2HUNA

Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
332
structure length
329
Chain Sequence
SMKLLVTGGMGFIGSNFIRYILEKHPDWEVINIDKLGYGSNPANLKDLEDDPRYTFVKGDVADYELVKELVRKVDGVVHLAAESHVDRSISSPEIFLHSNVIGTYTLLESIRRENPEVRFVHVSTDEVYGDILKGSFTENDRLMPSSPYSATKAASDMLVLGWTRTYNLNASITRCTNNYGPYQFPEKLIPKTIIRASLGLKIPIYGTVRDWLYVEDHVRAIELVLLKGESREIYNISAGEEKTNLEVVKIILRLMGKGEELIELVEDRPGHDLRYSLDSWKITRDLKWRPKYTFDEGIKKTIDWYLKNEWWWKPLVDERILHPTPWKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein PH0414 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Lyase
molecule keywords 336aa long hypothetical dTDP-glucose 4,6-dehydratase
total genus 124
structure length 329
sequence length 332
chains with identical sequence B
ec nomenclature ec 4.2.1.46: dTDP-glucose 4,6-dehydratase.
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hunA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2hunA02
5CDSA 2Q50A 2VYVD 5K0ZA 1ARZA 3BMQB 3LC7O 1NXQA 3ZW9A 1YJ8A 1DIBA 2A94A 2ZIZA 4XYGA 4J7UA 5LCXA 4ND2A 2I5PO 1OBFO 1PL6A 1W8DA 1NTOA 3PJGA 3ZGYA 4ALLA 1LC3A 1PZGA 2AE1A 2PZJA 4OXKA 1R0LA 4BKRA 4BQPA 1GUZA 4EJ0A 5JFOA 5IDWA 1QG6A 4Y67A 2OP0A 1LSOA 4WE3A 3AJRA 1DRUA 2WMDA 2CVOA 5JDCA 2P91A 5L7TA 2X0JA 4EW6A 1FF9A 4TQGA 1YOVA 4PZEA 4UVHA 5TSDA 4CMBA 3NAQA 3V1UA 2TMGA 3UGKA 3NRCA 2YZ7A 3FNHA 5FYDA 5BSEA 4IZHA 1B3BA 2AHRA 4Z0PA 3S1LA 3GPDG 3L6EA 1R6DA 1PS0A 4Y6SA 4XRRA 5EESA 5J23A 1F8FA 2WD8A 2HJRA 3K6JA 4XQGA 1MXHA 2X5OA 2XPCA 3F5QA 4QX6A 2Q2VA 1GEGA 1WDLA 1WDKA 5FWNA 4P4LA 3GPIA 3DAGA 3MTGA 1CQIA 1NQAO 4D42A 5A9SA 5L40A 5GZ6A 4F46A 1GYQA 4HFRA 3QRWA 1N9GA 5KTKA 2ZCUA 3JYPA 2D0IA 3LF2A 3O26A 2BHLA 4BNZA 3K2BA 4A0SA 1I2CA 4E30A 1NM5A 2VQ3A 3INRA 3DBRB 1YL5A 1LQTA 2VUTA 4RL6A 2RH4A 4BNKA 5FFFA 3GAFA 1ADFA 2DKNA 1UJMA 4LSWA 2GN8A 3GZNA 3E82A 4BO8A 3CMMA 1ZUD1 4NK4A 3HWRA 3IP3A 3I9LA 1PZFA 4UREA 4WOKA 3V1TC 2PD3A 2HK9A 3B70A 3NJ4A 4Q3CA 4RGBA 3DDNA 4B7CA 4R69A 4O59O 3EYWA 2G5CA 5DP2A 1XWFA 5LDHA 3NJ8A 1JWAB 3WWZA 4CLOA 4MVJG 4J9UE 1IHYA 4XWYA 1TVEA 5TNXA 3OJLA 3ZU3A 1BW9B 3I3OA 4BNUA 2D5CA 2QG4A 4GLLA 1HE4A 2P68A 2WD7B 3DOOA 1NWCA 5KKAA 2EKLA 1U3VA 4PIVA 2OORA 1YOVB 3IUPA 3HDHA 3BXXA 2I66A 4XIJA 2F1KA 1TI7A 2UVDA 3OJ0A 3IJRA 4NFSA 3PEFA 3DONA 4XJSA 2UDPA 4H15A 4I5EA 5DBIA 1B26A 4WCFA 3RUAA 3VPXA 3HQ4O 3PYXA 1BTOA 4OXNA 1DXYA 3JQ6A 4TVBA 1E1KA 1UZMA 2AEMA 3BTVA 4BMVA 4M54A 5CDGA 3IL2A 3OJOA 1Q0HA 4KWHA 1QYDA 3KRTA 2P9CA 4AJIA 1W4ZA 2AEJA 1KOLA 5TS3A 3RASA 5JAQA 1YVEI 1LRKA 4HFNA 2C59A 3G0OA 1U4SA 1UP6A 3JQGB 3TL2A 3UXYA 5CPFA 1I8TA 3WMWA 3I6IA 1K2WA 2W2LD 4XX0A 1PQPA 3BMOA 3TZQA 2JAHA 1LLQA 3SEFA 3P7MA 3TSCA 2EERA 2JHGA 3MWEB 4IS3A 2ZB3A 4NJOA 1PZHA 1DB3A 4DC0A 3JD3A 3ZNPA 1VL0A 2D2IA 4BMSA 1N1GA 3GVXA 1IE3A 1FDWA 4FBGA 2X5JO 4J4BA 1LRJA 1GAEO 1PJCA 4BO3A 1OAAA 1R0KA 4BNLA 3RUIA 3RVDA 4YT4A 4DUPA 1P0CA 4BIIA 5JS6A 3HZZA 4YAJA 4Z0HO 1SMKA 5KJCA 3WX0A 4KZPA 1Q1NA 1CEQA 4R51A 2O3JA 3S2GA 3GAZA 5A4DA 2ZJ1A 3KUXA 4TKMA 1BSVA 4E5MA 4PLHA 3ZWPA 3RC2A 3EGOA 4O1MA 1PZEA 3QVOA 4LMPA 2I65A 3KLMX 1DIRA 4B4VA 1O94A 2J3HA 4DMLA 4XDYA 4N5NA 5IDQA 3EAGA 1AXGA 2DUUA 5A3JA 3UF0A 3A4VA 4RF2A 3GFGA 4MIEA 5G2OA 4B3HA 4HWKA 2Q46A 2QRJA 1R16A 3KHUA 5G0VA 4EZBA 2ZJ0A 3NT5A 2QZ9A 3MTJA 2JL1A 3OIFA 4BO1A 4PZCA 4RVSA 1NVMB 2HU2A 4FOSA 4DIOA 2AA3A 3GVCA 8LDHA 3DZGA 3O4RA 3U4DA 2EF1A 5DN9A 5BT9A 1EVYA 2VZ9A 1A9YA 2Q99A 2EGHA 1M6WA 1RM5A 2PGDA 3OEWA 5JXWA 3L07A 3RIHA 4J4TA 3QY9A 5EINA 4QSMA 1T2CA 1Z75A 5DULA 4RPJA 5HS6A 4C4OA 3RFTA 3P5SA 1YB5A 3OSUA 3RSHA 2WYWA 3AY3A 3C7DB 1CQJA 5JMPA 3ZV4A 4HFJA 1JKIA 2BGLA 2VRCA 2EP5A 2Y0CA 2OHXA 4E4YA 3HADA 4YBZA 1JKJA 1WMBA 4I5GA 2EW8A 4PLTA 4J16A 3ICPA 3U09A 4D43A 4IINA 1DC4A 4FS3A 1H5QA 1O8CA 2W98A 3EK2A 4UVDA 2FZEA 1LNQA 1ZCJA 4OJNA 3DBRA 3A28A 4XGIA 3BMNB 3OMLA 2VHZA 4J9VA 1VJ1A 1HETA 1SB8A 4K26A 3ROKA 4E3ZA 5HRUA 3HSKA 3IKTA 5BR7A 1J4AA 3NDIA 4ND4A 4IJVA 1ZBQA 1HDOA 3OICA 2JFFA 4NG5A 4KUHA 4IQ8A 1O95A 3WGQA 2HMWA 2I3AA 2XF8A 1KBZA 4DGSA 5IZCC 1Y81A 4ESOA 3GK3A 5G0UA 3I9OA 3TDKA 1YGYA 3WGHA 4WLEA 1VLLA 4E2YA 5TQVA 4OHUA 5U4QA 1A7KA 1B0AA 1SEPA 4WKGA 3WXBA 3ZWWA 1V3TA 2J6IA 1SZJG 4L76A 3R6DA 3H2SA 2NTNA 4MDHA 1EK6A 4TWRA 3GC6A 1VM6A 3CE6A 3TF5A 1GL3A 1EUCA 1HDYA 2O23A 2YHIA 4GWGA 4E32A 4JBHA 3Q1LA 4J49A 5K6AA 4BHTA 4YJFA 5IZCA 4BKPA 1GU7A 1ISIA 4MVJE 2GN6A 1DRVA 2DUWA 3RBXA 1QP8A 3GUYA 5BSGA 5DBFA 3FBGA 2PY6A 2YW9A 3PQEA 3VH3A 3WNQA 3WGOA 2HRBA 1Y5RA 2PTGA 2FWMX 4GLOA 4LVCA 3WWYA 2J3IA 3R3JA 4W82A 3SXPA 1E5QA 1OFGA 4ZQFA 2V65A 2VZ8A 5TF4A 4CQLB 1AXEA 1JU9A 2OGUA 4AJ2A 3PLNA 1HDZA 4PLGA 3ZU4A 4CUZA 2BRUA 4CM9D 2J3KA 3I1JA 2NTJA 1P9LA 1UAGA 3NUGA 4IMPA 1RYEA 3KV3O 3LK7A 4Y98A 4UAGA 4XQ9A 2CDAA 1P45A 3KO8A 4IDBA 4JQCA 3H3JA 3TJRA 1V8BA 4D3DA 5JCXA 1WWKA 1ONNA 1I10A 2HSDA 1UXGA 3GG9A 3TFQA 5EN4A 1N7HA 1SO8A 1SNYA 1XSEA 5IG2A 3BTOA 4FGWA 4B7UA 3OETA 3E8XA 3R3SA 1M2WA 3GN1A 4LMRA 3ZU2A 4ALNA 1ZXBA 4CPDA 2X23A 2BI8A 3LT2A 1DIHA 2IZZA 1YE3A 4J1TA 3UCXA 1R37A 4RPGA 3L6DA 3RUHA 3H5RA 4U7WA 1ADCA 2LDBA 3F46A 4NR0A 2WE7A 5L4NA 2BGMA 2YDYA 3W4KA 3DL2A 2BI7A 5I8WA 3I9MA 4WK6A 1WLYA 3S2EA 1MV8A 5DCUA 5U9CA 1XR3A 1YO6A 3KB6A 5F1PA 5G0WA 1GZ3A 1DBVO 2CVZA 3SBOA 2IZ0A 1EE2A 3GVHA 1ULSA 3JD2A 2AQIA 3FRJA 4BV8A 1E7YA 5IXSA 2O50A 3WSVA 1FDSA 4BGEA 4BNIA 2AW5A 3NTRA 4RDIA 2PZKA 1KEVA 2QQ5A 5JDIA 3JQ9A 3L6OO 2C82A 4XQCA 4M55A 4MP8A 3ZWNA 1QYWA 5JC1A 3PTZA 1HT0A 3E48A 3E6AA 4BNXA 5I7EA 3SX2A 4ZA2A 3K73O 4BMNA 1UDAA 1ZH8A 5A06A 3UICA 2O4UX 4AJHA 3FI9A 3L4BC 3RQSA 3E18A 3IJPA 4U6SA 1GEEA 1E1LA 2ZTVA 1K3TA 3WFIA 3CTMA 1LJ8A 3D3WB 2VYVA 4DIFA 4QT0A 1TT5A 1BWSA 2VWGA 2Q1WA 2EKQA 3WQQA 3LDHA 3WB9A 4GMFA 3CSDA 4FFPA 2IZ1A 2ZB4A 1LA2A 4MVJH 4MVJF 3V8BA 5KVCA 1LC0A 3GHHA 4EEXA 3GZNB 3NGLA 3H3FA 1H2BA 1YDEA 5FI3A 2DBRA 1Z45A 3KTDA 1KVSA 2DVMA 4RVUA 3KYCB 1H94A 3QWIA 2VRBA 1NR7A 4XKJA 3PHLA 1T2EA 1XYGA 3WGTA 1DC6A 3RFVA 4D3FA 1NVTA 1XLTA 3F6YA 4K6FA 1DEHA 3QJ5A 1E7QA 2ZYDA 3WR5A 1CF2O 4AJ1A 2YV2A 4JLWA 1UXIA 3DZIA 2X9NA 1T1RA 2GPTA 4GQAA 4IM7A 4KUEA 4AJ4A 4N7RA 2DPHA 3JV7A 5TGDA 4WCFB 5B4TA 4P22A 1QRRA 4U6QA 3GDGA 1A71A 3I5MA 3ZDFA 3DWFA 3C7CB 4P4GA 4KTVE 3NX4A 1S7CA 4D46A 1VRWA 1LLDA 4YRBA 5BSFA 5B4VA 2WDZA 2D3TA 5L9AA 2DBZA 2OOSA 4GGOA 3D1LA 3ZWAA 2P4HX 4GBJA 1XQ1A 1YRLA 1EMDA 2Y05A 4EEZA 3DTTA 3AK4A 4XGNA 1NP3A 2VTDA 1C0KA 3JQ8B 2Y1DA 1T4DA 3NGXA 4GL4A 3Q11A 3LZ6A 1EQ2A 5T67A 4BO4A 2PD6A 3ZNOA 2YY7A 2G1UA 3GEMA 4BB6A 3VVCA 1BRMA 1Z6ZA 3D0OA 1GUFA 4XYMA 2ZYAA 2VOJA 3WYCA 4LVUA 1ZMOA 3JQAB 3QWAA 1ISFA 2HK8A 4BNYA 4E5YA 2X0IA 3EZYA 5BNFA 1B15A 2X1HA 4MVJD 4R9SA 3U4HA 2GN9A 1PJBA 2V6GA 3O9ZA 4ALJA 3QSGA 3C8MA 5KWEA 3BMQA 4FB5A 1YQGA 1MUUA 4LN1A 4G2NA 3JQGA 2FR1A 3PHIA 3Q6IA 4PCVA 3WG9A 2DU8A 4F45A 2W4QA 4FCCA 1GCOA 1SAYA 3UN1A 3GRPA 3KXDA 4LW8A 3FF4A 3GN2A 3VC7A 4EUHA 1I3LA 1KC1A 1QLJA 3PDJA 1Y1PA 4NBTA 5EIOA 3ZZNA 2P2SA 2YDXA 4ALMA 2O3TA 3GQVA 2W2LA 4E2ZA 1GD1O 1LUAA 4HXYA 5JW6A 1IZ9A 3K2EA 4YT5A 1JVSA 3K30A 4J7XA 5JCJD 2A4KA 4Z3DA 2R6JA 2QX7A 1ONOA 5AXAA 1BG6A 3OEYA 4GSLA 4L9RA 3ZWYA 4FOOA 5IN5A 4ROSA 1CIVA 2W2KA 3JQ7B 3IUSA 3QV1A 1Q7CA 1IY8A 1SCUA 1UZLA 3GG2A 1NQ5A 3LC1O 3ETEA 4YEDA 3JYLA 1PX0A 3VPSA 1HTBA 4INAA 1U9JA 2YFHA 1E5LA 3PHGA 3AOEC 2VTEA 4J3FA 5KVVA 2RCYA 5CEFA 4WJZA 1HDXA 5HWSA 4FC7A 1IB6A 1P1KA 4YQYA 4CUKA 4JROA 4IDGA 1YBAA 1LI4A 1GQ2A 1MA0A 3X2EA 1IL0A 1BGVA 1YXMA 4R01A 1HKUA 1KEUA 5TT1A 1BXGA 2VWQA 2YV3A 3WJ7A 4DQVA 2HDHA 1QYXA 1D8AA 1JA9A 1E92A 1B14A 2WSBA 3IAHA 5JYEA 3E03A 3EVTA 1E6WA 3JQEA 4WPGA 2X58A 3RUDA 4PLVA 2C29D 2Z95A 3A14A 4RQTA 4D0SA 4MKRA 4KMSA 4GMGA 3RKUA 4FJ1A 3N58A 2H1SA 1DSSG 4DYVA 4DYDA 3ZHZA 4ND5A 4OIMA 2FOIA 4ZQBA 3MJSA 2JJYA 4F6LA 4HV4A 1PWZA 3RUFA 4R5HA 1C3VA 3HHPA 5KCZA 4WLVA 4L8VA 1F12A 4RF3A 4RVGA 1M67A 3WTCA 3DZHA 4R68A 1N1EA 2GDZA 2NU9A 4NBWA 1T2AA 2PKQP 3RJ9A 3D7LA 2QRLA 2VHVA 4Q3DA 1Q0QA 1ZSVA 1HE2A 4CR7A 1TLTA 4MO2A 4CLDA 3IQDB 3FR7A 3LSYA 4AFNA 1MXFA 3OECA 1PGPA 2PH3A 3ITKA 3GFBA 3PQFA 4QUKA 5C7OO 1H6BA 4IDCA 2FSVA 1I32A 4OMUA 3DQPA 1UP4A 1R4MA 1RJWA 1UXJA 2VNAA 3DMTA 2FHSA 5CHEA 3E1KA 3INGA 1MFPA 5KJEA 1E0DA 1T4BA 4BNGA 2FR8A 3LF1A 5DBGA 1RWBA 1DLIA 8ADHA 2DT5A 3FSRA 3EW7A 4J1NA 1BXGB 4LRTB 4XB2A 1PGOA 1BHSA 3VDRA 1FJHA 4U0KA 3UOGA 2Y67A 1GYPA 3ENKA 1YBMA 3VH1A 1U28A 3KLPX 5EMHA 1GFSA 4RZHA 4J1QA 4OQYA 3PHJA 3F1LA 3TZKA 1E7RA 2WYVA 5KKCA 1I3MA 1I30A 1H6AA 5JLAA 3DFZA 2B4TO 4RDHA 1C1DA 2EW2A 3AY7A 4J7CA 2X5KO 2CSUA 3U49A 3HJAA 1PIWA 2I99A 1BDMA 3JYQA 3COSA 4FSHA 4GX1A 3PXXA 4DLAA 4XR9A 5L51A 2Y0EA 1A4IA 4OKNA 2HQ1A 5B1YA 1KY4A 2F00A 2UYYA 4DBZA 5AYVA 2OFPA 1RM4A 3SVTA 1HZZA 1C0IA 4BKOA 3H9UA 2HO5A 1B8PA 3C1OA 4IDFA 3I4CA 1LDNA 2JD0A 2Q2WA 2GSDA 3GT0A 1PU2A 2OUIA 2C5AA 4JJIA 3GMSA 4UEOA 4PLFA 1G1AA 4QXMA 3OF2A 3RI3A 1Z74A 3GRKA 2B4QA 4CLHA 1AGNA 2NM0A 1BXKA 3VKUA 4JCOA 3WBBA 4O5OA 4DRYA 1B3RA 1P1FA 1PSDA 4R1SA 3WS7A 1PJ2A 1SBYA 1RM3A 1LLCA 4GGPA 3F3SA 3W8DA 1NHWA 4OOFA 4AG3A 5COAA 4MVJP 5JC8A 2VOEA 2YQ5A 2BGKA 1FDVA 1HDCA 5KVSA 2ZKLA 1ZK3A 5U1PA 3A9WA 4JNKA 1W0CA 3UCFA 1EVZA 2DTEA 1K0UA 1X7GA 3C85A 1N9GB 1IPEA 2NUAA 2UV8A 4J91A 1L7DA 1ZK4A 4A03A 5AVOA 1J5PA 2GCGA 3P2YA 1X14A 3AFNA 1DHRA 3EVNA 1UP7A 1U2GA 1GR0A 4I5DA 3ONDA 1ZVMA 3ADPA 3TZHA 4XYLA 3DEYX 3DAFA 2A35A 1LEHA 1KETA 4CV3A 5ENVA 3AUUA 2JKVA 1T26A 3G1UA 4HKTA 1J6UA 1E3JA 1DOHA 4NHEA 1SPXA 2QYSA 1AHHA 1M66A 3NDRA 1O0SA 1E3WA 2JFHA 1HZJA 3E9QA 4QQRA 2IYPA 1ZJZA 4A27A 3G49A 1DRWA 4CM6A 1L7EA 3KBOA 3OBBA 1HF3A 4YAEA 1I33A 4FC6A 5EJ2A 2RH8A 1K6JA 1LTHR 2C54A 2H9IA 3ANLA 1QORA 5DCYA 2AQ8A 2WYUA 1Z7EA 4O0LA 3PFWO 4NQZA 4YT8A 5EPOA 5GZ1A 1NASA 2OBYA 3DTYA 2PH5A 4B4WA 2CDCA 4ZQEA 3WMXA 3FHLA 4XR4A 5JPIA 3H9JA 2HMVA 5DT9A 4NNJA 3IP1A 1ISGA 4RPKA 4L4RA 1C1XA 4MKZA 3K8ZA 3PIIA 5I9NA 3AY6A 4G65A 2HMSA 5L4LA 3BTSA 2PKQO 1J0XO 2Q4EA 2B37A 5A03A 3AOGA 3FBTA 3EY4A 3FNGA 1NPDA 3DXFA 4WEQA 3RC1A 4CQMB 1ENZA 1NYTA 2Y1EA 2EG9A 3M1LA 4D45A 3PP8A 4J0EA 2EJWA 2J5KA 2DAPA 2WE8A 1AN9A 2C5EA 2X86A 2J3JA 4EITA 1O89A 4J2HA 3U4IA 4WLNA 4XA8A 3JQ8A 3GUCA 4L4SA 1WDMA 1E3IA 2C07A 4E2WA 1KVTA 1Q7GA 3HDJA 2RBEA 1PL8A 1U4OA 4GKVA 1VL8A 4AJKA 4CR6A 1XU9A 5JNLA 3MZ0A 4NIMA 1IOLA 1ZO8A 1XG5A 5G0TA 2X9VA 4DBVO 3M1AA 2O2SA 1G0NA 2BFMA 4BO5A 9LDBA 1GV1A 5C7IO 1V3VA 2I3GA 4XIYA 4GPD1 3RC9A 4E6PA 1XQ6A 3NKLA 2BFAA 4BO2A 1VSVA 1HDGO 5GMOA 2VWHA 4AVYA 4E12A 3ANNA 1B8UA 1I3KA 4CMIB 2CFCA 3B6ZA 3VVBA 1I2BA 4QFDA 5ER6A 1CYDA 3ONFA 4YRDA 4A10A 1PJTA 1MGOA 4Q3NA 2JCYA 4R1TA 2VHWA 4IQ0A 5CEEA 1N2SA 4W9NA 4JIGA 4IXWA 4KUGA 1YBVA 3UHAA 2QW8A 1DFHA 3CINA 3FNEA 4JBGA 4CM8B 2IODA 3TRIA 1YL7A 1AUPA 4J6FA 4CV2A 1Q0LA 4BO0A 1E7SA 4CJXA 5A1TA 4MVJI 1ORRA 3JQCA 1Y6JA 4LK3A 3ZHXA 3ZNNA 3ZWMA 4A5OA 1MLDA 4P8RA 5B12A 3ZV3A 5TX7A 2NQ8A 3AI1A 4E31A 3CIFA 3I9JA 1FDUA 4DPKA 4QECA 1JKFA 1GZ6A 3FPCA 4GH5A 2HJSA 1YH3A 4GX2A 5FI5A 5A05A 5AXDA 4AJNA 5I7SA 1G0OA 3UAGA 1XEAA 4L0QA 1D7OA 2AEFA 2IYOA 4YJGB 1KY5A 2IXBA 4NH4A 3KSDO 1FDTA 3D5TA 2ET6A 3AI3A 1CETA 1R0SA 1DJQA 2AXQA 4MVJA 3OQ6A 1S6YA 1D4FA 4W7HA 4XJTA 4HNHA 3ULKA 4IJWA 4Z9FA 5A5FA 1H9AA 2E4AA 4EJMA 4IDAA 4ILKA 1B7GO 2D1YA 4R54A 2VNSA 1HL3A 4FJ0A 3U5TA 5HTOA 2Q4BA 5DF1A 2JD2A 1P1HA 2YQ4A 4O63O 3I9NA 4GKBA 2LDXA 3DC2A 3K92A 4WNIA 4HADA 4Z9YA 4HBGA 4MKXA 5B4UA 3U0BA 3JQFA 2Q2QA 4JBIA 1DO8A 3G3EA 2B69A 2PZLA 1XGKA 5ITVA 4YAIA 3V2GA 5JSFA 4W4TA 3QA9A 2WTBA 2DQ4A 3T7CA 1KEPA 3G79A 3VDQA 4M86A 4RZIA 4B8WA 4CM1A 2X0NA 3PJDA 4UVEA 5HA5A 1ZSYA 4N5LA 2BFOA 1D3AA 3MJVA 3OIDA 3RBZA 4CQMD 2XAAA 5IF3A 4PLWA 4D3SA 1C14A 5IDXA 4WEOA 1KVQA 1QSGA 3EHEA 4ZVVA 1DAOA 2H5LA 3D3EA 3FPLA 4YAKA 3BYZA 3JQFC 3ITDA 3E9NA 4NU6A 1ISMA 4A2CA 3M6IA 4YWJA 4EUFA 3G1TA 4UUMA 3D64A 2PA3A 1KC3A 4D79A 5ENDA 1ZIDA 1ISHA 1GYRA 1CDOA 4II3A 1H0KA 1B2LA 4B4UA 1HWYA 3PWZA 1P74A 3K5PA 3C1TA 3VZPA 5ICSA 2HUNA 3JD0A 2VT2A 1QYCA 4AICA 2Q45A 3LLSA 2Q1SA 3JQAA 2PGJA 4K28A 5H82A 5EL0A 1DIAA 1NX6A 2UAGA 3PLRA 3OQ1A 4W6ZA 4E33A 2PLAA 3PVZA 5A9SB 5IXYA 1NQOA 2NVWA 1J49A 2DTXA 3CEAA 2Q1UA 1O6ZA 4ND3A 5ES3A 5I9MA 4CM8A 1P1RA 1ZSNA 4G5HA 3BHIA 1P33A 4FPXA 2GF2A 3H4VA 5HS4A 2OZPA 4B8ZA 2WWRA 3GR6A 3NTOA 4UVGA 3VTFA 3JYNA 3L77A 3RUCA 1NFFA 3WQSB 1P0FA 3DBLA 3LT4A 4E0BA 4II2A 3INTA 2ZTMA 3MOIA 3WDSA 2O3SA 3C24A 1U7TA 1LU9A 2G17A 4GSKA 2AQHA 4BO6A 4PZDA 4FGSA 3S2IA 4EGFA 5DOVA 3DAPA 3UUWA 3ZWBA 4D0RA 3IOYA 1OC2A 4KWIA 3VH4A 5KOIA 3HN7A 3PWSA 5KIAA 1HEUA 3P2OA 2X9GA 3KEQA 1NHGA 5CAEA 4DVJA 2DTDA 1HE3A 1VKOA 5IFLA 1GDHA 1V0JA 4RVDA 3VPFA 3OA0A 4PG6A 4YXFA 4PGFA 1U5AA 5DCWA 3GEDA 4DC1A 2DFVA 4KOAA 1XA0A 2NNLD 2WJPA 4Q39A 1RKXA 4XYEA 1H6DA 4CLOB 4M49A 1WPQA 4TMFA 4WCDA 2NLOA 4Q3EA 5G4KA 5IJZA 3HFGA 2HAEA 2GERA 1DPGA 3AWDA 4D44A 2GLXA 5B37A 4YTEA 3GF4A 3F5SA 2P9EA 3MOGA 2VZ0A 3WGIA 3QVTA 2RHRA 3Q2KA 4ID9A 4Q3AA 1M76A 2O3QA 1JDJA 3GDOA 3TL3A 3GH3A 4YR9A 4ZN6A 4YVFA 3VZSA 4EI2A 5TT0A 1ML3A 4TRRA 2Q49A 2WD7A 1KERA 4ZU3A 4BS9A 4CLEA 2BMAA 4AJPA 4DL9A 5BNTA 4GWKA 5JCJA 2POQX 1EEHA 1U3TA 3SLKA 1UUFA 1E1MA 1PJ4A 4C7JA 2BLLA 3V1YA 1H9BA 1HSZA 2FN7A 3ANMA 3JTMA 2ILTA 4J43A 3VH2A 3L4SO 5A5EA 2Q3EA 1UDCA 2ZB8A 3ZHYA 1ZZEA 2ZTLA 3ZCXA 2C7VA 2QRKA 1OC4A 3PIDA 4YJDA 2V6BA 4EUEA 3O8QB 3O03A 4S3MA 4X54A 2DC1A 3WNVA 3DO5A 5CFZA 3CZMA 1X13A 1MX3A 3B1KA 2XXJA 3ETDA 1P77A 3W6ZA 4S1VA 2IEBA 2CDBA 3PJEA 4E5NA 4H7PA 4OSPA 1F17A 4Y6PA 4WCFC 4UULA 2OO5A 1GQYA 2DBVO 3TN7A 4L74A 1JN0A 3RWBA 5C7LO 5L4SA 3OM9A 3W6UA 3UH1A 3GGGA 4M87A 1VKNA 4CM4B 2CZCA 4CMEC 4MIOA 2H63A 1X1EA 2Y1FA 5G4LA 3ADOA 1LQUA 1QXSA 1V3UA 4CLRB 3IDSA 3NYWA 3JCZA 4MPDA 1E3LA 5H83A 4OKIA 3EZLA 4FFLA 3WIDA 2O48X 1LDBA 2JCXA 2NSDA 4A7PA 1ZFNA 1SEVA 1H93A 3NEPX 4QO7A 4TZTA 2IE0A 2FPGA 4BL5A 1A5ZA 1XHLA 3KYCA 4ZICA 2G76A 1EFLA 2B35A 2P9GA 3OP4A 3GA0A 4RLSA 3HN2A 2YV1A 4A26A 1IPFA 2X6TA 2O4CA 4QFCA 2V6MA 4RO0A 1DJNA 4MINA 2HMUA 1NQTA 3AU9A 5F1OA 1ADBA 3AM3A 4DREA 5CG2A 1TB4A 3TZCA 5C3MA 1U8FO 4HNGA 4G81A 3DOJA 4PLPA 2EP7A 3DBHB 1ZW1A 4PG8A 1U2DA 3D4OA 3I4FA 2CVQA 1Z73A 4DQXA 4IJUA 4RVHA 3K31A 3K9QO 4JJFA 1EZ4A 3U3XA 1DC5A 3V2HA 3WOHA 5T6BA 1KVRA 1OMOA 1VI2A 1LSSA 1M6HA 3DBLB 3ENNA 4XYBA 3T7EA 4AJEA 1MC4A 3WGGA 3UVEA 5L95A 1DHTA 4Z6KA 3UW3A 1F8GA 3OJEA 2FPIA 5KVQA 4J0FA 4BUCA 4E2XA 2C20A 1MG0A 3BA1A 1FMCA 1X0XA 2DFDA 3GNQA 3KM0A 4NFYA 3GVPA 2X4GA 5A3VA 1Z82A 4A73A 5ICMA 1EE9A 2B5VA 3H65A 3MJTA 3NT2A 1F14A 2OMEA 2BD0A 3H5NA 1C0LA 2EV9A 1NFQA 3L9WA 1H6CA 3U9LA 5T5QA 1YWGO 2VRCD 3NDJA 3DZKA 4OH1A 1QR6A 4GX5A 3DB2A 2VT3A 4IGFA 3R0IA 4O6VA 4UEJA 2AQKA 3QWBA 4R3WA 4CV0A 5JBIA 2GASA 4UUPA 4M89A 2G0TA 3PFFA 1OI7A 6LDHA 1E6EA 3JQBA 1ZK2A 2GZ2A 1O5IA 2PGLA 9LDTA 4AJOA 2FP4A 2OP1A 3F4BA 2EJVA 4IDDA 5DP1A 4YYZA 1X15A 1EVJA 4EJ6A 5EQFA 1HXHA 4DPMA 4L73A 4XD2A 2UUPA 1DAPA 3PPIA 5CEJA 4JP3A 1K89A 3DOCA 1I2ZA 1U3UA 2HK7A 4UUNA 3M2TA 4BKUA 5AXCA 3D4NA 4DQUA 4ZRMA 2HCTA 3I9KA 1JQBA 3OQBA 1E1NA 3T4XA 4BNWA 1ZK0A 1WVGA 1ZK1A 2ZK7A 3UCEA 2FY8A 3ROMA 3WBFA 1HE5A 3BZUA 4YAGA 2I6TA 1KEWA 4Z0TA 4FD3A 1PTJA 4ZJUA 2IRWA 3FTNA 7ADHA 3GEGA 1VPDA 4FQ8A 4N5MA 3DR3A 3QIVA 2X7HA 3DBHA 1ZXLA 4R1UA 1BMDA 1Y9AA 1VJTA 2GRAA 3WYBA 4B79A 4LCJA 4FFMA 4JP2A 3DZFA 3WSWA 3TFOA 4PG5A 2P5YA 4GVLA 2O7SA 1QV7A 4NU5A 4YRAA 2NQTA 5L7YA 1BDBA 1LDGA 4QTZA 4JGBA 5JE8A 3GMDA 5K6AC 3IC5A 3CXRA 3L4BA 1PJLA 2RAFA 4OAQA 3D4PA 1A4UA 5CPBA 2J8ZA 4DLLA 4Y8VA 2FZWA 4Y9DA 1O9BA 5T8KC 2PK3A 4YQZA 1PS9A 1WMAA 3GGPA 4JK3A 1GPDG 1Z7BA 3OJFA 2EGGA 4XQEA 5CDUA 4ZRNA 4DIBA 1GCUA 1E6UA 4BVAA 4TROA 1MB4A 4CLRA 3GLQA 3RBVA 5ILGA 5BNIA 1VL6A 4H16A 1YJQA 1ENOA 1IHXA 1SC6A 5K9ZA 3NV9A 5JY6A 1PJSA 4FW8A 4NJMB 2Y66A 3ABIA 3WIEA 4WASA 3ST7A 5T8KA 3AUAA 3I6QA 4RQUA 1BVUA 3E5RA 5F5NA 2Y68A 4IQGA 2OBNA 4MVJM 4UUOA 1Y5MA 2PWZA 2W2KB 3JQ7A 3PGXA 1I36A 1VSUA 5C37A 3BHJA 4WNCA 3TWOA 5EQDA 1VJ0A 4BNNA 5IDYA 3ZNQA 5GY7A 4R41A 1H2HA 1I01A 5EERA 4BV9A 1KYQA 3KSUA 4IPTA 4PLCA 4BO7A 2W90A 1I5RA 4NFHA 4RF4A 5AXBA 2WEKA 1LBEA 3ZWOA 4FFRA 4H3VA 4M1QA 3ROPA 1EUDA 1F06A 2JHFA 5F3RA 3PHHA 4YT2A 2E82A 5G4KB 3FD8A 1R4MB 2Y0DA 1ULUA 3AM5A 1HLDA 2GYYA 3H9QA 3DHEA 4DPLA 1Q2XA 4GI2A 4RV9A 4GVXA 1PGQA 2EHDA 3ZH2A 1GUYA 3JD1A 1MFZA 1AE1A 3NT4A 1WZIA 2AG8A 2VWPA 2GNAA 3H7AA 4JXKA 3DFUA 5IN4A 3RFXA 4I9HA 3CH6A 2FR0A 2QIOA 5BQFA 1XIVA 2CY0A 3H5AA 3U62A 2NWQA 4IIUA 1X7DA 2VHYA 4RPLA 5JDIC 4KQXA 1EFKA 4IDEA 4R3NA 5A02A 4CQMA 3PI7A 3H9GA 5CG1A 2UUOA 4R16A 1A9ZA 5TJHA 3D5QA 3LT1A 3RUEA 4CODB 5JAIA 1FK8A 4B7XA 1BXZA 3R1IA 1Y8RA 4FR5A 2OXIA 2NADA 4FJ2A 4OXYA 3ZWVA 1D1TA 1I0ZA 3RC7A 3X2FA 4E5PA 4CM5A 2XOXA 3HUDA 3WQRA 4PFJA 4Y6RA 4BNJA 3SC4A 1T24A 4PRLA 4FN4A 5L53A 4RJTA 4J4HA 5JO9A 4WLOA 4J90A 2AG5A 4OOEA 4IUYA 3ZWCA 3K96A 1ADGA 5G0SA 1RPNA 4ALKA 2WM3A 1NWHA 1SB9A 1F0YA 2C2XA 2JAPA 3F4LA 4JN6B 4RORA 1PJ3A 3BHMA 2HMTA 4XRGA 1YONA 4MJLA 5KJ1A 2X22A 3L9XA 5GZ3A 4OM8A 3Q9UA 4D7AA 3ICCA 5KJFA 2Y1OA 3QWHA 1P1JA 4BO9A 3AOEA 1HRDA 3H8VA 3VOSA 3RJ5A 5JAMA 4DA9A 4ZQHA 4IY1A 1YS4A 3VHRA 2CNBA 4LSMA 4YDRA 1LDEA 4F3YA 1DC3A 2XXBA 1YKFA 2YFQA 1N5DA 1LRLA 4WLFA 1PL7A 2FPPA 4W99A 4I8XA 4XGKA 4TRMA 4PVDA 3BMNA 3RROA 3SC6A 2PKRA 4BNFA 1CERA 3FCOA 1HYGA 4CLXA 2CMDA 4U5QA 3Q2IA 3KEOA 4U0JA 2JD1A 3W4IA 5MGBA 3BMCB 3M2PA 4K9DA 1GV0A 5CP8A 3BMCA 3WFJA 1XDWA 3TOXA 1X0VA 1IYZA 5LDGA 3UKOA 1OZAA 4XEHA 4YA6A 1SOVA 3B1JA 3AW9A 1U1IA 3LT0A 4PG7A 5ER9A 2E48A 4PG4A 4Z9XA 1NPYA 2FRDA 3PYMA 2VYND 4B4OA 4ITUA 2CD9A 2DLDA 3CUKA 1HLPA 2NV6A 3PZBA 3ZWXA 1ISJA 4R1NA 3AM4A 3TNLA 5LC1A 2V7PA 1QKIA 3CZRA 2ZYGA 3GDFA 4NBUA 4DLBA 4WLUA 5BSHA 2B36A 4N18A 3TOZA 4EYEA 5L7WA 1TT5B 3AI2A 5JAZA 3B20A 3OA2A 4QEDA 5A9RA 2BF7A 3RU9A 4KDEA 5FF9A 3PZRA 3JYOA 4BKQA 1GPJA 3E5MA 5ITWA 1JVBA 4D41A 2QZZA 2NVUB 4UEKA 3PGJA 1JW9B 4CL8A 4HP8A 4DXHA 4AJJA 2B4RO 4TSKA 1C0PA 3DMTC 3JD4A 3AUTA 5THQA 5T64A 1JAYA 3LVFO 1E7MA 1W6UA 4TRJA 4WOJA 3BAZA 1NPTO 1UAYA 3FN4A 1Y8QA 1JTVA 2GO1A 2FSSA 2PNFA 4AL4A 1X7HA 4Z3KA 4IZIA 4ONEA 2B5WA 1NR1A 3FWNA 1CJCA 4CMJA 4BGVA 2YJZA 1K6XA 1A27A 3JQDA 2O2YA 4HY3A 3CMCO 1V9LA 2V6FA 3LYLA 2C2YA 1IULA 3MWDB 4OYRA 1JAXA 2A92A 3H9EO 5F1KA 1T1SA 3HG7A 2BH9A 4YJHB 2P4QA 3G17A 2JCVA 2GR9A 4P38A 4R9RA 3ZV5A 4I1IA 3OHSX 4R5MA 3ASUA 4CMCA 1LDMA 1QYVA 3SJUA 3CKYA 3P19A 2D59A 5F5LA 4KP7A 1ZNQO 2VCYA 5DZSA 3RU7A 1JLLA 4W7IA 3CPSA 4HFMA 1CRWG 5I8ZA 2HRZA 2ZCVA 3VTZA 2Y1GA 1T2FA 1R4NA 3KYDA 3ZN2A 4EBFA 4PLYA 4YPOA 2DBQA 2GGSA 3EC7A 4J2OA 4K1LA 4FFNA 5A9TA 3TPCA 4FDAA 4JX8A 4URFA 4RLHA 2NTVA 1C1DB 1ZEMA 4L75A 4BGUA 2QHXA 3MJCA 4OL9A 3VZRA 1UZNA 5I7FA 4CMKA 3ZU5A 4MP3A 1QLHA 4CL3A 3DHYA 1NAHA 4CMHA 4PRKA 2YHIB 3LLVA 2O3RA 1W73A 3IKVA 1MC5A 1IUKA 3WLEA 3VPGA 5C5IA 2RIRA 3T4EA 1WW8A 1YB4A 1GZ4A 2O7QA 2PV7A 5JO0A 4NPCA 2P5UA 1UXHA 3ZHBA 2YHUA 4NDNE 5AQ1A 2VHXA 1G6KA 3MCVA 1YQXA 3N7UA 1NBOA 2CF5A 2D4AA 2NVUA 2ZB7A 3O8QA 3GY0A 1U5CA 4PN3A 4HUJA 4FFOA 5L3ZA 4ALIA 1PS8A 4NMHA 1A72A 1P1IA 1E3SA 2G82A 1B16A 1U8XX 3OH8A 4C7KA 3LQFA 2E49A 3PWKA 3BIOA 3QW2A 1ZKMA 4IJKA 1LLUA 4LRSB 3HNPA 3VZQA 5TJ9A 2FMUA 5AOVA 2TMDA 3ZW8A 1X1TA 1BW9A 1GQQA 1IZ0A 2A9FA 3I52A 4P4NA 3VKVA 2QYTA 4IBOA 4KDFA 1EQUA 2GN4A 3ZV6A 3PK0A 3Q0EA 3C3XA 2IEDA 3I23A 4R4JA 3ETGA 3QE3A 1TA4A 1KS9A 2CUKA 1A7AA 2W8ZA 1ZMTA 4F6CA 1NVGA 3RCBA 4KQWA 2JFGA 4GAEA 2VN8A 4RPHA 3TZ6A 5I7VA 5THKA 3AFMA 2EWMA 4BNMA 1E3EA 3H2ZA 1N92A 1QV6A 2BFPA 1MP0A 3Q3CA 1PR9A 4IMRA 1ENYA 3EUWA 4CMGA 1WZEA 3PJFA 3QWFA 1TXGA 3O38A 2J5QA 1GTMA 1PQWA 4WUVA 5CDYA 5KJ6A 3A06A 4TVOA 4M8SA 1WNTA 1Y9EA 1EDOA 1FXSA 3F9IA 4LCEA 3HE3A 1QMGA 3KYBA 2HLPA 3ZI0A 3RAJA 5KNLA 1DFGA 3KVOA 3EMKA 3HFSA 1TEHA 3AU8A 4YACA 2PFGA 3C1AA 5HBRA 4NK5A 4UVIA 2ZTUA 3S8MA 3NTQA 4BQRA 4E5KA 1V6AA 4EDFA 1K5HA 1LXCA 5I9LA 1WP4A 4JJGA 1EVIA 1YB1A 3QVSA 2X8LA 2ZQZA 5A04A 4GX0A 3WICA 2Y93A 4NBRA 3FWZA 4L4XA 2BKAA 5TLSA 3FTPA 1P31A 2EXXA 1VE9A 4DMMA 3GNTA 2O3UA 5ADHA 1UDBA 3ON5A 5TC4A 5TIIA 1HSOA 1N8KA 3GVIA 1E7WA 3W8EA 3AUSA 1N7GA 2YUTA 3DZBA 1Y8RB 3MEQA 4OGWA 4WECA 5HM8A 4CQLA 2H6EA 3QP9A 5COBA 1YDWA 1GADO 1I24A 1YQDA 2ZQYA 3GNSA 2C0CA 1PR3A 4PLZA 4B3IA 4CMEA 2NU8A 5DDIP 4BNVA 7MDHA 1PQUA 1DFIA 1DIGA 1RM0A 3D3WA 1XU7A 4RCVA 3TQHA 3RD5A 2Y1CA 4BNHA 1NAIA 1NFRA 3LU1A 4U8GA 4YB8A 4BGIA 2B0JA 3HB4X 3WGYA 1XCBA 2YYYA 5ILOA 4E13A 4IGEA 2Y99A 1Q7BA 4ND1A 4OQZA 4YJFB 4CV1A 3H6KA 4IIVA 3A1NA 4ZD6A 5DOZA 4I9UA 3SJ7A 1B8VA 2GUGA 2R00C 3S2FA 1K6IA 2PZMA 2R2GA 6ADHA 4QO8A 4IS2A 3EDMA 3WTBA 1LSUA 4OO3A 2I67A 1EDZA 4TKLA 2NVBA 2PD4A 4YJGA 3DBVO 5F21A 2HKIA 5COQA 4LISA 3W1VA 3PRJA 3OFSA 2GD1O 1R15A 3Q9NA 4W9NC 4ZGWA 3BTUA 1L1FA 3N74A 3GZ4A 3WJAA 3QQPA 4DWVA 1WAMA 1XELA 2NU6A 2Z1NA 2J5RA 4WGGA 1PJQA 1E77A 2R00A 4DTIA 5CDTA 4OSOA 3WGZA 3BMOB 4CM9A 4KTTE 4XCVA 3STHA 1XKQA 1EBFA 3IMFA 3KZVA 3MJ4A 3FR8A 2BELA 1ENPA 4CMAA 4NJMA 4Q9NA 1TT7A 4TZKA 2Z5LA 1U7HA 2VUUA 4ZQGA 3JSAA 3PQDA 2Q1TA 2D5AA 2DPGA 3WYEA 1WXDA 4N54A 3VAZA 4TRNA 3SLGA 3DMYA 3W8FA 1YL6A 1Y7TA 1U3WA 2AMFA 2PR2A 1PWXA 1ID1A 1R4NB 3DHNA 3KYDB 1ZJYA 4RF5A 3I83A 3QVWA 4PVCA 4CR8A 4BOYA 2VYNA 1V35A 4XDZA 5FEUA 1SOWA 1ONPA 1GY8A 3V5NA 2EKPA 1KIFA 2AE2A 4XB1A 2NU7A 2NACA 1M75A 4XZ3A 1R66A 2SCUA 3JQAD 3JQBC 1PGNA 4I08A 1I3NA 5IZ4A 1HYEA 2DM6A 1UXKA 3OIGA 1P3DA 3FNFA 3PYLA 4LGVA 3WLFA 4Q3BA 1EUZA 2C7GA 3KSZO 2E6UX 1EBUA 1UH5A 3L0DA 3IIEA 3ORFA 4FIZA 4YJHA 2IXAA 2VUSA 3JQ9C 3UFXA 3S55A 3PDUA 2I76A 3HDYA 3VPHA 4I9NA 3GGOA 4CM3A 2OL4A 3F1KA 2I9PA 3MJEA 3IS3A 1JWBB 1Y8QB 3LC2O 1PGJA 3GHYA 3QLJA 3QHAA 1PEDA 2EIHA 3V2UA 1BVRA 1T2DA 1DDOA 5TRTA 4J1SA 3GOHA 4CM7A 3HB5X 2E37A 4BB5A 5IAAA 1P44A 1HDRA 5JY1A 1NNUA 1RYDA 3F47A 5H81A 2D8AA 2RHCA 2GZ3A 2B83A 4BNTA 3E9MA 5MDHA 3B1FA 4MP6A 4B3JA 3RKRA 1AHIA 4MOWA 3U4CA 1KVUA 2Z1MA 1D1SA 2X0RA 5JMWA 4YCAA 4CMIA 5DNAA 3W4JA 5JYDA 4AJLA 4K6CA 5L45A 1DLJA 1UR5A 1MG5A 3KOUA 3DZJA 3ASVA 1OOEA 3C7AA 2GZ1A 4CM4A 1LX6A 1ZEJA 4MIYA 1R12A 4NI5A 5T57A 2IDZA 3KETA 1VC2A 3QVXA 1CWUA 3ONEA 4CUJA 4E21A 1LSJA 4I5FA 4NBVA 1T25A 3HDQA 5JDCC 3ROQA 4IXTA 1C1XB 4RVFA 4ZHSA 2CF6A 1HYHA 4HX5A 2EEZA 1EK5A 1LDYA 1E3WB 2ZATA 4NZ9A
chains in the Genus database with same CATH superfamily
5CDSA 2VYVD 1CIJA 4FU0A 2B94A 5K0ZA 3E4CA 2R6DA 1YRHA 5EKUA 3ZBPA 2WMYA 2XVMA 5WRFA 3ZW9A 5CW1A 1MZPA 3CLRC 2H1IA 4K9PA 3FNIA 2P90A 3G2JA 1H3NA 2OGSA 2I5PO 5CAEB 4F85A 1W8DA 3PJGA 1J0EA 2QG6A 5CCXA 1S2DA 2R5WA 5ALDA 2EP8A 4YRIA 1SXHA 2OHGA 3D3KA 3OCVA 4OUDA 4EJ0A 5JFOA 2RHMA 1QIJA 4AULA 1D9XA 4O4HA 5DHUA 2OFFA 4WE3A 4FHEA 4JSRA 3AJRA 4D4LA 4TMKA 1DRUA 2WMDA 2Z30A 5B7GA 5JDCA 3KQMA 3W2TA 3E15A 2FP4B 4QOHA 3H75A 4LHYA 4QKQA 2WIDA 1KMNA 4KFSA 2B8TA 4L78A 1GLVA 3EDOA 3SZRA 1W88A 3P9CA 1WY5A 5KC9A 2VNHA 3P9RA 3OZVA 2TMGA 1TEVA 1PFVA 2WU0A 2YZ7A 4UAJA 3UGKA 5DYGA 5BURA 5FYDA 3Q9SA 1FBTA 5B53A 3AVOA 1XVUA 3DNPA 3TBKA 4ZFNA 1DNPA 1G63A 1YQTA 2HA4A 3H18A 5DASA 4Z3OA 3GPDG 1MVLA 3L6EA 2YV4A 3Q12A 4LJ9A 4DLZA 5FH9A 1F8FA 2WD8A 5C81A 2HJRA 4TWIA 4HRXA 1QPGA 4I4TA 1MXHA 2N0SA 5F2KA 1P80A 3G8DA 1GEGA 3DUFB 3RRXA 1CTQA 2F3TA 5FWNA 4RPCA 3UB4A 5LJIA 1DGQA 4JJ6A 1I5EA 3R7WB 4F3KA 1PV2A 1N3IA 4FDMA 4JUBA 3HZOA 1IUOA 1LVHA 3LTEA 4HDRB 4F46A 4HFRA 5CBPB 1N9GA 4CHTA 2ZRMA 2ZCUA 4XPIA 2D0IA 3O26A 2CT8A 1MOPA 2W6QA 3M5PA 1MKYA 3DDZX 4A0SA 2WJIA 2KYRA 4DJAA 5LIRA 3I8OA 4HH3C 1WKVA 4NESA 1CZKA 2IPAB 4JLMA 1NM5A 4DV1B 3J7AC 4Z4FA 2R6CA 1BWPA 3W90A 4MMYB 4WNYA 3TE7A 3X3HA 3A4TA 3HCEA 1YL5A 5LXTF 2X4IA 4GS5A 2V0NA 4HWGA 4WRRA 4DIKA 4YRPA 5SY4A 3LLMA 2QLNA 3E84A 3GAFA 4TMTA 3ZHRA 1GCAA 3GZNA 4M83A 5EFZA 4YPVA 1C7JA 2SHKA 5HFNA 1R5NA 1HNNA 5I6DA 1P4RA 1R9NA 4O2RA 3HWRA 5CNJA 1S8FA 3IP3A 4FLEA 2MINA 3V1TC 1WA5A 3MTBA 3NJ4A 2HK9A 5KDOA 5LP6B 1D9ZA 1F4VA 1PW5A 3UB3A 3QXGA 4RTLA 4R69A 2BHNA 3QM1A 3QYPA 3UWMA 4TLAA 3GLIE 1PWHA 4IHJA 1QYIA 2RH9B 2VJDA 3JXEA 4I4TB 4XOIA 4DDKA 2RBGA 2DWQA 2HJHA 3AT1A 3TECE 3LDUA 1ZOPA 1L5LA 4X44A 3F3KA 1SCNE 3ZBUA 3ZU3A 4UHFA 4BNUA 1IM2A 1CB7A 2QG4A 4GLLA 4PSDA 2ZLBA 3UFBA 1BHQ1 3DOOA 2KHZA 3EZ6A 1VOTA 2EKLA 5GONB 4ZAVA 2Z2ZA 1CUUA 1TZMA 4PIVA 4ZCLA 1E1YA 1YOVB 1J23A 2JIZD 4XDHA 5C8YA 2K5UA 3RVLA 3ZWDA 3VKWA 1WXFA 3IUPA 4GLBA 1E9AA 1PBNA 3TEJA 1IJKA 2I66A 4CNQA 5A3QA 2WI8A 3SX4A 1SZPA 4HD8A 1TI7A 3A26A 5KYUB 3AJ8A 2AG6A 3GDWA 4JBNA 1QMPA 2BBTA 1BQ3A 5HCUA 2MMGA 4AS3A 4R7GA 1XRMA 1UDRA 3AB3A 4GF5A 5KQRA 2Q9AA 5D2CA 2BMJA 2HA5A 3F5DA 4PGHA 3HQ4O 1WPGA 3T7SA 2CL7X 4OQXA 3VNSA 2E6KA 3OOJA 2XAUA 3HCNA 4TVBA 3WDLA 5LOVB 2CYBA 4TS4A 1P2SA 2FHPA 2ZRKA 2XNDD 3H4MA 4UBKA 5SYAA 3IVMA 3KRTA 4CIBA 1DAFA 4GDMA 5H3CA 1Y6ZA 4DR1B 4AJIA 1FY2A 1YVDA 1W4ZA 3U61B 2AEJA 3ZXUB 2HPVA 2K2QB 2MSLA 4GPTA 5JAQA 1YVEI 4DJEC 1DX9A 4OM7A 1RTTA 1TUGA 4HFNA 3G0OA 2GCPA 2NZYA 4LZAA 2QZ4A 1I6LA 3JQGB 2HFJA 3TL2A 2IUSA 4RY8A 5CPFA 1G8JA 5AHWA 3O8OA 3T9EA 3WMWA 4V0ME 2BWJA 3AVWA 2VHCA 3E22B 3F6RA 3GYGA 3OURA 2JHGA 5DYTA 3WGJA 3AUYA 2GZSA 2L82A 4NJOA 2DUMA 1GL9B 2JFBA 1L3BA 2O8FB 3ZNPA 1VL0A 4BMSA 1MF7A 2FK7A 3DDSA 4WFJA 5I9SA 1FDWA 1E2JA 1TM4E 5BUQA 1NVKA 2ECOA 2OILA 2Q8NA 1PJCA 5DIFA 2IXTA 2WICA 3I6BA 3RK0A 1MW9X 3RK4A 1P0CA 5JS6A 3A1VA 3HZZA 3JRWA 4Z0HO 1JAIA 1ZWKA 2E5LB 1RP7A 1CY7A 1JRLA 3WX0A 4KZPA 2CVHA 4WY2A 1CEQA 1IVNA 3S2GA 1XCJA 4ZTUB 2BMDA 1XCPA 4M0CA 3C5VA 5EHZA 3VPBA 3VNQA 1HV8A 2B8JA 2FQYA 4TKMA 4MI1A 4E4RA 1M34B 3DLCA 4O1MA 3CJTA 2H1HA 1JHPA 2JI7A 1JJIA 4GC5A 3NHPA 4RIEA 4C89A 3LVQE 1E61A 3A7DA 2J3HA 2WSMA 4N5NA 2QROA 1KA9H 3DE4X 3B3FA 1SPBS 1FTYA 3PQ2A 4UJ3A 5BYBA 5A3JA 2GK4A 4H35A 4HDOB 5G2OA 3G02A 1CLEA 4PRZA 4HWKA 4QNMA 5BN5B 1FFBA 5BSVA 3QELA 3KHUA 4PANA 2MYNA 2ZR0A 2WC1A 3IVGA 5HG0A 5MF6A 1HTWA 2JL1A 3RG8A 1DQRA 4B6EA 2X7JA 2HU2A 2AA3A 3U4DA 1XROA 1O5OA 3DLPX 1NVXQ 2GEFA 3G1WA 1A9YA 2BAGA 2Q99A 5IUJC 4QOJA 2BIFA 2GARA 2PGDA 4BJHB 2B30A 3ZE2B 3I42A 1ZD4A 4EJFA 1V8PA 3QY0A 4YV1A 2DLCX 3CEMA 4BN5A 2LGJA 5EG5A 3CG4A 3F7TA 1XRRA 3PTAA 3P5SA 3U39A 2BISA 4HDQB 1YB5A 1NXVA 2HBYA 2H5EA 3ZOZA 4PYNA 2Z6UA 4M8NE 3JTEA 3C8ZA 1Q5PA 3AY3A 1CQJA 3OZAA 1ZMRA 4KSCA 1WB9A 5AR1A 1RCFA 1SXGA 1CDDA 1A69A 1WPRA 2OBMA 3H5WA 4HNSA 4E4YA 3HADA 4IDQA 4YBZA 5BOSA 3G7NA 4PLTA 4ZVNA 3JVEA 4B3BA 1KFEB 1Z33A 3U09A 1KAGA 4GZMA 1EIZA 4FS3A 4HN9A 1H5QA 2W98A 1M10A 3KOZA 3R75A 5CM2Z 1UWCA 4AZVA 2W42A 4BTEA 4S05A 3AUKA 1I4LD 3BMNB 3QMPA 3T94A 3VKGA 2O59A 1VJ1A 2QN8A 1HETA 5HRUA 2REOA 3ITEA 3G0HA 1DAIA 3KB1A 3TTVA 1J4AA 1CUAA 1HDOA 5IABA 3OICA 1TTPB 5CJ2A 5JH7A 4R8MA 2WF8A 3MILA 3GLFB 1AQ6A 1MQSA 1WNFA 3KELA 3KQOA 2HMWA 2I3AA 4OTZA 3UHPA 3U3KA 2OLJA 5IZCC 1A76A 1LD3A 4YBRA 3GK3A 4C3VA 1NBME 4LOJA 4PCLA 2PQMA 5G0UA 4D3ZA 4DNPA 3E1SA 4AMGA 5HKBA 1WETA 2ZSHA 1FUUA 1VLLA 1YIAA 1KYWA 2BONA 1BE0A 4QUIA 4U02A 3PC6A 4OHUA 3L41A 5K4AA 2X0DA 2XQVA 2ATVA 1YC2A 1SEPA 2W48A 1G21A 1G60A 1X9HA 1NW5A 2RB4A 1O8BA 3DMNA 3DT8A 3L84A 3QBDA 2C3UA 3GMTA 5JCOA 5HILA 1EHIA 4N9QA 2XCSB 1ZHHA 3U0VA 1XB2A 1KRXA 3WLIA 3A9RA 1UKEA 2HSZA 1VG0B 2VSFA 3GC6A 3KAJA 5CT8A 2R1TB 3KBBA 1GL3A 1EUCA 2O23A 3OX2A 4G1MB 2IYVA 1K08A 2DEUA 1Z0JA 3H11B 4JBHA 4RMIA 4OBXA 4LOAA 3U81A 3FNRA 1EFUA 2IY7A 1OFUA 3FWPA 5K6AA 4BHTA 1EWRA 2IGBA 5DBOA 5IZCA 2L0XA 4R2LA 4D99A 1RAIA 2FSFA 3K9WA 1DRVA 4MQUA 4EKIA 4YRTA 5F23A 4FGJA 2ZPUA 3EEOA 4D8VA 1WXGA 1QP8A 2RHOA 2C00A 4HGQA 4R83A 3PQEA 4G8CA 2YN4A 2VQDA 3IEPA 3AR5A 5AT1A 3WNQA 5I3ZA 2PUHA 1WJGA 2NSLA 1CE8A 2PZFA 4UHKA 3KQNA 3R2JA 2ZGVA 4KCGA 3DTVD 3EXFB 4KO3S 4C6TB 5IYZB 4LVCA 3KDSE 3IA7A 2NO0A 2J3IA 3PQ5A 4KAJA 3R3JA 4MB6A 3RLIA 4W82A 3ZLVA 3SNHA 3VNAA 3FGNA 5KNBH 2VZ8A 3SZLA 5KSZA 2GLTA 4A16A 4ZI7B 4NRDA 1ZGJA 3ABSB 3ZU4A 4CUZA 2AB0A 2YWXA 3UT5B 2VJLA 3ZVNA 2YUIA 4I36A 1N1DA 4QGFA 5CNKA 3SU8A 1RW4A 4PAWA 2NTJA 2WU4A 3BIFA 5K3EA 1YBFA 1P60A 3T9CA 2PG3A 2OENG 4Q02A 821PA 1M7BA 4UAGA 2BZ0A 1GRRA 5LYJA 4XQ9A 4P5DA 3C97A 1WW3A 4D3DA 4YV0A 5JCXA 1J8FA 2H8KA 4EI9A 3R3UA 5FOVA 1FXWA 3TFQA 5B2ZA 1N7HA 4IIJB 3WYGA 1LX7A 3WK5A 2GM9A 1O6BA 3Q3JB 1RYZA 4OUDB 3ZDRA 2Y1KA 4IUCS 3BFXA 2QK4A 4LMRA 1I4OA 1A9XA 3GN1A 3ZU2A 3ZLTA 2JLCA 3GJQA 3IAM1 1T2NA 1ZXBA 3QJYA 4UZFA 1FS4A 4BBZA 2IS4A 1P2UA 1EX1A 2GRJA 3Q10A 4A4DA 1W76A 4QEZA 3UCXA 1UBCA 4CKWA 3PL1A 3WL7A 3CNOA 4JR2A 2F3QA 3RUHA 2AFHE 1B42A 3KCQA 3R76A 3RVSA 3ZR4B 4ESEA 2QJOA 4JI3B 5CDFE 2AVNA 1RPZA 2YDYA 3STYA 2XGJA 1RWQA 5BUZA 4WK6A 2DY0A 3EF0A 1VP9A 2B6HA 2D2VA 5BMVB 1AQJA 3U13A 3CVUA 3KB6A 2W00A 5F1PA 1NXPA 4DM3A 1B74A 2IZ0A 3GVHA 3R8CA 4NMXB 1VJGA 3GJ6A 2JH3A 3SEQA 4BPRA 2AJTA 5IXSA 2O50A 1U8EA 4BNIA 4QDXA 4EZIA 2AW5A 1GNTA 2VSNA 1V5FA 3AF2A 3CT4A 4DUZB 4BP9A 1JFSA 2VJBA 2XA9A 1PTJC 4KHZA 1Z6YA 5A62A 2P69A 5ADUS 2QM0A 3LQYA 5JDIA 3QTBA 4XQCA 2RHBA 2ZT5A 3DOHA 4I46A 2HHLA 5ARDA 3PC7A 3OPYB 3UZUA 4B71A 5FBWB 4EK9A 1RJDA 2X0EA 3GPCA 1KMHA 3SZGA 3OWOA 3ABRB 3W2HA 2GLUA 1OXUA 2FWJA 1A2BA 4JIMA 4ZA2A 2O2XA 1A9XB 3K73O 1GQRA 2EQAA 4EG0A 2WUDA 5E1BA 1FNSA 2O4UX 1FS6A 2Q6TA 3HCRA 3UICA 3T5BA 4BFUA 2HDOA 2H92A 3L4BC 3NWOA 2JLWA 4M36A 1PNVA 4TYYA 1YI8A 1P9WA 2Y71A 1E1LA 3LRXA 2ZTVA 4HLDA 3WFIA 1D2GA 1LJ8A 2GF9A 4PAMA 2UYHA 1OU0A 3LQQA 4QT0A 4E88A 3QX9A 2UZ4A 3CCBA 3KFLA 2JB9A 1BWSA 2XZTA 3JZDA 3UJ7A 2Q1WA 4TXMA 3VHXA 3ABQB 3O84A 3ZI7A 4MVJH 4MVJF 5FWXA 3REGA 1O87A 3V8BA 3X1MA 5C5CA 4EEXA 3NGLA 1H05A 4MQEA 3H3FA 5A3RA 4O4IA 1C9EA 2DVMA 4U00A 3IXMA 1TFUA 1IZYA 3ZIDA 3T54A 5K99A 4PSCA 3QWIA 5FBVB 1XAIA 3H1EA 3UJNA 3ZZMA 2D5LA 2FH5B 3X1DA 3H17A 4KXVA 4PPQA 3LNCA 3S2UA 4FZVA 4EBBA 3ZK7A 4D3FA 5EKSA 4NENB 3QI7A 3QJ5A 1JIVA 3WR5A 1JHZA 2Q07A 3BSYA 1NNI1 1SKMA 3GLRA 3LKVA 2RK3A 4AJ1A 2YV2A 4Z7JA 2Y1WA 1T1RA 4JVMA 1XZQA 3TVTA 4N7RA 3GJ3A 5B3AA 1YK1A 1A2KC 2DH5A 3CRVA 4U6QA 5H4HA 5B4TA 5K0BA 1PHRA 2A5DA 3DXXA 4LHXA 4EYKA 2VFAA 4COOA 1VJCA 3BE5A 3B1YA 3FPGA 3UMSA 1WHTA 1XJQA 2QZPA 1NRWA 5C52B 1S7CA 2ILVA 1VRWA 3MT7A 5A7GA 3WQBA 5IJ9A 2WDZA 4AIRA 1UK7A 4FFSA 2DBZA 2IHUA 2JBAB 2J9YB 5B3KA 1XQ1A 2Y05A 4TM7A 5ICCA 2R8EA 4LNUB 3B5JA 4MW5A 3H19A 1C0KA 4EECA 3VKHA 3JQ8B 1PKEA 3AINA 2QLLA 3DZ8A 3EIOA 4FILA 4O4IF 5B7NA 1W5EA 3RIXA 2ZT6A 1R5OA 3T7RA 4AZTA 1LWNA 1SWWA 2D5IA 2OTCA 2YY7A 4I1OA 2ZB2A 1W36D 5FD8A 3BCSA 1QVRA 2IQ5A 2KBEA 3LXRA 5B7QA 4PO1A 3H0EA 2ZYAA 3VOBA 3TLBA 2RHHA 3IVRA 4LVUA 3RS3A 3T99A 1Y1SA 1PT9A 1G7RA 3EZYA 2IEAA 1B15A 3IV9A 3HKBB 1VYHA 5KPJA 5TMPA 3LW8A 4X8OA 2FPLA 2IOYA 2R96A 1WTAA 2W6OA 1JGTA 2HPZA 1YI1A 3BMQA 4FB5A 5KWEA 3A3YA 2CUTA 4UATA 2ASEA 4H08A 4G2NA 3VR3A 1HK7A 2Z5VA 3TIFA 1FMTA 3ZD7A 4XM1A 4NSNA 4F45A 1CCWA 1KBOA 2NYRA 5D87A 5EIWA 5AVWA 5KMGA 3DMDA 3S1AB 1ZUIA 3ETLA 3KXDA 1JHOA 5CIYA 3FF4A 1P5JA 4M0KA 3VC7A 1KC1A 2CL5A 1Y1PA 5EIOA 5CLFA 2GEBA 4WKOA 2E4VA 2PUJA 3ZLBA 4Q1VA 3QVGA 3STWA 2WQZA 3ZTWA 3GFSA 1LUAA 4HXYA 3IE0A 1W0KD 4X20A 2V1XA 1DXHA 3H2KA 4RTRA 4C22A 2ONYA 1J0AA 1N2IA 2R6JA 2QLFA 2XT6A 5FADA 1FNDA 3UUEA 2JIQA 1XZ8A 4U2GA 4B75A 3GFPA 3GLHE 2PU5A 4FKZA 4ZDJA 1VL5A 1FFEA 3NH9A 4HLNA 1Q7CA 5IMBA 3AJAA 1U94A 3ZJVA 2CLDX 2QUBA 4WXRA 1UZLA 4F04A 1JHXA 3GG2A 4WA7A 3SI7A 4US1R 5A6SB 4ZOAA 4BECA 1PX0A 7MHTA 1RD4A 1U0JA 4Y2QA 2QTFA 3TLJA 3R0ZA 3KR0A 3W7AA 2YFHA 3AOEC 3H83A 5K0EA 1PG5A 2VTEA 4PR0A 3Q9LA 3ELYA 1KRWA 4F8YA 3IIKA 1QGDA 4QJ3A 1UJCA 2HXYA 5CEFA 1KO7A 3MF4A 4MJ7A 4WJZA 2FN4A 1CQJB 4ZHQF 1P1KA 4KN5A 4W1RA 2DT8A 4CUKA 4AZ0B 3GLKA 1A77A 3Q72A 4NAUA 1U0TA 5CLQA 5CUQA 3X2EA 2W43A 2XRZA 2ODBA 1YXMA 2YN0A 1CUIA 1LI7A 3UK7A 4QOFA 4TLBA 2XGOA 4OD0A 4BQSA 4F2WA 1F0NA 4RABA 1G3IA 5AP9A 3IP7A 3AIKA 3WJ7A 2HDHA 1KSJA 4RLFA 5JYEA 4ZRDA 2A9OA 2PXHA 3E03A 2PRZA 2ZS9A 1E6WA 1UBMS 3JQEA 1S01A 3ELDA 4GYKA 1QX4A 4NE2A 2X58A 1NLUA 5ALPA 2WF5A 4WBNB 5K3FB 4PLVA 5JWHA 3B9BA 3A14A 4CKEB 3JALB 4FFBA 1K8QA 2MSCB 4Q4HB 3RKUA 3TINA 4HDSB 4EWLA 3FTCA 5J40A 2H1SA 1MJHA 3BIXA 4RAOA 1OLUA 4HB2A 3EDYA 3G8AA 4KBGA 4ID3A 4ND5A 4ZEXA 1H2XA 4FNOA 4DJ5X 1M72A 1AX9A 5DTEA 1KDYA 1IXKA 4F6LA 2E4XA 1IY2A 5BWCA 1U0GA 2BE9A 1SQFA 1CUWA 2WVHA 4HAIA 1T4CA 2FRDC 5KCZA 1K9VF 1D6NA 3N75A 2JJ2A 1PZNA 1S8NA 1TUIA 5E7MA 5EKDA 1KZHA 4KXXA 1VZ2A 2HLDA 3WTCA 4DA4A 4LZLA 4MB2A 1PD1A 3DZHA 2NU9A 2C5SA 1SCKA 1Q1AA 2XTAA 5T41A 4G67A 3LWBA 4NBWA 2X5XA 4H1TA 4S12A 5F98A 1JI3A 3K53A 1VXOA 1XHFA 2F64A 5EJGA 4X3CA 5CLLA 4OSEA 1TLTA 2JK0A 3B1XA 3OECA 3PQFA 2PH3A 3ITKA 4L4YA 5EP3A 2C2ZA 3K5IA 4MV4A 3L7JA 3ERCA 2RONA 4QYIB 2OPBA 3PRKE 1HFJA 4GOMD 2CJPA 2FHSA 2AXEA 5CHEA 1JTEA 1UKYA 1RQRA 2FN9A 3INGA 4B5KA 1KHTA 1ZN7A 2QR3A 2WJZB 4DLRA 4ZHQA 2ODNA 1JALA 3FOAA 5H7XA 4D4GA 1WCXA 3VR3D 4OHWA 3QX3A 5H59A 4KXQA 5DBGA 4I9FA 4NHOA 3NKFA 4KRYA 5JV5A 3EISA 1RZUA 5E7IA 1N8TA 5FUVA 1NXOA 1BXGB 4FD2A 3AP3A 4Q1FA 3I6YA 4XB2A 1BHSA 3VDRA 4UBIA 1U0NA 1Y89A 3AW8A 4QT4A 3HA7A 4U2EA 1JEQA 1U31A 2PAFA 4WL0A 3G2NA 2IW1A 4MVWA 3UUGA 1N3BA 1GYPA 1YDGA 2J87A 2VF4X 1CJUC 1U28A 3KLPX 2V5VA 4K03A 4M60A 1SKYB 2VH2A 1WZ2A 1CQPA 1GGEA 1UMCB 2XMZA 3PHJA 2BGJA 4X71A 4ZO6A 4ARAA 2R6ZA 1O9HA 4BBJA 2RGXA 1H6AA 1RWVA 3TM5A 3DFZA 2YRFA 1IU9A 4RDHA 1C1DA 1XEWX 3L5OA 3T52A 5EZYB 4J7CA 2X5KO 2CSUA 3U49A 2FCAA 1FL9A 2I99A 2VH1A 3HJAA 4X90A 3KQHA 5BN3B 1RRVA 1QGZA 2XH8A 1PFKA 2RMKA 3ND8A 4Q1EA 2QVXX 3FZGA 3NBQA 4GX1A 3JVUA 4ZVPA 4YP7A 3FOBA 5BSTA 1A4IA 2G70A 4OKNA 2JASA 1FFGA 1L6IA 1KY4A 3GELA 3G0IA 3AEXA 3O4JA 2O1XA 4ZAWA 4RYLA 1DE0A 1RZ3A 4L15A 1RM4A 4UCQA 3TG8A 1HZZA 4LV5B 3MT9A 2BP7A 2IU6A 3PNYA 2HA3A 1N2OA 4M9RA 3O92A 3QW4B 4LBYA 5LXTA 2FEAA 3VSBA 2JD0A 2Q2WA 3CCFA 2XODA 3CJRA 7YASA 1PU2A 2OUIA 3A6ZA 3ZE8A 3VNBA 4UEOA 1D0VA 3HKEA 2OCDA 2XNJA 3LECA 4IQ4A 1QNFA 2R4QA 4H6WA 5ECYA 1Q19A 3IRVA 4YP0A 3GRKA 2HCRA 3G9UA 4JLBA 4JJ4A 2W11A 3ABZA 2NM0A 4AAYA 1BXKA 3FSGD 3U56A 1GPMA 4JCOA 5CB6A 4DRYA 1TQ8A 1KK0A 4R1SA 3BCRA 1L8XA 1L5SA 1PJ2A 1ZGGA 1JG6A 1JYFA 1LLCA 3CKKA 3UQZA 4GGPA 3F3SA 3OF3A 3PGVA 4WZBE 1L4UA 1G2PA 3W8DA 3U9TA 4EG3A 5COAA 4LKRA 3FE2A 2MR6A 4MVJP 4QU8A 2IPNA 3RYCA 4C9BA 2ZRQA 2W6MA 3BDVA 4Q6WA 3QVLA 5JR3A 1JA1A 4PSAA 5AOBA 2O19A 1ZH0A 2A7XA 1K0UA 3A3PA 1R5JA 2FMXA 1L5HB 1N9GB 1EP3B 1SXJB 2IZ7A 4UDOA 3W77A 1IPEA 2BGNA 1CDZA 4QQ8A 4C0WA 1ZK4A 3T9FA 1W75A 2GCGA 3ZDXB 4QDZA 1FU7A 5CHYA 1CY2A 4RK1A 4OL0A 2ZYIA 2ERCA 3DPUA 2QRVB 3QUBA 4IIYA 3ONDA 2YFYA 3IJEB 3LTNC 1ZVMA 3EQZA 2QN6A 4XYLA 3DEYX 4BMXA 3ZGLA 4M99A 1TZJA 1QQAA 3IPAA 4EG8A 5DM0A 3EVZA 5KU7A 3AUUA 2JKVA 2F9MA 4R81A 4EL0A 5K3FA 3ZQKA 1KSGA 3D4BA 4DEVA 1C3JA 1SPXA 2CLCX 2L19A 1AHHA 1M66A 2VH5R 1HZJA 4H7IA 5JAUA 2IYPA 4EUKA 3GLGA 3S8EA 3G49A 4CM6A 5CA1B 2VHTA 4MUYA 4ZGGA 4JI6B 2MSWA 3KBOA 3OBBA 1QB8A 3ADDA 2AS0A 4L9AA 4U9HS 2XRFA 4JJEA 4EGSA 3UV3A 2HUPA 2OO7A 3EIEA 2ADFA 5AW9A 3ANLA 1QORA 4MCJA 5ARBA 1OB2A 5DHTA 4EDHA 2L18A 4QUHA 3NOXA 2UZ3A 1NASA 2OBYA 2PO7A 1SQGA 2G5PA 3C5WP 5EAIA 5JZVA 1E1CB 1PEAA 3TTSA 3J81A 3K1AA 1G16A 2PH5A 3DLIA 4LZWA 2CDCA 3PX2A 3KQYA 4PFQA 3DYIA 4ZQEA 4F2GA 1J1ZA 3S28A 3R3HA 5DT9A 3P5BA 5DWDA 1SJ9A 4NNJA 3KKEA 3NBYC 3WK6A 3H84A 2ZI5A 1ZD8A 1DBWA 4L4RA 4RD1A 4RV5A 4FM9A 2PJRA 4KQ2A 2UVPA 1JXAA 2ZR9A 4MKZA 1AZLA 3IOMA 5E1MA 3HV0A 1CUBA 1J2EA 5L4LA 2J7PD 1IIRA 2WM9B 4D5EA 3H7IA 2D0DA 1NBEA 4IEFB 4G97A 1NNSA 3GL9A 3AETB 3I01M 3FNGA 5HDBB 1UC9A 3RC1A 4CQMB 1ENZA 4YUWA 3CB4A 1COWA 3R7WA 4D45A 3PP8A 4FUQA 3TRJA 1KP2A 4UC0A 1E2QA 2EJWA 1XQWA 2DAPA 2V9PA 3EZXA 3ZX5A 3ZGXA 4IHQA 5A4FS 2X86A 1NOKA 2HJ9A 3MGCA 1O89A 4NMMA 2HLNA 4CG2A 1SUEA 3DF7A 1XNGA 2AI2A 3KVRA 3MK31 3BRCA 4M9ZA 4AO8A 2VP5A 3I9FA 1NRIA 1UFKA 2JJMA 3P45A 4GPEA 4P3YA 1I2MA 1E3IA 3OWHA 3X1ZA 2A0KA 3P4UA 1E79D 3D81A 3P94A 2ZOSA 3HDJA 1M73E 3PT5A 5D3QA 3OQPA 3ESXA 5CT6A 5F73A 3W3AD 1U4OA 3ICVA 1L7PA 5JNLA 1KYVA 1XU9A 4PTYA 2WWHA 3MZ0A 3WWDA 3BILA 3VUFA 4XB6B 4A8HA 3QEMB 5G0TA 2YWDA 4RQBA 4RPIA 4FZ5A 1YI0A 1TJ4A 4NZYA 2Y4NA 3KDAA 4FMBB 5EJ9A 3M1AA 2M6KA 4FI3C 2FF7A 4N6NA 5PNTA 4DJFC 2VQEB 1H1DA 1GV1A 1RJGA 3C6KA 2ZKIA 2B8EA 1Z5VA 2CFOA 3TTTA 2PS1A 4GPD1 2JGFA 3QU4A 1YNSA 4E6PA 1C7RA 5GMOA 3VO9A 3L8ZA 1JHMA 1Z5ZA 1QWOA 3ANNA 3LOPA 5EWLA 5J2TA 1N9ZA 4BVGA 1Y7PA 4CMIB 1YB6A 2SKEA 2PCJA 3A1SA 1IEWA 2YN2A 3B6ZA 4REMA 3VVBA 1CR4A 5ER6A 4RTMA 2NG1A 4R7TA 4WW0A 1QV9A 1BH2A 3IELA 4CEIA 3ZIAA 4A10A 2E4WA 5JXIA 1YZHA 1UT6A 4AMBA 1MGOA 1ZOIA 3EIFA 4KIWA 4Q3NA 2WFMA 4CN9A 1L8LA 1LS6A 1SC4A 2ZPTX 4IQ0A 4NX2A 3LS2A 2XADA 4L8YA 1KZ6A 2HIMA 4W9NA 4JIGA 5CGZA 2ODQA 3L92A 5BYJA 3JAKB 5BR8B 1Z4OA 3LWZA 3REOA 1MJFA 1MH9A 1YL7A 1AUPA 2O1SA 2QTRA 3DTVB 3OZUA 4CV2A 5H8WA 3EH1A 3L8GA 4MVJI 2G28A 4Z51A 5ALWA 3PB3A 2JIMA 1GZHB 1EX9A 2OZLA 4AG6A 2FVXA 2E21A 1PR6A 3TQQA 3RYFB 5HNKA 2IS2A 1E2HA 2P4UA 3DYBA 2Q5OA 2WT4A 2XNCA 3RRMA 4FK8A 1FDUA 1DC8A 3QVUA 4AK9A 1LPOA 2BJHA 4AY5A 3TSZA 1Z5OA 4BE7B 4AJNA 2CNNA 2HJSA 3ESBA 3PIRA 1G0OA 5ALMA 5H68A 1XEAA 3SF8A 3CWZA 5IH7A 1RXVA 4P3KA 2PRKA 4YJGB 4F2PA 2CN1A 4ZCPA 1M2VA 2C8VA 1FDTA 3D5TA 2XI4A 3D8HA 5FOUA 4OJYA 1GT6A 1HX7A 4JYAB 2AXQA 3K1YA 4Q4JB 1FMLA 2MTBA 3M4JA 2KW5A 5E4TA 5A2QA 3LVBA 3K0CA 1NGSA 3HXKA 1AS2A 4B3XA 1QIKA 2ZJOA 3TTUA 1PNTA 4F5WA 1TZKA 3EXHC 4IDAA 1YBHA 3W06A 3GCZA 1S0UA 4Z7NB 4BTLA 3U5TA 2Q4BA 1LNZA 2RG7A 1P1HA 3ZVKA 4UXHA 2HHHB 3BRWA 2O5RA 3EZ2A 4IGIA 3FPEA 3I9NA 4JLUA 3ZHOA 4QRDA 5FWAA 2FFQA 2GAJA 3RFUA 2JHPA 4HBGA 2P9ZA 2QRMA 3LQ4A 2C4MA 3AVQA 3E7WA 3I73A 1SELA 3SQOA 3BDAA 3O8CA 1DO8A 1JWLA 2DPLA 1EK1A 3UK2A 3S0JA 2R1ZA 1UANA 1P9RA 1XGKA 2ZS7A 3MTEA 4RLQA 4YAIA 1U0BB 5JSFA 4IDXA 4CTMA 4W4TA 2A0FA 1FVFA 4HNUA 5A4MS 4DLWA 5DNDA 1Q92A 1M74A 4TLCA 2RIPA 5JJKA 4LFAB 3QA9A 2WTBA 1XMSA 4UBJA 3G79A 3MTIA 4RZIA 3S4YA 3BGWA 1VBMA 4EF6A 4UVEA 5HA5A 3WSTA 5KB3A 3B5EA 1ZM3A 3G0DA 3OESA 3MJVA 3RBZA 3OZ7A 2NXCA 1CPYA 2XAAA 4PLWA 1WABA 2VIIA 3TUJC 4E4TA 2C83A 2XUHA 4JP5A 5EJFA 2RGEA 4YQEA 1QSGA 3HUTA 3RADC 3DE1X 3BYZA 2AEEA 2DXIA 4N5DA 3QPDA 4QXPA 1L4FA 3TMKA 2DH6A 4WJLA 1TVMA 3A37A 3BGIA 2R8RA 3F90A 3G2PA 4EUFA 3NORA 4HQLA 2CWWA 4LJ6A 4UFNA 5DHRA 3ZDAA 3GD5A 4NYJR 5E7JA 2OCPA 2FSGA 4RL4A 4RJKA 3OFKA 4GU5A 16PKA 2BGTA 3NIGB 4D79A 2PUEA 3HEMA 1Z7GA 4Q34A 5JSKA 1GRQA 3NC0C 4MWEA 3SDSA 1ISHA 3QIAA 4AF6A 1SFRA 1XKXA 2P3LA 3GH1A 4PYKA 1JPJA 1ADYA 4Y2UA 4B4UA 3IAFA 1HWYA 5LQKA 1XZDA 1YA4A 4RTJA 3K5PA 3C1TA 5HFJA 2GWRA 5HP4A 1VL2A 4KJZA 2VAXA 5B1SA 2QWXA 3LLSA 2QA5A 2C99A 3G5AA 1X1QA 5H82A 3DE0X 2V9ZA 2W7TA 3PLRA 2VYQA 4MRVA 4NCIA 2QD3A 4W6ZA 3U16A 1JHRA 1VBKA 5LQJA 1DP4A 2NVWA 3T3NA 2DTXA 2QGZA 1O6ZA 1EDEA 1Y3AA 3LVRE 5ES3A 4DDVA 3D1VA 2MU1A 4BLQA 3PF9A 2ODPA 2R11A 5FCDA 4OH7A 3BHIA 5F33A 1JMVA 5HS4A 4B8ZA 1M0WA 5J2UB 3CEPB 1VHWA 4PSVA 4TMVA 4S1WA 5ECWA 3GR6A 2GK7A 3NTOA 3T12A 2CJFA 3ZK9A 1TCUA 3F4KA 3AZOA 5DTRA 5DYWA 3FVQA 1UPXA 2OEPA 1QQBA 3UA3A 4DG8A 3WQSB 1R0BA 2YVQA 1DG3A 3DBLA 1B6RA 3LT4A 3CT6A 3I9V1 1V95A 3INTA 2ZTMA 1FUKA 1WMFA 2P0YA 2VAVA 3OM0A 3A6GA 2O3SA 3ZDBA 3WLQA 4IHAA 2RI1A 1ESEA 4U2BA 2PZBA 3PQ6A 1THZA 4TV9B 3TK1A 3H5OA 5FO0A 4D9FA 1SIWA 1E3TA 1OC2A 5EE5B 2JLBA 4U2KA 1WXIA 3AFGA 2Q41A 2W9XA 3WLNA 1HEUA 1DG1G 3HKEB 4R2JA 4LWPA 2QY6A 2PZGA 1N2JA 3HJFA 2SBTA 2GBIA 1O7JA 3IQIX 3QBTA 3TR5A 1YC5A 2QTCA 2VVTA 3NWJA 2DTDA 3TQIA 1GU1A 4C7OA 3TW8A 5AW2A 1KI9A 2GA9A 4N8DA 2JJ1A 1V0JA 3KWFA 4TS3A 3PC8A 4RVDA 3SQNA 3VPFA 4EFMA 2PGOA 3K32A 3QX7A 3DC7A 2O2GA 2RARA 3R3WA 3AERA 3GEDA 2CHUA 2DFVA 3W05A 1LPAB 3EVCA 2Z98A 1SKYE 2Y27A 2P6UA 3ES9A 1N5RA 1M7HA 3ORQA 3B5IA 1I0IA 4AYWA 2SICE 2VRWA 4MQBA 3ZZTA 1WPQA 4REQB 2NLOA 3AF1A 3G0CA 1U7DA 5IJZA 2BZSA 3ZK8A 4LRQA 3CUSA 1DPGA 5J1SB 2ENWA 5E4YA 1RLOA 2NOAA 5LYYA 5BV7A 5KTOA 1ZRSA 3U17A 4PX3A 1RJFA 1MIOB 3EGDB 4PAGA 3G2LA 3GJYA 3GF4A 3T3PB 4BLUA 5KTNA 3OQNA 2JCSA 3PNVA 4FEGA 4BFZA 1ABEA 4YMWA 4AYTA 3GW8A 4Y1FA 3QVTA 4LDZA 2YJTD 4Q3AA 4XCQA 1M76A 1QE5A 1T5IA 2ZRPA 3OLCX 3QFTA 3Q8WA 2YRXA 3TL3A 5KWIA 1UJ4A 2K7ZA 1KR5A 1WXEA 3QHPA 4Z4IA 2QT9A 4EI2A 4ZN6A 2EU8A 3OUTA 3CZ4A 3MPUA 4JT9A 4O3FA 4PYOA 4F21A 1M8KA 4F8EA 4TRRA 5DW0A 1GM5A 2Q49A 2WD7A 1SHTX 3BXEA 2Q3DA 5CXSA 4BZXA 4CLEA 2BMAA 2BM0A 2H4WA 4JI7B 5BNTA 5DXAA 2POQX 2WWGA 1QTQA 3KE8A 2VDOB 1N34B 1RCTE 4NZOA 4C7JA 1XVVA 3R0QA 4BZWA 3E9ZA 2F8LA 2PX6A 5FWXB 1E96A 3L4SO 4J75A 3F98A 4AZSA 4QU0A 1G5PA 1T10A 3GJTA 1UDCA 2ZB8A 3GDHA 2CXPA 1OTXA 4LC9A 4X7RA 1W5FA 1FP6A 1SD1A 3LCJA 2ZS8A 4JYPA 2QSJA 2VKQA 2ZE6A 1M5RA 4JOBA 1EGVB 1Z8DA 3KKNA 2IW3A 1G4AE 3IO5A 2CLEB 3EFOA 1FNBA 3DO5A 2OBBA 4N0MA 4N40A 3OTOB 3LHSA 2XXJA 3ETDA 4BFSA 3UGJA 1EFTA 1G20E 2EJUA 3W6ZA 1YFJA 3PGKA 3GA7A 3S68A 1O9GA 4PXSA 3MMNA 3T5GA 2PX0A 2R79A 4H7PA 3HLKA 1EWVA 4OSPA 1P4AA 4P81A 3MVEA 1JV2B 1H2YA 3CW8X 4WCFC 4UULA 3ESCA 3VNRA 2O2CA 2GJKA 2Z04A 2D5BA 4PNEA 4L74A 4ENSA 3O93A 1C8BA 5K7SA 3OHMA 2OCKA 2A59A 1WHTB 4D82A 1FYDA 2XTMA 2FPMA 5L4SA 1DKNA 1YRWA 2N9UA 3OM9A 3PNPA 4MDYA 5LLSA 4JKYA 1AU9A 3QA3E 4M87A 2OAQ1 3FHTA 4X3PA 2H63A 1X1EA 1FUEA 2AR7A 2JIRA 2VDLB 1QXSA 1V3UA 2AJLI 1V25A 1UF9A 1YJAA 3I04A 3IDSA 4YK7A 5JMTA 1R4ZA 1PEKE 1R9GA 1QPBA 3LFTA 4CT5A 3WO0A 3FAZA 1E3LA 4OKIA 3BZBA 3EZLA 1LDBA 3PUHA 1J09A 4GMHA 3P2EA 4MAFA 4J0HA 2C3PA 3SZ3A 3VU1A 3R3VA 4A7PA 4I4TF 4HL6A 1ZFNA 1SEVA 4R7ZA 5DM70 1PLKA 2FEPA 4Z4CA 2IE0A 4MHOA 1XJ5A 2BC9A 4BL5A 1A5ZA 2R8XA 1GXSA 4X64B 2R4UA 2O14A 4UUAA 5E2AA 4XH9B 2G76A 2R1TA 2B35A 3FPAA 1DCFA 1SBIA 4ZK2A 4A26A 5CNMA 1TIPA 2EL9A 2G08A 2YVAA 5AKYA 3AEKA 3PD0A 2O4CA 4QFCA 2V6MA 2AI1A 4RO0A 2D13A 3MUOA 2HMUA 2TYSB 1E6LA 1MO3A 4MINA 2ZBFA 4UOZA 2JFPA 5LDDC 1SULA 1Y3CE 3U3DA 3FOEC 2CKDA 4LYFA 5C3MA 1U8FO 4UARA 1ACMA 4G81A 2W4MA 4IVRA 1MT0A 3RSGA 3U4QA 3R8FA 2RHJA 1DU4A 3BXOA 3LQRA 2BEWB 2ATCA 2EP7A 2IX9A 4PLPA 4O2BF 3FUVA 5CK4A 3FKSD 2LKDA 2CVQA 1TW2A 5AIBA 4WK4B 3HCAA 1KWKA 4JJFA 1BE8A 2HZ7A 4CETA 2VS1A 3OLQA 4HNRA 3V2HA 5I47A 4XWWA 1VI2A 4FGUA 1M6HA 4FYHA 2AOWA 1UFRA 1W581 2EHJA 1MC4A 3TVYA 3FTQA 3EIQA 3HJCA 2GWHA 3NO4A 5L95A 4Z6KA 1CG6A 4GQBA 5DLDA