOBL 1XH3A 2ZUUA 3HAEH 1W72L 5E6YA 3PNWA 1T1WB 5F7UA 1YECH 1J8HA 5HYEA 5C92A 4WFED 3AAZB 3SDCC 3V6OA 2XWJB 3RGVD 4HS6B 5MEQB 3QXVA 4L8BA 4Q0XH 1U8MB 3OAYH 4Q6IA 2M2DA 1B0RB 1CDYA 3KYNA 4HK0A 3BXNA 1R5WA 2XWBA 4HWZB 5E1HB 1PX3A 3BYTA 1OSZA 1JHKL 2R0ZH 3GMPA 4UT6H 4XP5H 3ZYZA 1WTLA 2WBJC 5DO2D 1D5IL 4IIQA 5HGAA 1HHHB 3MNVA 4WGWB 1FYTB 1M05A 5FYKU 4PJXE 4JZOB 4L4VA 3T4AA 2YD4A 3GIVB 4EQ2A 3SE8L 3TWCH 2J5LB 3FO1A 3U48A 5T3XL 2OSLA 1T80A 3NCMA 1NGPH 4NFDA 1MQKL 2DM7A 5LAXB 5LGHH 3QRGL 3IKCB 4LASL 4ODTH 4TTGA 3RGVC 3HAEB 5EORL 2EO1A 1QPPA 4FXLA 2M1KA 2H6PA 4YWGH 1NC4D 2BJML 2WANA 3ARZA 4HUWA 3BDXA 5IW1A 2YRPA 5D6DA 3W0WB 3SCMD 3GKWL 3F58H 3MO1B 3UAJD 1S7QA 5JQ6H 5C0DA 1I1YB 3QXAB 4U2ZA 3G6DL 5L7XL 2EH8L 1AP2B 3WLWC 4PY8I 1QSFD 3WE6A 5KVFL 1MIML 1JK8B 3DVGB 5FGCE 1FSKC 1ORQB 5TPWL 3TPUA 4CAGA 5FKPA 4FQ2H 1NCUA 4HJGB 4DKEH 3IFNL 3BJLA 4QTHB 2QEJA 2ZUQC 4HFUH 4W6XB 3MFFB 2DQIH 5IK3A 4R7NA 2AK4A 3NCYP 2B0SL 1CLOH 2APWA 3DO7A 2A1WL 3QFDA 1N0XL 1CG9B 2NY5H 2APTA 4JFOA 2Y9RT 1QA9B 1QSED 3IDUA 1T5WA 1PDKA 1R0AH 2ZCLL 3UYOD 4X6FA 2QSVA 3T8XB 1CICA 15C8H 4KGJA 5BOPA 4K3GA 2VXQL 3SCMC 2EIBA 3ESVF 4JFZL 3RZCB 3JTSA 4L8DB 3UAJC 1IM3A 3BJ91 3LS4L 4HK0B 3CMOL 4R2GD 1D3CA 4PJAF 2XWBB 3HC3H 4X5LA 4NZTH 3VWKD 5GISH 1N5YH 2BSSB 3CFBB 3QQ9D 5DEGB 3MCLL 1EO8H 5CEXA 1FORH 2DQJH 3FB5A 3QG7H 4L1DA 4NUGL 4OZIA 5AYQA 2GY7B 3VXUB 5I8OL 1R3IH 1M05B 3X3FL 2C4XA 1NCAH 4CNIA 1UZ6F 2DOCA 4L4VB 3TNMA 3T4AB 5D9SA 3CZFB 3PWPE 2ZOKB 5H2BA 4PTTA 3VI3F 4RWHA 2E27L 1PKOA 3MV01 5CJ8A 1MI5B 3MMEA 4H5SB 3F7QA 2KBGA 3FZUD 1QBML 4ETYA 4MDIB 3VG9C 4ISVA 4LIQH 2H2PD 5EU3A 4FFWD 2B4CC 2EYSA 3VWKC 5GS1A 1DCLA 3QUYA 3T2NL 3MV9B 1S7QB 4UBDD 4LHQB 1CVSC 3TCXA 4E42A 4GBXB 1JGUH 3QQ9C 4NP4L 4X0KA 5TE7L 1A6VL 3IU3A 3I3EA 2VE6B 5BS0E 2ADFH 4V1DD 5GPRA 1IEBA 1G9MH 3KPTA 1VGKB 5KTEL 2DIAA 3VXOA 4Z6AT 1FRGL 2J3SA 5KSAD 4PJGF 4G42A 5A16A 2DQDH 4Z7VF 4JFHE 4DN3L 3S98A 1U8QB 1LO4H 5IBTH 2D3VA 1E4JA 1D6EB 3O2DL 3UEZA 3S9DB 2VDQH 3G9AB 1T2JA 4NKIH 3CSYA 4R96B 1QACA 2UVEA 4OLWH 4N0YL 1JCKA 3V0VB 4PD4K 1DN2A 3L3GA 5L0QC 5I9QC 5E1AB 5KVEH 3FZUC 5I74B 2ZSVB 1CICB 1IGTB 5DD6B 1RVFL 2VL4A 1PGRB 4OFIA 1VDGA 3JWDH 3LRGA 2H2PC 4L8SB 2BNRB 2HTLD 4FFWC 4LPYA 5C3TA 2PO6D 5BW7A 3QH3B 4U49A 4UBDC 4JPWL 4Y4KA 5IESL 4Y16D 3FTGB 3QWQB 5ESQA 3IDJA 5JOFA 1RUAL 4M7JH 3RL2A 1P2CA 1MRCH 3D85A 3NFPA 4F8TA 1UM4H 4HWNA 4KWUA 2V2XB 5J6GA 3ZSSA 5GS2H 5KSAC 4LLWB 4ENED 3TCLA 5DC9B 5DZLA 5J7CC 4L8CA 4C4KO 5C8JA 3RWDA 5DUPL 1JPGA 4XPBH 2DMKA 1U8JB 4GMTL 3V4PL 3MBED 4B0MM 3GMOB 4MJ4A 3D3VD 5EU7C 3U6RB 4OFDA 4XPHH 2F58L 1NCCL 2Q1EA 5B4MD 4WW1A 3MCKA 4WI5A 1KXQE 1MHCA 4R4ND 4RQQB 4OV5A 2VKWA 5IG7A 5KZCD 4ISVB 5E2WH 2PO6C 4HV8A 5EU3B 4JJ5A 3WS3B 5DHXB 1N4XH 2EYSB 4UU9B 1OAQL 2CSPA 3QUYB 4X7FC 1LEKB 4X9GA 5SWZB 4Y2OA 3LH2H 4LGSB 4RFNC 1HZHH 4Y16C 4EN3A 3GB7A 2UY6A 2RR3A 1OGTB 5IGXL 3ARFB 1GIGH 3GSQB 3LD8C 3QNZA 4MHHI 4X4YB 3IU3B 4ZUUA 5EWIH 4OI8A 3E0GA 1IEBB 1XGQA 1JGLL 1HSBB 1CD1A 2J7LA 4XPAH 3SOBH 3Q5OA 1MHEB 4XAWH 3MACH 4ENEC 2ICWJ 4FOMA 4P5KA 1KJMB 1LEGA 1G7HA 4RA3A 4EBQL 4TSAH 1CGWA 4RIRA 1AQKL 3NGBB 2J12B 4W81A 5LCVH 4YXLL 2XTJE 1A7OH 2NY4D 2HN7B 4HH9A 4GW5B 3TT3L 1ZT7B 5B4MC 3WFCL 3L3GB 4IRJB 3QP3A 3SGJC 5FYKD 1S7WB 4R4NC 1IM9D 3MRFB 5D7IA 3IJSA 1NCBL 4NDMA 3HG1B 4ZAKA 4UV7H 2MKWA 1LO3H 4LLMA 3IDIA 2X42A 1LE5B 5DSCB 2E8ZA 4NQVB 4KI5E 5J4MA 2GJ6A 4N5EC 3BGMB 1LVEA 3OV6A 3EYVB 4G8IA 4NN5C 1L7TH 3TO2A 2NY1D 4M7KL 5LG1A 1BVKA 1OARL 3G6AB 1EEZA 1F4HA 2Y5TB 4JGUA 1V3MA 1AO7E 3FHAA 3T3PE 5M7QA 4K23H 4FNLH 4D94A 2DM2A 2QLVB 4P3DA 1N6QH 3LKSA 1A14L 4IBLT 2OLDA 4OCYH 2YS4A 1NUFA 2NY4C 1DBAL 4CVXA 5JHDD 3KPQA 1K4DA 5DJAB 2CUHA 2AJVH 4R9HA 1NAMA 1KENH 3FQUA 3BHBB 4IMKA 1HXMB 2FL5A 3S35H 2X7LA 2NY0B 3MRJA 1AXTH 3QIWB 4GRLD 3BP5A 5L88H 3MCKB 1IKFL 43C9B 1FZMA 2B7DT 3S36L 3D0VA 5CSGA 4O51A 2IQ9H 5E4EB 4NQCB 4C58B 2W0FA 3MV8B 4LRIA 3I6LE 4NC2B 2ZUWA 1GZQA 1G6RH 2QHLA 5B38A 1PY9A 2DLIA 4P5TD 3G6JF 4ONHB 3SKMA 3SO3C 1BF8A 2X1XR 4DTGH 1X4YA 3HI5L 1H3PH 1FNAA 3L7FB 3QAZC 4QOKA 4XHJD 1BAFH 2OXHA 3BO8B 4Y7MA 3SKNB 5I19L 1S5IH 4LCIH 3O2WL 5HBBA 3QUKA 5E8DH 4ZUUB 2NY1C 4PRPB 1UM6L 4G9FA 3GMRA 3C8HA 1RUMH 1YC7A 3SDYL 2R56H 2VDML 1LEGB 1KIUA 1CBVH 2BVPA 1M71B 3B9EA 2VLRB 3RIAK 4YJZL 4ZO8A 5D7LE 2Z31A 5IW3A 1QRNE 5FUZL 3GMLB 2GJJA 4OIBA 5A2KH 4EIGB 4ZYKA 1Z9SA 4KHTL 4OFYD 1PZ5A 3OAZK 1V7ML 1MVUA 3B8YA 3O9WA 5FB8A 4MXQD 2K3TA 3ARSA 4A6YA 3TYFA 3MA7A 1YN6A 3NN8B 4D9QE 4E41A 1E4XL 3NACL 4ZFFB 4GQPH 3IFLH 4OM1H 3UC0L 4Z78B 3WIIH 4H0HB 3DTXB 3CVHA 4PJHF 2R15A 4WENB 4NUGH 2VL5B 3ARDB 5I6XC 4PUBH 3MLVL 4ZUWB 4Y88A 1FVEB 1LE9B 5J56B 2XG5A 3IRZA 5KG9B 3I3BA 3NFSL 1G6RB 3IGAB 3ULUE 4K2UH 2RBLA 1EBAA 2XKUA 5DR5L 3WHE0 1D5XA 1H5BA 1WFTA 4KRLB 1BVKB 4NN6B 1ZTXL 1EO7A 3ARQA 4FTVB 1ZANL 5DJDA 1SEBA 5JXED 1U8OB 3F5WA 4K7FB 4X99A 2WWMD 2ZJSH 2J6EA 1ZGLM 4ODHL 2VLKD 2EEDA 4OUUA 5HHXL 5HVHB 2H9GA 2CLRA 4BELD 1CF8H 4PJCE 4A6YH 4HG4J 4MJ2A 3B6SA 2HWZL 2OTWA 5C9JA 4OCXH 3N85H 4MXQC 1VFAA 2ED8A 4P3CH 4PJ7A 3LS5H 1F90H 3KPRA 3D18A 2BNQA 3BP5B 3I9GH 2XQBH 5DJ0A 1HH6A 3L3OB 5TQ0H 1GGCH 4DUXA 3O6FB 4YDJA 5SX5K 1A4JA 5J6HA 4P46D 4YFLI 1RUPL 4QRQA 5FUOL 1Q0YL 3SKMB 1I1FB 2PXYD 4LGPB 5GRYA 4P4KB 4QOKB 4RGOL 2YA1A 1HHGA 2VZ3A 1YEFL 3EDKA 3O4OB 4M5ZL 2YK1L 3HZMA 1XGPA 5E8EB 1FNHA 1TVDA 1E4WH 4F33A 3FT4A 1Z5LB 4N90D 3WJLC 3MREB 5JXEC 3L3DB 1CE1H 4IRZL 3ME0A 2GKIA 3OKEA 1EHLL 2EDWA 5D1XD 2WWMC 2DQFA 3SHSA 5FOJA 1N7ML 3ZMRA 3MROB 2MCPL 2DQTH 4D3CL 4DFHA 1DEEA 2LE9A 2Z31B 5I76B 2OTPA 2BERA 3K4AA 4ZYKB 5DK2B 5TE4H 4X6EB 4ZO7A 1MVUB 3O9WB 1NFDB 1EV2E 5C0AD 4Z7OF 5LGJB 3TH2T 4A6YB 3OXRA 1P9MC 3SDDB 1YN6B 4E41B 4WEMB 4GG6A 2JK5B 1OWWA 2OCFD 4KQ3H 4BQ8A 2ZSWA 2ZUYA 3IS1X 4M03A 4NUJA 4P46C 3NCEB 5D8JL 1P4BL 2Z8VC 4BK5A 2EEBA 5EO9B 4P2QD 3WNPA 4X6DE 2PXYC 2GTWA 1MF2H 4YHYB 5K9QI 3CDYA 3FO0L 4CW1A 2ZKHL 5KVDH 5AZ2H 4YHIB 3T3MF 2JJTA 5JW5B 4G6FB 2DL9A 2PYED 1D5XB 3AM8A 4LAJH 4XNYL 3VXQA 1LQSR 4DGIL 5IMKB 5DRZB 1HSAA 4PB9H 4NZDA 4JO2H 1JUFB 1SEBB 5D1XC 1NCCH 3I50L 4ZUVA 1XZ0B 2RB8A 3FN0L 3RNQA 3RQ3A 1TPXB 4RISH 5GS0H 4LHUA 1GOHA 2XPGB 3C8KB 4XHQA 2H9GB 1KTLB 5H35A 1MAMH 4U6TA 2ICEB 2OTWB 1VFAB 2DAVA 4YZFF 5T1LA 3KPRB 3TBWB 5HYQA 4K71B 4J23A 4TQEH 1G7IA 2KQMA 2C3VB 1HH6B 5D7KD 1Y18B 3ZYIA 5HHMD 4YXHL 4RAHA 4JRXD 4Z7WA 1U95A 2FATH 4Q7DA 2GSGA 3WXVL 1NFIB 2AERT 1KELH 2ZCHH 3QB7C 1JWUB 1MAJA 5DD5H 5JNYB 1ED3B 1J0JA 5EC2B 3BIAX 4NOFA 1I1AB 5E08H 4JKWA 2V9RA 4NC0B 3SDXB 4TRPL 1HQ4B 3KXFD 3VFVA 4NJAL 5CLWA 4F9PA 4F33B 5BJTA 1PLGL 4K7PX 3RNKA 5TE6H 4JRYD 1QSEE 4N0UE 4NRXA 4F80A 4E0RB 5B39A 4I0PA 2DQFB 3M8OH 3ARUA 4K07A 3FQRA 2Q8AH 4HCRH 1VFBA 4N8PA 4Y5XB 3B5TA 1Y0LB 2IALB 1RJYA 3B5GA 5A43C 2G60H 4OLUL 32C2A 3OXRB 5MERA 1FG2B 4OQTL 4BSVB 2CKBL 2A9NH 3FKUS 1I9IH 3CXDL 4Q9RH 5DJYB 4IJ3B 5E99H 2ZSWB 1WAAA 1C08A 1UB5A 4TUJB 4O2CA 2HH0H 3QPXL 1EEYB 1NBYA 4LMQI 2O26U 2GQHA 3OKKB 4PD4J 2AV7B 2YPLA 4Y5YB 1YEKH 2OBGA 2R0KL 5EUOB 1KLUA 4PRDB 1FV1B 1D5MA 4Y19D 4IRSD 2R29L 4YK4C 3UYRL 1PSKL 2FZ3B 2P5WA 3ARGB 5GGRY 4PLJD 1UCBH 2FHCA 1CXKA 1H9VA 2BDNH 2BRQA 4F7EB 3EDDA 4PRIA 4MQ7B 2EYRA 3ZE2F 1OTTD 4YR6A 3QI9D 4U1IA 2VQ1B 5DRXB 4PJDB 4UDTB 2GW5A 5ADOH 1MJJA 2MHAA 2DKSA 1KN4L 5HYQB 3OQ3B 1S9XB 4YDLC 2R0WH 4WUUD 1RURH 4NO3B 2R1XB 3O2WH 1QBAA 1IAMA 1UWEH 4XBPB 4V1DE 3VFOA 5I1KL 3QDGD 5TDOB 2V7NA 4CMHC 3GSVB 1C12B 2E9WA 1W0WA 2QSQA 1DBJH 4IRSC 4M6OH 2EYTA 3SQOH 4AEEA 3JV5A 3P2TA 4ONFL 3ETBF 4XBGA 2GITA 4EEEA 2OK0H 4PLJC 1JMZA 3PDOA 5JMOC 5DMYA 2ITCA 3CK0L 1U8PA 1IEAB 3VA2C 3VFMA 2MFNA 5I66B 4U1SB 5EU7E 5LQBH 1QTYT 4JHWL 3BAEL 2FO4B 4K8RD 5FM5M 1OTTC 3QI9C 2FO1A 2G75B 4XNZB 1AE6H 3LKPB 4GAJH 1VFBB 4JDTH 4W4NA 1G84A 3BFOA 1VEOA 2VUYA 4UUJA 4P4RA 3UP1A 4XPGH 3TIEB 3JUZA 2OQJA 5DLML 3GBNL 3MLVH 4JVUA 2YWYA 5ISZD 4HQQH 3ULVD 2CIKA 2F53B 5GIRB 3VGAC 3QEQD 4PGZA 2YSSB 4AG4H 9CGTA 1JI1A 2L7UA 4XMKH 5BVPL 2AEQL 5FDYA 4HC1H 4U1NB 2BVEA 4BH8A 5F7MC 4RZCA 2KZWA 3O6LL 2ATPB 1NGQH 1WSST 3CC5B 2ARJB 3OB0H 5C0BD 1MEXH 3DO3A 4U2YA 4X80H 1M7DB 4PLKD 1ITBB 2OI9B 1TETH 5T1KD 2EEAA 2VQTA 4C56B 2CO6B 4KAQH 1F6FB 2BHYA 2VLJD 4M48H 2PYFA 3I6KB 5E4IA 3D3VE 2NY2D 2QR0A 5FGBC 1WBZA 5INCB 4K8RC 3I6GB 4JFQA 5ICZB 3WCYA 1CWVA 3P4LA 3TJEH 1U3HB 2PW1B 1DBMH 2Q6WA 4L4TA 4EKXA 5E2JA 2IBZY 1Q0YH 3ULVC 1TJHL 4LSPH 2X4NA 3PQYD 3GSNA 4WI6A 2XXMB 2MCG1 3JUYA 2DQHL 4OZHE 3T65B 4J3SA 3MOBH 5DK0B 1WGOA 4HF5L 5DJ2A 5EOTB 3VFOB 2R2BA 3RBGA 1JMXA 3BQUD 1Q0XH 1A3LL 2YD5A 1RSFA 1FN4B 2V7NB 4R26L 1JYVA 4HWBA 2KUTA 4M61B 4OF0A 1OQOA 4QGTA 5EU6B 1ZLWK 4PLKC 2EYTB 5C07D 1R24B 2MCPH 3QHFL 3ULSB 5BRZB 4MD0A 4WI7A 4NO2B 4YC2B 1A22B 2WNGA 3GHEL 1I8LC 3EYUL 3HCVB 3ARTA 4XP4H 2NY2C 2BOCB 3BT2H 1TNNA 4G6JH 1JNLH 1X5KA 4JM4L 2BHUA 4ZFZA 4H88L 2WINA 3MRGB 5FYKE 4WWID 3CSPA 2XIDA 2R39A 3F7RA 3QFJA 4PGCA 1IKNC 3V5DB 5E8NB 2FHBA 1K8DA 4MXWH 4U0RC 1P7KA 2AQ1A 4MGXA 4MMZC 4ELKA 4KHXL 3TYGH 2NTFA 4DN4L 3MJ9A 1UWGH 3MLXL 4U1HB 2H2SD 1SQ2N 4MAYD 1VACB 3DUSB 1TZIA 2IBGA 1MCLA 3LEYL 1KEGH 2W91A 3BQUC 2SEBA 5C09B 2NY7H 3BRGC 3WDJA 4XNYH 4RZCB 1V5JA 4LSRH 4TNVK 2WP3T 4QRRB 3R4DA 5JIHA 4XXCA 3IAQA 4MSWA 5B38G 2XTLA 3MLRL 4YHLH 4D8PA 2GK0A 3V79C 1XF1A 1IGMH 3T2PA 5C9KA 1G6VK 1FIGH 3UTOA 1CLYH 3MNWA 3EYSL 2PYFB 1OF2B 2XN9A 5E6ID 4ZFGL 2L7JA 5AZEL 1A3RL 1WBZB 4O02L 2F5BH 4AEIH 4NM8L 1YDPA 1TZGH 2OJEA 2X44D 3HC4L 1CDJA 1T3FA 2I5YL 4BZ1L 3EDEA 2UWEB 4HEPG 6FABH 4NQXA 1U36A 4G3YL 5EZOH 3M07A 5J9PA 3WXVH 1MCRA 1OD7A 3PHOA 5F88A 1KUMA 5I2IB 2H2SC 4MAYC 1KG0B 1GC1C 5IB3A 4YBQD 2FIKB 5FM8A 5B8CA 2R8SL 1IT9L 3D69A 4G8GB 4XCCL 1DE4A 4URTB 4RWYH 3FB6A 1MH5B 2BSTA 1K9TA 2DLGA 3EJZD 2X9XA 1KTKE 1E0OB 1QLEL 2VN7A 3MZGB 5EZJA 4NO0D 1LO0L 4KKNA 4YHMH 3S5LA 1XGTA 3FQWA 5I1IH 4PJXA 1YNKH 12E8H 3GJFK 5HHVH 5E6IC 1PKQB 3U82B 3FRPA 3S8WA 3B9KA 5I1GL 1ZA6B 1SBBA 4QKXB 5FYJD 3OR6A 4OGZA 2J1KA 5MEPB 1CL7I 1U92A 4YGAB 3CJJA 5J11B 2L0DA 1IAIM 2J8UB 4OLZL 2KDGA 2PW2A 3BN3B 4LKCA 1F13A 4MDJA 3UJTH 1XCTB 2ZUVA 3VJ6B 2BRRL 4PJ8A 1K8DB 3NH7H 1D6VH 1U9KA 3EOBB 4ELKB 4FQHA 2Z8SA 3RJDA 1KLGB 5DVNA 3LQAL 4KRMB 1ZHNA 4YBQC 3AROA 1T5XA 3VRIA 4F7MA 4HAGA 2OL3H 1TZIB 4N8VB 3D9AH 1RIUL 4LVEA 3H42H 5HDBE 3RWCB 4MB3A 3QCVH 1A5FH 1AKJA 1CFSB 3EJZC 4JKKA 3X3GL 1NJ9B 3SEPA 4EDXA 4JGMA 1CYGA 4GAFB 3TPKA 1J0IA 4WGVB 2Y6SD 3UPRB 2GK0B 3LPWA 2YBRA 2VLKE 2R9HD 2F54B 3WO4B 2M8XA 4HWUA 3U2SA 3MNWB 1F00I 3OJDB 1OTSD 4FQJL 4RSVA 1WCBB 1HHJA 3MZTA 3QDMD 4P9MH 2NW3B 4UI2A 1F4AA 2XT1B 1FL5B 3QO0B 4MZ3A 2Q7YA 4TYUA 5LXGH 5BQ7A 4XP1L 4CADB 2HJKA 3DVIA 5J9PB 4Z77A 4X9FA 3ABZA 1OP3H 1NFDF 2PNDA 2H1PH 3MODL 2EDDA 2Z8WC 5J8OA 2VDKH 4AMKH 1RZIB 2YD1A 4HFWA 4F2MA 3RP1A 1RIVH 5HDQH 2ED9A 4LFHG 3UO1H 5EFIB 4KZEL 2OL3B 3N9GL 2RGSA 3I75A 2A9ML 1ZA3B 3CXHK 4RBPK 1FDLL 4JHBA 1FYTD 3HPJA 1T21A 3VGFA 2Y6SC 5DRWA 1FPTL 2AI0L 2R9HC 3ARWA 3MQIA 3S5LB 1OAYH 3KS0H 4DOHE 2A6KA 4EI5A 1FO0A 3Q6GH 2AXFA 4PV8A 4PJXB 1OTSC 5DMJB 5F6HI 2KKQA 3RDTB 2AEPH 4G43A 5IW6B 2FECL 3V2AR 3PWPA 1MJ8H 1I3GH 2FGZA 5EZIL 2APVA 1U92B 3T1WA 3N1QC 2DN7A 3IU4H 4KK9D 3SE9L 4KQ4L 4LHUG 4UDUA 3DMMA 3TNNA 1G1YA 4P2QE 4PJ8B 5FHBL 3W0WD 1U3JA 3S6CA 3L3HB 3VRIB 1UEMA 1MCKA 1RZGA 1NGXB 5F97E 3OJVC 2PYEE 4PFEA 3B3IA 4JKPL 4D9LL 4G8EA 3VH8A 4RNRB 1WEJL 4Y5VC 4OM0L 3U36A 2BVUA 4M00A 5DMKB 5AYUH 4LLVB 5BS0A 3BI9X 1GGUA 1FO0H 4MJIB 4CU6A 1DANT 5GRWA 4DVRL 2N4IA 3V6ZA 1JI2A 2XACC 2YBRB 3K74B 5DWUH 3SDXF 3VFPA 3TLRA 4YPJA 2JCCE 4YX2H 4LSTL 1UWXH 2FJGA 2O5ZL 1BJ1J 2P5EB 1HHJB 5I17B 1A7BA 1CFNA 1NAML 1KJ2H 4DJMA 3NMEA 5DHVH 3MLPA 3FN9A 4O2FA 5D7KE 5B39G 5I1AA 1RIHH 5HHME 4DGYL 2Q7YB 3OF6A 3T0BA 4JRXE 5MI0B 1FNSL 3HI6L 1LP9B 3MRLA 1HINH 3MRPA 4NGHH 3RZCD 1EMTH 3DX8B 5D1QC 5FO7B 5HYIA 1TXKA 1MVFA 4W4OC 1F6AB 2AP2A 4QRSA 1MWAH 2WW8A 2NW2A 2E7HA 3LKQA 4HPOH 3ROOA 4J6RL 5ACZA 5LJYH 2P7TB 2XZCH 2YOCA 2XI9A 4JRYE 3VXUD 2AEIT 3VXSB 3HMXA 3HPJB 4H88H 5EUOF 1OWRM 5CZVH 2EDQA 4NO5A 2ZUSA 3P9WB 2A6KB 4UINH 5EA0H 2QKIA 2FWOB 1FO0B 4PR5B 5F9DC 4R7DB 1QKZL 4N8CH 2BX5A 1OGAE 3TN0D 4OZ4B 4TUKH 4KHXH 4FZ8H 3THML 4DQOH 3PWPB 4PJAE 5L2KD 4XP9L 1HYSD 3A6OA 2MPAH 1MI5D 2WK2A 4M1GL 2V9TA 3VXTA 4F37K 1KJ2B 4WTZA 2ZCKL 4KV5F 4LSQH 5DHVB 3SGDI 1CCZA 3DMMB 2JJUA 4LSSH 4NFCA 2P8PB 3WEXB 5IF0A 2BMKA 5DI8A 3BKJL 3RZCC 4PJDF 1IZJA 3QQNA 3CVHL 5GGSA 2CGRH 4DAGL 3KR3L 3MV9D 4G6KH 1NGWA 1P69B 1UZ6E 4GBXD 3S34L 3L5WB 4RFEB 3H7BB 3B3IB 1U93A 2X5PA 3ECBA 1SJVA 3EYSH 4NZJA 1BZ7B 1MWAB 1KXTB 4JPVH 4LLYB 4XVJL 3VI3E 2HP4A 1XIWD 3O3DB 3KPLA 4RAVA 4XCEB 5DJZA 3LZFH 3V6ZB 3CDFA 3KHQA 4UIKH 4LU5H 3RPIB 2J6EL 1UM5H 2X09A 2BXYA 4WIQA 3TN0C 2ZWLT 4JN2A 1HYSC 1I4FA 5EBMA 2GHWB 4RMRA 5D7JA 5ITFA 1Q94B 4WUUE 2DWDA 1SYVB 1FL6A 4CDHA 1G1CA 2NY5C 1VHPA 4NNYA 4QF1A 5CD3B 3UJIH 3AY4A 4LGRB 3QDGE 2BNRD 5CWSB 3VD5A 2VYRE 1MCSA 3FQTB 4HXBH 3MRPB 5F89A 4XXDA 1SEQH 4Q2ZA 4PJGE 4IS6A 1F4YH 4ORGB 4GBXC 4ZG1A 2DWEA 4Z7VE 3QIUD 2NW2B 5EO0A 3JBG7 1B88A 4J12A 4JY6A 3Q3GB 2WLZA 1HK6A 3W9DA 1RZKC 4KKLC 4YO0B 1B4JH 4UZGA 5AWNL 2R1WA 3VG0L 1F5WA 1XIWC 5E8OA 1JZ8A 1D5ZA 5JA9A 1AO7A 1ZWIA 5C1MB 3PP3K 3WIFA 1NL0L 4NHCH 2ADJB 5F3HA 4MS8D 5SWSE 2HKHL 2D31B 3LDBB 4FXGA 5ISZE 4S2SA 1LWRA 1FFNB 3QEQE 4OD1L 4GAGL 5K93A 4I3RL 5H94A 4KKAD 3A67L 4KXZH 1NDMA 5I74C 1RIUH 1KYOJ 4OLXH 1NMCB 1YEGL 4GH7B 3WSQH 4L8SC 4M8VA 1TJIH 3B2UD 2BMKB 3PGCA 4NRYA 4L3AA 5C0BE 5I16A 1QYGL 4GSDH 5IMLB 4JY4A 5SWZD 4YFEA 2A74A 3QIUC 4M02A 5DJ6B 5C6TL 1A7QH 5FYLH 2CIIB 4UB0L 5KAQF 3W11D 3ARFD 2VLJE 4NNXA 1U93B 2DMCA 4GMSH 4I0KA 5DZNA 2FSEB 3PWUB 3U7YH 3EW3B 3MRCA 3VFGH 4PG2C 2VDRH 4DCQB 3C09C 1HEZB 1G9MC 2A73B 3L95A 5CSZA 3OKDB 4U6YA 3FQNA 4LCWD 3BZDA 4RAVB 3RWEB 1F11B 1KPVA 3BVNA 1ZLSH 5C2UB 5GS2D 5BOZG 4KU1A 2B2XL 1AI1H 4MS8C 1O0VA 3BP7A 5D7LA 4FHBD 1QRNA 3PQYE 5C3LD 3MTRA 3HC0A 4NFBA 2YD6A 4C83B 4IRJD 1RHHB 2VIRA 4KKAC 1MRFH 1S9WA 5DD1H 2NLJA 3EJJX 1FZJA 5E00B 3O45A 4QF1B 1T0MA 1I8KB 3QXDB 3B2UC 2NXZB 5ANME 1EH9A 3TZVA 1WK0A 3K81A 2CXKA 4FFZL 4WRLA 5I1LA 1M6OA 1S9YA 3PXJA 2I07A 5C07E 1KGCE 4G6MH 3DX7A 3W11C 4R4FH 3ARFC 4UIMB 5EO0B 1XCQB 4IDJL 4UAOB 4FG6D 4XVUD 1A7PH 3TA3B 4X5WB 2KL6A 4ZOBA 4DW2L 5LWYL 1ZLUK 1JZ4A 2R1WB 5EOCL 5E8OB 5IVXB 1J1PL 3TVMB 5EOQL 3C8DA 4XH2B 1YY8A 4I18B 5C08D 1D5ZB 5HHQB 1I8MB 4KQ4H 3NGBC 4GKZA 4KUCF 2W0LA 3BRDA 1J1OL 4M6NL 1EFXA 1MNUH 4XZUA 2IANE 2VXTH 2WIIB 5DYOA 5DC0A 5IQ9A 3SDCA 1QFWI 4IRJC 4M1CD 4PJCA 3S37X 2HTKD 2NY0D 3QIWD 1ZGLA 2K1MA 4DGVL 2BVTA 1VENA 1S8DB 2UWEF 2FIRT 3I2CL 5B3NA 4NQCD 2OZ4H 3WUWB 3DSNA 4M8QA 2WBJA 4Y1AB 3PV6B 5KVMC 1CDUA 2QHRH 2NNAA 4XNQA 1AY1H 2NY3B 4FG6C 1UH4A 4XVUC 1JZ6A 1R3HA 1QPXA 1EXUA 5EZLB 3OKLB 3QUMH 1YJDL 1YYLH 1AD0A 4PRPD 3RAJH 1LK2A 2FLBT 3QIBB 4LEOB 4MNHA 1CFVL 2ARWA 1LGVA 4AT6B 1YNTB 2Z0BA 2E5EA 3RY6A 5T3XD 5C7XH 2FH6A 2VLRD 4MZ2A 4OCSL 4YEFA 3LKRA 3DHJA 1V3KA 1V3LA 4KVNL 1UA6H 2WUBL 3BP7B 3G6JE 5TDPA 3RGVA 1BM3H 4X7TA 3UTZA 2P8LA 1QRNB 1E27A 4M1CC 2HTKC 5DK3A 2NY0C 3QIWC 4NWUL 1S9WB 3MYJB 2CLZA 2NLJB 4OD3L 1CFTB 1I3RA 1FZJB 1SY6A 2J8UF 5CIPA 5E4EC 5I1EH 4WFGD 1EPFA 2P8MA 5HJ3A 4PRBA 3ZKSD 3MLUL 1QZ1A 3CFJB 4XBEL 1EJ6A 5F9JA 3ARDD 1F3DJ 1M6OB 3FN3A 4LSUL 1VFOA 1DL7H 3PF2A 3DX7B 1TVBA 4X6DA 2CMRH 3RTQA 3NPZB 5D93B 1OT2A 4RGMB 2ICCA 1A9BA 4O9HL 3QO1B 2HLAB 3NAAH 3CZJA 4K7PL 1E6JH 5EIIB 1E28A 5FYJE 2HYMA 3QUMB 4FTVD 3GBML 3BWUC 1ZEAH 1T1YB 3CFEA 3LKNA 5EUKB 1JRHI 4D0DB 3WBDA 5BZDA 4OGAD 2LV4A 4M1GH 1OLLA 3KYKL 2XNAA 1EFXB 4PJHE 1AHWB 4E5XA 3UYPA 4EUPA 2B1AH 3CXHJ 5IQ9B 1CZ8L 1NC4A 3RWFA 3L5XH 3ZKQD 4YDKL 1FHGA 2G9HA 3SCMA 4RGNB 3MLSH 3OGOE 1INDL 5CINH 5IJKC 4K3HA 3MXVH 5FK9A 4JAMB 5F9AC 5TJWK 1KIQA 2Z91B 4RAUB 3O6FD 4PBWD 3ARDC 2QSCL