2HUGA

3d solution structure of the chromo-2 domain of cpsrp43 complexed with cpsrp54 peptide
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
57
structure length
57
Chain Sequence
GSQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle 43 kDa protein, chloroplast
publication title Assembly of chloroplast signal recognition particle involves structural rearrangement in cpSRP43.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 2
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2hugA00
2VXWA 3IL8A 2JYOA 1BF4A 1HFGA 1WTPA 5CORA 5CMDA 1J8IA 1B2TA 2X6LA 2B2TA 2KOLA 1DONA 1XX8A 2MPMA 2EE1A 3FPUB 2FMMA 4IUTA 1NR4A 2B2WA 2HCIA 3I91A 4LMQD 3R93A 4X3SA 3GV6A 3MWYW 2DY8A 2B2YA 2RA4A 4CJ2C 1J9OA 1F9PA 1B50A 3I8ZA 1GUWA 2MJ8A 1DOKA 1ILQA 4ZKCB 1RODA 1SAPA 1CM9A 1S4ZA 2HUGA 2K04A 2H1EA 1NR2A 2L4NA 3P7JA 1U4MA 1EOTA 1VMCA 2FJ2A 2HDLA 3D6WA 1PFBA 1EL0A 1BNZA 2HDMA 5EJWA 3TZDA 2KEDA 1AP0A 3H91A 1M8AA 1IKMA 5T1GA 2K01A 3IFDA 4NW2A 1JICA 2MGSA 2X6GA 2L11A 4OIKA 3G7LA 5COYA 1MSHA 1NAPA 4XT1B 4OIJA 3DM1A 1G2SA 2R3ZA 2L9HA 2Q8TA 1BBXC 1WD1A 1G2TA 1HUNA 1KNEA 2HCCA 3DEPA 4ZKBB 1U4RA 1VMPA 2FINB 1G91A 4MHEA 1O7YA 1LV9A 1QG7A 1U4LA 1WTWA 2B2UC 1G6ZA 2B2UA 2L12A 1C8CA 5CBEE 4IUQA 2D9UA 2NZ1D 1WTVA 1F9SA 2JP1A 5E4WC 1DOLA 4O42A 2BDNA 2X69A 1O7ZA 5D14A 2K05A 1WTOA 3ONAB 2NWGA 5EPJA 1PFMA 1JE4A 5EPKA 3SVMA 1ZXTA 1MGSA 2DY7A 3N52A 3I3CA 3I90A 1MSGA 3Q6SA 4HAEA 1HHVA 4CJ1B 2K28A 4IURA 4RWSC 1F9QA 1CA6A 1ILPA 1A15A 3DEOA 2EOTA 4ZLTF 2KUMA 1MI2A 1SDFA 1HFNA 1ML0D 1B53A 3KBXA 5CBAE 1WD0A 1F2LA 4DN4M 2SDFA 1CA5A 1EIHA 2B2VC 3F2UA 2B2VA 1PFNA 2FFKB 2N88A 4R9WA 1IL8A 2L1BA 2CVRA 4HCSA 4XT3B 3MTSA 4IUUA 5D65A 4QUCA 2RSNA 4X3UA 1EQTA 3TN2A 1QE6A 2FHTA 1KNAA 3KUPA 1WVLA 3GV3A 4U68A 4QUFA 1HUMA 1IKLA 2Q8RE 4X3KA 5T1IA 5JJZA 1Q3LA 1U4PA 1RTNA 2MP1A 4R8IA 2KECA 3FDTA 3UI2A 2KVMA 1B4OA 1ICWA 1PLFA 1AZPA 1X3PA 2B2TC 5EPLA 1DOMA 1NCVA 1RJTA 2K03A 1WTRA 2RSOA 1ESRA 1WTXA 1HA6A 1DZ1A 1RTOA 2B2WC 2IL8A 4IUPA 1B3AA 4RA8A 2J7ZA 5DNFA 1F9RA 2RVLA 5AFWA 1TVXA 3LWEA 2XIWA 1PDQA 2B2YC 1RHPA 2EPBA 5EKIA 1X3QA 3HP3A 1HRJA 1X32A 1SSOA 2KEEA 2NYZD 4X3TA 5EQ0A 4ZAIA 2K1BA 1BO0A 4UAIA 4CJ0B 1E0BA 1EIGA 2M2LA 1WTQA 4MN3A 1O80A 3QO2A 1AZQA 4HSVA 4XDXA 1QNKA 2N55A 4IUVA 5E4XA 4ZK9B 4RAUC 1XYIA 4HEDA
chains in the Genus database with same CATH superfamily
5CORA 1VQ8A 4P2CB 1CI3M 4K0KQ 1VQKA 4OEMB 3ZJYC 1FR3A 3S9WA 3KK7A 5C4ZA 1RL2A 4A3GG 3E6ZX 3I55A 3BYYB 4UY8C 2RKSA 1K83B 4JI6L 4DV0Q 5I9OA 2Z9HA 4DV1L 3CMAA 1ESFA 4GLXA 3NQTA 2EXDA 2WAQG 1YI2A 3E5SA 1V8QA 1BNZA 1UEBA 4DKAC 1XWEA 2KBNA 1SLJA 3W3AA 4PMBA 3S2HH 3ULJA 1PH4A 2JA6H 1HZCA 2BCOA 1EU4A 1PRTF 1WCMB 4QL5A 4DUYQ 1V1OA 2ZJQA 3CF5A 1F2YA 3RMHA 4B9XA 4BS9A 1HUNA 4ULLA 2HCCA 5DM73 2BA1A 4PG3A 2ASBA 3GD7A 4GOPC 1W6JA 2PMZE 4P72A 4DV4L 3K5OA 4LFBL 1EY9A 4EGVA 2LMCB 4IURA 1STHA 1BCPB 2AQ1B 4PZ6A 1HJPA 5K36G 1B53A 2PZWA 5CBAE 2E2HB 4FP5D 3S17B 2XTIA 2EQSA 5E1FA 1A8VA 3HOXH 2DN8A 5IP7H 2DGYA 2E2HH 1IBLQ 2J0TD 2KHIA 1Q3LA 2ID0A 2OEOA 2IPKD 4G4KA 1H9SB 5JEAG 3CCJA 1YHBA 1YJWA 2ZT9C 4LUZA 2JA8H 4JV5Q 3OIPA 4IO9A 1A3UA 1X3GA 1VQ7A 1HRJA 5I2XA 1MJEA 3L2PA 1N36Q 4MN3A 1B7YB 5IYCH 4B3RL 3CHBD 3LX0A 4QCLA 3IRBA 4IPCA 3T1YL 2HHHQ 3M4QA 2Z1CA 1BOSA 4A3MH 2WKCA 4XXEA 4A3DG 4S3SA 2KOLA 1DONA 1XX8A 3FPUB 1Y1WG 4JBMA 1EYCA 3T53B 4CGYB 2UU9L 2HCIA 1C7YA 4UHVA 5C3EG 3ER0A 4RH6A 3CC4A 4BY1H 1JT8A 5JOBA 3M3YH 5C5MA 2I5LX 3ZYYX 1YNND 1TT2A 2CH4A 3J80L 4KLKA 3HOWG 1H9RA 1G8ZD 1S5CD 1I6VC 1ENCA 4GNXC 3D6WA 3NTHA 1WJJA 1IBML 1AP0A 4OIKA 4HJ9A 4FO2A 1PH8A 1EFWA 4C56C 3S1NH 1KDBA 3FPPA 1S5FD 1EY0A 1X56A 3DM1A 1QB5D 1UUPA 2NN6H 2CFMA 4J1MA 4NKLA 3KLSX 3CCUA 3S14H 2XNAC 2A6ED 3OPOA 4AYBB 1I4QA 3FRPB 2P5ZX 1PXUA 3A0JA 4WJ3M 2F0WA 4PV1C 1TKWB 3MXNA 2K52A 3JAML 1GM5A 1CSQA 3L3OC 4V0BA 4J8QA 2N8NA 1EY6A 2CKZB 2K28A 1A15A 5CGKA 2JEBI 2EOTA 2N49A 2R6GA 1MD2D 3DEOA 2H5XA 2KCCA 4K2LA 1ET9A 1E24A 3F2UA 2AUJD 4JI7Q 1XNQQ 1M1KC 1PH5A 3W1GA 1IL8A 4QUCA 3S1MB 2XSCA 5M5XH 2FHTA 4U68A 3KF6A 1HQRD 2CH4W 3I4MG 4YY3L 3M4PA 1STNA 5IP9H 4A3FG 3UE0A 2WAQB 3MEHA 3A8JE 3SR1A 4LF7Q 4NPSA 2EXZA 3D0FA 3URYA 1YJNA 5C4XG 1PRTB 1KD1C 2HD3A 2XWBB 2I5HA 2A69C 1XTCD 4AH6A 1F77A 4CJ0B 5E3FA 3S1RB 3T56B 2NUCA 3K81C 3S2DH 2MO0A 3QO2A 3KYHC 1HXYD 1GKHA 4F7XA 1KL9A 1PVOA 4IUVA 3S1RH 1TY0A 1Z47A 5M5WB 4L5QA 2MUYA 1SYCA 2JJQA 1EWHA 3I73A 1Z6HA 4WJWA 1E1TA 4LMQD 1D7QA 2VQEL 4X3SA 4CDCC 2Z6KA 5FO7B 4N8X1 4DAVA 1N8RC 4P71A 1ILQA 2ICIA 2VUMB 2K04A 1Y8PB 4TVAB 5M5YB 4UP7A 2QEJC 1NMGA 2CQOA 2QGQA 2UXDQ 2VUMH 1E2ZA 3H91A 2EYMA 1HTPA 5FO8B 5M9OA 4YHHQ 2CWPA 4C3JH 2F3WA 3K57A 1QVGA 1NJIC 4DV5L 1KNEA 1P8LA 4DK0A 1N33L 3MFYA 2RCNA 1WTWA 1I6HH 4EQOA 2LFNA 1E22A 1IW7C 2R7ZH 1H9JA 1TWHB 4A75A 4IFDH 4K6LA 1GHKA 4K0KL 3H09A 5IYBH 1L1OC 1HHVA 5FJ8G 3IFTA 3HOUH 3T51B 1OXUA 4A3DB 3J80E 4DV0L 3GTKB 2K32A 3RLNA 1Y1WB 4R9WA 2LSSA 4DR6Q 3C2PA 4HCSA 1A3VA 1EQTA 3CQZB 1KNAA 5C3XA 3GTKH 1Y69U 3M4OB 1IKLA 5ISRA 1B4OA 5IWAQ 4RGTA 4X66L 2AUKA 1NCVA 1RJTA 1SMYC 4B3SQ 4DUYL 1UE1A 2GN5A 1HNZQ 4IUPA 3M4OH 3AU7A 3VDYA 1H9KA 1JB7A 2EYJA 5EBDA 1GD7A 1IBKQ 1D6EC 3BDCA 4IUNA 2CCZA 3EVQA 2F0TA 2PI2A 3JAME 1I4PA 2I5MX 2A73B 3GTJH 2R93H 5M3MB 1KDAA 3W5OA 1KAWA 1KAAA 3M7GA 3NBHB 3K5LA 1XJVA 1D1KA 1S5BD 4RG1A 4BBSB 4IUTA 4ZCKA 1ET6A 5M3MH 3H3VI 1EZ8A 1AEXA 2SNMA 3F8TA 3J7AF 1RCVD 4A3IH 3I4NG 1O7LA 2EYHA 4C1NK 1HTLD 3SK4A 1Q46A 3I56A 1TS3A 4ZKCB 1IBLL 1SFOB 2IW3A 4DXGA 1EFID 1X54A 2DNEA 1SFOH 2R92G 1UE7A 1FJGQ 3KDFB 3HKZB 4ALPA 4X62L 2ZM6Q 3NBIA 3I72A 4A3FB 3NTIA 5J39A 1VQ5A 5JJIA 1S5ED 1YZ6A 5J1ZA 1HNWQ 4BY7H 1W6KA 3TZUA 4ZKBB 3NE5B 5C4XB 2OQ0A 2MNAA 1PH9A 2O5IC 1G91A 1CQFA 2HHHL 3OMCA 5FO9B 2D9UA 2OTLA 2IX3A 4JI1Q 5D14A 4KK7A 2NWGA 1HZBA 1ZXTA 1A62A 2VW9A 1D8LA 3A74A 4RCNA 1L0XB 2WINB 1FVIA 2WFWA 4KJNA 5G3LD 3SGIA 2K6AA 2KUMA 1ML0D 3MEFA 4HSPA 2D0OA 3KF8A 3VYTA 2CVRA 2RDHA 4IUUA 5KIXA 3J7ZC 4X3UA 4AQYQ 2RDGA 3PUVA 2YU9B 3J80i 1U0LA 4A3JH 1K28A 1NUCA 3D6CA 4R8IA 1P16A 2PMZB 2QEXA 1QNUA 2A19A 1HA6A 5CV4A 3CPFA 1GXDC 2B2WC 1BDOA 1GUSA 3A5ZB 1WOCA 2ZXOA 4I7ZC 1PHJA 4X3TA 2F0NA 2KEEA 4LF8Q 4QF4A 1H95A 1K8OA 2F0JA 1I3QB 3OW2A 4EQ5A 4H13C 2KHJA 5GQOA 3G71A 4RGOS 1X65A 1HZAA 1I3QH 2JYOA 1LACA 4FYDA 4GS3A 2O5JC 1MHWC 5FLXL 4HIMA 4F8MA 4X64Q 4OO1H 2K4KA 2EE1A 2KCMA 4DF7A 1DJRD 1NR4A 2B2WA 2MHVA 4XIGS 3VR2A 3DXJC 4JI7L 1XNQL 1VQAA 2K5VA 2RA4A 4GN4B 1HH2P 1XMOL 2QDLA 1AN8A 3HOYH 1J6QA 1RODA 3BU2A 1N34Q 3K58A 2K75A 2CQAA 2AWNA 4X6AH 1VQ9A 1N9WA 4NXMQ 4B08A 3OYYA 3J81c 1VQ4A 2ALYB 2N3SA 4LF7L 2F0HA 1U9RA 3NTKA 4NW2A 1S3OA 5FOBB 4WORA 1QVCA 4KD3A 1O78A 1PTOC 5C3WA 5IP7G 3HOZB 2UXBQ 1TWCH 1VDZA 5C5LA 1BBXC 5D3DA 2PW7A 2DJGC 1EYGA 1KABA 2VL6A 3NELA 1K8AC 4LF4Q 1CQVA 2YV5A 4MHEA 3PMFA 1QG7A 2AHOB 2JA8G 5TSSA 3M85A 1Q7YC 5CBEE 4C3HH 4UP9A 5E4WC 2VQFQ 2QA4A 3GTOB 3JC66 2AQ2B 4I65A 3OSOA 4KD4A 4GKKQ 4WJ4A 1BQQT 1C48A 1C9OA 1BVSA 3FEWX 3L7ZC 3PUYA 4A3MG 1E2WA 1F2LA 2I46A 4A3CH 3I4NB 2KJXA 4DV7Q 3S16B 2UXCQ 3PSIA 2UXDL 3HFZB 4X3KA 2R61A 1HA5A 1VQBA 3S16H 1BBUA 3J7YW 1E2VA 1IHZA 4YHHL 3PO2B 1JWMD 3HOVH 1ZKOA 3C46A 5IIFA 1Q8IA 2R92B 2B2YC 1CSPA 3OHXC 1DD2A 1X3QA 3HP3A 5IGDA 2NYZD 1Q12A 3H6MA 3PO2H 4UAIA 2I07B 3LNNA 4OX9Q 1Q1BA 1AZQA 1LO5D 1SE3A 3A54A 3HS0C 2NN6G 2KQ3A 3QIAA 4LF9L 4GKJQ 2F0IA 4IOAA 1TWFH 1PYWD 1I50H 1SE8A 2EYLA 4ODGA 3C1FA 1LT6D 3TQYA 1LTTD 1FNVA 4A3LH 1V43A 4LF6Q 2OCEA 1LTBD 3H0GB 4G7HC 1PH3A 2UUAL 4DR6L 1G291 2DY8A 2B2YA 4K14A 4DR1Q 4AYBG 1JWUD 1TU2B 2NZHA 2A69D 3U4VA 1SAPA 1X9NA 2EYPA 5KRUA 3GTQH 2NVYH 4GZYC 3EJIA 4NB3A 5ELBA 3RN2A 2PPBC 4B3SL 1JORA 2RHQB 1HNZL 3NK9A 4EX5A 1V1PB 4OGQC 5COYA 3CRLC 3KFUA 3RZDH 4YCVA 4ME3A 3VR5A 1HZ9A 1VCIA 4DR7Q 1I94L 1G2SA 2PQAA 2L9HA 4QY7A 2Q8TA 5H1SE 1IBKL 5IP9G 1F2MA 4RCOA 3S1QH 2Z0SA 1B9NA 1BUVT 5DEHA 3D4WA 1TR5A 3S2HB 2L15A 2JA6B 5HY6A 5FLXE 3H3VC 2K05A 5EPJA 2EJFC 3SVMA 4XQJA 1R4QB 4JVZA 1AE2A 1AW7A 1DXMA 3NBHA 4KI0A 2D2CC 1F9QA 2VB2X 5JJLA 4DGZA 3VYUA 3PGZA 2N78A 3BDOA 2JK8A 1KHIA 2EIFA 1EQQA 3PUXA 2N88A 5D65A 1RKNA 2JA5B 1ZYRC 1J5EL 2IX0A 3HKSA 1FJGL 1IW7D 2E5LQ 5FK9C 1CKMA 4DPGA 3SXHA 2JA7B 2F0OA 3TMEA 2JA5H 4JBWA 3MFGA 4DV2Q 3O13A 2UUBQ 3EFXD 1HNWL 3QB3A 4J15A 4JI5Q 1PDQA 2JA7H 1RHPA 4DAYA 2EPBA 3HOXB 2VUMG 1TXYA 3GDEA 2HIXA 3PIPA 4IN3A 4JI3Q 4C3IH 1PMRA 4MIUA 3W2DA 1QNKA 4DV6Q 2EZVA 3GTLB 2Q8IB 2JA8B 2VXWA 2X6LA 3IAYA 5EKKA 3NUCA 1LM0A 1X3FA 2ZXRA 2E2JH 1SMYD 2FMMA 2D0PA 5ELFA 3S15H 1Y1VB 3G4SA 3GTLH 2A74C 4LWCA 4XYOA 1X3EA 5M3FH 1RD9D 4DUZQ 2B63B 4CDDC 5IYBG 4AQYL 3I8ZA 4DR3Q 4DNIA 4JBJA 1GO3E 1Y1VH 1PZID 3HOUG 4A3MB 2HUGA 1L2FA 3J81L 1EY4A 2B63H 3Q22A 1WFQA 1VMCA 3H94A 2FJ2A 2L5TA 2C5CA 5AJ3Q 1EL0A 1KTKA 1MIUA 2FXQA 4ZUIA 1DGSA 1GUOA 2YTXA 4LUOA 4X65Q 4BY1B 2BH2A 4LF8L 2HT1A 3M3YB 2R3ZA 4JI0Q 1JOOA 1JOQA 1CKOA 2ZTEA 2NN6I 2RBMA 1U4RA 4LFAQ 4IPDA 3CCLA 1EIFA 1U4LA 4IALA 1G6ZA 1F2ZA 3TP5A 3LWUA 2LXJA 4IUQA 3ERQA 3NXWA 3J7AV 3S1NB 2TSSA 2BOSA 4X64L 4A3KH 1VQDA 4HCEA 3RLOA 3TS0A 3HEJA 1YIJA 3S14B 1XMQQ 2R93G 4F87A 1IXRA 2SDFA 1N34L 3PO3H 3STBC 2F0MA 3ERSX 2E76C 4DR4L 2RSNA 5M3MG 3KLWA 1LTGD 4DK3C 3GV3A 2E2IH 2F4VL 1Q81C 1SROA 2RCFA 4BBSG 1AZPA 3F1ZA 2EYFA 1WTRA 1OXXK 1K3BC 1HNXQ 1Z9FA 2RVLA 5AFWA 3BVMA 5FLMH 3NPPA 2WIIB 1JC7A 4GN3B 5M5XB 4LUVA 4JI8Q 1SSOA 3WOFA 2K1BA 2XRQD 3UDIA 1GJXA 1LT3D 2VS1A 1QUQA 1YITA 4BY7G 2RDFA 3T1HQ 3HKZG 4GKKL 3AFPA 4RAUC 5A35A 1ENAA 4DR2Q 4A76A 1CZWA 1YNJC 2NBFA 4V190 5EBCA 3TS2A 5LMUQ 5CR3A 2Z6KC 1DM0B 2KCTA 3S2DB 1J9OA 4DV7L 3HRZC 5ELOA 1YEZA 3R2IA 1FGBD 1NR2A 2PZUA 1RDPD 1EOTA 1CK1A 4Y52H 1QILA 5G3LF 4IOCA 1Y8NB 4K5XA 4A3GH 4K2KA 2AWOA 1NE3A 1TWAH 3G7LA 3E0JA 1V1QA 1QCBD 5CV7A 4ABNA 1UNSA 3DEPA 3HG9A 1FL0A 2SNSA 5LL6S 4M8AA 2CHBD 4CKBA 4K5WA 1XNRQ 2VY3A 2YTYA 5ELEA 4LW1A 3CCEA 2BDNA 2PO4A 2BE5C 1NBWA 4JI4L 2VB3X 4UPAA 4LF6L 1YBYA 4E6IA 1PTOB 3N52A 2HQEA 4ZQ3A 4C3JB 3I3CA 3UDXA 4IJLA 4J6HA 4DR1L 1TS5A 1PTOD 1TWGH 1I6HB 1JJCB 1HFNA 1PTOH 5DLQE 4H7BA 4HTHA 4JI2Q 3J81E 2R7ZB 1EIHA 1KQSA 1CKNA 4POGA 1S5DD 4A3EH 4OO1G 3TN2A 3AYHB 3L9AX 3EQLC 4A3BB 4P74A 1EQRA 2WB1E 4XQNA 2CW0C 1EY8A 2PNRC 3KLRA 4PQXA 4DNRB 3HOUB 4A3BH 2B2TC 1EUJA 5EPLA 1DOMA 1HQMC 4ZYSA 3OTOQ 4DR7L 2XVSA 1BR9A 4WFN3 3NP8A 2PI2E 4P75A 3OWFA 3K5MA 1VQCA 1SRUA 1PZKD 2OXPA 1BO0A 3OWEB 4MTNA 3E9IA 3BG3A 3BVGA 1LT4D 4KN4C 3AB9A 1OXTA 3SE0A 4DA2A 1XYIA 3HOZG 5J22A 2QKIC 1EOVA 5CMDA 5C4JH 2B2TA 2R7FA 5IT9c 4C3HG 2Y0SE 4K6DA 5L37A 1QJOA 1QOHA 3X3NA 4L5TA 1BCPC 1I4RA 3K7AH 4CJ2C 1B44D 2F0SA 3GTJB 4G7ZC 2R93B 3D4DA 1CHQD 1LTAD 3RR5A 3PF4A 2L4NA 2XGTA 3KJOA 3BZKA 2KEDA 4DV2L 1M8AA 4A3IB 2MGSA 4B3MQ 4JOIA 5J3BA 3HOWH 3TP7A 3NHHA 1OXSC 3VR4A 3DLLA 3DWPA 2EJGC 2FINB 1VQJA 5GAGC 1O7YA 4HJAA 3BZDB 2LKVA 4FDBA 3SDZA 5JVH3 2MO1A 2NZ1D 4DV1Q 3EBEA 3RD4A 1VQHA 2G5DA 3PO2G 1W3SA 4G57A 5C44H 1E1OA 5JJKA 4L8JA 1EEFD 4JV5L 4BY7B 4CJ1B 1H9SA 3K8AA 4RWSC 3B6YA 5JPMC 2V1CC 1B9MA 4BBRB 1OXVA 1II3A 5NUCA 1N36L 3GTMH 4IFDJ 1IYUA 2E75C 3BDLA 1QZHA 2B2VA 2JE6I 2FFKB 3MC0B 4JG2A 3AEVA 1IL2A 4BBRH 1ONLA 1WVLA 4QUFA 1GUGA 2Q8RE 3J81i 4HJ8A 2D5DA 4KHVA 4YWMA 3L0OA 3UI2A 4A4IA 1VQ6A 2NTTA 3H0GG 5DAUA 1CZGA 4DV4Q 1ESRA 3GP7A 3H3VH 4JI0L 3FP9A 4TKOB 2B8FA 4DV3Q 1PZJD 1R4PB 3K0YA 5BN3A 4LFAL 5HGQA 2PZTA 4NDXA 4A3JB 1EIGA 2D62A 1VQGA 1M4VA 3T4AC 5ELNA 5CV5A 4GOPB 1Q86C 1XPRA 2ENBA 3FKIH 4HSVA 3T13A 3G48A 4JBKA 1ZYRD 5E4XA 1IYJB 1KLUD 4HEDA 1MBYA 3DWQA 4G7OC 1EWCA 1QWYA 1J8IA 3T16A 1Q1EA 1I4GA 5KYLA 2MPMA 3VA5A 4OO1I 2M9VA 1EIYB 3F2CA 4ILWA 4R4QA 1KRSA 4C1NI 2OF1A 2I0QA 5IODA 4YWKA 2F0VA 2JA6G 3ICEA 1CM9A 1S4ZA 2C9OA 2WAQE 1O7IA 2E2DC 3DUZA 3P20A 4KY7A 3TZDA 3R2TA 4L5SA 2YYZA 5T1GA 4JYAQ 2KCNA 1ASYA 2A8VA 5HURA 3JAMi 3PV0A 5C0XH 2IWHA 3HOYB 3NQIA 4KV6A 5I6YA 1PRTC 2JSOA 3QWNA 4C2MH 3M4YA 4YCUA 2JA5G 3RN5A 2GVBA 3Q8DA 3D3RA 1PV4A 2F4IA 1STGA 2RHSB 1STEA 4PNYA 2B2UA 2E8GA 2JA7G 3J81j 1LYLA 1O7ZA 1X6OA 4DR2L 3E0EA 1A3TA 2EJMA 2PQEA 1TWCB 3A7AB 2OQKA 2DY7A 1VS0A 1UE5A 3I90A 3HOXG 5LMUL 2Q2HA 4KHPQ 1K0RA 4YCWA 3CP0A 2AQ3B 3ULLA 4A93B 1MJCA 3I2ZA 4C3HB 1XPOA 5EKLA 3GTPH 2LS01 1AH9A 3KUPA 4A93H 1PYBA 5FJ8H 3CCQA 2PCFB 5BN4A 4GNXB 3K6OA 3MXNB 2IJ0A 4LK1C 2MP1A 1L0WA 2KECA 1PLFA 4Y7NH 1R9TH 1Y1VG 3M9BA 2M00A 2BA0A 4TRDA 5IYCG 1RTOA 1IZ6A 4K8JA 1VQPA 2B63G 3KJPA 1WTHA 2A5HA 5I4DA 1LTRD 4ID6A 1GHJA 3RZOB 2ICEC 1DCZA 3BJUA 4OXPA 3KF6B 3STBD 3J80c 3GQBA 1YNXA 1CHPD 1G6PA 5KGUA 2K7VA 5KNCA 3HOVB 3MAQA 3RZOH 4BXXH 5IOCA 4YY3Q 1VQMA 4BY1G 1HFGA 5IT9L 4IPGA 3E3XA 2F3VA 4JCVE 1PH6A 1NSNS 2NTSA 3I70A 4JI2L 4DK1A 3CAMA 1DYQA 1ZEQX 3R93A 3W1BA 1YJ9A 2A68C 1SBBB 1GUWA 2F0PA 3OIQA 1TWFB 1I50B 2LXKA 2WP8J 3P7JA 5C0XJ 1U4MA 1B1ZA 2OT2A 2HDLA 4L63B 3OTOL 5KNDA 2HDMA 3F2DA 3PO3G 4KHZA 4UDUC 3MXUA 1AFPA 2X6GA 2JA9A 2EYOA 4GLAC 1YNJD 5JVG3 1A0IA 3GTQB 2NVYB 5LMNW 1TY2A 1YHAA 1FNWA 1K8MA 5CYUA 4M1UB 5FLMG 4N9PA 2L12A 1B3QA 1JMCA 3VYSA 1STBA 1ENFA 1DOLA 1Z7TA 5IWAL 3RZDB 2Q2UA 1WTOA 1PFMA 1EY5A 4QGUA 5IY0A 1K3RA 4HR7B 3A8IE 3S1QB 3K59A 2IY5B 4O0AA 5ELDA 3I4LA 2DJFC 2F0GA 3D4RA 1MI2A 2F3IA 2BH8A 4DAPA 4JC0A 5JPNC 4DK6C 2NVTH 3A55A 3V2TA 3V05A 4B3ML 3I4OA 2K33A 3NSWA 2BE5D 1A2TA 1SNQA 1X3PA 3C1EA 1WTXA 2BDOA 2IL8A 1B3AA 1BBWA 2J7ZA 2WV6D 4CHTB 1D2BA 5ELCA 4HIKA 2NZOA 1NNXA 5LMNQ 1E0BA 1WTQA 4DNTB 4U673 2GVAA 1N32Q 3D31A 2HIVA 3DHQA 4XYQA 2IHFA 4FF3A 2N55A 4GLVB 1K83H 2LY7A 2CW0D 1L1OB 2WB1B 1WTPA 2ZM6L 1SNDA 5I6WA 4X66Q 3Q24A 3KDFA 3KLSA 2ES2A 3PUZA 4C3IB 5CV9A 4BA2I 3QJYA 1B50A 5F2DA 3TRZA 1WCMH 1JB3A 2NVXB 1JR0D 4JI1L 2QF7A 4FXKC 4C3JG 1C4QA 1PFBA 4JW0A 3S15B 2E2JB 3CCRA 4OELB 1PTOF 1FD7D 2NVXH 4A3EG 4FXGC 5M3FB 2K01A 3SK5A 3NWSA 1JWSD 2G9HD 4DV3L 4RKLA 1CTMA 3WOEA 2R7ZG 5FKAC 4XT1B 5BR8Q 1JQYD 4IFDG 5D3IB 1T5EA 3U9SA 2Y0SB 1OTCA 4OWTB 4A3BG 4QB4A 1BCPD 3K5NA 5IGGA 2R7DA 1WI5A 5KYIA 4HIDA 4HJ7A 4H0LC 1MKHA 2WKDA 1S40A 2F0DA 1WTVA 4GOPA 5IT9E 3S17H 1HCZA 3DM3A 4FXDA 1JE4A 3CMEA 4NXNQ 1GVPA 1NY4A 3EROA 1SMXA 3QR8A 1BXTA 4KJOA 3UE1A 4CDFC 2XRSD 3G6EA 2H4OA 4KN7C 4X62Q 1C0AA 2K50A 4DN4M 2JEAI 2WACA 3CCSA 3MTSA 1VF5C 2ZXPA 5GROA 3Q23A 4A3KB 2E74C 2TMPA 4QMGA 1U4PA 3M7NA 4JYAL 4R8NA 2KHSA 2KVMA 5IGCA 3HZXA 1VQOA 2K03A 3BVZA 4PMWA 1QZGA 3K80C 5EGTA 4RA8A 2K5QA 3PO3B 1F9RA 1D1IA 3LWEA 2XIWA 1EQVA 3KF8B 2A6HC 2F0QA 3DMUA 3S24A 4QQBX 2E2IB 1KRTA 3ITPA 1HR0W 3GTGB 3I7FA 4DXFA 4NXML 2V4DA 3AQQA 3WDNA 3EIVA 1I5FA 4A3IG 1YHQA 1Y8OB 3IL8A 4KHPL 2VNUD 1FYCA 3GTGH 4OONA 4MTKA 2UXBL 4CKCA 5IYDH 5IGFA 4R1JA 3I91A 4NMZA 4CDEC 5CV6A 5IGBA 5C44G 4LF4L 1CT1D 4YIJA 2MJ8A 1STAA 1D5XC 4HMIA 2VQFL 1KDCA 1EY7A 2B3GA 4APVA 3VA7A 3PIOA 1CUKA 3OOCA 4GNXA 2JQOA 3IFDA 1SJHD 4R4CA 4AIMA 4BBRG 1TS2A 4EVOA 1MSHA 1PH1A 2ZJRA 4OIJA 4QIWE 4R4TA 1WD1A 3P1HA 2ZTDA 1GOZA 4TSSA 1SE4A 2O4XA 3VR6A 3SK8A 3CC7A 1BKBA 1UE6A 3MHBA 5IE8A 2UXCL 2OTJA 2F03A 1HR0Q 1XMOQ 3TP6A 4A3GB 1I4HA 3TP8A 2OWOA 4LF5Q 1TWAB 2JP1A 4O42A 1Q90A 1SR3A 3S1MH 5EPKA 1EWIA 2UUCQ 1GUNA 2F0EA 1L0YB 1WYDA 1W2BA 3FKIG 4BA1I 2RQXA 1E7ZA 1CA6A 4A3JG 1AE3A 4P73A 5GAEC 3KBXA 1WD0A 1PA6A 1SJED 1CA5A 1PRTD 4OX9L 3TBIB 1OO9B 4IJHA 1ICFB 2MFIA 4RGNA 1CFMA 2RF4A 4GKJL 2K5HA 4RHRA 5HGTA 1RTNA 3UDGA 4IFDI 3TDQA 1TWGB 2A1AA 2ZTCA 4POFA 5FLXc 4Q0FA 3CU7A 4HIOA 4A3EB 2B39A 5I9PA 5IGEA 3AMUA 5M5WH 4HN7A 5K5PA 1X32A 1EZ6A 2CWAA 2SOBA 1EEID 1U5KA 2EY1A 5C0XG 2HQLA 1KIXA 2QW7A 1JJGA 3DWAA 2ATWA 3CRKC 2NB0A 4L5RC 3K7UC 3VR3A 4Z9CB 1FGUA 1FNUA 3U50C 5K36H 1M90C 1BF4A 3HOYG 4PZ8A 5M5YH 5GADC 3AFQA 1V1PA 1VQNA 4B3TQ 4LJZC 1PH7A 4N9TA 1F9PA 1EYDA 3RUZA 1DOKA 1A6XA 4I7AA 5JEAH 5C4JB 4KKTA 4DR5Q 1SN8A 2JXMB 3KOJA 2QCPX 3X3MA 4LF9Q 1IKMA 4YWLA 1TWHH 2L11A 3K7AB 4IQZA 4A93G 1SNMA 4KKUA 4JOIC 4UP8A 4FF4A 5LMNL 5BN5A 1KXLA 3ND9A 3G6JB 1N32L 2UUAQ 2A68D 2KA7A 3IKJA 1ASZA 4PZ7A 5C3EB 2F1MA 3C3LA 1A63A 4A3DH 4RKBA 2E5LL 1F9SA 1Y1WH 1YVCA 2Q2IA 1STYA 3ONAB 4N8FA 4K8IA 4OWWB 5C3EH 1GUTA 4LFCQ 3CQZH 4IPHA 3HOWB 2B8GA 4A3CG 1KLGD 1VQEA 2AKWB 2IX1A 1L1OA 3Q6SA 2UUBL 1LABA 1T5XD 2PQAB 4JI5L 1XTDA 2K5WA 3UDFA 3RNUA 4BXXG 3CCVA 1XPUA 1D5ZC 4F88A 1SDFA 1UWVA 1I94Q 4JI3L 2B2VC 2Z6BA 4FF1A 3HOVG 4EQPA 5C44B 3TSSA 3MA2B 4DV6L 2IHEA 4JI6Q 4CBVA 4WRDA 4ZRZA 1SYEA 3PCOB 3BS1A 2F0KA 5KEEA 5BR8L 2RSOA 1SEBD 3GTMB 1SNPA 2L55A 4KY6A 4O2DA 4IZ8A 5EAYA 3CD6A 4DUZL 1TVXA 1K8GA 1RF2D 4DR3L 1HPCA 5CC4A 4ZAIA 2QDBA 3U9OA 1YNNC 4BBSH 2M2LA 1PYSB 1X55A 1I4XA 3P75A 4A3LG 1PFSA 5AJ3L 3A5UA 4NXNL 4KY5A 3V96A 3BZCA 4RFBA 2AMCB 5E7NA 1J5EQ 3FHWA 3NEMA 3I4MB 4OL7A 2YTVA 4X65L 1G51A 1SYGA 4LFBQ 1SYDA 3CKIB 4DAYB 3VYRA 4H44C 5I2YA 1JCKB 1LUZA 5JEAJ 5JAVA 1SE2A 2K5NA 3I4MH 1E3PA 3FKIB 2A6EC 4NP5A 4AYBE 4A3FH 4TQUS 3QOJA 1Y14B 2H1EA 3MZ5A 3Q0AA 2G9DA 3LGJA 4KTAA 2MQHA 5C4XH 5EJWA 3N6RA 1LT5D 2EDGA 2F0LA 1JE5A 1SNCA 1XMQL 1LTSD 1K9MC 2K14A 2ZJPA 3TEHB 5C0XI 5A2QL 5C4HA 1LLRD 1G2TA 3KBGA 3GO5A 2XWJB 3A7LA 1T9HA 1UEAB 1VMPA 2PYKA 5LL6X 3R8BA 5DM63 4R4OA 3CPWA 1LV9A 2B2UC 2L0CA 1QVFA 1C8CA 4B9WA 4LNQA 3QG1A 3PIP3 1K0SA 4B3RQ 3T1YQ 3ND8A 3TREA 3MXPA 1HNXL 2YU9H 5CV8A 1TIID 4HMJA 4C2MB 4HAEA 3A56A 2F0FA 1JJ2A 3FMCA 1H9MA 4JI8L 4ZLTF 2XN9C 2F52A 4JK1C 2UU9Q 4MZ9A 2J4XA 1PFNA 4XT3B 2L1BA 4JPBW 1QE6A 3R3OA 1LTLA 3T1HL 1SYFA 2WB1G 1SXTA 3K0XA 5JJZA 1NTGA 3FDTA 3SEBA 1WCMG 5GAHC 2PW5A 4LAAA 3SK6A 4C3IG 1Q82C 3OMGA 1IBMQ 1DZ1A 2QILA 5DNFA 3GTPB 4XQQA 1A2UA 3E9HA 5EKIA 1HR0L 4DFAA 4H02A 4BWGB 1XXGA 4LF5L 3F2BA 1O80A 4Y7NB 1R9TB 1TQOA 4XDXA 4K5VA 4DR4Q 5M3FG 2UUCL 4XTCS 3PF5A 3CXCA 2Z8LA 5C6AA 2F4VQ 4L6TB 4MNOA 1PH2A 1B2TA 1BCPF 2Y0SG 4FNFA 1VQFA 4GN5A 2EY5A 4RHSA 1SYBA 3GV6A 3MWYW 4ME5A 3NENA 3HOZH 2EY6A 2A6HD 2IT1A 1XNRL 1D5MC 1VF7A 1QUQB 2Z4IA 2O2LD 5LHY1 1KC8C 1B8AA 3EA6A 4DAMA 4RMFA 3MXGA 1K73C 1JICA 2JN4A 3D8GA 3GTOH 1NAPA 1V9PA 1SNOA 3FVQA 4R4IA 4OHJA 4KMUC 1VQLA 2NVQB 2DUDA 3HGBA 4ZUJA 4QJFA 4A3KG 2KENA 4HJ5A 3NWTA 1IYVA 2EVBA 4PMCA 4FVMA 4FF2A 2NVQH 4EQNA 1EYAA 2X69A 3I4NH 3CC2A 4B3TL 1B70B 3PIO3 1LTID 1MGSA 3PQIA 3PUWA 3JAMc 3EN2A 1NMFA 1EU3A 1MSGA 2GA4B 1ILPA 1S72A 3ULPA 2FMCA 1RIPA 2VQEQ 4QIWB 3WWVA 1VQIA 5IYDG 5KNBA 2R92H 4DR5L 2Q2TA 2VZAA 2C35B 1HUMA 5T1IA 2SEBD 2K5DA 2DNCA 1ICWA 3U58A 2PNHA 3J7A5 5A2QE 4JI4Q 1JOKA 2B29A 4DU9A 3QOLA 4O1NA 3BYTB 1CKNB 2Z4HA 4KKSA 2NVTB 5EQ0A 1UAPA 3H15A 3CCMA 1Q8KA 4Q5VA 3RLFA 3H0GH 3U4ZA 3A8KE 3CW2C 3MVVA 1TS4A 3OW7A 3SHLA 4DV5Q 2F0UA 4CKEA 1N33Q 4LFCL 4RGMA 4ZK9B 3HKZE 2EY2A 4OWXB
chains in the Genus database with same CATH topology
5CORA 4P2CB 1CI3M 1FR3A 3S9WA 3KK7A 5C4ZA 3E6ZX 3BYYB 2RKSA 1K83B 5I9OA 1ESFA 3NQTA 3E5SA 1V8QA 1BNZA 1XWEA 3W3AA 4PMBA 2BCOA 1EU4A 1PRTF 1WCMB 1V1OA 1F2YA 3RMHA 4BS9A 4B9XA 1HUNA 4ULLA 2HCCA 5DM73 2BA1A 3GD7A 1W6JA 3K5OA 1EY9A 4EGVA 2LMCB 4IURA 1STHA 1BCPB 2AQ1B 5K36G 1B53A 2PZWA 5CBAE 2E2HB 4FP5D 3S17B 5E1FA 2DN8A 2J0TD 1Q3LA 2ID0A 2OEOA 2IPKD 4G4KA 1H9SB 5JEAG 2ZT9C 3OIPA 1A3UA 1HRJA 5I2XA 4MN3A 3CHBD 3LX0A 4QCLA 2Z1CA 1BOSA 2WKCA 4XXEA 4S3SA 2KOLA 1DONA 1XX8A 3FPUB 1EYCA 3T53B 4CGYB 2HCIA 4RH6A 5JOBA 5C5MA 3ZYYX 1YNND 1TT2A 3J80L 1H9RA 1G8ZD 1S5CD 1I6VC 1ENCA 3D6WA 3NTHA 1AP0A 4OIKA 4FO2A 4C56C 1KDBA 3FPPA 1S5FD 1EY0A 3DM1A 1QB5D 1UUPA 2NN6H 4J1MA 4NKLA 3KLSX 2XNAC 2A6ED 3OPOA 4AYBB 1I4QA 3FRPB 1PXUA 2F0WA 4PV1C 1TKWB 3MXNA 3JAML 3L3OC 4V0BA 4J8QA 1EY6A 2K28A 1A15A 5CGKA 2JEBI 2EOTA 3DEOA 2R6GA 1MD2D 2KCCA 4K2LA 1ET9A 3F2UA 2AUJD 1IL8A 4QUCA 3S1MB 2XSCA 2FHTA 4U68A 1HQRD 1STNA 2WAQB 3MEHA 3A8JE 3SR1A 2EXZA 3URYA 1PRTB 2XWBB 2A69C 1XTCD 4CJ0B 1F77A 5E3FA 3S1RB 3T56B 2NUCA 3QO2A 1HXYD 4F7XA 4IUVA 1TY0A 1Z47A 5M5WB 2MUYA 1SYCA 1EWHA 3I73A 1Z6HA 4WJWA 4LMQD 4X3SA 5FO7B 4DAVA 1ILQA 2ICIA 2VUMB 2K04A 1Y8PB 5M5YB 2QEJC 1E2ZA 3H91A 2EYMA 1HTPA 5FO8B 5M9OA 2F3WA 3K57A 1KNEA 4DK0A 3MFYA 1WTWA 4EQOA 2LFNA 1IW7C 1H9JA 1TWHB 4IFDH 4K6LA 1GHKA 3H09A 1HHVA 3IFTA 3T51B 1OXUA 4A3DB 3J80E 3GTKB 2K32A 1Y1WB 4R9WA 3C2PA 4HCSA 1A3VA 1EQTA 3CQZB 1KNAA 5C3XA 1Y69U 3M4OB 1IKLA 5ISRA 1B4OA 4RGTA 2AUKA 1NCVA 1RJTA 1SMYC 4IUPA 3AU7A 1H9KA 2EYJA 5EBDA 1D6EC 3BDCA 4IUNA 3EVQA 2F0TA 3JAME 1I4PA 2A73B 5M3MB 1KDAA 1KAAA 3M7GA 3K5LA 1D1KA 1S5BD 4BBSB 4IUTA 1ET6A 1EZ8A 1AEXA 2SNMA 3J7AF 1RCVD 1O7LA 2EYHA 4C1NK 1HTLD 3SK4A 1TS3A 4ZKCB 1SFOB 2IW3A 4DXGA 1EFID 2DNEA 3HKZB 3NBIA 3I72A 4A3FB 3NTIA 5J39A 1S5ED 5J1ZA 1W6KA 3TZUA 4ZKBB 3NE5B 5C4XB 1G91A 2O5IC 1CQFA 3OMCA 5FO9B 2D9UA 2IX3A 5D14A 4KK7A 2NWGA 1ZXTA 4RCNA 1L0XB 2WINB 4KJNA 5G3LD 2K6AA 2KUMA 1ML0D 4HSPA 3KF8A 3VYTA 2CVRA 2RDHA 4IUUA 5KIXA 4X3UA 2RDGA 3PUVA 2YU9B 1NUCA 3D6CA 4R8IA 2PMZB 1QNUA 1HA6A 5CV4A 1GXDC 2B2WC 1BDOA 1GUSA 2ZXOA 4I7ZC 4X3TA 2F0NA 2KEEA 1K8OA 4QF4A 2F0JA 1I3QB 4H13C 4RGOS 2JYOA 1LACA 4FYDA 2O5JC 5FLXL 4F8MA 4OO1H 2EE1A 4DF7A 1DJRD 1NR4A 2B2WA 2MHVA 4XIGS 3VR2A 3DXJC 2RA4A 1AN8A 1RODA 3K58A 2CQAA 2AWNA 4B08A 2F0HA 1U9RA 3NTKA 4NW2A 5FOBB 4WORA 4KD3A 1O78A 1PTOC 5C3WA 3HOZB 1VDZA 5C5LA 1BBXC 5D3DA 2PW7A 1KABA 1CQVA 4MHEA 3PMFA 1QG7A 5TSSA 3M85A 5CBEE 5E4WC 3GTOB 2AQ2B 4I65A 3OSOA 4KD4A 1BQQT 1C48A 3FEWX 3L7ZC 3PUYA 1E2WA 1F2LA 2I46A 3I4NB 2KJXA 3S16B 4X3KA 2R61A 1HA5A 3J7YW 1E2VA 1IHZA 3PO2B 1JWMD 1ZKOA 3C46A 5IIFA 1Q8IA 2R92B 2B2YC 3OHXC 1DD2A 1X3QA 3HP3A 5IGDA 2NYZD 1Q12A 3H6MA 4UAIA 2I07B 3LNNA 1Q1BA 1AZQA 1LO5D 1SE3A 3A54A 3HS0C 2NN6G 2KQ3A 3QIAA 2F0IA 1PYWD 2EYLA 4ODGA 3C1FA 1LT6D 1LTTD 1FNVA 1V43A 1LTBD 3H0GB 4G7HC 1G291 2DY8A 2B2YA 4K14A 1JWUD 1TU2B 2A69D 1SAPA 2EYPA 5KRUA 4GZYC 3EJIA 5ELBA 2PPBC 1JORA 3NK9A 1V1PB 4OGQC 5COYA 3CRLC 3VR5A 1VCIA 1G2SA 2L9HA 2Q8TA 1F2MA 4RCOA 1B9NA 1BUVT 5DEHA 3D4WA 1TR5A 3S2HB 2JA6B 5FLXE 3H3VC 2K05A 5EPJA 2EJFC 3SVMA 4XQJA 1R4QB 1AW7A 1DXMA 3NBHA 4KI0A 2D2CC 1F9QA 2VB2X 4DGZA 3VYUA 3BDOA 3PUXA 2N88A 5D65A 1RKNA 2JA5B 1ZYRC 2IX0A 1IW7D 5FK9C 3SXHA 2JA7B 2F0OA 3TMEA 4JBWA 3MFGA 3O13A 3EFXD 3QB3A 1PDQA 1RHPA 4DAYA 2EPBA 3HOXB 4IN3A 1PMRA 4MIUA 3W2DA 1QNKA 2EZVA 3GTLB 2Q8IB 2JA8B 2VXWA 2X6LA 3IAYA 5EKKA 3NUCA 2ZXRA 1SMYD 2FMMA 5ELFA 1Y1VB 2A74C 4XYOA 1RD9D 2B63B 3I8ZA 1PZID 4A3MB 2HUGA 3J81L 1EY4A 3Q22A 1VMCA 2FJ2A 2L5TA 3H94A 2C5CA 1EL0A 1KTKA 4ZUIA 1GUOA 4BY1B 3M3YB 2R3ZA 1JOOA 1JOQA 2NN6I 2RBMA 1U4RA 1U4LA 4IALA 1G6ZA 1F2ZA 3TP5A 3LWUA 4IUQA 3ERQA 3NXWA 3J7AV 3S1NB 2TSSA 2BOSA 4HCEA 3HEJA 3S14B 4F87A 2SDFA 2F0MA 2E76C 2RSNA 1LTGD 3GV3A 1AZPA 2EYFA 1WTRA 1OXXK 2RVLA 5AFWA 3BVMA 3NPPA 2WIIB 1JC7A 5M5XB 3WOFA 1SSOA 2K1BA 2XRQD 1GJXA 1LT3D 2RDFA 4RAUC 5A35A 1ENAA 1CZWA 1YNJC 2NBFA 4V190 5EBCA 5CR3A 1DM0B 3S2DB 1J9OA 3HRZC 3R2IA 1FGBD 1NR2A 2PZUA 1RDPD 1EOTA 1CK1A 1QILA 5G3LF 1Y8NB 4K5XA 4K2KA 2AWOA 3G7LA 3E0JA 1QCBD 5CV7A 4ABNA 1UNSA 3DEPA 3HG9A 2SNSA 5LL6S 4M8AA 2CHBD 4CKBA 4K5WA 5ELEA 2BDNA 2PO4A 2BE5C 2VB3X 4E6IA 1PTOB 3N52A 2HQEA 4ZQ3A 4C3JB 3I3CA 4J6HA 1TS5A 1PTOD 1I6HB 1HFNA 1PTOH 4H7BA 4HTHA 3J81E 2R7ZB 1EIHA 1S5DD 4OO1G 3TN2A 3L9AX 3EQLC 4A3BB 4XQNA 2CW0C 4DNRB 1EY8A 2PNRC 3KLRA 4PQXA 3HOUB 2B2TC 5EPLA 1DOMA 1HQMC 4ZYSA 2XVSA 1BR9A 4WFN3 3NP8A 3OWFA 3K5MA 1PZKD 2OXPA 1BO0A 3OWEB 3BG3A 3BVGA 1LT4D 4KN4C 3AB9A 1OXTA 3SE0A 4DA2A 1XYIA 5J22A 2QKIC 5CMDA 2B2TA 4C3HG 4K6DA 1QJOA 1QOHA 3X3NA 1BCPC 1I4RA 4CJ2C 1B44D 2F0SA 3GTJB 4G7ZC 2R93B 3D4DA 1CHQD 1LTAD 2L4NA 2KEDA 1M8AA 4A3IB 2MGSA 3TP7A 3NHHA 1OXSC 3VR4A 3DWPA 2EJGC 2FINB 1O7YA 3BZDB 2LKVA 3SDZA 5JVH3 2NZ1D 3RD4A 4G57A 4L8JA 1EEFD 4BY7B 4CJ1B 1H9SA 4RWSC 5JPMC 1B9MA 4BBRB 1OXVA 1II3A 5NUCA 4IFDJ 1IYUA 2E75C 3BDLA 2B2VA 2JE6I 2FFKB 3MC0B 1ONLA 1WVLA 4QUFA 1GUGA 2Q8RE 2D5DA 4KHVA 3UI2A 2NTTA 5DAUA 1CZGA 1ESRA 3GP7A 4TKOB 2B8FA 1R4PB 1PZJD 3K0YA 5BN3A 2PZTA 4NDXA 4A3JB 1EIGA 2D62A 1M4VA 3T4AC 5CV5A 2ENBA 4HSVA 3T13A 1ZYRD 5E4XA 1KLUD 4HEDA 1MBYA 3DWQA 4G7OC 1EWCA 1QWYA 1J8IA 3T16A 1Q1EA 1I4GA 5KYLA 2MPMA 3VA5A 4OO1I 2M9VA 4ILWA 4C1NI 2OF1A 5IODA 2F0VA 1CM9A 1S4ZA 2C9OA 2E2DC 3DUZA 3P20A 4KY7A 3TZDA 3R2TA 2YYZA 5T1GA 2KCNA 5HURA 3PV0A 5C0XH 2IWHA 3HOYB 3NQIA 4KV6A 5I6YA 1PRTC 2JSOA 3QWNA 3M4YA 3D3RA 2F4IA 1STGA 1STEA 4PNYA 2B2UA 1O7ZA 1A3TA 2EJMA 2PQEA 1TWCB 3A7AB 2DY7A 3I90A 2AQ3B 4A93B 4C3HB 5EKLA 2LS01 3KUPA 2PCFB 5BN4A 3K6OA 2IJ0A 4LK1C 2MP1A 2KECA 1PLFA 2M00A 2BA0A 4TRDA 1RTOA 4K8JA 2A5HA 5I4DA 1LTRD 4ID6A 1GHJA 3RZOB 2ICEC 1DCZA 3GQBA 1CHPD 5KGUA 2K7VA 5KNCA 3HOVB 3MAQA 5IOCA 1HFGA 5IT9L 2F3VA 1NSNS 2NTSA 3I70A 4DK1A 1DYQA 1ZEQX 3R93A 2A68C 1SBBB 1GUWA 2F0PA 3OIQA 1TWFB 1I50B 2WP8J 3P7JA 5C0XJ 1U4MA 1B1ZA 2OT2A 2HDLA 4L63B 5KNDA 2HDMA 4KHZA 4UDUC 3MXUA 1AFPA 2X6GA 2EYOA 1YNJD 5JVG3 3GTQB 2NVYB 1TY2A 1FNWA 5CYUA 1K8MA 4M1UB 4N9PA 2L12A 3VYSA 1STBA 1ENFA 1DOLA 1Z7TA 3RZDB 1WTOA 1PFMA 1EY5A 4HR7B 3A8IE 3S1QB 3K59A 5ELDA 3I4LA 2F0GA 3D4RA 1MI2A 4DAPA 5JPNC 3A55A 3V2TA 3V05A 2K33A 3NSWA 2BE5D 1A2TA 1SNQA 1X3PA 3C1EA 1WTXA 2BDOA 2IL8A 1B3AA 2J7ZA 2WV6D 4CHTB 1D2BA 5ELCA 1E0BA 1WTQA 4DNTB 4U673 3D31A 3DHQA 4XYQA 4FF3A 2N55A 2LY7A 2CW0D 2WB1B 1WTPA 1SNDA 5I6WA 3Q24A 3KLSA 3PUZA 4C3IB 5CV9A 4BA2I 3QJYA 1B50A 5F2DA 1JB3A 2NVXB 1JR0D 2QF7A 4FXKC 4C3JG 1C4QA 1PFBA 2E2JB 3S15B 1PTOF 1FD7D 4FXGC 5M3FB 2K01A 3SK5A 3NWSA 1JWSD 2G9HD 4RKLA 1CTMA 3WOEA 5FKAC 4XT1B 1JQYD 4IFDG 5D3IB 1T5EA 3U9SA 2Y0SB 4QB4A 1BCPD 3K5NA 5IGGA 5KYIA 4H0LC 2WKDA 2F0DA 1WTVA 5IT9E 1HCZA 4FXDA 1JE4A 3EROA 1BXTA 4KJOA 2XRSD 2H4OA 4KN7C 4DN4M 2JEAI 2WACA 3MTSA 1VF5C 2ZXPA 3Q23A 4A3KB 2E74C 2TMPA 4QMGA 1U4PA 3M7NA 4R8NA 2KHSA 2KVMA 5IGCA 3HZXA 2K03A 3BVZA 4PMWA 5EGTA 4RA8A 2K5QA 3PO3B 1F9RA 1D1IA 3LWEA 2XIWA 1EQVA 2A6HC 2F0QA 3DMUA 2E2IB 3ITPA 3GTGB 4DXFA 2V4DA 3WDNA 1Y8OB 3IL8A 2VNUD 1FYCA 4CKCA 5IGFA 3I91A 4NMZA 5CV6A 5IGBA 1CT1D 4YIJA 2MJ8A 1STAA 1D5XC 4HMIA 1KDCA 1EY7A 3VA7A 3OOCA 3IFDA 1SJHD 4EVOA 1TS2A 1MSHA 4OIJA 1WD1A 3P1HA 1GOZA 4TSSA 1SE4A 2O4XA 3VR6A 3SK8A 3MHBA 2F03A 3TP6A 4A3GB 1I4HA 3TP8A 1TWAB 2JP1A 4O42A 1Q90A 5EPKA 1GUNA 2F0EA 1L0YB 4BA1I 2RQXA 1CA6A 3KBXA 1WD0A 1CA5A 1SJED 1PRTD 3TBIB 1OO9B 4RGNA 1CFMA 4RHRA 5HGTA 1RTNA 4IFDI 3TDQA 1TWGB 4Q0FA 3CU7A 4A3EB 2B39A 5IGEA 5I9PA 3AMUA 4HN7A 5K5PA 1X32A 1EZ6A 2SOBA 1EEID 2EY1A 5C0XG 3DWAA 3CRKC 2NB0A 3VR3A 4Z9CB 1FNUA 5K36H 1BF4A 1V1PA 4LJZC 4N9TA 1F9PA 1EYDA 3RUZA 1DOKA 1A6XA 5JEAH 5C4JB 4KKTA 2JXMB 2QCPX 3X3MA 1IKMA 2L11A 3K7AB 4IQZA 1SNMA 4KKUA 4FF4A 5BN5A 3ND9A 3G6JB 2A68D 2KA7A 3IKJA 5C3EB 2F1MA 3C3LA 4RKBA 1F9SA 1STYA 3ONAB 4K8IA 1GUTA 3HOWB 2B8GA 1KLGD 2IX1A 3Q6SA 1LABA 1T5XD 2K5WA 1D5ZC 4F88A 1SDFA 2B2VC 4FF1A 4EQPA 5C44B 3TSSA 3MA2B 4CBVA 4WRDA 4ZRZA 1SYEA 3BS1A 2F0KA 5KEEA 2RSOA 1SEBD 3GTMB 1SNPA 2L55A 4KY6A 4IZ8A 1TVXA 1RF2D 1HPCA 5CC4A 4ZAIA 2QDBA 3U9OA 1YNNC 2M2LA 3P75A 1I4XA 4KY5A 3V96A 4RFBA 3I4MB 4OL7A 1SYGA 1SYDA 3CKIB 3VYRA 4H44C 5I2YA 1JCKB 5JEAJ 5JAVA 1SE2A 3FKIB 2A6EC 4NP5A 4TQUS 3QOJA 2H1EA 3MZ5A 3Q0AA 2G9DA 4KTAA 5EJWA 3N6RA 1LT5D 2EDGA 2F0LA 1SNCA 1LTSD 5C0XI 5A2QL 5C4HA 1LLRD 1G2TA 3KBGA 3GO5A 2XWJB 3A7LA 1UEAB 1VMPA 2PYKA 5LL6X 3R8BA 5DM63 1LV9A 2B2UC 2L0CA 1C8CA 4B9WA 3QG1A 3PIP3 3ND8A 3MXPA 5CV8A 1TIID 4HMJA 4C2MB 4HAEA 3A56A 2F0FA 3FMCA 1H9MA 4ZLTF 2XN9C 4JK1C 2J4XA 1PFNA 4XT3B 2L1BA 1QE6A 3R3OA 1SYFA 1SXTA 5JJZA 3FDTA 3SEBA 2PW5A 4LAAA 3SK6A 4C3IG 3OMGA 1DZ1A 2QILA 5DNFA 3GTPB 4XQQA 1A2UA 5EKIA 4DFAA 4BWGB 1XXGA 1O80A 4Y7NB 1R9TB 1TQOA 4XDXA 4K5VA 4XTCS 2Z8LA 5C6AA 4L6TB 1B2TA 1BCPF 4FNFA 2EY5A 4RHSA 1SYBA 3GV6A 3MWYW 4ME5A 2EY6A 2A6HD 2IT1A 1D5MC 1VF7A 2Z4IA 2O2LD 5LHY1 3EA6A 3MXGA 1JICA 3D8GA 1NAPA 3FVQA 1SNOA 4OHJA 4KMUC 2NVQB 3HGBA 4ZUJA 3NWTA 1IYVA 2EVBA 4PMCA 4FVMA 4FF2A 4EQNA 1EYAA 2X69A 3PIO3 1LTID 1MGSA 3PUWA 1EU3A 1MSGA 2GA4B 1ILPA 2FMCA 4QIWB 5KNBA 1HUMA 5T1IA 2SEBD 2K5DA 2DNCA 1ICWA 5A2QE 1JOKA 4DU9A 3QOLA 4O1NA 3BYTB 2Z4HA 4KKSA 2NVTB 5EQ0A 1UAPA 4Q5VA 3RLFA 3A8KE 3MVVA 3OW7A 1TS4A 3SHLA 2F0UA 4CKEA 4RGMA 4ZK9B 2EY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXW A;  3IL8 A;  2JYO A;  1BF4 A;  1HFG A;  1WTP A;  5COR A;  5CMD A;  1J8I A;  1B2T A;  2X6L A;  2B2T A;  2KOL A;  1DON A;  1XX8 A;  2MPM A;  2EE1 A;  3FPU B;  2FMM A;  4IUT A;  1NR4 A;  2B2W A;  2HCI A;  3I91 A;  4LMQ D;  3R93 A;  4X3S A;  3GV6 A;  3MWY W;  2DY8 A;  2B2Y A;  2RA4 A;  4CJ2 C;  1J9O A;  1F9P A;  1B50 A;  3I8Z A;  1GUW A;  2MJ8 A;  1DOK A;  1ILQ A;  4ZKC B;  1ROD A;  1SAP A;  1CM9 A;  1S4Z A;  2HUG A;  2K04 A;  2H1E A;  1NR2 A;  2L4N A;  3P7J A;  1U4M A;  1EOT A;  1VMC A;  2FJ2 A;  2HDL A;  3D6W A;  1PFB A;  1EL0 A;  1BNZ A;  2HDM A;  5EJW A;  3TZD A;  2KED A;  1AP0 A;  3H91 A;  1M8A A;  1IKM A;  5T1G A;  2K01 A;  3IFD A;  4NW2 A;  1JIC A;  2MGS A;  2X6G A;  2L11 A;  4OIK A;  3G7L A;  5COY A;  1MSH A;  1NAP A;  4XT1 B;  4OIJ A;  3DM1 A;  1G2S A;  2R3Z A;  2L9H A;  2Q8T A;  1BBX C;  1WD1 A;  1G2T A;  1HUN A;  1KNE A;  2HCC A;  3DEP A;  4ZKB B;  1U4R A;  1VMP A;  2FIN B;  1G91 A;  4MHE A;  1O7Y A;  1LV9 A;  1QG7 A;  1U4L A;  1WTW A;  2B2U C;  1G6Z A;  2B2U A;  2L12 A;  1C8C A;  5CBE E;  4IUQ A;  2D9U A;  2NZ1 D;  1WTV A;  1F9S A;  2JP1 A;  5E4W C;  1DOL A;  4O42 A;  2BDN A;  2X69 A;  1O7Z A;  5D14 A;  2K05 A;  1WTO A;  3ONA B;  2NWG A;  5EPJ A;  1PFM A;  1JE4 A;  5EPK A;  3SVM A;  1ZXT A;  1MGS A;  2DY7 A;  3N52 A;  3I3C A;  3I90 A;  1MSG A;  3Q6S A;  4HAE A;  1HHV A;  4CJ1 B;  2K28 A;  4IUR A;  4RWS C;  1F9Q A;  1CA6 A;  1ILP A;  1A15 A;  3DEO A;  2EOT A;  4ZLT F;  2KUM A;  1MI2 A;  1SDF A;  1HFN A;  1ML0 D;  1B53 A;  3KBX A;  5CBA E;  1WD0 A;  1F2L A;  4DN4 M;  2SDF A;  1CA5 A;  1EIH A;  2B2V C;  3F2U A;  2B2V A;  1PFN A;  2FFK B;  2N88 A;  4R9W A;  1IL8 A;  2L1B A;  2CVR A;  4HCS A;  4XT3 B;  3MTS A;  4IUU A;  5D65 A;  4QUC A;  2RSN A;  4X3U A;  1EQT A;  3TN2 A;  1QE6 A;  2FHT A;  1KNA A;  3KUP A;  1WVL A;  3GV3 A;  4U68 A;  4QUF A;  1HUM A;  1IKL A;  2Q8R E;  4X3K A;  5T1I A;  5JJZ A;  1Q3L A;  1U4P A;  1RTN A;  2MP1 A;  4R8I A;  2KEC A;  3FDT A;  3UI2 A;  2KVM A;  1B4O A;  1ICW A;  1PLF A;  1AZP A;  1X3P A;  2B2T C;  5EPL A;  1DOM A;  1NCV A;  1RJT A;  2K03 A;  1WTR A;  2RSO A;  1ESR A;  1WTX A;  1HA6 A;  1DZ1 A;  1RTO A;  2B2W C;  2IL8 A;  4IUP A;  1B3A A;  4RA8 A;  2J7Z A;  5DNF A;  1F9R A;  2RVL A;  5AFW A;  1TVX A;  3LWE A;  2XIW A;  1PDQ A;  2B2Y C;  1RHP A;  2EPB A;  5EKI A;  1X3Q A;  3HP3 A;  1HRJ A;  1X32 A;  1SSO A;  2KEE A;  2NYZ D;  4X3T A;  5EQ0 A;  4ZAI A;  2K1B A;  1BO0 A;  4UAI A;  4CJ0 B;  1E0B A;  1EIG A;  2M2L A;  1WTQ A;  4MN3 A;  1O80 A;  3QO2 A;  1AZQ A;  4HSV A;  4XDX A;  1QNK A;  2N55 A;  4IUV A;  5E4X A;  4ZK9 B;  4RAU C;  1XYI A;  4HED A; 
#chains in the Genus database with same CATH topology
 5COR A;  1VQ8 A;  4P2C B;  1CI3 M;  4K0K Q;  1VQK A;  4OEM B;  3ZJY C;  1FR3 A;  3S9W A;  3KK7 A;  5C4Z A;  1RL2 A;  4A3G G;  3E6Z X;  3I55 A;  3BYY B;  4UY8 C;  2RKS A;  1K83 B;  4JI6 L;  4DV0 Q;  5I9O A;  2Z9H A;  4DV1 L;  3CMA A;  1ESF A;  4GLX A;  3NQT A;  2EXD A;  2WAQ G;  1YI2 A;  3E5S A;  1V8Q A;  1BNZ A;  1UEB A;  4DKA C;  1XWE A;  2KBN A;  1SLJ A;  3W3A A;  4PMB A;  3S2H H;  3ULJ A;  1PH4 A;  2JA6 H;  1HZC A;  2BCO A;  1EU4 A;  1PRT F;  1WCM B;  4QL5 A;  4DUY Q;  1V1O A;  2ZJQ A;  3CF5 A;  1F2Y A;  3RMH A;  4B9X A;  4BS9 A;  1HUN A;  4ULL A;  2HCC A;  5DM7 3;  2BA1 A;  4PG3 A;  2ASB A;  3GD7 A;  4GOP C;  1W6J A;  2PMZ E;  4P72 A;  4DV4 L;  3K5O A;  4LFB L;  1EY9 A;  4EGV A;  2LMC B;  4IUR A;  1STH A;  1BCP B;  2AQ1 B;  4PZ6 A;  1HJP A;  5K36 G;  1B53 A;  2PZW A;  5CBA E;  2E2H B;  4FP5 D;  3S17 B;  2XTI A;  2EQS A;  5E1F A;  1A8V A;  3HOX H;  2DN8 A;  5IP7 H;  2DGY A;  2E2H H;  1IBL Q;  2J0T D;  2KHI A;  1Q3L A;  2ID0 A;  2OEO A;  2IPK D;  4G4K A;  1H9S B;  5JEA G;  3CCJ A;  1YHB A;  1YJW A;  2ZT9 C;  4LUZ A;  2JA8 H;  4JV5 Q;  3OIP A;  4IO9 A;  1A3U A;  1X3G A;  1VQ7 A;  1HRJ A;  5I2X A;  1MJE A;  3L2P A;  1N36 Q;  4MN3 A;  1B7Y B;  5IYC H;  4B3R L;  3CHB D;  3LX0 A;  4QCL A;  3IRB A;  4IPC A;  3T1Y L;  2HHH Q;  3M4Q A;  2Z1C A;  1BOS A;  4A3M H;  2WKC A;  4XXE A;  4A3D G;  4S3S A;  2KOL A;  1DON A;  1XX8 A;  3FPU B;  1Y1W G;  4JBM A;  1EYC A;  3T53 B;  4CGY B;  2UU9 L;  2HCI A;  1C7Y A;  4UHV A;  5C3E G;  3ER0 A;  4RH6 A;  3CC4 A;  4BY1 H;  1JT8 A;  5JOB A;  3M3Y H;  5C5M A;  2I5L X;  3ZYY X;  1YNN D;  1TT2 A;  2CH4 A;  3J80 L;  4KLK A;  3HOW G;  1H9R A;  1G8Z D;  1S5C D;  1I6V C;  1ENC A;  4GNX C;  3D6W A;  3NTH A;  1WJJ A;  1IBM L;  1AP0 A;  4OIK A;  4HJ9 A;  4FO2 A;  1PH8 A;  1EFW A;  4C56 C;  3S1N H;  1KDB A;  3FPP A;  1S5F D;  1EY0 A;  1X56 A;  3DM1 A;  1QB5 D;  1UUP A;  2NN6 H;  2CFM A;  4J1M A;  4NKL A;  3KLS X;  3CCU A;  3S14 H;  2XNA C;  2A6E D;  3OPO A;  4AYB B;  1I4Q A;  3FRP B;  2P5Z X;  1PXU A;  3A0J A;  4WJ3 M;  2F0W A;  4PV1 C;  1TKW B;  3MXN A;  2K52 A;  3JAM L;  1GM5 A;  1CSQ A;  3L3O C;  4V0B A;  4J8Q A;  2N8N A;  1EY6 A;  2CKZ B;  2K28 A;  1A15 A;  5CGK A;  2JEB I;  2EOT A;  2N49 A;  2R6G A;  1MD2 D;  3DEO A;  2H5X A;  2KCC A;  4K2L A;  1ET9 A;  1E24 A;  3F2U A;  2AUJ D;  4JI7 Q;  1XNQ Q;  1M1K C;  1PH5 A;  3W1G A;  1IL8 A;  4QUC A;  3S1M B;  2XSC A;  5M5X H;  2FHT A;  4U68 A;  3KF6 A;  1HQR D;  2CH4 W;  3I4M G;  4YY3 L;  3M4P A;  1STN A;  5IP9 H;  4A3F G;  3UE0 A;  2WAQ B;  3MEH A;  3A8J E;  3SR1 A;  4LF7 Q;  4NPS A;  2EXZ A;  3D0F A;  3URY A;  1YJN A;  5C4X G;  1PRT B;  1KD1 C;  2HD3 A;  2XWB B;  2I5H A;  2A69 C;  1XTC D;  4AH6 A;  1F77 A;  4CJ0 B;  5E3F A;  3S1R B;  3T56 B;  2NUC A;  3K81 C;  3S2D H;  2MO0 A;  3QO2 A;  3KYH C;  1HXY D;  1GKH A;  4F7X A;  1KL9 A;  1PVO A;  4IUV A;  3S1R H;  1TY0 A;  1Z47 A;  5M5W B;  4L5Q A;  2MUY A;  1SYC A;  2JJQ A;  1EWH A;  3I73 A;  1Z6H A;  4WJW A;  1E1T A;  4LMQ D;  1D7Q A;  2VQE L;  4X3S A;  4CDC C;  2Z6K A;  5FO7 B;  4N8X 1;  4DAV A;  1N8R C;  4P71 A;  1ILQ A;  2ICI A;  2VUM B;  2K04 A;  1Y8P B;  4TVA B;  5M5Y B;  4UP7 A;  2QEJ C;  1NMG A;  2CQO A;  2QGQ A;  2UXD Q;  2VUM H;  1E2Z A;  3H91 A;  2EYM A;  1HTP A;  5FO8 B;  5M9O A;  4YHH Q;  2CWP A;  4C3J H;  2F3W A;  3K57 A;  1QVG A;  1NJI C;  4DV5 L;  1KNE A;  1P8L A;  4DK0 A;  1N33 L;  3MFY A;  2RCN A;  1WTW A;  1I6H H;  4EQO A;  2LFN A;  1E22 A;  1IW7 C;  2R7Z H;  1H9J A;  1TWH B;  4A75 A;  4IFD H;  4K6L A;  1GHK A;  4K0K L;  3H09 A;  5IYB H;  1L1O C;  1HHV A;  5FJ8 G;  3IFT A;  3HOU H;  3T51 B;  1OXU A;  4A3D B;  3J80 E;  4DV0 L;  3GTK B;  2K32 A;  3RLN A;  1Y1W B;  4R9W A;  2LSS A;  4DR6 Q;  3C2P A;  4HCS A;  1A3V A;  1EQT A;  3CQZ B;  1KNA A;  5C3X A;  3GTK H;  1Y69 U;  3M4O B;  1IKL A;  5ISR A;  1B4O A;  5IWA Q;  4RGT A;  4X66 L;  2AUK A;  1NCV A;  1RJT A;  1SMY C;  4B3S Q;  4DUY L;  1UE1 A;  2GN5 A;  1HNZ Q;  4IUP A;  3M4O H;  3AU7 A;  3VDY A;  1H9K A;  1JB7 A;  2EYJ A;  5EBD A;  1GD7 A;  1IBK Q;  1D6E C;  3BDC A;  4IUN A;  2CCZ A;  3EVQ A;  2F0T A;  2PI2 A;  3JAM E;  1I4P A;  2I5M X;  2A73 B;  3GTJ H;  2R93 H;  5M3M B;  1KDA A;  3W5O A;  1KAW A;  1KAA A;  3M7G A;  3NBH B;  3K5L A;  1XJV A;  1D1K A;  1S5B D;  4RG1 A;  4BBS B;  4IUT A;  4ZCK A;  1ET6 A;  5M3M H;  3H3V I;  1EZ8 A;  1AEX A;  2SNM A;  3F8T A;  3J7A F;  1RCV D;  4A3I H;  3I4N G;  1O7L A;  2EYH A;  4C1N K;  1HTL D;  3SK4 A;  1Q46 A;  3I56 A;  1TS3 A;  4ZKC B;  1IBL L;  1SFO B;  2IW3 A;  4DXG A;  1EFI D;  1X54 A;  2DNE A;  1SFO H;  2R92 G;  1UE7 A;  1FJG Q;  3KDF B;  3HKZ B;  4ALP A;  4X62 L;  2ZM6 Q;  3NBI A;  3I72 A;  4A3F B;  3NTI A;  5J39 A;  1VQ5 A;  5JJI A;  1S5E D;  1YZ6 A;  5J1Z A;  1HNW Q;  4BY7 H;  1W6K A;  3TZU A;  4ZKB B;  3NE5 B;  5C4X B;  2OQ0 A;  2MNA A;  1PH9 A;  2O5I C;  1G91 A;  1CQF A;  2HHH L;  3OMC A;  5FO9 B;  2D9U A;  2OTL A;  2IX3 A;  4JI1 Q;  5D14 A;  4KK7 A;  2NWG A;  1HZB A;  1ZXT A;  1A62 A;  2VW9 A;  1D8L A;  3A74 A;  4RCN A;  1L0X B;  2WIN B;  1FVI A;  2WFW A;  4KJN A;  5G3L D;  3SGI A;  2K6A A;  2KUM A;  1ML0 D;  3MEF A;  4HSP A;  2D0O A;  3KF8 A;  3VYT A;  2CVR A;  2RDH A;  4IUU A;  5KIX A;  3J7Z C;  4X3U A;  4AQY Q;  2RDG A;  3PUV A;  2YU9 B;  3J80 i;  1U0L A;  4A3J H;  1K28 A;  1NUC A;  3D6C A;  4R8I A;  1P16 A;  2PMZ B;  2QEX A;  1QNU A;  2A19 A;  1HA6 A;  5CV4 A;  3CPF A;  1GXD C;  2B2W C;  1BDO A;  1GUS A;  3A5Z B;  1WOC A;  2ZXO A;  4I7Z C;  1PHJ A;  4X3T A;  2F0N A;  2KEE A;  4LF8 Q;  4QF4 A;  1H95 A;  1K8O A;  2F0J A;  1I3Q B;  3OW2 A;  4EQ5 A;  4H13 C;  2KHJ A;  5GQO A;  3G71 A;  4RGO S;  1X65 A;  1HZA A;  1I3Q H;  2JYO A;  1LAC A;  4FYD A;  4GS3 A;  2O5J C;  1MHW C;  5FLX L;  4HIM A;  4F8M A;  4X64 Q;  4OO1 H;  2K4K A;  2EE1 A;  2KCM A;  4DF7 A;  1DJR D;  1NR4 A;  2B2W A;  2MHV A;  4XIG S;  3VR2 A;  3DXJ C;  4JI7 L;  1XNQ L;  1VQA A;  2K5V A;  2RA4 A;  4GN4 B;  1HH2 P;  1XMO L;  2QDL A;  1AN8 A;  3HOY H;  1J6Q A;  1ROD A;  3BU2 A;  1N34 Q;  3K58 A;  2K75 A;  2CQA A;  2AWN A;  4X6A H;  1VQ9 A;  1N9W A;  4NXM Q;  4B08 A;  3OYY A;  3J81 c;  1VQ4 A;  2ALY B;  2N3S A;  4LF7 L;  2F0H A;  1U9R A;  3NTK A;  4NW2 A;  1S3O A;  5FOB B;  4WOR A;  1QVC A;  4KD3 A;  1O78 A;  1PTO C;  5C3W A;  5IP7 G;  3HOZ B;  2UXB Q;  1TWC H;  1VDZ A;  5C5L A;  1BBX C;  5D3D A;  2PW7 A;  2DJG C;  1EYG A;  1KAB A;  2VL6 A;  3NEL A;  1K8A C;  4LF4 Q;  1CQV A;  2YV5 A;  4MHE A;  3PMF A;  1QG7 A;  2AHO B;  2JA8 G;  5TSS A;  3M85 A;  1Q7Y C;  5CBE E;  4C3H H;  4UP9 A;  5E4W C;  2VQF Q;  2QA4 A;  3GTO B;  3JC6 6;  2AQ2 B;  4I65 A;  3OSO A;  4KD4 A;  4GKK Q;  4WJ4 A;  1BQQ T;  1C48 A;  1C9O A;  1BVS A;  3FEW X;  3L7Z C;  3PUY A;  4A3M G;  1E2W A;  1F2L A;  2I46 A;  4A3C H;  3I4N B;  2KJX A;  4DV7 Q;  3S16 B;  2UXC Q;  3PSI A;  2UXD L;  3HFZ B;  4X3K A;  2R61 A;  1HA5 A;  1VQB A;  3S16 H;  1BBU A;  3J7Y W;  1E2V A;  1IHZ A;  4YHH L;  3PO2 B;  1JWM D;  3HOV H;  1ZKO A;  3C46 A;  5IIF A;  1Q8I A;  2R92 B;  2B2Y C;  1CSP A;  3OHX C;  1DD2 A;  1X3Q A;  3HP3 A;  5IGD A;  2NYZ D;  1Q12 A;  3H6M A;  3PO2 H;  4UAI A;  2I07 B;  3LNN A;  4OX9 Q;  1Q1B A;  1AZQ A;  1LO5 D;  1SE3 A;  3A54 A;  3HS0 C;  2NN6 G;  2KQ3 A;  3QIA A;  4LF9 L;  4GKJ Q;  2F0I A;  4IOA A;  1TWF H;  1PYW D;  1I50 H;  1SE8 A;  2EYL A;  4ODG A;  3C1F A;  1LT6 D;  3TQY A;  1LTT D;  1FNV A;  4A3L H;  1V43 A;  4LF6 Q;  2OCE A;  1LTB D;  3H0G B;  4G7H C;  1PH3 A;  2UUA L;  4DR6 L;  1G29 1;  2DY8 A;  2B2Y A;  4K14 A;  4DR1 Q;  4AYB G;  1JWU D;  1TU2 B;  2NZH A;  2A69 D;  3U4V A;  1SAP A;  1X9N A;  2EYP A;  5KRU A;  3GTQ H;  2NVY H;  4GZY C;  3EJI A;  4NB3 A;  5ELB A;  3RN2 A;  2PPB C;  4B3S L;  1JOR A;  2RHQ B;  1HNZ L;  3NK9 A;  4EX5 A;  1V1P B;  4OGQ C;  5COY A;  3CRL C;  3KFU A;  3RZD H;  4YCV A;  4ME3 A;  3VR5 A;  1HZ9 A;  1VCI A;  4DR7 Q;  1I94 L;  1G2S A;  2PQA A;  2L9H A;  4QY7 A;  2Q8T A;  5H1S E;  1IBK L;  5IP9 G;  1F2M A;  4RCO A;  3S1Q H;  2Z0S A;  1B9N A;  1BUV T;  5DEH A;  3D4W A;  1TR5 A;  3S2H B;  2L15 A;  2JA6 B;  5HY6 A;  5FLX E;  3H3V C;  2K05 A;  5EPJ A;  2EJF C;  3SVM A;  4XQJ A;  1R4Q B;  4JVZ A;  1AE2 A;  1AW7 A;  1DXM A;  3NBH A;  4KI0 A;  2D2C C;  1F9Q A;  2VB2 X;  5JJL A;  4DGZ A;  3VYU A;  3PGZ A;  2N78 A;  3BDO A;  2JK8 A;  1KHI A;  2EIF A;  1EQQ A;  3PUX A;  2N88 A;  5D65 A;  1RKN A;  2JA5 B;  1ZYR C;  1J5E L;  2IX0 A;  3HKS A;  1FJG L;  1IW7 D;  2E5L Q;  5FK9 C;  1CKM A;  4DPG A;  3SXH A;  2JA7 B;  2F0O A;  3TME A;  2JA5 H;  4JBW A;  3MFG A;  4DV2 Q;  3O13 A;  2UUB Q;  3EFX D;  1HNW L;  3QB3 A;  4J15 A;  4JI5 Q;  1PDQ A;  2JA7 H;  1RHP A;  4DAY A;  2EPB A;  3HOX B;  2VUM G;  1TXY A;  3GDE A;  2HIX A;  3PIP A;  4IN3 A;  4JI3 Q;  4C3I H;  1PMR A;  4MIU A;  3W2D A;  1QNK A;  4DV6 Q;  2EZV A;  3GTL B;  2Q8I B;  2JA8 B;  2VXW A;  2X6L A;  3IAY A;  5EKK A;  3NUC A;  1LM0 A;  1X3F A;  2ZXR A;  2E2J H;  1SMY D;  2FMM A;  2D0P A;  5ELF A;  3S15 H;  1Y1V B;  3G4S A;  3GTL H;  2A74 C;  4LWC A;  4XYO A;  1X3E A;  5M3F H;  1RD9 D;  4DUZ Q;  2B63 B;  4CDD C;  5IYB G;  4AQY L;  3I8Z A;  4DR3 Q;  4DNI A;  4JBJ A;  1GO3 E;  1Y1V H;  1PZI D;  3HOU G;  4A3M B;  2HUG A;  1L2F A;  3J81 L;  1EY4 A;  2B63 H;  3Q22 A;  1WFQ A;  1VMC A;  3H94 A;  2FJ2 A;  2L5T A;  2C5C A;  5AJ3 Q;  1EL0 A;  1KTK A;  1MIU A;  2FXQ A;  4ZUI A;  1DGS A;  1GUO A;  2YTX A;  4LUO A;  4X65 Q;  4BY1 B;  2BH2 A;  4LF8 L;  2HT1 A;  3M3Y B;  2R3Z A;  4JI0 Q;  1JOO A;  1JOQ A;  1CKO A;  2ZTE A;  2NN6 I;  2RBM A;  1U4R A;  4LFA Q;  4IPD A;  3CCL A;  1EIF A;  1U4L A;  4IAL A;  1G6Z A;  1F2Z A;  3TP5 A;  3LWU A;  2LXJ A;  4IUQ A;  3ERQ A;  3NXW A;  3J7A V;  3S1N B;  2TSS A;  2BOS A;  4X64 L;  4A3K H;  1VQD A;  4HCE A;  3RLO A;  3TS0 A;  3HEJ A;  1YIJ A;  3S14 B;  1XMQ Q;  2R93 G;  4F87 A;  1IXR A;  2SDF A;  1N34 L;  3PO3 H;  3STB C;  2F0M A;  3ERS X;  2E76 C;  4DR4 L;  2RSN A;  5M3M G;  3KLW A;  1LTG D;  4DK3 C;  3GV3 A;  2E2I H;  2F4V L;  1Q81 C;  1SRO A;  2RCF A;  4BBS G;  1AZP A;  3F1Z A;  2EYF A;  1WTR A;  1OXX K;  1K3B C;  1HNX Q;  1Z9F A;  2RVL A;  5AFW A;  3BVM A;  5FLM H;  3NPP A;  2WII B;  1JC7 A;  4GN3 B;  5M5X B;  4LUV A;  4JI8 Q;  1SSO A;  3WOF A;  2K1B A;  2XRQ D;  3UDI A;  1GJX A;  1LT3 D;  2VS1 A;  1QUQ A;  1YIT A;  4BY7 G;  2RDF A;  3T1H Q;  3HKZ G;  4GKK L;  3AFP A;  4RAU C;  5A35 A;  1ENA A;  4DR2 Q;  4A76 A;  1CZW A;  1YNJ C;  2NBF A;  4V19 0;  5EBC A;  3TS2 A;  5LMU Q;  5CR3 A;  2Z6K C;  1DM0 B;  2KCT A;  3S2D B;  1J9O A;  4DV7 L;  3HRZ C;  5ELO A;  1YEZ A;  3R2I A;  1FGB D;  1NR2 A;  2PZU A;  1RDP D;  1EOT A;  1CK1 A;  4Y52 H;  1QIL A;  5G3L F;  4IOC A;  1Y8N B;  4K5X A;  4A3G H;  4K2K A;  2AWO A;  1NE3 A;  1TWA H;  3G7L A;  3E0J A;  1V1Q A;  1QCB D;  5CV7 A;  4ABN A;  1UNS A;  3DEP A;  3HG9 A;  1FL0 A;  2SNS A;  5LL6 S;  4M8A A;  2CHB D;  4CKB A;  4K5W A;  1XNR Q;  2VY3 A;  2YTY A;  5ELE A;  4LW1 A;  3CCE A;  2BDN A;  2PO4 A;  2BE5 C;  1NBW A;  4JI4 L;  2VB3 X;  4UPA A;  4LF6 L;  1YBY A;  4E6I A;  1PTO B;  3N52 A;  2HQE A;  4ZQ3 A;  4C3J B;  3I3C A;  3UDX A;  4IJL A;  4J6H A;  4DR1 L;  1TS5 A;  1PTO D;  1TWG H;  1I6H B;  1JJC B;  1HFN A;  1PTO H;  5DLQ E;  4H7B A;  4HTH A;  4JI2 Q;  3J81 E;  2R7Z B;  1EIH A;  1KQS A;  1CKN A;  4POG A;  1S5D D;  4A3E H;  4OO1 G;  3TN2 A;  3AYH B;  3L9A X;  3EQL C;  4A3B B;  4P74 A;  1EQR A;  2WB1 E;  4XQN A;  2CW0 C;  1EY8 A;  2PNR C;  3KLR A;  4PQX A;  4DNR B;  3HOU B;  4A3B H;  2B2T C;  1EUJ A;  5EPL A;  1DOM A;  1HQM C;  4ZYS A;  3OTO Q;  4DR7 L;  2XVS A;  1BR9 A;  4WFN 3;  3NP8 A;  2PI2 E;  4P75 A;  3OWF A;  3K5M A;  1VQC A;  1SRU A;  1PZK D;  2OXP A;  1BO0 A;  3OWE B;  4MTN A;  3E9I A;  3BG3 A;  3BVG A;  1LT4 D;  4KN4 C;  3AB9 A;  1OXT A;  3SE0 A;  4DA2 A;  1XYI A;  3HOZ G;  5J22 A;  2QKI C;  1EOV A;  5CMD A;  5C4J H;  2B2T A;  2R7F A;  5IT9 c;  4C3H G;  2Y0S E;  4K6D A;  5L37 A;  1QJO A;  1QOH A;  3X3N A;  4L5T A;  1BCP C;  1I4R A;  3K7A H;  4CJ2 C;  1B44 D;  2F0S A;  3GTJ B;  4G7Z C;  2R93 B;  3D4D A;  1CHQ D;  1LTA D;  3RR5 A;  3PF4 A;  2L4N A;  2XGT A;  3KJO A;  3BZK A;  2KED A;  4DV2 L;  1M8A A;  4A3I B;  2MGS A;  4B3M Q;  4JOI A;  5J3B A;  3HOW H;  3TP7 A;  3NHH A;  1OXS C;  3VR4 A;  3DLL A;  3DWP A;  2EJG C;  2FIN B;  1VQJ A;  5GAG C;  1O7Y A;  4HJA A;  3BZD B;  2LKV A;  4FDB A;  3SDZ A;  5JVH 3;  2MO1 A;  2NZ1 D;  4DV1 Q;  3EBE A;  3RD4 A;  1VQH A;  2G5D A;  3PO2 G;  1W3S A;  4G57 A;  5C44 H;  1E1O A;  5JJK A;  4L8J A;  1EEF D;  4JV5 L;  4BY7 B;  4CJ1 B;  1H9S A;  3K8A A;  4RWS C;  3B6Y A;  5JPM C;  2V1C C;  1B9M A;  4BBR B;  1OXV A;  1II3 A;  5NUC A;  1N36 L;  3GTM H;  4IFD J;  1IYU A;  2E75 C;  3BDL A;  1QZH A;  2B2V A;  2JE6 I;  2FFK B;  3MC0 B;  4JG2 A;  3AEV A;  1IL2 A;  4BBR H;  1ONL A;  1WVL A;  4QUF A;  1GUG A;  2Q8R E;  3J81 i;  4HJ8 A;  2D5D A;  4KHV A;  4YWM A;  3L0O A;  3UI2 A;  4A4I A;  1VQ6 A;  2NTT A;  3H0G G;  5DAU A;  1CZG A;  4DV4 Q;  1ESR A;  3GP7 A;  3H3V H;  4JI0 L;  3FP9 A;  4TKO B;  2B8F A;  4DV3 Q;  1PZJ D;  1R4P B;  3K0Y A;  5BN3 A;  4LFA L;  5HGQ A;  2PZT A;  4NDX A;  4A3J B;  1EIG A;  2D62 A;  1VQG A;  1M4V A;  3T4A C;  5ELN A;  5CV5 A;  4GOP B;  1Q86 C;  1XPR A;  2ENB A;  3FKI H;  4HSV A;  3T13 A;  3G48 A;  4JBK A;  1ZYR D;  5E4X A;  1IYJ B;  1KLU D;  4HED A;  1MBY A;  3DWQ A;  4G7O C;  1EWC A;  1QWY A;  1J8I A;  3T16 A;  1Q1E A;  1I4G A;  5KYL A;  2MPM A;  3VA5 A;  4OO1 I;  2M9V A;  1EIY B;  3F2C A;  4ILW A;  4R4Q A;  1KRS A;  4C1N I;  2OF1 A;  2I0Q A;  5IOD A;  4YWK A;  2F0V A;  2JA6 G;  3ICE A;  1CM9 A;  1S4Z A;  2C9O A;  2WAQ E;  1O7I A;  2E2D C;  3DUZ A;  3P20 A;  4KY7 A;  3TZD A;  3R2T A;  4L5S A;  2YYZ A;  5T1G A;  4JYA Q;  2KCN A;  1ASY A;  2A8V A;  5HUR A;  3JAM i;  3PV0 A;  5C0X H;  2IWH A;  3HOY B;  3NQI A;  4KV6 A;  5I6Y A;  1PRT C;  2JSO A;  3QWN A;  4C2M H;  3M4Y A;  4YCU A;  2JA5 G;  3RN5 A;  2GVB A;  3Q8D A;  3D3R A;  1PV4 A;  2F4I A;  1STG A;  2RHS B;  1STE A;  4PNY A;  2B2U A;  2E8G A;  2JA7 G;  3J81 j;  1LYL A;  1O7Z A;  1X6O A;  4DR2 L;  3E0E A;  1A3T A;  2EJM A;  2PQE A;  1TWC B;  3A7A B;  2OQK A;  2DY7 A;  1VS0 A;  1UE5 A;  3I90 A;  3HOX G;  5LMU L;  2Q2H A;  4KHP Q;  1K0R A;  4YCW A;  3CP0 A;  2AQ3 B;  3ULL A;  4A93 B;  1MJC A;  3I2Z A;  4C3H B;  1XPO A;  5EKL A;  3GTP H;  2LS0 1;  1AH9 A;  3KUP A;  4A93 H;  1PYB A;  5FJ8 H;  3CCQ A;  2PCF B;  5BN4 A;  4GNX B;  3K6O A;  3MXN B;  2IJ0 A;  4LK1 C;  2MP1 A;  1L0W A;  2KEC A;  1PLF A;  4Y7N H;  1R9T H;  1Y1V G;  3M9B A;  2M00 A;  2BA0 A;  4TRD A;  5IYC G;  1RTO A;  1IZ6 A;  4K8J A;  1VQP A;  2B63 G;  3KJP A;  1WTH A;  2A5H A;  5I4D A;  1LTR D;  4ID6 A;  1GHJ A;  3RZO B;  2ICE C;  1DCZ A;  3BJU A;  4OXP A;  3KF6 B;  3STB D;  3J80 c;  3GQB A;  1YNX A;  1CHP D;  1G6P A;  5KGU A;  2K7V A;  5KNC A;  3HOV B;  3MAQ A;  3RZO H;  4BXX H;  5IOC A;  4YY3 Q;  1VQM A;  4BY1 G;  1HFG A;  5IT9 L;  4IPG A;  3E3X A;  2F3V A;  4JCV E;  1PH6 A;  1NSN S;  2NTS A;  3I70 A;  4JI2 L;  4DK1 A;  3CAM A;  1DYQ A;  1ZEQ X;  3R93 A;  3W1B A;  1YJ9 A;  2A68 C;  1SBB B;  1GUW A;  2F0P A;  3OIQ A;  1TWF B;  1I50 B;  2LXK A;  2WP8 J;  3P7J A;  5C0X J;  1U4M A;  1B1Z A;  2OT2 A;  2HDL A;  4L63 B;  3OTO L;  5KND A;  2HDM A;  3F2D A;  3PO3 G;  4KHZ A;  4UDU C;  3MXU A;  1AFP A;  2X6G A;  2JA9 A;  2EYO A;  4GLA C;  1YNJ D;  5JVG 3;  1A0I A;  3GTQ B;  2NVY B;  5LMN W;  1TY2 A;  1YHA A;  1FNW A;  1K8M A;  5CYU A;  4M1U B;  5FLM G;  4N9P A;  2L12 A;  1B3Q A;  1JMC A;  3VYS A;  1STB A;  1ENF A;  1DOL A;  1Z7T A;  5IWA L;  3RZD B;  2Q2U A;  1WTO A;  1PFM A;  1EY5 A;  4QGU A;  5IY0 A;  1K3R A;  4HR7 B;  3A8I E;  3S1Q B;  3K59 A;  2IY5 B;  4O0A A;  5ELD A;  3I4L A;  2DJF C;  2F0G A;  3D4R A;  1MI2 A;  2F3I A;  2BH8 A;  4DAP A;  4JC0 A;  5JPN C;  4DK6 C;  2NVT H;  3A55 A;  3V2T A;  3V05 A;  4B3M L;  3I4O A;  2K33 A;  3NSW A;  2BE5 D;  1A2T A;  1SNQ A;  1X3P A;  3C1E A;  1WTX A;  2BDO A;  2IL8 A;  1B3A A;  1BBW A;  2J7Z A;  2WV6 D;  4CHT B;  1D2B A;  5ELC A;  4HIK A;  2NZO A;  1NNX A;  5LMN Q;  1E0B A;  1WTQ A;  4DNT B;  4U67 3;  2GVA A;  1N32 Q;  3D31 A;  2HIV A;  3DHQ A;  4XYQ A;  2IHF A;  4FF3 A;  2N55 A;  4GLV B;  1K83 H;  2LY7 A;  2CW0 D;  1L1O B;  2WB1 B;  1WTP A;  2ZM6 L;  1SND A;  5I6W A;  4X66 Q;  3Q24 A;  3KDF A;  3KLS A;  2ES2 A;  3PUZ A;  4C3I B;  5CV9 A;  4BA2 I;  3QJY A;  1B50 A;  5F2D A;  3TRZ A;  1WCM H;  1JB3 A;  2NVX B;  1JR0 D;  4JI1 L;  2QF7 A;  4FXK C;  4C3J G;  1C4Q A;  1PFB A;  4JW0 A;  3S15 B;  2E2J B;  3CCR A;  4OEL B;  1PTO F;  1FD7 D;  2NVX H;  4A3E G;  4FXG C;  5M3F B;  2K01 A;  3SK5 A;  3NWS A;  1JWS D;  2G9H D;  4DV3 L;  4RKL A;  1CTM A;  3WOE A;  2R7Z G;  5FKA C;  4XT1 B;  5BR8 Q;  1JQY D;  4IFD G;  5D3I B;  1T5E A;  3U9S A;  2Y0S B;  1OTC A;  4OWT B;  4A3B G;  4QB4 A;  1BCP D;  3K5N A;  5IGG A;  2R7D A;  1WI5 A;  5KYI A;  4HID A;  4HJ7 A;  4H0L C;  1MKH A;  2WKD A;  1S40 A;  2F0D A;  1WTV A;  4GOP A;  5IT9 E;  3S17 H;  1HCZ A;  3DM3 A;  4FXD A;  1JE4 A;  3CME A;  4NXN Q;  1GVP A;  1NY4 A;  3ERO A;  1SMX A;  3QR8 A;  1BXT A;  4KJO A;  3UE1 A;  4CDF C;  2XRS D;  3G6E A;  2H4O A;  4KN7 C;  4X62 Q;  1C0A A;  2K50 A;  4DN4 M;  2JEA I;  2WAC A;  3CCS A;  3MTS A;  1VF5 C;  2ZXP A;  5GRO A;  3Q23 A;  4A3K B;  2E74 C;  2TMP A;  4QMG A;  1U4P A;  3M7N A;  4JYA L;  4R8N A;  2KHS A;  2KVM A;  5IGC A;  3HZX A;  1VQO A;  2K03 A;  3BVZ A;  4PMW A;  1QZG A;  3K80 C;  5EGT A;  4RA8 A;  2K5Q A;  3PO3 B;  1F9R A;  1D1I A;  3LWE A;  2XIW A;  1EQV A;  3KF8 B;  2A6H C;  2F0Q A;  3DMU A;  3S24 A;  4QQB X;  2E2I B;  1KRT A;  3ITP A;  1HR0 W;  3GTG B;  3I7F A;  4DXF A;  4NXM L;  2V4D A;  3AQQ A;  3WDN A;  3EIV A;  1I5F A;  4A3I G;  1YHQ A;  1Y8O B;  3IL8 A;  4KHP L;  2VNU D;  1FYC A;  3GTG H;  4OON A;  4MTK A;  2UXB L;  4CKC A;  5IYD H;  5IGF A;  4R1J A;  3I91 A;  4NMZ A;  4CDE C;  5CV6 A;  5IGB A;  5C44 G;  4LF4 L;  1CT1 D;  4YIJ A;  2MJ8 A;  1STA A;  1D5X C;  4HMI A;  2VQF L;  1KDC A;  1EY7 A;  2B3G A;  4APV A;  3VA7 A;  3PIO A;  1CUK A;  3OOC A;  4GNX A;  2JQO A;  3IFD A;  1SJH D;  4R4C A;  4AIM A;  4BBR G;  1TS2 A;  4EVO A;  1MSH A;  1PH1 A;  2ZJR A;  4OIJ A;  4QIW E;  4R4T A;  1WD1 A;  3P1H A;  2ZTD A;  1GOZ A;  4TSS A;  1SE4 A;  2O4X A;  3VR6 A;  3SK8 A;  3CC7 A;  1BKB A;  1UE6 A;  3MHB A;  5IE8 A;  2UXC L;  2OTJ A;  2F03 A;  1HR0 Q;  1XMO Q;  3TP6 A;  4A3G B;  1I4H A;  3TP8 A;  2OWO A;  4LF5 Q;  1TWA B;  2JP1 A;  4O42 A;  1Q90 A;  1SR3 A;  3S1M H;  5EPK A;  1EWI A;  2UUC Q;  1GUN A;  2F0E A;  1L0Y B;  1WYD A;  1W2B A;  3FKI G;  4BA1 I;  2RQX A;  1E7Z A;  1CA6 A;  4A3J G;  1AE3 A;  4P73 A;  5GAE C;  3KBX A;  1WD0 A;  1PA6 A;  1SJE D;  1CA5 A;  1PRT D;  4OX9 L;  3TBI B;  1OO9 B;  4IJH A;  1ICF B;  2MFI A;  4RGN A;  1CFM A;  2RF4 A;  4GKJ L;  2K5H A;  4RHR A;  5HGT A;  1RTN A;  3UDG A;  4IFD I;  3TDQ A;  1TWG B;  2A1A A;  2ZTC A;  4POF A;  5FLX c;  4Q0F A;  3CU7 A;  4HIO A;  4A3E B;  2B39 A;  5I9P A;  5IGE A;  3AMU A;  5M5W H;  4HN7 A;  5K5P A;  1X32 A;  1EZ6 A;  2CWA A;  2SOB A;  1EEI D;  1U5K A;  2EY1 A;  5C0X G;  2HQL A;  1KIX A;  2QW7 A;  1JJG A;  3DWA A;  2ATW A;  3CRK C;  2NB0 A;  4L5R C;  3K7U C;  3VR3 A;  4Z9C B;  1FGU A;  1FNU A;  3U50 C;  5K36 H;  1M90 C;  1BF4 A;  3HOY G;  4PZ8 A;  5M5Y H;  5GAD C;  3AFQ A;  1V1P A;  1VQN A;  4B3T Q;  4LJZ C;  1PH7 A;  4N9T A;  1F9P A;  1EYD A;  3RUZ A;  1DOK A;  1A6X A;  4I7A A;  5JEA H;  5C4J B;  4KKT A;  4DR5 Q;  1SN8 A;  2JXM B;  3KOJ A;  2QCP X;  3X3M A;  4LF9 Q;  1IKM A;  4YWL A;  1TWH H;  2L11 A;  3K7A B;  4IQZ A;  4A93 G;  1SNM A;  4KKU A;  4JOI C;  4UP8 A;  4FF4 A;  5LMN L;  5BN5 A;  1KXL A;  3ND9 A;  3G6J B;  1N32 L;  2UUA Q;  2A68 D;  2KA7 A;  3IKJ A;  1ASZ A;  4PZ7 A;  5C3E B;  2F1M A;  3C3L A;  1A63 A;  4A3D H;  4RKB A;  2E5L L;  1F9S A;  1Y1W H;  1YVC A;  2Q2I A;  1STY A;  3ONA B;  4N8F A;  4K8I A;  4OWW B;  5C3E H;  1GUT A;  4LFC Q;  3CQZ H;  4IPH A;  3HOW B;  2B8G A;  4A3C G;  1KLG D;  1VQE A;  2AKW B;  2IX1 A;  1L1O A;  3Q6S A;  2UUB L;  1LAB A;  1T5X D;  2PQA B;  4JI5 L;  1XTD A;  2K5W A;  3UDF A;  3RNU A;  4BXX G;  3CCV A;  1XPU A;  1D5Z C;  4F88 A;  1SDF A;  1UWV A;  1I94 Q;  4JI3 L;  2B2V C;  2Z6B A;  4FF1 A;  3HOV G;  4EQP A;  5C44 B;  3TSS A;  3MA2 B;  4DV6 L;  2IHE A;  4JI6 Q;  4CBV A;  4WRD A;  4ZRZ A;  1SYE A;  3PCO B;  3BS1 A;  2F0K A;  5KEE A;  5BR8 L;  2RSO A;  1SEB D;  3GTM B;  1SNP A;  2L55 A;  4KY6 A;  4O2D A;  4IZ8 A;  5EAY A;  3CD6 A;  4DUZ L;  1TVX A;  1K8G A;  1RF2 D;  4DR3 L;  1HPC A;  5CC4 A;  4ZAI A;  2QDB A;  3U9O A;  1YNN C;  4BBS H;  2M2L A;  1PYS B;  1X55 A;  1I4X A;  3P75 A;  4A3L G;  1PFS A;  5AJ3 L;  3A5U A;  4NXN L;  4KY5 A;  3V96 A;  3BZC A;  4RFB A;  2AMC B;  5E7N A;  1J5E Q;  3FHW A;  3NEM A;  3I4M B;  4OL7 A;  2YTV A;  4X65 L;  1G51 A;  1SYG A;  4LFB Q;  1SYD A;  3CKI B;  4DAY B;  3VYR A;  4H44 C;  5I2Y A;  1JCK B;  1LUZ A;  5JEA J;  5JAV A;  1SE2 A;  2K5N A;  3I4M H;  1E3P A;  3FKI B;  2A6E C;  4NP5 A;  4AYB E;  4A3F H;  4TQU S;  3QOJ A;  1Y14 B;  2H1E A;  3MZ5 A;  3Q0A A;  2G9D A;  3LGJ A;  4KTA A;  2MQH A;  5C4X H;  5EJW A;  3N6R A;  1LT5 D;  2EDG A;  2F0L A;  1JE5 A;  1SNC A;  1XMQ L;  1LTS D;  1K9M C;  2K14 A;  2ZJP A;  3TEH B;  5C0X I;  5A2Q L;  5C4H A;  1LLR D;  1G2T A;  3KBG A;  3GO5 A;  2XWJ B;  3A7L A;  1T9H A;  1UEA B;  1VMP A;  2PYK A;  5LL6 X;  3R8B A;  5DM6 3;  4R4O A;  3CPW A;  1LV9 A;  2B2U C;  2L0C A;  1QVF A;  1C8C A;  4B9W A;  4LNQ A;  3QG1 A;  3PIP 3;  1K0S A;  4B3R Q;  3T1Y Q;  3ND8 A;  3TRE A;  3MXP A;  1HNX L;  2YU9 H;  5CV8 A;  1TII D;  4HMJ A;  4C2M B;  4HAE A;  3A56 A;  2F0F A;  1JJ2 A;  3FMC A;  1H9M A;  4JI8 L;  4ZLT F;  2XN9 C;  2F52 A;  4JK1 C;  2UU9 Q;  4MZ9 A;  2J4X A;  1PFN A;  4XT3 B;  2L1B A;  4JPB W;  1QE6 A;  3R3O A;  1LTL A;  3T1H L;  1SYF A;  2WB1 G;  1SXT A;  3K0X A;  5JJZ A;  1NTG A;  3FDT A;  3SEB A;  1WCM G;  5GAH C;  2PW5 A;  4LAA A;  3SK6 A;  4C3I G;  1Q82 C;  3OMG A;  1IBM Q;  1DZ1 A;  2QIL A;  5DNF A;  3GTP B;  4XQQ A;  1A2U A;  3E9H A;  5EKI A;  1HR0 L;  4DFA A;  4H02 A;  4BWG B;  1XXG A;  4LF5 L;  3F2B A;  1O80 A;  4Y7N B;  1R9T B;  1TQO A;  4XDX A;  4K5V A;  4DR4 Q;  5M3F G;  2UUC L;  4XTC S;  3PF5 A;  3CXC A;  2Z8L A;  5C6A A;  2F4V Q;  4L6T B;  4MNO A;  1PH2 A;  1B2T A;  1BCP F;  2Y0S G;  4FNF A;  1VQF A;  4GN5 A;  2EY5 A;  4RHS A;  1SYB A;  3GV6 A;  3MWY W;  4ME5 A;  3NEN A;  3HOZ H;  2EY6 A;  2A6H D;  2IT1 A;  1XNR L;  1D5M C;  1VF7 A;  1QUQ B;  2Z4I A;  2O2L D;  5LHY 1;  1KC8 C;  1B8A A;  3EA6 A;  4DAM A;  4RMF A;  3MXG A;  1K73 C;  1JIC A;  2JN4 A;  3D8G A;  3GTO H;  1NAP A;  1V9P A;  1SNO A;  3FVQ A;  4R4I A;  4OHJ A;  4KMU C;  1VQL A;  2NVQ B;  2DUD A;  3HGB A;  4ZUJ A;  4QJF A;  4A3K G;  2KEN A;  4HJ5 A;  3NWT A;  1IYV A;  2EVB A;  4PMC A;  4FVM A;  4FF2 A;  2NVQ H;  4EQN A;  1EYA A;  2X69 A;  3I4N H;  3CC2 A;  4B3T L;  1B70 B;  3PIO 3;  1LTI D;  1MGS A;  3PQI A;  3PUW A;  3JAM c;  3EN2 A;  1NMF A;  1EU3 A;  1MSG A;  2GA4 B;  1ILP A;  1S72 A;  3ULP A;  2FMC A;  1RIP A;  2VQE Q;  4QIW B;  3WWV A;  1VQI A;  5IYD G;  5KNB A;  2R92 H;  4DR5 L;  2Q2T A;  2VZA A;  2C35 B;  1HUM A;  5T1I A;  2SEB D;  2K5D A;  2DNC A;  1ICW A;  3U58 A;  2PNH A;  3J7A 5;  5A2Q E;  4JI4 Q;  1JOK A;  2B29 A;  4DU9 A;  3QOL A;  4O1N A;  3BYT B;  1CKN B;  2Z4H A;  4KKS A;  2NVT B;  5EQ0 A;  1UAP A;  3H15 A;  3CCM A;  1Q8K A;  4Q5V A;  3RLF A;  3H0G H;  3U4Z A;  3A8K E;  3CW2 C;  3MVV A;  1TS4 A;  3OW7 A;  3SHL A;  4DV5 Q;  2F0U A;  4CKE A;  1N33 Q;  4LFC L;  4RGM A;  4ZK9 B;  3HKZ E;  2EY2 A;  4OWX B; 
#chains in the Genus database with same CATH homology
 5COR A;  4P2C B;  1CI3 M;  1FR3 A;  3S9W A;  3KK7 A;  5C4Z A;  3E6Z X;  3BYY B;  2RKS A;  1K83 B;  5I9O A;  1ESF A;  3NQT A;  3E5S A;  1V8Q A;  1BNZ A;  1XWE A;  3W3A A;  4PMB A;  2BCO A;  1EU4 A;  1PRT F;  1WCM B;  1V1O A;  1F2Y A;  3RMH A;  4BS9 A;  4B9X A;  1HUN A;  4ULL A;  2HCC A;  5DM7 3;  2BA1 A;  3GD7 A;  1W6J A;  3K5O A;  1EY9 A;  4EGV A;  2LMC B;  4IUR A;  1STH A;  1BCP B;  2AQ1 B;  5K36 G;  1B53 A;  2PZW A;  5CBA E;  2E2H B;  4FP5 D;  3S17 B;  5E1F A;  2DN8 A;  2J0T D;  1Q3L A;  2ID0 A;  2OEO A;  2IPK D;  4G4K A;  1H9S B;  5JEA G;  2ZT9 C;  3OIP A;  1A3U A;  1HRJ A;  5I2X A;  4MN3 A;  3CHB D;  3LX0 A;  4QCL A;  2Z1C A;  1BOS A;  2WKC A;  4XXE A;  4S3S A;  2KOL A;  1DON A;  1XX8 A;  3FPU B;  1EYC A;  3T53 B;  4CGY B;  2HCI A;  4RH6 A;  5JOB A;  5C5M A;  3ZYY X;  1YNN D;  1TT2 A;  3J80 L;  1H9R A;  1G8Z D;  1S5C D;  1I6V C;  1ENC A;  3D6W A;  3NTH A;  1AP0 A;  4OIK A;  4FO2 A;  4C56 C;  1KDB A;  3FPP A;  1S5F D;  1EY0 A;  3DM1 A;  1QB5 D;  1UUP A;  2NN6 H;  4J1M A;  4NKL A;  3KLS X;  2XNA C;  2A6E D;  3OPO A;  4AYB B;  1I4Q A;  3FRP B;  1PXU A;  2F0W A;  4PV1 C;  1TKW B;  3MXN A;  3JAM L;  3L3O C;  4V0B A;  4J8Q A;  1EY6 A;  2K28 A;  1A15 A;  5CGK A;  2JEB I;  2EOT A;  3DEO A;  2R6G A;  1MD2 D;  2KCC A;  4K2L A;  1ET9 A;  3F2U A;  2AUJ D;  1IL8 A;  4QUC A;  3S1M B;  2XSC A;  2FHT A;  4U68 A;  1HQR D;  1STN A;  2WAQ B;  3MEH A;  3A8J E;  3SR1 A;  2EXZ A;  3URY A;  1PRT B;  2XWB B;  2A69 C;  1XTC D;  4CJ0 B;  1F77 A;  5E3F A;  3S1R B;  3T56 B;  2NUC A;  3QO2 A;  1HXY D;  4F7X A;  4IUV A;  1TY0 A;  1Z47 A;  5M5W B;  2MUY A;  1SYC A;  1EWH A;  3I73 A;  1Z6H A;  4WJW A;  4LMQ D;  4X3S A;  5FO7 B;  4DAV A;  1ILQ A;  2ICI A;  2VUM B;  2K04 A;  1Y8P B;  5M5Y B;  2QEJ C;  1E2Z A;  3H91 A;  2EYM A;  1HTP A;  5FO8 B;  5M9O A;  2F3W A;  3K57 A;  1KNE A;  4DK0 A;  3MFY A;  1WTW A;  4EQO A;  2LFN A;  1IW7 C;  1H9J A;  1TWH B;  4IFD H;  4K6L A;  1GHK A;  3H09 A;  1HHV A;  3IFT A;  3T51 B;  1OXU A;  4A3D B;  3J80 E;  3GTK B;  2K32 A;  1Y1W B;  4R9W A;  3C2P A;  4HCS A;  1A3V A;  1EQT A;  3CQZ B;  1KNA A;  5C3X A;  1Y69 U;  3M4O B;  1IKL A;  5ISR A;  1B4O A;  4RGT A;  2AUK A;  1NCV A;  1RJT A;  1SMY C;  4IUP A;  3AU7 A;  1H9K A;  2EYJ A;  5EBD A;  1D6E C;  3BDC A;  4IUN A;  3EVQ A;  2F0T A;  3JAM E;  1I4P A;  2A73 B;  5M3M B;  1KDA A;  1KAA A;  3M7G A;  3K5L A;  1D1K A;  1S5B D;  4BBS B;  4IUT A;  1ET6 A;  1EZ8 A;  1AEX A;  2SNM A;  3J7A F;  1RCV D;  1O7L A;  2EYH A;  4C1N K;  1HTL D;  3SK4 A;  1TS3 A;  4ZKC B;  1SFO B;  2IW3 A;  4DXG A;  1EFI D;  2DNE A;  3HKZ B;  3NBI A;  3I72 A;  4A3F B;  3NTI A;  5J39 A;  1S5E D;  5J1Z A;  1W6K A;  3TZU A;  4ZKB B;  3NE5 B;  5C4X B;  1G91 A;  2O5I C;  1CQF A;  3OMC A;  5FO9 B;  2D9U A;  2IX3 A;  5D14 A;  4KK7 A;  2NWG A;  1ZXT A;  4RCN A;  1L0X B;  2WIN B;  4KJN A;  5G3L D;  2K6A A;  2KUM A;  1ML0 D;  4HSP A;  3KF8 A;  3VYT A;  2CVR A;  2RDH A;  4IUU A;  5KIX A;  4X3U A;  2RDG A;  3PUV A;  2YU9 B;  1NUC A;  3D6C A;  4R8I A;  2PMZ B;  1QNU A;  1HA6 A;  5CV4 A;  1GXD C;  2B2W C;  1BDO A;  1GUS A;  2ZXO A;  4I7Z C;  4X3T A;  2F0N A;  2KEE A;  1K8O A;  4QF4 A;  2F0J A;  1I3Q B;  4H13 C;  4RGO S;  2JYO A;  1LAC A;  4FYD A;  2O5J C;  5FLX L;  4F8M A;  4OO1 H;  2EE1 A;  4DF7 A;  1DJR D;  1NR4 A;  2B2W A;  2MHV A;  4XIG S;  3VR2 A;  3DXJ C;  2RA4 A;  1AN8 A;  1ROD A;  3K58 A;  2CQA A;  2AWN A;  4B08 A;  2F0H A;  1U9R A;  3NTK A;  4NW2 A;  5FOB B;  4WOR A;  4KD3 A;  1O78 A;  1PTO C;  5C3W A;  3HOZ B;  1VDZ A;  5C5L A;  1BBX C;  5D3D A;  2PW7 A;  1KAB A;  1CQV A;  4MHE A;  3PMF A;  1QG7 A;  5TSS A;  3M85 A;  5CBE E;  5E4W C;  3GTO B;  2AQ2 B;  4I65 A;  3OSO A;  4KD4 A;  1BQQ T;  1C48 A;  3FEW X;  3L7Z C;  3PUY A;  1E2W A;  1F2L A;  2I46 A;  3I4N B;  2KJX A;  3S16 B;  4X3K A;  2R61 A;  1HA5 A;  3J7Y W;  1E2V A;  1IHZ A;  3PO2 B;  1JWM D;  1ZKO A;  3C46 A;  5IIF A;  1Q8I A;  2R92 B;  2B2Y C;  3OHX C;  1DD2 A;  1X3Q A;  3HP3 A;  5IGD A;  2NYZ D;  1Q12 A;  3H6M A;  4UAI A;  2I07 B;  3LNN A;  1Q1B A;  1AZQ A;  1LO5 D;  1SE3 A;  3A54 A;  3HS0 C;  2NN6 G;  2KQ3 A;  3QIA A;  2F0I A;  1PYW D;  2EYL A;  4ODG A;  3C1F A;  1LT6 D;  1LTT D;  1FNV A;  1V43 A;  1LTB D;  3H0G B;  4G7H C;  1G29 1;  2DY8 A;  2B2Y A;  4K14 A;  1JWU D;  1TU2 B;  2A69 D;  1SAP A;  2EYP A;  5KRU A;  4GZY C;  3EJI A;  5ELB A;  2PPB C;  1JOR A;  3NK9 A;  1V1P B;  4OGQ C;  5COY A;  3CRL C;  3VR5 A;  1VCI A;  1G2S A;  2L9H A;  2Q8T A;  1F2M A;  4RCO A;  1B9N A;  1BUV T;  5DEH A;  3D4W A;  1TR5 A;  3S2H B;  2JA6 B;  5FLX E;  3H3V C;  2K05 A;  5EPJ A;  2EJF C;  3SVM A;  4XQJ A;  1R4Q B;  1AW7 A;  1DXM A;  3NBH A;  4KI0 A;  2D2C C;  1F9Q A;  2VB2 X;  4DGZ A;  3VYU A;  3BDO A;  3PUX A;  2N88 A;  5D65 A;  1RKN A;  2JA5 B;  1ZYR C;  2IX0 A;  1IW7 D;  5FK9 C;  3SXH A;  2JA7 B;  2F0O A;  3TME A;  4JBW A;  3MFG A;  3O13 A;  3EFX D;  3QB3 A;  1PDQ A;  1RHP A;  4DAY A;  2EPB A;  3HOX B;  4IN3 A;  1PMR A;  4MIU A;  3W2D A;  1QNK A;  2EZV A;  3GTL B;  2Q8I B;  2JA8 B;  2VXW A;  2X6L A;  3IAY A;  5EKK A;  3NUC A;  2ZXR A;  1SMY D;  2FMM A;  5ELF A;  1Y1V B;  2A74 C;  4XYO A;  1RD9 D;  2B63 B;  3I8Z A;  1PZI D;  4A3M B;  2HUG A;  3J81 L;  1EY4 A;  3Q22 A;  1VMC A;  2FJ2 A;  2L5T A;  3H94 A;  2C5C A;  1EL0 A;  1KTK A;  4ZUI A;  1GUO A;  4BY1 B;  3M3Y B;  2R3Z A;  1JOO A;  1JOQ A;  2NN6 I;  2RBM A;  1U4R A;  1U4L A;  4IAL A;  1G6Z A;  1F2Z A;  3TP5 A;  3LWU A;  4IUQ A;  3ERQ A;  3NXW A;  3J7A V;  3S1N B;  2TSS A;  2BOS A;  4HCE A;  3HEJ A;  3S14 B;  4F87 A;  2SDF A;  2F0M A;  2E76 C;  2RSN A;  1LTG D;  3GV3 A;  1AZP A;  2EYF A;  1WTR A;  1OXX K;  2RVL A;  5AFW A;  3BVM A;  3NPP A;  2WII B;  1JC7 A;  5M5X B;  3WOF A;  1SSO A;  2K1B A;  2XRQ D;  1GJX A;  1LT3 D;  2RDF A;  4RAU C;  5A35 A;  1ENA A;  1CZW A;  1YNJ C;  2NBF A;  4V19 0;  5EBC A;  5CR3 A;  1DM0 B;  3S2D B;  1J9O A;  3HRZ C;  3R2I A;  1FGB D;  1NR2 A;  2PZU A;  1RDP D;  1EOT A;  1CK1 A;  1QIL A;  5G3L F;  1Y8N B;  4K5X A;  4K2K A;  2AWO A;  3G7L A;  3E0J A;  1QCB D;  5CV7 A;  4ABN A;  1UNS A;  3DEP A;  3HG9 A;  2SNS A;  5LL6 S;  4M8A A;  2CHB D;  4CKB A;  4K5W A;  5ELE A;  2BDN A;  2PO4 A;  2BE5 C;  2VB3 X;  4E6I A;  1PTO B;  3N52 A;  2HQE A;  4ZQ3 A;  4C3J B;  3I3C A;  4J6H A;  1TS5 A;  1PTO D;  1I6H B;  1HFN A;  1PTO H;  4H7B A;  4HTH A;  3J81 E;  2R7Z B;  1EIH A;  1S5D D;  4OO1 G;  3TN2 A;  3L9A X;  3EQL C;  4A3B B;  4XQN A;  2CW0 C;  4DNR B;  1EY8 A;  2PNR C;  3KLR A;  4PQX A;  3HOU B;  2B2T C;  5EPL A;  1DOM A;  1HQM C;  4ZYS A;  2XVS A;  1BR9 A;  4WFN 3;  3NP8 A;  3OWF A;  3K5M A;  1PZK D;  2OXP A;  1BO0 A;  3OWE B;  3BG3 A;  3BVG A;  1LT4 D;  4KN4 C;  3AB9 A;  1OXT A;  3SE0 A;  4DA2 A;  1XYI A;  5J22 A;  2QKI C;  5CMD A;  2B2T A;  4C3H G;  4K6D A;  1QJO A;  1QOH A;  3X3N A;  1BCP C;  1I4R A;  4CJ2 C;  1B44 D;  2F0S A;  3GTJ B;  4G7Z C;  2R93 B;  3D4D A;  1CHQ D;  1LTA D;  2L4N A;  2KED A;  1M8A A;  4A3I B;  2MGS A;  3TP7 A;  3NHH A;  1OXS C;  3VR4 A;  3DWP A;  2EJG C;  2FIN B;  1O7Y A;  3BZD B;  2LKV A;  3SDZ A;  5JVH 3;  2NZ1 D;  3RD4 A;  4G57 A;  4L8J A;  1EEF D;  4BY7 B;  4CJ1 B;  1H9S A;  4RWS C;  5JPM C;  1B9M A;  4BBR B;  1OXV A;  1II3 A;  5NUC A;  4IFD J;  1IYU A;  2E75 C;  3BDL A;  2B2V A;  2JE6 I;  2FFK B;  3MC0 B;  1ONL A;  1WVL A;  4QUF A;  1GUG A;  2Q8R E;  2D5D A;  4KHV A;  3UI2 A;  2NTT A;  5DAU A;  1CZG A;  1ESR A;  3GP7 A;  4TKO B;  2B8F A;  1R4P B;  1PZJ D;  3K0Y A;  5BN3 A;  2PZT A;  4NDX A;  4A3J B;  1EIG A;  2D62 A;  1M4V A;  3T4A C;  5CV5 A;  2ENB A;  4HSV A;  3T13 A;  1ZYR D;  5E4X A;  1KLU D;  4HED A;  1MBY A;  3DWQ A;  4G7O C;  1EWC A;  1QWY A;  1J8I A;  3T16 A;  1Q1E A;  1I4G A;  5KYL A;  2MPM A;  3VA5 A;  4OO1 I;  2M9V A;  4ILW A;  4C1N I;  2OF1 A;  5IOD A;  2F0V A;  1CM9 A;  1S4Z A;  2C9O A;  2E2D C;  3DUZ A;  3P20 A;  4KY7 A;  3TZD A;  3R2T A;  2YYZ A;  5T1G A;  2KCN A;  5HUR A;  3PV0 A;  5C0X H;  2IWH A;  3HOY B;  3NQI A;  4KV6 A;  5I6Y A;  1PRT C;  2JSO A;  3QWN A;  3M4Y A;  3D3R A;  2F4I A;  1STG A;  1STE A;  4PNY A;  2B2U A;  1O7Z A;  1A3T A;  2EJM A;  2PQE A;  1TWC B;  3A7A B;  2DY7 A;  3I90 A;  2AQ3 B;  4A93 B;  4C3H B;  5EKL A;  2LS0 1;  3KUP A;  2PCF B;  5BN4 A;  3K6O A;  2IJ0 A;  4LK1 C;  2MP1 A;  2KEC A;  1PLF A;  2M00 A;  2BA0 A;  4TRD A;  1RTO A;  4K8J A;  2A5H A;  5I4D A;  1LTR D;  4ID6 A;  1GHJ A;  3RZO B;  2ICE C;  1DCZ A;  3GQB A;  1CHP D;  5KGU A;  2K7V A;  5KNC A;  3HOV B;  3MAQ A;  5IOC A;  1HFG A;  5IT9 L;  2F3V A;  1NSN S;  2NTS A;  3I70 A;  4DK1 A;  1DYQ A;  1ZEQ X;  3R93 A;  2A68 C;  1SBB B;  1GUW A;  2F0P A;  3OIQ A;  1TWF B;  1I50 B;  2WP8 J;  3P7J A;  5C0X J;  1U4M A;  1B1Z A;  2OT2 A;  2HDL A;  4L63 B;  5KND A;  2HDM A;  4KHZ A;  4UDU C;  3MXU A;  1AFP A;  2X6G A;  2EYO A;  1YNJ D;  5JVG 3;  3GTQ B;  2NVY B;  1TY2 A;  1FNW A;  5CYU A;  1K8M A;  4M1U B;  4N9P A;  2L12 A;  3VYS A;  1STB A;  1ENF A;  1DOL A;  1Z7T A;  3RZD B;  1WTO A;  1PFM A;  1EY5 A;  4HR7 B;  3A8I E;  3S1Q B;  3K59 A;  5ELD A;  3I4L A;  2F0G A;  3D4R A;  1MI2 A;  4DAP A;  5JPN C;  3A55 A;  3V2T A;  3V05 A;  2K33 A;  3NSW A;  2BE5 D;  1A2T A;  1SNQ A;  1X3P A;  3C1E A;  1WTX A;  2BDO A;  2IL8 A;  1B3A A;  2J7Z A;  2WV6 D;  4CHT B;  1D2B A;  5ELC A;  1E0B A;  1WTQ A;  4DNT B;  4U67 3;  3D31 A;  3DHQ A;  4XYQ A;  4FF3 A;  2N55 A;  2LY7 A;  2CW0 D;  2WB1 B;  1WTP A;  1SND A;  5I6W A;  3Q24 A;  3KLS A;  3PUZ A;  4C3I B;  5CV9 A;  4BA2 I;  3QJY A;  1B50 A;  5F2D A;  1JB3 A;  2NVX B;  1JR0 D;  2QF7 A;  4FXK C;  4C3J G;  1C4Q A;  1PFB A;  2E2J B;  3S15 B;  1PTO F;  1FD7 D;  4FXG C;  5M3F B;  2K01 A;  3SK5 A;  3NWS A;  1JWS D;  2G9H D;  4RKL A;  1CTM A;  3WOE A;  5FKA C;  4XT1 B;  1JQY D;  4IFD G;  5D3I B;  1T5E A;  3U9S A;  2Y0S B;  4QB4 A;  1BCP D;  3K5N A;  5IGG A;  5KYI A;  4H0L C;  2WKD A;  2F0D A;  1WTV A;  5IT9 E;  1HCZ A;  4FXD A;  1JE4 A;  3ERO A;  1BXT A;  4KJO A;  2XRS D;  2H4O A;  4KN7 C;  4DN4 M;  2JEA I;  2WAC A;  3MTS A;  1VF5 C;  2ZXP A;  3Q23 A;  4A3K B;  2E74 C;  2TMP A;  4QMG A;  1U4P A;  3M7N A;  4R8N A;  2KHS A;  2KVM A;  5IGC A;  3HZX A;  2K03 A;  3BVZ A;  4PMW A;  5EGT A;  4RA8 A;  2K5Q A;  3PO3 B;  1F9R A;  1D1I A;  3LWE A;  2XIW A;  1EQV A;  2A6H C;  2F0Q A;  3DMU A;  2E2I B;  3ITP A;  3GTG B;  4DXF A;  2V4D A;  3WDN A;  1Y8O B;  3IL8 A;  2VNU D;  1FYC A;  4CKC A;  5IGF A;  3I91 A;  4NMZ A;  5CV6 A;  5IGB A;  1CT1 D;  4YIJ A;  2MJ8 A;  1STA A;  1D5X C;  4HMI A;  1KDC A;  1EY7 A;  3VA7 A;  3OOC A;  3IFD A;  1SJH D;  4EVO A;  1TS2 A;  1MSH A;  4OIJ A;  1WD1 A;  3P1H A;  1GOZ A;  4TSS A;  1SE4 A;  2O4X A;  3VR6 A;  3SK8 A;  3MHB A;  2F03 A;  3TP6 A;  4A3G B;  1I4H A;  3TP8 A;  1TWA B;  2JP1 A;  4O42 A;  1Q90 A;  5EPK A;  1GUN A;  2F0E A;  1L0Y B;  4BA1 I;  2RQX A;  1CA6 A;  3KBX A;  1WD0 A;  1CA5 A;  1SJE D;  1PRT D;  3TBI B;  1OO9 B;  4RGN A;  1CFM A;  4RHR A;  5HGT A;  1RTN A;  4IFD I;  3TDQ A;  1TWG B;  4Q0F A;  3CU7 A;  4A3E B;  2B39 A;  5IGE A;  5I9P A;  3AMU A;  4HN7 A;  5K5P A;  1X32 A;  1EZ6 A;  2SOB A;  1EEI D;  2EY1 A;  5C0X G;  3DWA A;  3CRK C;  2NB0 A;  3VR3 A;  4Z9C B;  1FNU A;  5K36 H;  1BF4 A;  1V1P A;  4LJZ C;  4N9T A;  1F9P A;  1EYD A;  3RUZ A;  1DOK A;  1A6X A;  5JEA H;  5C4J B;  4KKT A;  2JXM B;  2QCP X;  3X3M A;  1IKM A;  2L11 A;  3K7A B;  4IQZ A;  1SNM A;  4KKU A;  4FF4 A;  5BN5 A;  3ND9 A;  3G6J B;  2A68 D;  2KA7 A;  3IKJ A;  5C3E B;  2F1M A;  3C3L A;  4RKB A;  1F9S A;  1STY A;  3ONA B;  4K8I A;  1GUT A;  3HOW B;  2B8G A;  1KLG D;  2IX1 A;  3Q6S A;  1LAB A;  1T5X D;  2K5W A;  1D5Z C;  4F88 A;  1SDF A;  2B2V C;  4FF1 A;  4EQP A;  5C44 B;  3TSS A;  3MA2 B;  4CBV A;  4WRD A;  4ZRZ A;  1SYE A;  3BS1 A;  2F0K A;  5KEE A;  2RSO A;  1SEB D;  3GTM B;  1SNP A;  2L55 A;  4KY6 A;  4IZ8 A;  1TVX A;  1RF2 D;  1HPC A;  5CC4 A;  4ZAI A;  2QDB A;  3U9O A;  1YNN C;  2M2L A;  3P75 A;  1I4X A;  4KY5 A;  3V96 A;  4RFB A;  3I4M B;  4OL7 A;  1SYG A;  1SYD A;  3CKI B;  3VYR A;  4H44 C;  5I2Y A;  1JCK B;  5JEA J;  5JAV A;  1SE2 A;  3FKI B;  2A6E C;  4NP5 A;  4TQU S;  3QOJ A;  2H1E A;  3MZ5 A;  3Q0A A;  2G9D A;  4KTA A;  5EJW A;  3N6R A;  1LT5 D;  2EDG A;  2F0L A;  1SNC A;  1LTS D;  5C0X I;  5A2Q L;  5C4H A;  1LLR D;  1G2T A;  3KBG A;  3GO5 A;  2XWJ B;  3A7L A;  1UEA B;  1VMP A;  2PYK A;  5LL6 X;  3R8B A;  5DM6 3;  1LV9 A;  2B2U C;  2L0C A;  1C8C A;  4B9W A;  3QG1 A;  3PIP 3;  3ND8 A;  3MXP A;  5CV8 A;  1TII D;  4HMJ A;  4C2M B;  4HAE A;  3A56 A;  2F0F A;  3FMC A;  1H9M A;  4ZLT F;  2XN9 C;  4JK1 C;  2J4X A;  1PFN A;  4XT3 B;  2L1B A;  1QE6 A;  3R3O A;  1SYF A;  1SXT A;  5JJZ A;  3FDT A;  3SEB A;  2PW5 A;  4LAA A;  3SK6 A;  4C3I G;  3OMG A;  1DZ1 A;  2QIL A;  5DNF A;  3GTP B;  4XQQ A;  1A2U A;  5EKI A;  4DFA A;  4BWG B;  1XXG A;  1O80 A;  4Y7N B;  1R9T B;  1TQO A;  4XDX A;  4K5V A;  4XTC S;  2Z8L A;  5C6A A;  4L6T B;  1B2T A;  1BCP F;  4FNF A;  2EY5 A;  4RHS A;  1SYB A;  3GV6 A;  3MWY W;  4ME5 A;  2EY6 A;  2A6H D;  2IT1 A;  1D5M C;  1VF7 A;  2Z4I A;  2O2L D;  5LHY 1;  3EA6 A;  3MXG A;  1JIC A;  3D8G A;  1NAP A;  3FVQ A;  1SNO A;  4OHJ A;  4KMU C;  2NVQ B;  3HGB A;  4ZUJ A;  3NWT A;  1IYV A;  2EVB A;  4PMC A;  4FVM A;  4FF2 A;  4EQN A;  1EYA A;  2X69 A;  3PIO 3;  1LTI D;  1MGS A;  3PUW A;  1EU3 A;  1MSG A;  2GA4 B;  1ILP A;  2FMC A;  4QIW B;  5KNB A;  1HUM A;  5T1I A;  2SEB D;  2K5D A;  2DNC A;  1ICW A;  5A2Q E;  1JOK A;  4DU9 A;  3QOL A;  4O1N A;  3BYT B;  2Z4H A;  4KKS A;  2NVT B;  5EQ0 A;  1UAP A;  4Q5V A;  3RLF A;  3A8K E;  3MVV A;  3OW7 A;  1TS4 A;  3SHL A;  2F0U A;  4CKE A;  4RGM A;  4ZK9 B;  2EY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...