2HUPA

Crystal structure of human rab43 in complex with gdp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
172
structure length
162
Chain Sequence
YDFLFKLVLVGDASVGKTCVVQRFKTGAFDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human RAB43 in complex with GDP
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RAS-related protein RAB-43
total genus 57
structure length 162
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hupA00
4PC3A 4GP6A 5CIQA 2QP3A 4LYAA 5L3QA 4MYTA 4X8LA 4LK2A 1X8LA 4PHGA 1GKYA 1LF5A 4ASUD 3A58B 2CVHA 3K70C 1J99A 2NO9A 3MSXA 4ZI3A 2JLQA 1NBMD 2WMOB 3HYRA 3LY5A 3T1VA 5FFMA 3ICQB 3M4YA 4PC6A 5BW8A 4AC9A 2C8VA 3WHKA 2IS2A 3X1YA 2C03A 1NVVQ 1XXHB 3NIBA 4IOMA 4JKYA 4URUR 1W36B 3K53A 1CULC 4EQ6B 3FB4A 2BKEA 1TAGA 5FR2A 4F4IA 1LF0A 5K8LA 4NDZA 2IYSA 2NO6A 5KNBA 4M53A 1FUKA 1XD2B 4QHSA 1N5LA 4DSUA 3OIYA 1W4AA 1EG7A 3RANA 2QZ4A 5EUMA 1FP6A 3W5JA 1N3BA 1XP8A 4JSTA 4B34A 1FFHA 3KJHA 5C46F 2OSBA 2O0KA 5HKKD 3SU8A 4L4UA 2NO0A 3VNVA 5CK5A 3CB4A 5J4YA 3KTAB 4Q9LA 1AM4D 2LKDA 1H8HA 4LYJA 1OH5A 4CRWB 4TL7A 3IGFA 3QEJA 5F9HA 2D2FA 4TYNA 1DO0A 4DT1A 1E1QA 1DAFA 2BC9A 2ZJ5A 2QP4A 3B1VA 5H1YA 3K9LA 2QQEA 3N70A 4M2LA 4ARZA 1U9IC 2YVUA 1YVDA 721PA 4BFTA 4Q1BA 3B9PA 4A6XA 1CXZA 4US2R 3HJNA 5J5CA 5DH9A 5B2ZA 3ICEA 3C4JA 2ZR7A 3EXAA 2QP9X 4GPTA 5EXTA 1W4RA 4NKRA 2DFTA 4KODA 3RS2A 1WQ1R 1NRJB 2AHOA 1XPRA 4Q7JB 3VQTA 1CTQA 1Z22A 5FOVA 1OH7A 4DEYA 4OHYA 2ZRHA 5EP1A 3BFXA 3L0PA 5A0FA 1VG0B 2ZRCA 3TMKA 2C9CA 3FTQA 2GJAA 4QM6A 1VIAA 3GP8A 4KAXA 1KI2A 1XTSA 4CEIA 1PUJA 4AYTA 1N6IA 2CCJA 3M0EA 1JNYA 3FMFA 2VSOA 3MD0A 3LNCA 1VDZA 3IPXA 4B48A 2HT6A 3A1SA 3DO6A 2W6JD 3NH6A 1SGWA 3VR5A 2PZEA 3NVAA 4B2LA 2F3RA 5KUTA 3OEEA 4AKGA 2C77A 2ZPTX 4PHFA 5J47A 3GEIA 1GG2A 2PMKA 4Q21A 4POAA 5BWMA 4H1VA 3RRMA 1MO3A 5IK2A 1XD9A 1RC8A 1N6NA 4LJ9A 3VX4A 3UPUA 1T6NA 3VR3A 4FWTA 1HT2E 1W36C 2KJQA 1FQJA 5HE8A 1EFHA 1IN7A 3EZFA 5HE9A 1RZ3A 4IOLA 3U3RA 2WICA 1E9SA 1TUIA 4FWIB 3NEYA 3THYA 3AVUA 1XZPA 2CE2X 4G3XA 2QROA 1SULA 1LTQA 3V00A 4TLAA 4FCWA 4MKIA 5ANRB 4BFWA 4O2LA 3QXSA 2EFHB 3B13B 4IVPA 4OQXA 2C04A 2ASEA 3KL4A 2PT7A 4QBHA 5CYOA 2XNDD 4LJAA 4TTPA 3B85A 3SYKA 3UMSA 1GIAA 3A1WA 2AR7A 2FFQA 3CIOA 3IEUA 4LV5B 4QRHA 4DLVA 5J4KA 4IDHA 5KNCA 3OZXA 2RGAA 3CNLA 2Z0MA 1W0JD 2X2EA 4ACBA 4PSKA 3CWZA 3QVUA 2Z6VA 2ZI6A 4V0MA 4WZ6A 4NTZA 5SZIA 5BN4A 2D7DA 4Z1MA 2IWHA 1BYIA 2ZR0A 3U5ZB 3BXZA 4OHVA 1M6NA 5KDLA 3GPLA 2ODBA 1GFIA 3MWLA 3DOEA 3U44A 4OJQA 1JXMA 121PA 1CRQA 1YZLA 3QBVA 4H1UA 2CL7X 3L8YA 2NPIA 1W0KA 2IYUA 2OEPA 3SFVA 3QSYA 2ZQ5A 3FFAA 2MSCB 1NLZA 3TR0A 3P4YA 3DM9B 2GBLC 4DRZA 1COWD 1IAQA 4B3GA 4K81B 4DEXA 1YKSA 3OHMA 4DB4A 4IDPA 1Z6XA 4DKXA 1Z06A 3TJZA 3KQUA 3GLGB 4URXR 3GLFB 3GMTA 3CPJB 1KYIA 3GD7A 3W34A 2REOA 4P4SB 3AH8A 1ZD8A 1T3SA 3QKRB 4MRSA 2QA5A 1F2UB 1HT1E 1W0KD 4W9MC 3ZVNA 2QI9C 2FSGA 5E95A 3VU9B 1ZCBA 1R2QA 2CL0X 3I1FA 1U0LA 4NONA 1BYUA 2JDIA 2ZEJA 1E2MA 2ZRNA 3RNLA 3E1SA 3T1QA 5KU1A 3DM5A 2IYLD 4AKHA 3PENA 2WWXA 1U9IA 4MUAA 3PG5A 3CKLA 3MLEA 1GOTA 3RSLA 1ZM4A 2GBLA 4WW0A 4B73A 1SVSA 1OLOA 1MRNA 1JPNA 2QEQA 5LD2C 3AP1A 2FDCA 3EARA 4RZXA 4UNRA 1KI6B 4JLKA 2GK6A 2O5VA 2QSZA 5KOYA 2O8DB 1CJUC 3MGCA 3VAAA 1DG3A 4HDQB 1OFUX 4EFLA 2A7QA 2J0UB 4W5WA 2GWHA 3IPYA 4TZ0A 2C96A 1G9XA 3PEYA 2R6DA 2N46A 4A0RA 2CL6X 2F3TA 1NIPA 3U60B 2HJGA 3ZIAA 3RSOA 5D3QA 1W48A 3TIFA 4NBSA 3BGWA 4ESHA 1V5WA 4HAUA 2ZI7A 4NZYA 4OKSA 2AK3A 4H9GA 4MGIR 3ZLJA 1Q57A 4MGYR 4B35A 5TV2A 4ZIRA 2A5YB 4NPHA 4GNKA 1X1SA 2FZLA 1ZNYA 1ZJ6A 2ZJBA 4EAQA 1XMIA 1V43A 4IDOA 4QNRA 4OQFA 3FMPB 4LWZA 2O52A 2ZANA 1HQCA 2O8CA 1R0YA 2VF8A 3TLXA 1TPZA 1S1MA 1E94E 1GL7A 1KDRA 2IF2A 4KBGA 4GP7A 2WOJA 5FBLB 2GEVA 2X2FA 3KXKA 1VTKA 5FTLA 1HA3A 3W8NA 2IW3A 1Q21A 1W1WA 4HLUC 4IEEA 5FUVA 1Q12A 3WHLA 3OEHA 5FPKA 1KJZA 2ZUDA 3UXMA 2A30A 1WA5A 3ZVRA 3I72A 3CRQA 2JA1A 1IY1A 3UKDA 2A5GA 1PVOA 4QXAA 1KZ7B 1KO7A 5G41A 3G82C 5JEDA 5EE9A 2OE2A 4P4TA 1VG9B 4EPWA 4KBFA 5CB6A 3KJIA 4WXPA 5JSZA 4RZ3A 1ANKA 4JKIA 2GAAA 2NO7A 3KKPA 3ZD7A 5FI0B 3V4FA 2GETA 3KX2A 3DOFA 4XSHA 3IHLA 4NCHA 1DADA 1OIWA 4D0LB 2ODWA 3BORA 1UKEA 2WTUA 1QF9A 1EGAA 2RB4A 4G5RA 1R0ZA 1E79D 1CU1A 2V8OA 1A82A 3C16C 3QPVA 1SKYB 3THYB 2IYTA 2I1QA 2DPXA 2WWWA 3NG1A 3TH5A 4QGGA 3NXSA 1DAGA 4X8OA 3NWJA 2AK2A 3AVQA 2ZAMA 3ND8A 3FOZA 4CEHB 1Z0AA 3FDIA 2WPDA 3LXRA 4D4LA 2NQ2C 1P2UA 4LYHA 4BRWA 2EYUA 2GESA 3Q5EA 4JS0A 1HURA 1I2MA 1H8EA 1FL9A 1XTIA 2JLSA 3ZVLA 5DNYB 4ZCMA 4TLDA 1AKYA 3KFXA 3LLMA 2IYRA 4IVQA 1VG1A 2WZQA 5H70A 2HV8A 5JS8A 2FGKA 4ZDJA 2ZS7A 4LBWA 1UAAA 3MAAC 1X86B 2VIIA 4GOXA 2Q9AA 2AKAB 1YQTA 1JBKA 2ECKA 3FKSD 2BBTA 4Q1EA 1GAJA 3TW4A 4BLSA 1Z6AA 4N3NA 1JJ7A 1B0UA 4LBYA 3CH5A 2BM1A 5FI1B 1QVRA 1BMFD 2CCGA 2ZU0C 4KU4A 2ZVQX 3HPQA 4OK5A 1N6OA 2QTFA 1E79A 3UG6A 3AKEA 3NBZC 4Q7MB 2BMFA 1COWA 4JLVA 5LB2A 3M6AA 1E2NA 1EFCA 1ZNXA 1DE0A 1JB1A 3AGQA 2FGJA 4PX9A 3TAUA 1SXJE 2CNWD 4A36A 3HYTA 2DBYA 4Q9IA 5JLJA 5FH9A 2YHSA 4GI7A 3EX7C 4U00A 1S9DA 3K9NA 4MDFA 1RRGA 4YMWA 2EVWX 1VKJA 4RFSA 4XTRA 3ZYCA 3SJAA 4TMKA 2F1HA 4Q47A 2HT1A 3JZMA 1QBKC 2BCGY 4KYIB 3R9XA 2DY1A 1XF9A 4S35A 5DLQC 2R6FA 4V0OA 3R7WA 1ZCAA 2EWWA 4PFSA 2G9NA 5JJKA 4JT2A 2QBYA 3KJEA 5ELXA 3IEVA 2KSQA 1KI9A 4OL0A 1RYFA 3IIKA 1FW6A 1KJWA 2Q3FA 3K9HA 3AVYA 2X19A 5DI9A 1JR3D 4I4LA 4NE2A 3WBJA 1NJGA 4F93B 2BBOA 3GEHA 4OQNA 4C2UA 4C0QC 4CDGA 3VTKA 1PLKA 2YJTD 4C0SA 1TQ2A 3TNFA 3MMPA 1KGDA 4BE7B 4J0QA 1UF9A 4XSGA 2W6JA 5TMPA 2FN4A 3NTUA 1XPOA 5FUWA 5JEEA 3EAQA 4EQ6A 4D25A 3UMRA 2QMHA 4NYJR 1KKLA 4JLMA 1KO5A 1XNJA 1GRRA 1XXHA 4LJYA 4MYUA 5TARA 2VHJA 4I1UA 1G8PA 3Q7PA 2JEOA 4TL6A 2JASA 2QQ0A 3AGPA 1GKIA 2IF0A 2J0UA 4M1OA 4B3DA 3GFPA 3RRYA 4BECA 2F1IA 2GCNA 4TQ9A 4D82A 2FG5A 2J87A 4AY2A 2BV3A 2NZJA 2CK3D 3MFYA 3VR6A 2VEDA 2D06A 3O8BA 1II9A 2OFOA 1AGRA 1LB1B 3FHOA 4EPRA 4BFYA 2MSEB 4KXFB 4MKGA 4UXHA 4EJSA 3TBKA 3IBGA 2XOKD 1SXJD 1OF1A 1E1QD 2BJVA 1GP2A 3FMIA 3FGNA 4HYYA 3K0CA 4HB3A 4I1VA 1W47A 3LBIA 1F2UA 1F2TB 1F3OA 1W2HA 3B1XA 3P4XA 4W7SA 3K09C 1XWIA 4HUTA 2WIBA 2HCBA 2XB4A 5CJPA 1LS6A 4V0NA 3L0OA 2E9SA 1TF7A 1E4VA 3FFBA 1I2DA 4LHWA 1A5TA 5EQTA 1ZP6A 4FCVA 1XZQA 2QTHA 2BWJA 2ATVA 1S3GA 2NOAA 1ELOA 4Q4AB 3GJXC 2QAGC 3G5UA 2GXAA 2QAGA 4YMVA 1K5DA 4LRWA 1SVIA 2UZIR 5DISB 2ATXA 3SJZA 2Q3HA 1P75A 3U44B 3DKPA 5KPJA 1ZNZA 1KMQA 5DO9A 2JJ1D 1US8B 1G4UR 3EZ2A 4Z8YA 1N6LA 1W5TA 1TX4B 2J0VA 4LX0A 3MWKA 3VFDA 2R6AA 5TB5A 2ZUCA 4E5UA 5G53C 3NBYC 3NC0C 1KY2A 4A0GA 3X1ZA 4Z1MD 1HEIA 2CVFA 3VHXA 3AM1A 1G3MA 2ORWA 3LAWA 1KI3A 1VCIA 4M1YA 4EFMA 5GJVC 3N5CA 1AQYA 1GL6A 2MSDB 4DIEA 4B2PA 1KSGA 4QC2A 3SQXA 1T5IA 5SZKB 4DZZA 3I8SA 4EJSC 3QXJA 2ZSDA 4A2PA 3SFZA 2XNDA 3THXA 3AF0A 3SJBA 4DCVA 4HZUA 1A2BA 1HYQA 3GEEA 4NHOA 5TVKA 5JCZA 2GJSA 3GJ6A 1II8A 2QMOA 3F0TA 4KFRA 2OZEA 4GMDA 4D81A 2ZM5A 1UBEA 1D8TA 3LO5A 4XH9B 1FNNA 4DHEA 1G18A 2H16A 3ZGXA 1G8HA 3IBYA 4BLPA 2VF7A 1NSFA 2QM8A 4LJ5A 4MGZR 3ECCA 5JWRA 2ZYTX 2ZJ2A 2WSMA 3BERA 4DCSA 1E4YA 4DLYA 3KXLA 4TYYA 1VMAA 4DDUA 4BFVA 3MJHA 4PSVA 4XVQA 1NI3A 1XJ0A 1E9EA 1OKKD 3TVDA 3CRMA 3QF4B 4NCJA 4RVCA 3IQWA 4B3BA 3U6KA 1RVDA 3IIMA 4B76A 4L16A 5AJZA 4TMXA 3PEUA 5FPHA 2J7KA 3H1TA 4KFSA 2BMJA 2OAQ1 1PZNA 2V54A 3H2YA 1G41A 1XRJA 1NLYA 3DZDA 4IKEA 2Z83A 3O8DA 4HZIA 5JRJA 5KTYA 1KK2A 1YRAA 2KB0A 1VCOA 1VHTA 1N6PA 2ZSAA 2J7PD 2TMKA 2ZS9A 4M0LA 2IT1A 1E2IA 3W6OA 3DEFA 3OIUA 3LW7A 2V7QA 5J4LA 3OE7A 1P2VA 3GJ4A 3S1AA 3A1VA 5FL7D 4TL9A 4ZO4A 1JAHA 4XWAA 1Q3TA 2WWFA 1OXTA 1T8UA 2H8KA 2PZFA 4R7ZA 1DTSA 3GLHA 3ZZUA 5JCPA 1II8B 2ANBA 3PITA 1LFDB 1X6VA 2FEMA 2CLDX 2XITA 4AKEA 4BFSA 1FPMA 1KAOA 1Z8FA 2BM0A 5IHPA 2FFAA 3CF0A 3CM0A 3QF7A 4LJ7A 1ZYUA 2PEZA 3ZZ0A 4B2IA 1AN0A 1KK1A 1QHGA 2CHQA 3I5YA 3DMNA 1CP2A 4N1AA 2WWYA 2FV8A 4LOAA 2ZE5A 2YWGA 3L0IB 2AFIE 4C7OA 4QHTA 2B8WA 2OBLA 4JMPA 1X8KA 3EIEA 4R2IA 1W2GA 4YC7A 3RRNA 1G20E 1H8HD 3A37A 1UDWA 4V03A 3REFA 4UXJA 4JVNA 2HF9A 2JJ2D 3HP1A 4NU0A 2BDTA 4PO1A 5JECA 2GXUA 2XJ4A 3KB2A 2VBCA 2YWEA 4MDEA 2A5JA 5CLQA 1XD2A 3L82B 2CBZA 1DELA 2G3YA 4JL8A 2XEXA 3QXCA 2H17A 2DWPA 3CX6A 2EU8A 3ONWA 5JHHB 2ONKA 5JJIA 2GXSA 1T91A 5A5GA 3PUVA 4ILEA 4LI0A 4RJLA 3T5GA 4EIWA 4NYJQ 3MWYW 2CLCX 2QGNA 3EIHA 3EPJA 1EFTA 3B2EA 2WAXA 2I1VB 4NH0A 2AKYA 3U3KA 1NMXA 1KO8A 2ZRJA 1OFHA 1PUIA 1YRBA 2IBMA 4F7WA 3LQQA 3RS3A 3VNUA 2GRJA 1E0JA 1UADA 2IS1A 2CK3A 2V9PA 1Z0IA 2J9RA 2R9VA 5GJWC 4TZ6A 1F5NA 2ZE8A 1WXQA 2ZRAA 1JI0A 3F3YA 3OIVA 5F3WB 1Q0UA 4RKFA 1CS4C 3DMDA 1P60A 1AQUA 4A92A 2GA8A 1OSNA 2C78A 4D4JA 1NL3A 1DEKA 3UMFA 3AKDA 3B82A 3ZDQA 2XNSA 5DYGA 4Q5IA 1FZQA 3CZQA 2R2AA 3U4QB 3H86A 2GK7A 2VQSA 2WOOA 3RWOA 4B71A 1M7HA 2AN9A 1VIYA 4C0BA 4HLDA 1E2EA 6Q21A 2IL1A 3OFNA 5GJCA 5JMTA 2OBMA 1XU4A 2Q9CA 4DDVA 1T4GA 3T34A 1E2JA 5HR5A 3V9PA 3Q8XB 3TW8B 3A6PC 4OK6A 4YDSA 4MRPA 1F48A 2J7PA 1VECA 3LRPA 1OHHA 1XMVA 2JLXA 2KWIA 1NVXQ 2A78A 3D8BA 1U0HC 2GXQA 2IHYA 2LKCA 3UG7A 3WMEA 4PQRA 1A1VA 4PSAA 3PQCA 4NP6A 2GF0A 4B6FA 2PX0A 3ASZA 2RGBA 3AF2A 4FW9A 2RGDA 4X8MA 1MABB 2WKQA 2RGXA 3IILA 4CIDA 1JALA 3ZS8A 1JR6A 3FWYA 2XAUA 4L15A 5J4VA 5KNDA 3TR5A 1OKKA 1XPUA 1QHHB 4BGDA 1RJ9B 1E2FA 4B43A 2ZJOA 1N0UA 2OO7A 5KYKA 1AA9A 2W6ID 3TVTA 2FSFA 2ZSFA 2AD5A 1NKSA 3RABA 4BPBA 2QRZA 1KI7A 3EWAA 4DJTA 5IRCD 3U61B 1DAEA 2Z4SA 2ZROA 2IUUA 1CR1A 2QBYB 1Z63A 3AVOA 3B1ZA 2HJVA 2B21A 1NY6A 4B74A 1N2CE 4PAOA 3W3ZB 5FUYA 5C2JB 2ZSBA 2J0SA 4OYHA 2WIAA 1CR2A 1UPTA 3NDBB 4A8JA 2F9LA 4HSEA 3KQLA 1F60A 2GNOA 1KDPA 1XCMA 2FSIA 1TU4A 1K5GA 1SVOA 5DIFA 4MGKR 4PPNA 3WMFA 5H68A 1Z6YA 1JQLB 3BFKA 4A0HA 5B57C 5K8UA 1Q20A 3CNNA 3HPRA 4JBYA 3FYHA 1H8ED 4PPFA 2F6RA 1J8YF 8OHMA 4WZAE 2YV5A 4BZXA 4HUQB 1Z0FA 2OFWA 3CRRA 3QPWA 4DCNA 2J3EA 2E1RA 2PBRA 1R4AA 4C7OB 3BAFA 2NMVA 3C14C 3KKOA 3FHTA 5EE3A 1OXUA 3U7FB 3GLHE 3UWKA 4JYBA 2QSYA 4A9AA 5JBQA 1PLLA 4DBLC 3OF5A 1SVMA 2DYKA 4QFMA 3QI2A 1H65A 3L8ZA 1SXJA 2XX3A 2P6UA 1U8AA 1YHNA 4TT3D 3ADBA 2R65A 2BCJQ 1XMJA 4KV9A 1KIMA 2BEKA 1KI1A 4NL4H 1TADA 3CBQA 1P5ZB 3I8XA 2O0HA 2OESA 3E2IA 3GJ3A 5D3MA 1CF4A 1N0VC 3S1AB 2D74A 3KZ1E 4LDJA 4XIGS 4JBWA 3P1JA 4DDTA 1XTRA 3B78A 4TLBA 1CEEA 2JGNA 1NJFA 2F43A 5L3VA 3T61A 1NP6A 1ZIOA 4Q19A 5KSPA 1SXJB 4QKQA 4HATA 2XSZA 2EFDB 4XD7D 4TYWA 1IXZA 5IF9A 4HAWA 2QE7A 1I4LD 1P6XA 1NN3A 4PPQA 1FMJA 3BS4A 3W6NA 4F38A 4II7A 2ZYWX 5JFGA 3I92A 2G1JA 4IRUB 4YXWD 1NLFA 2FOLA 4TMZA 4QJ3A 1FP7A 2OFXA 1OXVA 3W3AA 1BH2A 1G6OA 4LC1A 5FL3A 2CJWB 4BLTA 4D80A 4YQFA 4KITB 4XWOA 2NIPA 1XEWX 3NHBA 2G6BA 1NNEA 1XTQA 5FBRB 5CB8A 5JZVA 3LXXA 4Q1AA 2V7QD 4D4MA 3F8TA 1MOZA 3U6BA 3JZAA 1Z08A 2FNAA 4TQAA 4QJ4A 2JLZA 1RFLA 3ADCA 3BJIC 5DSZA 1M2OB 3GLIB 3GLFE 4KSCA 1T0HB 2RHMA 1D6JA 4YLGA 1OH8A 2R62A 1KKMA 2YYZA 1MR3F 4NYMQ 5SZJA 4R98A 4ARZB 1W46A 2IUSA 3K8YA 2V3CC 4RZUA 1IN6A 2PT5A 1E9BA 1E6CA 3AP3A 2O8CB 3FVQA 1L4YA 2ANCA 1AJEA 2YC2C 4LHZA 4MKFA 3CNOA 3KQNA 2EYQA 4LC0A 1EK0A 5F98A 2HF8A 1QDEA 4PC2A 4DLUA 1EFUA 1VYTA 1T8TA 3KUCA 3QPUA 3A4MA 3T1OA 5L3SA 3R20A 3MRSA 2IEYA 1VYVA 2FWRA 3TQFA 4ZIRB 3LX5A 3AEZA 2ZTSA 4TMTA 2EFEB 1FQKA 3TUZC 5JWHA 1SQ5A 1MO5A 3LW8A 4LJ4A 3QBTA 3QJYA 2IWRA 1UEIA 2ZRMA 1US8A 4MYHA 1KHTA 4B32A 4G5OA 2VRWA 3WYFA 2IS6A 1JQJC 1Z47A 2P0EA 2P3SA 2J45A 4YONB 1P3JA 1U99A 3UIEA 2QAGB 5AJXA 4ACAA 4WIAA 3PCRB 5EXXA 4AG6A 4ZDWA 2OHFA 3LFUA 4C0LA 3F5FA 3MWJA 3D6TB 2ERXA 4GT1A 4RCYA 1Q44A 3X1DA 1AS2A 4EKDA 4YMUA 3UATA 4ON9A 3QIAA 3TQCA 1QHSA 1JPJA 2RGGA 1ZNWA 1KI8A 1KMHA 1G64A 1JEDA 1JR3E 2O0JA 1A4RA 4E03A 4IFBA 3QOFA 3CF6R 4IEIA 1DS6A 1JEEA 1UKZA 2JIZA 1OFIA 4N0EA 3V4RA 3T35A 4EJSB 1E2PA 1CKEA 5J40A 3RWMB 3ZS9A 3M1IA 2AL7A 4BZQA 2RH5A 1AIPA 4Q4LA 1YZTA 2A3RA 2JATA 2ORIA 3QKRA 3QG1A 4RCZA 5AJVB 1S0UA 2ZSEA 4M9ZA 4ZV4A 1YJ5A 2ZAOA 3EC2A 2GCPA 4IDNA 2IS4A 5FTJA 2QN6A 4UJ3A 3GLGA 3CF2A 1R5OA 4GOJA 4KJZA 4PHHA 4FINA 1GRQA 1CJVC 4TSFD 2G83A 1ZRHA 4W5HA 5JWOA 1Y3AA 3GJ7A 3LVQE 3NHAA 4CF7A 3U7EB 5KHOC 3W8RA 1MT0A 4JZKA 2LWIA 3QKTA 2SHKA 1XCPA 1E69A 1ZIPA 4PZZA 1E3MA 3JVUA 2VPPA 1VG8A 1UBCA 3LH5A 2IC5A 1L4UA 3TK1A 5DI3A 3SHWA 2FE4A 2XB2A 3CW2A 2XZLA 4PC7A 3VR4A 2OM2A 2NO1A 3EZ9A 3RAPR 4PO8A 2CDNA 5CJ2A 1UDXA 1M7GA 1XB2A 4CEJB 2WSSD 3A1UA 4TWZA 2OCPA 5BN5A 4CT5A 2HCJB 4G01B 5L3SB 3EPKA 4TYPA 2FEOA 5TXGA 4WAUA 1BO6A 1Z6GA 1WBDA 1ZM3A 2WVJA 4C3ZA 4D26A 4KYUA 3CLVA 2PJZA 3RHFA 4A4DA 1OE0A 4FMDB 3KDSE 1HE1C 2GJ9A 4QNMA 3C41J 3IKJA 4Q4JA 5FUXA 4ZCIA 3GLGE 2ZJZA 1NG1A 5G40A 3R7WB 2JAQA 4HB2A 3ZJYA 4DWJA 3SDZA 1FX0B 1G16A 3KQKA 4Q03A 3K0SA 4LPSA 1QRAA 4WVFA 1ZBDA 2QE7D 3I3SR 4WBSA 2OBNA 4UXIA 1YR6A 3ZIAD 2HXSA 3PEWA 1N5JA 3GCGA 4OI4A 1L2TA 1DOAA 2DFKB 5AUNB 3TSOA 3AVWA 1D2MA 1WP9A 3B6EA 1W5SA 1WMSA 2WJYA 2WM9B 1OIVA 5TY0A 5LD2B 1GL9B 2J59A 5EUQB 2QM7A 4IDQA 1TNDA 2R6GA 4C9BA 2B7BA 3OAAA 3CPEA 3VR1A 1KTVA 4N0DA 1R8SA 1R7RA 2V55B 3EA5A 4CEIB 3WRXC 1E99A 4KO8A 4TMVA 4GRAA 4P31A 3PIRA 5FBVB 1FNMA 4B3FX 1KDOA 1DPFA 1VCNA 2AXPA 2F9MA 2ZUBA 3ZQJA 4KVGA 2F7SA 2IYWA 4LV8B 2FPKA 2QT0A 1S8FA 2PMDA 1WF3A 1S9HA 4KVAA 4TSFA 2V1UA 3AVTA 1S1CA 4OHZA 3RC3A 4ZI2A 3HR8A 3B8HA 5DHAA 2ONJA 4YMSA 4M22A 5E7JA 2RHDA 2BOVA 4HAVA 3WNBA 2IYVA 3U7GA 1IBRA 4Y0AA 4TYQA 1OT3A 2C9OA 2QAJA 2J0QA 2ZU6A 3K70D 2DHRA 1G5TA 5BN3A 3L43A 1NN1A 1FX0A 4BFXA 3WP1B 4AYXA 2J46A 4V0LA 4RD6A 1J8MF 1NVWQ 2BVNA 2MMCA 1GTVA 4AYWA 3THXB 4JSYA 3BB1A 4OI0A 2IYYA 2A2ZA 1FUUA 4I1SA 4X8HA 4NCKA 2UKDA 2A5DA 2HLDD 2B6HA 4OHXA 4O3MA 4YDHB 2P67A 1DBSA 1Z07A 4LYFA 4LZZA 1KY3A 4LPKA 1U90A 3SI7A 4XOIA 1B23P 1W0JA 1E9DA 1Q1ZA 2O8FB 3QEOA 1ZINA 4HUQA 3VMFA 3TAHA 4PO9A 4TTRA 2J5XA 3QKSB 3CH4B 1L7VC 4MRNA 4R9UC 4B47A 4ZDIA 4FMBB 5EE1A 4RFVA 4D6PA 5CIWA 4FMCB 2BIFA 1NVVR 2F1RA 2X8AA 2BMDA 4O25A 4FN5A 3L2OB 3TUIC 3CWQA 1ZM2A 5C1BA 3K9GA 1Z5ZA 2GF9A 3P26A 3T06B 3B60A 2XTMA 1ZVQA 1G21E 2REXB 3BOSA 4XVRA 2ZRBA 4HAYA 3AVVA 2YNMA 3SBEA 1YR9A 3IHWA 4JVSB 1JXOA 3LDAA 3EZ7A 2R8RA 3AVXA 1G8YA 2DR3A 2AD1A 3D31A 2VP6A 4US0R 1C1YA 4RD2A 3KXIA 3B9QA 5KDDA 2ZS8A 5JHGB 1XJQA 4HEJA 4PANA 4BEBA 3OEED 4P33A 3RC8A 1AS0A 4UJ5A 1DARA 1G17A 4TTQA 3LX8A 2KBEA 1M8PA 2WJJA 4M4SA 4DSTA 5SZHB 3PVSA 1MABA 3ZVMA 1TL7C 3LQRA 2O8EA 2ZVPX 1IN8A 4Q9JA 4LSGA 4I81A 2WJHA 4ZKDA 1G8GA 4HAXA 2V6IA 3WYGA 3AB3A 4AG5A 5KSZA 3SHFA 4NCIA 1SHZA 1XD8A 2NTYC 2HXYA 2REBA 5E7MA 3P32A 4US1R 2W0MA 3ZD6A 2Q3MA 4URWR 3CRW1 2YOHA 3SYNA 1Q1QA 1KO4A 5FPSA 1U0JA 3BH7A 5J4HA 1KI6A 4F4JA 5GVRA 4LJ8A 3SS8A 1E0AA 3G0HA 3LVRE 1P61B 1I4DD 3KKNA 4Q66C 5HCNA 4RY2A 2E87A 1W7AA 1NN0A 1PLJA 3AKYA 3K0FA 2WHXA 3WNCA 1ZM7A 2QPOA 5HZKA 4EFNA 2Y8EA 2DB3A 1J70A 4C30A 1G5RA 2AFHE 2ZETA 3DZ8A 4Z8XA 3A4NA 2J41A 3OESA 4K46A 1Q22A 1IONA 3WP0A 5M04A 1OB5A 4A2WA 2WV9A 1Z2AA 4LGMA 4V02A 1TMKA 4B44A 2CHVA 3ETLA 1DO2A 4ITRC 4KFTA 3IIJA 2G77B 1M34E 3HR7A 2QENA 5KO2A 4M8NE 4QG7A 4TT3A 1AS3A 2QY9A 2VSXA 2WKRA 4EDHA 1P72A 2XOKA 1IXSB 2NG1A 3K1JA 5B30A 3K0AB 2IYZA 3C8UA 4NYMR 2ZRDA 2JDID 1MO4A 2C95A 3P20A 4TL8A 4BWYA 5JRZA 4Z54A 2ODNA 4LHXA 2GTPA 3LA6A 4RFSB 2GCOB 4IXNA 2JLRA 1U8ZA 4EUNA 2KE5A 2RGNA 4R71A 4UNSA 2EWVA 2JJ2A 2P6NA 4CGZA 4Q4HA 4DSNA 3QKSA 5HKKA 1NBMA 3N2EA 2ZJ8A 1R5BA 4LUCA 3WBKA 5DN6D 2H92A 2AX4A 5C4GB 1UKYA 4DVGA 4GL2A 3WYAA 2Q21A 3RS5A 3SOPA 5A4JA 3BWDD 2YKGA 4V0ME 1W44A 3OE7D 1P4SA 4GMXA 4YMTA 1E9AA 3I32A 1QVAA 2D7CA 1NG9A 1UJ2A 1G6HA 2GHIA 4AKIA 2D4HA 2JJ8A 1KK0A 5KSOA 4QHYA 3RS0A 1OYYA 1XEXB 1SZPA 1Z3IX 3B1WA 2VTKA 3GJ8A 1YZUA 2QMEA 1GNPA 1G8FA 2OCAA 2PJRA 2GDJA 1CBUA 4Q01A 5EE5B 3K09A 4JJZA 1TUEA 2W2XA 2ZRLA 1GWNA 4L9WA 2VP2A 2PL3A 1C9KA 3CO5A 1RYHA 4D4KA 1MH1A 2IXFA 1J7KA 2W58A 2RCNA 4HLUA 4D0GA 2J1LA 2YINC 1VPLA 4UNPA 1SKQA 4RKEA 5FOTA 1Y63A 1DAHA 1YR7A 5BQ5A 5CLLA 5AUOB 4IVRA 1X1RA 5FTMA 1ZUNB 1GZSA 3LD9A 4A82A 5DHFA 1QZXA 3TKLA 1EX6A 4WOPA 1UEJA 1IN5A 3NKVA 4Q9KA 2K5UA 2ZR9A 5BYJA 1IHUA 3K70B 1XEXA 5HTKA 3PJRA 1K8RA 2W2VA 2V4ZA 3IQXA 1E9RA 2RAPA 1XDBA 3RVBA 1NY5A 3FKQA 3WNDA 1E32A 4A0FA 1Q1BA 2VHUA 3Q85A 3N2IA 2DWOA 2CNWA 2GZAA 4MUBA 1E1RD 4NYIR 1R6BX 4DIDA 3IUYA 2Q9BA 4DSOA 3DDCA 1S4QA 2AWNA 4L9SA 1Z2CA 3NC1C 3THWA 4MKHA 4MRRA 4Q18A 2ZRPA 3ZH9B 2HLDA 4KI0A 4QOSA 1NVUQ 4QGHA 3CX8A 5DN6A 4LY6A 1FTNA 4PTLA 5EP3A 3O8CA 1OPXA 4L5BA 5TDHA 2QNRA 2RGEA 4HDOB 3GJ0A 4MA4A 4NMMA 1VYUA 2JJ1A 4PHTA 3I5XA 2V1XA 1Z29A 3FKSA 1XTJA 4PPGA 3O47A 4RSGA 1EXMA 1GDDA 1Q1EA 3EWSA 1P9NA 2X1VA 3SC3A 3AF4A 2KI5A 2NZ8A 2XZPA 2O8BA 3UK6A 1RW4A 2N42A 3KTAA 1E98A 1E9CA 1EFRD 1YZNA 1L8QA 3AV0B 3E5HA 3RRZA 4JIMA 2GZDA 3CPHA 3KB1A 1LY1A 2R6CA 2OXCA 2VL7A 1P62B 4M21A 4CVNA 1OFTA 1UFQA 2FFHA 4G5GA 1E2DA 2C99A 1NIJA 1QHHA 2P65A 3EZ6A 1I4TD 2W00A 2C98A 3WY9A 2CMKA 1XCGB 1DAKA 3QUSA 1YZGA 3CR8A 4TQUS 1ZUIA 3BB3A 1IY2A 2OILA 2QTVB 1QHYA 2GAOA 5DE3A 3ZZTA 4EPTA 4MH0R 3X2SA 1R0XA 4FIDA 2H7VA 4IXMA 2H57A 5H8WA 3QVVA 4F4CA 4P32A 1N5KA 4S2EA 5AWFC 3MG9A 1DG1G 2IYQA 3AVPA 1OXSC 2B92A 1NF3A 3OAAD 4Q9HA 1KNXA 3EG5A 4BFUA 1ZUHA 4BUJA 2HDNB 3ND9A 4RD3A 1RRCA 3TGPA 2IXEA 1T3HA 4CZ2A 3KQHA 1U8YA 1G4AE 2OUKA 4Q00A 1XX6A 1S2MA 3A4LA 1ZC3A 2F1JA 5DYIA 2WAYA 4R2HA 4IHQA 5KSYA 4JLBA 1G3RA 5JJLA 1U98A 2WWGA 3LBNA 1OB2A 3FE2A 4QBIA 3PR1A 4AD8A 1F2TA 1R0WA 5CM8B 5E3HA 4BFZA 4MITA 1WBBA 3EC1A 4M1SA 2BBSA 1G7TA 1GITA 2CXXA 3PUZA 2D2EA 2XZOA 3H4MA 1ZMXA 4ESVA 4QGAA 1LV7A 1OIXA 4A8JC 4JLPA 1II0A 1N6KA 4AI6A 2IX3A 3Q9LA 2HUPA 3OIWA 3LBHA 4IOKA 1ZC4A 3TUJC 4C2TA 2BKUA 4QL3A 2W0SA 1KMHB 5FL7A 3K0EA 3GLFA 1KSFX 3U7HB 4M1KA 3R9IA 5EJEA 4PQFA 2VP4A 3QE0A 1N6HA 3A8TA 1D9ZA 5EXPA 3W5IA 5HPYB 3Q3JB 1TTTA 3LLUA 1FTSA 3VX3A 3O8RA 4QBGB 3SEAA 4XWKA 4E09A 4G5SA 1BKDR 3BE4A 5GADl 4KLNA 1PJRA 5FBWB 1E2LA 2XSZD 4XD7A 5DGXA 2L0XA 1NMYA 2C9YA 1CJTC 2LCFA 4PZYA 5EZ5A 1M7BA 1WDTA 2VSFA 4LJ6A 4EPXA 1W4CA 2G88A 3GFOA 1Z6TA 3DPUA 3AF1A 4URZR 1YU9A 4GFDA 4PR0A 5EP2A 1LNZA 2GEDA 2GJ8A 1VHLA 1M1YE 2GEUA 1XEFA 2WSSA 3CRVA 4MQBA 3GFTA 1T0JB 4DB2A 2O8FA 5EP4A 1CLUA 4DUGA 1A7JA 1KAGA 3VHLB 1OHHD 4JL6A 4LBVA 1IJEA 5CDFA 2FU5C 4JBXA 2F55A 4OK3A 1R8QA 3UWOA 1KO1A 3Q72A 4DLTA 1SXJC 3A1TA 1XXHE 3EW9A 3H0KA 1SVLA 5FPYA 2KBFA 3AP2A 3TE6A 2HYIC 2UVQA 1TF5A 4M9XA 3GJ5A 3PV0A 4RD4A 2O8BB 3QY0A 4BASA 5K8IA 3GQBA 621PA 2PX3A 1XTKA 2QMUA 2RGNC 5CM9C 1GKUB 3MCAA 4P4UA 1G7RA 4WXRA 5KPDA 5FR1A 2QPTA 1ODFA 1OJLA 1ESNA 5P21A 4FMCF 4PZLA 1ZU5A 2G0TA 1TF2A 3GLIA 2DWQA 2GZHA 1RE0A 2B7CA 3KJGA 3HU3A 1EWQA 1GILA 2QL6A 2YZ2A 4GZLA 2PLFA 4RZ2A 5FOWA 2OXRA 1IXRC 1QHXA 4M1MA 1ETUA 1QHNA 2ODEA 3EIQA 1A2KC 2FMXA 4M1WA 3DHWC 2CJWA 4AIIA 4MRVA 4TLCA 1Z0KA 3Q7QA 1E2GA 4HLQB 1HY3A 3A36A 2ORVA 1GNRA 3BRWD 4CW7A 2FPLA 2H5EA 5EXSA 5LPNA 5CDFE 1D2NA 3WMGA 3SJCA 2H1LA 2QUZA 1CR4A 3SNHA 4XVUA 4Q7LA 3R9WA 3QF4A 2ZE7A 3AUYA 3EA0A 4JLNA 1NBME 1T3LA 3RS7A 5AUQA 3CONA 4O2RA 1ONBA 3BH0A 2VP0A 4HB0A 1R10A 2W6IA 4JVMA 1N5IA 2W83A 4UKDA 5AJWA 1OW3B 5D3MB 1N6RA 3QXXA 3HU1A 4HI0E 3RS4A 2OLJA 5AJYA 4G0NA 4ABYA 4CEHA 4C0KA 2ZIAA 4CYMA 3NBFA 3NBXX 1S96A 1BIFA 1KSHA 1QG4A 2ZRGA 3RYTC 4B3CA 2JLYA 4DT1B 1UKVY 2RKOA 4HZUB 3P27A 4IOJA 4Q4JB 4M9QA 4W5JA 2BEJA 1RRFA 1UBGA 2QGZA 1CRPA 3I61A 1D9XA 3KFVA 4KCGA 5FOSA 2P6RA 1UBFA 2BMEA 1W4BA 1S3SA 1FOEB 1QHIA 3SBDA 5JSZB 1D5CA 2DFLA 4CEJA 2YWFA 1P2TA 2XTZA 1JR3A 4URVR 2VHTA 3BFVA 2GCOA 4AURA 5DI3B 1E2QA 1OYWA 4A8JB 3K0AA 4XJXA 2OCBA 1MKYA 2Q0HA 5F9FA 3B5JA 1KNQA 4Q4AA 2YC4C 1JJVA 3VKWA 3T15A 1G5PA 4UNQA 3U3JA 3W90A 4Z51A 1G3QA 1G291 3QNUA 3PEVA 4KFUA 5BXQC 2IA5A 4DLSA 1J2JA 2ZI4A 3E70C 1IM2A 1DAIA 1SKYE 5G3ZA 4B3XA 5L3QB 4U7DA 2ZI5A 4M1TA 5FPTA 2PZGA 4IJMA 3CX7A 1M74A 4OQMA 3C15C 4BLQA 3BK7A 3HU2A 1AKEA 2N1BA 1NN5A 3PFIA 2YOGA 1XEWY 1T5LA 3MJRA 2FX3A 2ZI3A 5L8VA 2I4IA 3HWSA 3BIFA 1KZGB 2C5LA 2ZREA 3W6PA 3B7GA 5LDDC 4LHYA 1BMFA 4G1UC 3WXMA 3SN6A 2A5FA 2V6JA 2EW1A 1BS1A 1GSIA 2IXGA 3BH6A 4V0KA 2OCYC 4C0HA 5JS7A 5HZHA 3NDPA 3VR2A 3HDTA 3LV8A 1J90A 1SVWA 1JAIA 1ZAKA 5CK4A 5AK0A 2VH5R 4F92B 3SR0A 3VKGA 4DXAA 2ZJYA 2IYXA 2QG6A 3I4LA 1CJKC 3BBPA 3PUYA 1HQYE 4M9SA 1TQDA 1VCMA 2R44A 1WE2A 3D3QA 3BB4A 3ASYA 3ADKA 3QG5A 3IO5A 4HLCA 1FMLA 2ZRFA 1KK3A 2BHRA 1AGPA 4LV6A 3QQ5A 1GM5A 1OV4A 1KOFA 2BJWA 1EESA 4P0TA 4NCNA 3RDPA 2VHCA 4JJKA 1G7CA 4DC9A 4A1FA 4OHWA 1IN4A 221PA 421PA 5G3YA 3IDQA 1IY0A 5LB4A 1KI4A 5FBQB 5FTNA 1P2SA 1KDTA 1DAMA 1R5NA 3AUXA 2W2TA 3GLIE 5B64A 2MMGA 1MO6A 1G7SA 3PUXA 5FTKA 2VYFA 3U3MA 1LS1A 4P4SA 1AZSC 1HH4A 4GOKA 1HE8B 2Z5FA 3D7MA 4LCBA 2VA8A 3UANA 2WPDD 3L0SA 1EWRA 2ZJAA 4FCTA 4Q1CA 3TSZA 2JLVA 2WWHA 2D62A 2YOFA 3DL0A 2WKPA 1JECA 2XXAA 2DCUA 2FPMA 5K8TA 1G3UA 4C0JA 4D2IA 1NMZA 4FD2A 3SE0A 4P3YA 3QXHA 3R8FA 3THOA 4JLDA 2CEAA 5C4MA 3DVLA 5AUPB 1E0SA 2OAP1 4GZMA 4JL5A 2IK8A 4DDWA 2WJGA 1LVGA 1WB9A 1XBTA 3THWB 3VKHA 2PCJA 4WA7A 2PCLA 5BYKA 1WRBA 2NPFA 3AQ4A 4GBMA 4OQLA 3C5HA 5UKDA 2AXNA 5HCIA 4KLZA 3AF3A 4EPYA 2FF7A 4B33A 2IHBA 4ERNA 1CIPA 2X77A 3BC1A 1DVRA 2NGRA 4A15A 2I3BA 1RKBA 521PA 3OFND 1TU3A 4G5QA 5E7IA 1RRPA 4ZCLA 1U2RA 1Q3HA 3PXGA 4B6EA 3I73A 2GKSA 4URYR 4B75A 2G1KA 2FJUA 2ZITA 1D2EA 3OEHD 4RD0A 3U3OA 821PA 3B1YA 4UQOA 3U2QA 1E2HA 3T1TA 2DFNA 2JCSA 1E2KA 2WJIA 2P2LA 4WZBE 4YXWA 1EX7A 2H18A 3KKMA 1ZU4A 3LWNA 3ZQ6A 1TEVA 5IK2D 1W36D 2OT3B 3NEJA 4OJKA 1ZD9A 4RD1A 1K6MA 2VHQA 1SVKA 2F43B 2CHGA 2ZRKA 3GLHB 4TMWA 3TRFA 3X1WA 2JLUA 1SHKA 3NH9A 1HUQA 5FOUA 2Q6TA 2GVZC 3WRYC 2G0NA 2ZYVX 1G1MA 2GJKA 1ZW6A 2ZI9A 4KSBA 4UNNA 4Q1DA 3EASA 3T12A 2VLIA 2VO1A 4C0AC 4NYIQ 4EPVA 2VP9A 2EQBA 5C18A 1IQPA 4I1OA 4DLRA 4JLAA 1Z0DA 2RGCA 4D0NA 3I62A 1X8JA 3SZRA 2WWIA 1AK2A 3C7KA 2FSHA 2D3WA 5EE0A 1F6BA 1PV4A 5B58C 1CJMA 1UM8A 4FI3C 1RPZA 2FH5B 4BRUA 2GVDC 4QGFA 1ZD1A 4GDFA 4FXPA 4Q48A 1YZQA 1YZKA 4DCTA 1U81A 3BD9A 4ZDKA 1IJFA 4CT4B 4E22A 3X1XA 1YR8A 2FZ4A 3QKUA 3T5DA 3PUWA 2PLRA 3R8CA 1BOFA 5KDOA 2ERYA 1KSJA 1E9FA 1U94A 4A2QA 4DCUA 4OI2A 3REGA 2QT1A 4JYCA 4HDCA 1T9HA 2A9KA 1ZM9A 4F91B 4XTCS 4ZKEA 1XJCA 3C5CA 1IOZA 2Z4RA 1N25A 4Q4HB 4O0MA 2PEYA 1GUAA 1E96A 3MUFA 2QU8A 2CE7A 1P9WA 4Q02A 2QRNA 2HYDA 4ZPXA 1XMSA 4BQSA 5F2EA 2AWOA 5L3RA 4OBEA 1G3IA 2QORA 1G19A 1W49A 2QPAA 4IW3B 1OXXK 3QENA 2JIZD 3FHCB 2XTNA 1MRSA 1YE8A 2XXAB 3ADDA 2WMNB 4QM7A 2OV2A 3K0CC 4JLOA 3SQWA 4BZPA 1NSTA 1P73A 1TQ4A 1X3SA 3KKQA 4U02A 2OLKA 2GILA 1N0WA 4AK9A 1P9RA 5CITA 2XGJA 4JVLA 5IDVA 1EFRA 3EPLA 2IUTA 3FPAA 4C4PA 4HAZA 2BBWA 1NKTA 1RJ9A 4BEJA 3CUEF 4GSYA 5E4FA 2YWHA 1E1RA 2HEIA 4K8OA 5IT5A 1GVNB 2P5SA 5JI3E 2JLWA 1AZTA 3J81k 1P7CA 2WBLC 3K0FB 2C2HA 1LW7A 2VP5A 3FMOB 4IFEA 4DLZA 2ZXUA 1Z0JA 2P5TB 5LBIA 4JT4A 5GVSA 2EFCB 2FFBA 1O87A 4MYCA 3SYLA 1KJYA 4PXAA 3KUDA 4ASUA 1RIFA 4LBZA 5AR1A 2Z43A 1GRNA 5FOXA 3CR7A 3H84A 2O8EB 1E0KA 4TN1A 2CLSA 1Z28A 4PQYA 2XJ9A 4DLWA 4I99A 2UZ3A 2ZYUX 1TQ6A 3Q5DA 2FA9A 4OI1A 2O8DA 4FMDF 4DUGD 4PC1A 1GNQA 1ESMA 1HTWA 5CYPA 3JVVA 4HB4A 4Q1FA 4QBFA 4A6PA 4E07A 2B8TA 2ZE6A 5GJBA 1XFAA 3EPHA 1WCV1 4Y0VA 2WJVA 1Z83A 3W9YA 1QG2A 1O3YA 1CR0A 2CCKA 4PAMA 2ZRIA 4BLOA 3AKCA 4PAQA 3TSWA 4U5XA 3U4QA 4AWXA 2IEZA 2RMKA 4JLJA 3DKVA 2EFGA 4KHZA 1HV8A 1OH6A 3VU9A 4DLXA 1TEXA 1C4OA 1MV5A 4QJ5A 4LHVA 4TLEA 4Q7KA 3RLFA 4L8GA 5EZ6B 2PH1A 5JI2E 4BLRA 3CZPA 2OG2A 3IO3A
chains in the Genus database with same CATH superfamily
4GP6A 2XMBA 4OHKA 1H5NA 4PINA 2AQKA 1MZVA 3BWMA 3WX0A 2XCSB 3OZVA 4HWGA 1X8LA 4PHGA 3IUMA 4PF1A 4YAFA 5CPFA 2CVHA 4GOMD 1XZEA 5K0CA 2CB9A 1G98A 4G0XA 2NO9A 4OJYA 3RUDA 4ZI3A 1TJ5A 1HDYA 1L4EA 3I01A 3NCHA 4JB3A 1MD9A 1ZMTA 3M4YA 4MB6A 3Q2IA 1NVKA 1N2XA 1TTPB 5EGSA 3W04A 2K7ZA 3ZHTA 1Y4ZA 1B6RA 3IKLA 4CL8A 3A4YA 5BW8A 1U31A 4UUBA 5ILQA 3WAJA 2FQWA 2K2QB 6ADHA 4IOMA 1T3GA 5FUBA 4I4CA 3QVSA 1P5HA 3BX1A 3LQYA 4L07A 4EW1A 5ED0A 1VPDA 3P5SA 2W22A 1Z0ZA 2C42A 1TA4A 3RT9A 1NI4B 1V5EA 3DC7A 2K4MA 2XT6A 3H1GA 3I6QA 4BCCA 3AUSA 3EDRA 1D2AA 4M0PA 3QU4A 4PS0A 3ZTWA 1XD2B 3EB9A 5AVYA 1NU8A 4DSUA 1NXXA 3N8DA 3TQIA 5EIHA 1E0DA 1V26A 2FW7A 4OFWA 1BG6A 4HY3A 5EUMA 2O7NA 1FP6A 2O4UX 4YEDA 4BGIA 3QVXA 1FS4A 1J09A 2JFWA 4B34A 4I2VA 1FFHA 5KQLA 2IOHA 5MF6A 1NA5A 3A6FA 2NAPA 3CVUA 3FNGA 3SU8A 3VNVA 2QRUA 1YQGA 2AJDA 2LKDA 1H8HA 5G0UA 1L6RA 1RYDA 3GVXA 3IAUA 5DGCA 3ZD9A 4RK5A 5F9HA 4CLXA 2V7TA 2P91A 4TYNA 3NJRA 5JJIA 3L1KA 4DT1A 4O8CA 3JZFA 1E1QA 1DAFA 2BFEB 1BQ4A 2QP4A 1FMCA 4KMOA 2P35A 4B9AA 4UEKA 4YBZA 2JLAA 4TKMA 4RMGA 1GUFA 1U9IC 4X60A 1ARZA 5IKPA 3GX1A 2AKEA 4XX0A 5F12A 1EKXA 2A57A 4KE8A 7YASA 5CGQB 4WD3A 5C7LO 5J5CA 3ICEA 5B2ZA 4N8EA 4F4FA 3H19A 4MUHA 2QTMA 1RYZA 2FN3A 3ND5A 4GPTA 5ER6A 2V9CA 4KODA 2XYPA 1UR5A 3L18A 4OEHA 5IAJA 3WKDA 5CA1A 5IHXA 4YIKA 1ISMA 1QCDA 4MMYB 4Q7JB 1JEYB 1A3CA 4EHIA 4KVZA 3U1BA 2XXJA 3T54A 2C00A 5AXBA 4PRLA 1GQFA 5KZMB 1ZHHA 3BFXA 1A77A 3L0PA 5A0FA 5T5QA 1KVRA 4BGVA 4F8EA 4LHSA 4W5RA 3TMKA 3DBLA 2PA3A 2C9CA 3ICVA 1C81A 1N1EA 3KVYA 3GB9A 4CLOA 3FSEA 1KVQA 2GJAA 3F6RA 3LHDA 3PKZA 3UJ6A 1VIAA 1DWQA 5T57A 4A10A 2PUWA 2QXYA 1KI2A 1XTSA 1PUJA 1HTTA 2OP1A 2P4SA 4R7GA 1N6IA 5IARA 1VLHA 3MD0A 2VSOA 2IKQA 1N0IA 2RKWA 2UUOA 4GH5A 3AM5A 1GD1O 4B48A 2HT6A 2BGWA 3OG9A 3NHZA 2DLNA 4GKJB 1A9TA 2SKDA 4WN3A 1JU4A 2GR9A 4LDZA 4I4TB 5HF8A 2F3RA 2JB9A 1P4JA 4M0CA 4JP8A 1CDDA 3KT8A 1N1GA 1A9QA 2VRCD 4OHCA 3UV7A 2P40A 2ZPTX 5TS2A 4BNDA 1TRKA 4QVGA 3E03A 3EIFA 3QOXA 3X1KA 1GDTA 2RHJA 4HQFA 4R68A 3HLYA 5EQJB 2Z1MA 3IOCA 4PEVA 2PMKA 1DIBA 2Q7XA 5BWMA 1JEJA 1WMBA 4H1VA 2RHBA 5G4KB 1NU6A 1ENOA 2IELA 3UUFA 4RSMA 4D97A 5CFMA 4H0FA 5CW2A 1WUKS 1W36C 2KLHA 1ZJYA 2O05A 3EQ8A 1IN7A 2OKGA 3EZFA 4G4JA 4D4IA 2DLDA 3CB2A 4JD5A 4RQTA 4OI0A 1IWOA 2POQX 2OPBA 3LGXA 4FWIB 5CT8A 4U7JA 3NEYA 5H5JA 3S5JA 3TM5A 2B83A 2QROA 2F17A 3GW8A 3TKYA 2IZ5A 1HDXA 1L5KA 2X4IA 3CLSD 1RPNA 3TIVA 4O2LA 2ZUSA 2VJOA 5DTMA 4IVPA 2GN8A 5F1KA 3TZBA 4OQXA 1T9KA 3L6CA 4FFVA 4DY4A 3KL4A 1HFEL 1QCZA 3KHSA 3KS9A 4QOIA 4BO7A 5FX2A 2I54A 2BFNA 3B85A 3D6VA 1M72A 4GPIB 1GIAA 3A1WA 2H4ZA 3LVFO 1NRWA 3CIOA 5KHAA 4E2ZA 4EI8A 5J4KA 3ZBTA 4NS1A 5DNUA 5AXCA 4ZO7A 2RGAA 1VE1A 2REQA 2VDMB 2H1CA 5DFAA 5IAGA 3QVUA 2IDKA 4ZVKA 2PMBA 1QJCA 3OLCX 4V0MA 4BKQA 4C6TB 2D7DA 2XMGA 3I2HA 3E7WA 1BYIA 1UM9A 3QLUA 4L51A 1M6NA 3FVTA 2NSDA 3DE5X 4P4NA 1CW2B 2ODBA 5JO0A 1FW8A 4R2XA 3MWLA 5AVUA 3ENNA 3BHNA 2LUOA 1JXMA 1XNHA 1EVKA 4PLTA 2Q5OA 3ESZA 3T6KA 1XALA 1EX1A 3L8YA 3GZTB 4N5HX 4NF2A 1RKVA 4TX1A 2ZQ5A 3HDGA 3OCCA 1YVRA 2HZBA 2MSCB 3RVOA 5FWYA 3P4YA 3DM9B 3ZLUA 3P2KA 3T0GA 1T2NA 2OTCA 4Y6QA 5FA5A 1MEEA 2KPOA 3OHMA 4IDPA 1Z2NX 3WYNA 1Z06A 3TJZA 3LT2A 2OY0A 3I5AA 3KQUA 2A0YA 3DH0A 3GLFB 4GI5A 2GM3A 5LIRA 1U0EA 2REOA 3OZGA 3AH8A 4U2CA 4Z49A 1TEZA 1DIAA 3QMWA 3QVOA 4MRSA 2J48A 1Q91A 2C5FA 1ZOOA 3ZVNA 2QI9C 3VU9B 3CGGA 1ZCBA 1R2QA 2CL0X 3SQNA 2OXEA 3NIWA 1A0OA 1Y3BE 3TEMA 4ZQGA 2JDIA 4XR9A 3EFHA 4RTKA 3JASB 3E1SA 1Y6FA 4B84A 4O59O 1MQSA 1ZGCA 3F6YA 2O9JA 4AKHA 3L46A 2HQBA 3TYXA 3RSLA 3MLEA 4B73A 2ID8A 2GBLA 4HT3B 1TEHA 3L9WA 2Q1WA 1MRNA 1JPNA 4UBMA 3AP1A 1YFJA 1B8UA 1C8LA 3ABQB 2NXJA 3EARA 4P5EA 4R05A 3E2MA 4XGQA 3WYDA 5SY6A 3QTBA 1U7PA 3AHFA 3MCWA 4PZ0A 4IDBA 1QS0B 3DL7A 3B3AA 1CJUC 2P7IA 4QAJA 1DG3A 2VCEA 5AVZA 1FYWA 2C5SA 1HE2A 1K5HA 1AKUA 1PJCA 1SCBA 1JG3A 4FFSA 3W9SA 1RQRA 4EFLA 2HCTA 2GBPA 3ZY2A 4AIRA 2QJRA 4BQIA 1WD7A 4QO7A 1K9SA 3LL7A 1C8KA 1RM3A 2R6DA 4DR1B 2CL6X 2NUAA 2POCA 3O21A 1O0SA 3AESB 4TVKA 5JNRA 4LSWA 3HP4A 3RSOA 1F1BA 3TIFA 4JI6B 1A7UA 4NBSA 5HJ2A 3H8SA 3UQYS 4PBTA 1V5WA 3FKJA 4NZYA 1T26A 2BKAA 3F7TA 4ZVVA 1PZHA 5EJFA 4RA9A 1Q0PA 1P4AA 4MGYR 1B0PA 4P7JA 4RY9A 4COOA 1TT5A 1SCQA 2A5YB 1V7ZA 1D2RA 2BONA 5EJ9A 2WB2A 1E3JA 1E5LA 1YHYA 2VF5X 1X94A 2ZJBA 3L77A 2PZKA 3RIHA 3O3OB 3ZGVA 1V1MA 1UWVA 1ST3A 4IDOA 1KC1A 3AR7A 2I7DA 2Y0EA 3BICA 4MYRA 1UXGA 4PO3X 2OZLB 1O6ZA 3QTTA 4LWZA 5HUHA 5LLTA 1J4AA 2Q2OA 3SP1A 4CQMB 5KVSA 3IP6A 1OBOA 3MEQA 2ZANA 3GNLA 5E9QA 1GAEO 1PT8A 2VF8A 4I50B 3K1YA 1TPZA 1S1MA 4F3CA 1Q6ZA 1FFYA 3LQ4A 1E6EA 1RBYA 1SPXA 1IK6A 3UWPA 2ZBVA 5EXEA 4BX9A 2IW3A 3G8CA 1G21A 4O4IB 4IEEA 5J2TB 1Q12A 3CUVA 5K99A 3LHKA 1KJZA 1K63A 3FDFA 3IUBA 4FYKA 3KD3A 4UE3S 4P8RA 3KZKA 4DDUA 3ZVRA 3I72A 3KJFA 1KQ3A 1QGZA 4I66A 1PL0A 3D2LA 1LBEA 2FRDC 4QXAA 1YMQA 2CNBA 4WK0B 5AD1A 1KO7A 5JEDA 1I0LA 1XZAA 3G82C 4MV0A 4J2HA 2ZOSA 2JFUA 5EE9A 4PFJA 3T7JA 1MQ8B 2PUTA 5KQRA 5CFPA 2F3QA 1KZ1A 1SVNA 1XE3A 1RKQA 3FJYA 4XUCA 4LYGA 3KJIA 4WXPA 5JZSA 3MTJA 1QPZA 4WL0A 4RZ3A 3IVAA 2Q45A 3KKPA 1IQRA 3V4FA 3I04M 1IOLA 3BMNA 2RH4A 2PUDA 4KW7A 4XSHA 3UV6A 1RAIA 1DADA 1T5HX 1Z4KA 3RREA 1C7JA 5I4IA 4EHKA 3FYUA 4YQEA 3CVOA 4UVDA 1EGAA 2RB4A 2Y77A 3KKZA 3WIVA 2C9BA 2NQTA 3D1JA 2AF4C 5A4KA 3C16C 5JXGA 3RFUA 1Z26A 3K94A 4KMRA 4ZGBA 1XNRB 4JLWA 2UAGA 2I1QA 2IYTA 3R76A 3RTBA 4F85A 3JVIA 4LWPA 4ZO9A 1A5SB 2PVCA 2HRRA 3IDAA 1OI7A 4A0SA 4DG5A 2VWPA 3GUHA 3EBLA 1WKVA 2ZAMA 4OMDA 1KRXA 3FOZA 2R66A 2PT9A 3I05A 3PC7A 2RIRA 3WA6A 5G4KA 3OE5A 2GZSA 5LZ7A 4HDNA 3S3TA 4EW6A 2NQ2C 3Q5EA 1RFGE 4JS0A 2DH6A 5CCEA 1I2MA 5LQCA 1H8EA 1AXEA 3T9FA 4BE4A 1XTIA 3EHDA 3BRCA 3ZVLA 4D7AA 4E3WA 4QFBA 1FFAA 3WFZA 1VG1A 5CLJA 4XUDA 5CU7A 4D3XA 5JS8A 1PJ3A 2FGKA 2Y2VA 4B80A 4KWCA 4LBWA 2GERA 1ZK3A 2Q9AA 4BBAA 1YQTA 2GRAA 4MI6A 1WVGA 3HDYA 2PGXA 3D4PA 4OB7A 3TZEA 3VDQA 1C4XA 3ZG6A 1SUEA 1Z6AA 2HI0A 1BQEA 5T64A 2W8BA 5IDQA 3CH5A 1AHNA 2BM1A 1GA1A 3GFFA 5C3MA 1RWPA 5K0GA 4BNWA 2ZU0C 2Q3BA 3UJ9A 3I9FA 1N6OA 3IAM1 1E79A 3NRCA 5EC8A 3UG6A 1HL3A 4ARIA 2C20A 4AS1A 4Q7MB 1JFLA 4PRZA 4QUHA 1GR1A 1U1EA 4J6FA 1FDIA 3CY6A 4P3NA 1XK6A 2J3JA 1DE0A 1JB1A 1UJMA 2FGJA 1RLUA 3IA2A 3TLZA 3U7QA 1PF7E 3OJLA 4TKVA 3HYTA 4A36A 3U7IA 3OZAA 1MPTA 1WEHA 4NJMB 5EIOA 5FH9A 4WLNA 1ENYA 1S9DA 3K9NA 4R31A 2IZ6A 4ZOQI 3DVRX 5T4EA 4NESA 1NWCA 4Q47A 4HRYA 3OF2A 1RADA 2O6HA 3CWCA 4KYIB 2XR1A 1F3LA 3ZW7A 2ZIZA 3G2HA 1BWRA 1JAYA 4FE4A 4YO7A 2HPZA 2HSGA 1XF9A 1XKLA 2BFEA 2PKCA 5DLQC 1MMFB 1NASA 4WLFA 4KR3A 4X62B 2E5FA 5EUBA 5C1PA 2XUAA 5DSXA 3RFTA 1K86A 5BRAA 4RSRA 2XYHA 5H59A 1H85A 2Q1UA 4JT2A 3UUGA 2YWJA 3A25A 2YHIB 1FW6A 4OL0A 4ALIA 4RTQA 4J0DA 1D4ZA 2Q3FA 3AVYA 2X19A 3HXMA 2COKA 3IELA 1QQTA 4V0QA 3WBJA 2GYUA 5FAKA 4FQ7A 4PLFA 2BBOA 2ZJ1A 4WCDA 1LDNA 4X97A 1A96A 4FSXA 2VUUA 5REQB 2IYNA 4CDGA 4PV7A 5CFZA 5EKSA 3RBZA 1PLKA 2YJTD 2BH2A 4A03A 4BFLA 4FOPA 2GLXA 4F8JA 1CDZA 1R4NA 3MT7A 5TMPA 2F3PA 3OT5A 1DIRA 5FUWA 1NI4A 2WPNA 3RTEA 4AROA 2WQ7A 5LLDA 3G88A 1ICIA 1TM3E 1U7XA 1SC9A 3S1LA 4GX5A 4NYJR 1GPDG 3MTDA 1Y5IA 3GDGA 1GRRA 1XXHA 3AY6A 3L6BA 1SOAA 3EBPA 3MGKA 5CMLA 3WO0A 1I7LA 4B3IA 4ZYUA 1O54A 2XVMA 3AFNA 4M1OA 1WHTA 2QJTA 3L1JA 3MJEA 2CVPA 2WHPB 3E9CA 3KYDA 3U1VA 2F1IA 2JEYA 4JJEA 5EEHA 4D82A 2ZP1A 4GLFA 4YT2A 4UOZA 4LNAA 3JR7A 4N49A 4K6GA 3N0RA 2CK3D 3DA8A 3L0CA 3MFYA 1JZTA 3VR6A 1DC3A 4RHYA 4LTMA 4F3YA 4PSDA 4HS4A 3JZIA 2QZPA 2D06A 2GYYA 1KZ9A 2JHCA 3NM6B 1OFVA 1GZUA 3O8BA 3QLJA 4FGZA 3N2YA 1E8DA 3GV0A 3CUYA 3B6ZA 5DRYA 4EB3A 3QVKA 1TJ4A 4MKGA 2FQXA 3TBKA 3BMCB 4HDRA 1V6SA 4EF6A 2BJVA 2G8NA 4J7XA 4ZRMA 3FMIA 2IXTA 2HPVA 2XYGA 1BKSB 5DNVA 1F2TB 1KAEA 3HBAA 3BVPA 4N4AA 5EPOA 4W7SA 2Q2VA 3T3IA 1XWIA 2J9GA 4MWCA 1CQXA 1NXWA 1ZK2A 3KVVA 5CB4B 2AZDA 3I0NA 5E6SB 4AXBA 1T15A 1LS6A 4V0NA 1WXFA 1RXIA 1JDZA 2IDZA 4GVXA 4GR4A 2E9SA 5JCXA 1TF7A 2R8ZA 1E4VA 4LDNA 4YCBA 1EDBA 4LHWA 4ER7A 5EQTA 3QI7A 4CLDA 1Y80A 2YL2A 2NSJA 3CN7A 1AKVA 1U6KA 4FCVA 4K3UA 3AB7A 2DFVA 3V7NA 1CLEA 3QEMB 2BWJA 3C2QA 5AW6A 3Q87B 2DT5A 1OX6A 2J30A 3G5UA 3ZLVA 1V7QA 1UZLA 3M4ZA 4YMVA 1K5DA 1SVIA 3JAKA 1P77A 3SJZA 1FLVA 2GAJA 1KMCA 1UJ6A 4TMFA 4XUGB 3TCKA 3CCCA 4EUEA 1D1TA 2B6NA 4DYHA 4ZANA 3BIJA 3OD5A 3EZ2A 2D59A 5MN6A 1QH8A 1CF2O 1FYEA 1AO3A 3MWKA 4NCXA 4ZC8A 3JQGA 2IGBA 3OQIA 4YS6A 3VYVA 4RGQA 3OBIA 4A0GA 2XBUA 1VBNA 2QVCA 1HEIA 5EHIA 1F8FA 1PG2A 2CVFA 2VNKA 3E0QA 2ORWA 2CLLB 3NATA 4QD3A 2FSSA 3LAWA 5EQDA 4B6OA 2MHCA 2JIBA 4HRAA 2MSDB 4HBZA 5AICA 3LZDA 4M8IA 5TPZD 9ATCA 2Z3WA 1EU1A 3T1HB 5IDXA 1KSGA 4BJHB 4QC2A 4N3GA 1DEOA 3P2YA 3I8SA 4DZZA 1AQLA 3E27A 2CMFA 3BZWA 1GPAA 4GPD1 1E6LA 4Q3BA 4DCVA 1U2SA 4CDNA 1TD9A 4C14A 1A2BA 3FYTA 1REQA 4WK6A 2WHQA 4QU9A 5AQ1A 4JV5B 1NBAA 1YB6A 4BXOA 2GJSA 2UDPA 4MWTA 5DGIA 4C5AA 5ELMA 3GJ6A 3OICA 4HEHA 2OZEA 2PANA 2A9QA 3E58A 1R12A 1DQYA 5SY4A 3ZV6A 1ABEA 1L5VA 3RAGA 3ZGXA 3QVWA 1GZ5A 2FR0A 3TQRA 1RAGA 4I9HA 2IQIA 2F64A 1NSFA 1BFKA 4FYIA 3E15A 4EF5A 5JWRA 2JW5A 1U0NA 4DG8A 3QUQA 3PLRA 3LG2A 4DLYA 3KXLA 4OGWA 2WTBA 4G1VA 5HS4A 4PSVA 5D8DA 1ODJA 1JLLA 1ISPA 3FZYA 5TF4A 1XJ0A 2NYUA 4U2EA 5DB4A 1YZFA 3H05A 4RLFA 2HCRA 3QF4B 1RE1A 2AS0A 2IY7A 4JQYA 2GUGA 1CFZA 3AERB 2EBWA 1RVDA 1JKJA 3CQ9A 3K96A 3NAZA 4HWPA 4RPHA 4B76A 4UMDA 3D8RA 4L16A 1LI5A 1PIWA 1X1AA 2ZAYA 4BO6A 4KFSA 4N7JA 4FGUA 4YUVA 2H2IA 3ANYB 3H2YA 4G8CA 3THSA 1G41A 1E1CA 4IKEA 4MI1A 1H9CA 4PLPA 4HZIA 5DV9A 1ND6A 1PJ8A 4HFRA 1S8AA 2HSZA 3M89A 4UZFA 2FK8A 3CGWA 3HUFA 4II3A 4WXEA 4L8YA 4GLLA 3IB3A 5ICFA 3AG6A 2J7PD 3PQ5A 2ZS9A 3EVTA 2COEA 1H93A 2LNDA 2P78A 4M98A 4BO2A 4M0LA 2PXHA 5I9MA 3EZYA 1HE3A 1IHPA 3OIUA 5HA5A 4ZHQF 1SVUA 1FS6A 5J4LA 3FNQA 2P3OA 3OE7A 2R1ZA 1GQRA 3JWIA 3OQHA 4GZ3A 4K9NA 3A1VA 1W88B 4RGVA 4C7XA 5GOZA 4F6RA 2XUHA 4ZO4A 3FSGD 1CUDA 2PFSA 4XWAA 5F1PA 5TMEA 3U4CA 3ZNQA 4PAGA 4EI9A 4GXQA 3JD1A 4U4AA 1U9JA 2E6KA 5LL6P 1DTSA 3ZC3A 4HCJA 4M0DA 3PITA 1P1BA 1Q17A 1NHGA 2FEMA 3OKCA 2CLDX 4XX1A 4GKAA 4AKEA 3DPSA 3QLEA 1GLGA 1Z8FA 2BM0A 2FFAA 2MYPA 2X0JA 5JAMA 5B7PA 1AN0A 2G9UA 3VC7A 3I5YA 1NZJA 4KQIA 4C4XA 1CP2A 5KNCH 2H1RA 2FV8A 2BFMA 2Y1XA 4IUYA 3L0IB 1RAHA 3DCIA 3TW6A 3FPEA 3NOOA 4YPVA 4QHTA 4C7OA 3ZGZA 2HWXA 4S3MA 3OQNA 3RRNA 3FLEA 4YC7A 2G63A 2VA9A 2OXTA 1G20E 3A37A 5HKKD 2FZCA 4RHXA 4PO1A 5ES3A 1SC3A 2XJ4A 4M8SA 4IQGA 2YWEA 1GXSB 5AM4A 2A5JA 4CT0A 1RMTA 2CBZA 1IFXA 1YVEI 2OCXA 4FFWA 4A91A 2G3YA 5BT8A 4LRUA 5KYWA 4NU8X 3KT6A 5HEKA 3RUIA 2DWPA 1ADFA 2JKZA 3CX6A 2EU8A 2GXSA 4MVJD 3PUVA 1FJHA 3DNPA 4XR4A 1TM5E 2C7PA 4LI0A 1Q19A 2GPJA 1QQ5A 2ZT7A 3DWEX 2GEFA 3GDOA 3KWJA 4HQ6A 4IDDA 5HJ5A 3O1IC 5DYWA 3MWYW 4D3DA 2CLCX 2QGNA 3EIHA 2ZTHA 3G2IA 1EFTA 4IZHA 4PGFA 4IG4A 4RWEA 3QPCA 2Y1EA 4NH0A 4IV8A 5TEVA 1V47A 1NMXA 1KO8A 2ZRJA 1ZDMA 1JFRA 1PUIA 3EFOA 4WKGA 5CX4A 2YICA 4LFBB 3SSOA 1H0RA 1EJ2A 1O2DA 3L7DA 1J0XO 3WLEA 1R0KA 1ISIA 2GRJA 3RSSA 3T1NA 2CK3A 2G36A 2V9PA 4XGIA 3JTMA 3T7IA 1OAKA 5K05A 4Q9DA 3IP8A 1NKVA 4CM3A 1N7GA 1IY9A 3OFKA 3OY7A 4JB0A 5E3JA 3A32A 3LUDA 1JI0A 3W2GA 4YX9A 5CB4A 1W0CA 4X66B 1KEWA 3F73A 2UYOA 3ESBA 3LLSA 1YXMA 1Q0UA 2J3LA 2FUCA 3AR5A 3N5KA 5LBTA 1UJ5A 5LZ2A 1ZD3A 5B4UA 1K3UB 5JMPA 3PWZA 2C78A 2NTNA 4HVCA 4EHHA 1CE8B 4NMLA 2NV2B 3AKDA 3GLTA 3UTDA 3ZDQA 4Y2QA 3V8QA 3W0LB 1EHIA 4Q5IA 5DYGA 4BN4A 3E8SA 3DHEA 1G8MA 5D87A 1A2OA 3ZQKA 3H86A 2GK7A 2ZYGA 2FPGA 4EFDA 2VQSA 3CXRA 3PNBA 5EIXA 1BDIA 1EGHA 4EG4A 2JGDB 3AUFA 4AF7A 4OXIA 1OA0A 4MGEA 5I45A 1VIYA 3QU2A 4LGCA 3K73O 3T9EA 6Q21A 1RIIA 2HBQA 3MAGA 3KQMA 1UC8A 2G28A 3MYRA 2AGVA 4ZEWA 2NZ2A 1AG9A 2H1SA 1VGQA 2X6TA 5L7TA 5CH3A 1SCUA 4R2KA 1ORRA 2PRSA 1E2JA 4PZUA 3F71A 3BHMA 2V8BA 3FCCA 3VOAA 3WFJA 1M75A 4OK6A 4CCYB 4ZDIA 1C1DB 3L7YA 1MOSA 2ESRA 4I50F 3JQ8A 3O8QA 2GASA 1A5ZA 1ADGA 1VECA 1XRPA 2RAFA 4CETA 2C7GA 2CNKA 4W5QA 5LMUB 3K35A 2C94A 2GXQA 3WMEA 1QHFA 3P9XA 5IVIA 1DAPA 3QVGB 4NWIA 3KT0A 4L4YA 1ORVA 2Q4DA 4MV6A 1YQ9A 4J76A 3ASZA 3AIKA 4X3PA 4IZ6A 2E18A 4S04A 1D2GA 1H4QA 1E1YA 1DJQA 1P0IA 1I6KA 4M37A 1FNSA 2WKQA 5D1NA 2ZQYA 1UL1X 3GOHA 3G7NA 3QU5A 4CIDA 3H99A 1DMRA 1ZMRA 1N3LA 4XB1A 1NW6A 2P5UA 2XAUA 3TG8A 2IPNA 3OPNA 3CSUA 4LMRA 5BSGA 4BGDA 2DKFA 1RJ9B 3FWNA 2V6FA 2UV8A 3NRJA 4RO0A 3STWA 4B43A 1FP1D 1BXKA 3H1FA 4UHDA 1AA9A 3LYLA 3TVTA 3UKOA 2FSFA 4WBNA 4IJKA 3BD8A 2O3UA 2EGUA 3A6EA 2O3TA 2QRZA 4DJTA 3SSNA 4DS3A 3IQGX 1PYDA 3VNBA 2I80A 1U8XX 4LZPA 1ZK0A 1IVYA 3T5PA 2PMCA 3GJRA 3UA3A 3MT9A 1Z63A 3AVOA 1Y82A 3EE6A 1J9EA 2HJVA 2B21A 1B2RA 4MVCA 3ZV5A 1DSSG 3DVQX 3IXMA 2JD1A 1H1LB 3R0JA 4N0QA 1N2CE 1R15A 2G40A 1A72A 1FMTA 3KSDO 3Q6IA 4KDFA 3R5TA 5FUYA 3R9KA 3TVYA 5I9IA 1LNSA 1HYGA 1P17A 4S2UA 3C1TA 3JAWB 3UJPA 4EJ2A 4J2OA 2UUAB 1FRVA 2PWAA 3F6CA 1KBOA 1BCRA 1LWOA 2GNOA 3LPNA 3UT0A 1C8BA 4LEIA 4YP1A 3UHJA 2ENUA 2FSIA 3KBBA 3T41A 1TU4A 4WFJA 1SVOA 1XRMA 3QPBA 5IJ0A 3D6HA 3MWEA 3WMFA 1RQGA 2FYTA 2WU0A 4NJMA 1JQLB 1DXYA 1E4OA 1VL5A 4A0HA 1M2EA 5B57C 3CNNA 1QFXA 3A31A 3BJEA 1H8ED 1XZDA 2F6RA 3MWDA 4PPFA 8OHMA 4OQDA 2H3EA 3CW8X 4HUQB 2VH1A 2OFWA 4GPZA 2C7BA 5IFLA 1I01A 4O0LA 4KO2S 4RK0A 2B9EA 1LRJA 1MB9A 5EFOA 4ZQFA 2RC5A 2E1RA 1C7RA 4KZPA 3MRVA 2D1SA 3BAFA 1KL7A 4NZNA 4MVJM 4WKOA 2FSUA 2VXOA 3OTHA 3JYOA 1B6TA 4Y1FA 2NU6B 5FD8A 1GKKA 3D9QX 5B4VA 1AO0A 2WZDA 3PNPA 5ADWA 3U7FB 4ZHSA 2HJHA 3ELBA 1LPOA 5JBQA 1PLLA 1XQWA 1C14A 5GPBA 4X64B 4F1WA 3D5TA 3RYHA 3CN9A 4TTSA 3QI2A 4GI3A 1SXJA 2P6UA 1QIGA 4FEEA 1U8AA 1P80A 2GQ0A 3OTOB 1EG2A 1O96B 5IJXA 3ZXSA 4NJOA 3GRZA 4KV9A 1KIMA 1Q0QA 2UZ4A 4NL4H 1SCDA 1TADA 2ZTUA 4ZI7B 2VLBA 3I8XA 2O0HA 4ZJZA 3R7AA 1JJAA 3GJ3A 5D3MA 1ZY2A 4JP2A 3KQSA 1FFXB 3S1AB 3VR2D 4DILA 4TRRA 4XIGS 1EFVA 1Z5GA 5DJ5A 4F3RA 1Y3DE 4NLLA 5CVTA 3P1JA 4N01A 1XTRA 2SECE 1QP4A 4MUGA 1WX1A 1EVLA 4R1UA 3DBHB 1NJFA 5EHQA 1V8BA 1NP6A 3FUXA 4Q19A 3VTZA 1SXJB 4L0QA 4W9NA 2GZRA 1G8KA 3ABRB 1O08A 4XD7D 4B7XA 4TYWA 4HAWA 4FHEA 3QVMA 3ZK8A 2EEZA 2ENWA 4CMKA 1YI1A 1YA8A 3N0WA 3NTRA 2NLOA 3W6NA 3HVHA 1PTKA 1RYYA 3I92A 3HRHA 4FNMA 4BBJA 4IRUB 1Q50A 3H5RA 3LDFA 5KSWB 1SOMA 4YP7A 1NLFA 5BQ3A 4W8GA 4K6OA 2O8VA 1JLMA 2O4CA 4WUTA 1Y9DA 5FBHA 4BLTA 4L3VA 4XWOA 2NIPA 2A67A 3REQA 1XEWX 2LGJA 2G6BA 1TJPB 5BSMA 1WHSA 2JCXA 5CB8A 4M0KA 5JZVA 3DB1A 4BUZA 4CMEA 3F8TA 3NWOA 6NULA 1Z08A 4DKJA 3M6LA 3LQKA 3NLLA 5EMJA 1EWKA 3V4LA 2YXNA 3DPIA 2EV9A 2IHJA 1L9KA 4ECAA 4L4RA 3H9UA 3BSFA 1YVUA 3MGBA 2KLBA 1JAXA 4N5LA 2BTQA 1T0HB 2BE7A 1D6JA 1DQRA 1QE5A 1LJ8A 2R11A 3QXGA 4OQZA 3R0ZA 4YLGA 4A8PA 4X85A 2AG6A 2R62A 2WTMA 4OIMA 5KKNB 3Q3IA 1KAMA 1MR3F 1PZGA 1ZUD1 4J0FA 5KYXB 5J2TA 2I91A 1W46A 1FDRA 3SDSA 2WUFA 1T5DX 1X1BA 2PLWA 3AUJB 2A33A 3K8YA 2J31A 4MYSA 1AQJA 4C5CA 3SIWA 5CM2Z 4OX9Y 2G25A 1E9BA 1E6CA 3KJZA 5EKDA 3Q8WA 3OPVA 3ROEA 4CMEC 3CEPB 1AJEA 1U65A 2J32A 4V2IA 4N6GA 1HETA 3O8LA 5CFQA 1B6GA 3QELB 1EK0A 3O94A 1QDEA 1SUBA 2AOWA 1VYTA 4DLUA 2LZ0A 1T8TA 3KUCA 4I8DA 3TMYA 3OOJA 1PFGA 5IANA 3MRSA 3KB8A 4PNZA 4CDMA 2FOXA 3UJBA 1XLWA 2IUYA 2NYRA 5JC8A 2ABWA 3TUZC 1VSUA 4WN9B 5KHLB 4YJ2A 2QJOA 1OWLA 2A14A 1FXWA 3NWPA 2YRXA 3QBTA 4LJ4A 3SHTA 2OWDA 3VPCA 1I3KA 1UEIA 1JIQA 2W9XA 1A9RA 3ANXA 3EQ9A 1DBVO 3GLSA 3C3KA 1P1IA 4QXMA 5D2CA 1WQ4A 2P0EA 2QX6A 5FHQA 4IZIA 3TOVA 4H60A 1LPMA 4CNBA 2O06A 4J0KA 1SBYA 2Q3LA 2Q7OE 4MUEA 1KEUA 1TOAA 3CVVA 2G06A 2DHDA 3LFUA 4F8YA 3CNHA 3UAGA 4IFIA 1JIUA 1PHPA 1U8UA 3A6HA 4HYEA 2ERXA 4RSHA 3WKBA 1DL5A 2Y1LA 1E7WA 5D3KA 4ON9A 1RAAA 3QIAA 1JPJA 1VJ5A 5DBEX 1V0JA 1VCHA 2A9PA 3JVEA 4LXXA 1OZ0A 1KMHA 3KG2A 3EVFA 3TJRA 4HMQA 4TXJA 3BREA 2PH7A 1QHEA 2JGDA 2V59A 1Y6JA 4KACA 1IEWA 1E58A 4B31A 2QSUA 3BIWA 4TWJA 3N74A 1B3BA 3V8BA 3WGJA 5G0WA 5BW6B 2XQJA 1QO0D 2PX2A 1TCUA 2JIZA 3FVVA 2XI4A 4EQZA 3V4RA 2B30A 4J1TA 3AEQA 4XWYA 4UMEA 3ZS9A 1BNCA 3M1IA 1J5XA 4EENA 5C1IA 3RS0A 1AIPA 4J9VA 5L4LA 1AH2A 2ARKA 2QTGA 2JATA 3QG1A 1YIDA 1YMUA 3KUUA 4ZV4A 4M9ZA 5DT9A 4HN9A 4JC4A 3KB6A 2GCPA 3OPMA 5FTJA 3CF2A 1R5OA 1U9YA 3COPA 4KJZA 5DM0A 3CKKA 3FTCA 4EKIA 3C98A 4FINA 3AUUA 2WHRA 1WMDA 1EFLA 3NYWA 3G02A 4MW2A 1ZRHA 4TSFD 5JWOA 4O5OA 4CF7A 3NHAA 1GPUA 3DLHA 2JGRA 2R4UA 2K2WA 2ILTA 4Y0NA 1YS9A 1O6FA 3AT1A 1EUZA 3COVA 4E30A 1AMNA 2LWIA 3PKIA 5CX1A 3TTUA 5PGMA 1T1EA 1XCPA 5DYYA 1E69A 1ZIPA 2OORA 4E2WA 5A9RA 4TV9B 1UBCA 4X90A 2D13A 2IC5A 3NBMA 5C52B 5COQA 3HH8A 1J39A 1IUPA 2RSLA 2C2OA 2JVIA 3WWYA 1X9HA 4PC7A 1RP1A 1UM9B 4TOIA 4NENA 1GRCA 3EZ9A 1QYXA 1Z37A 2CDNA 3PRYA 1VJ0A 1M7GA 5IULC 1DOZA 3OOSA 1GXSA 3A1UA 3LJKA 2V7WA 2G1AA 4TWZA 4ALMA 4E21A 3QYJA 1QXSA 1YS1X 1NR7A 2OCPA 3QZUA 4HNUA 3UC9A 5ICCA 3DZCA 4UMFA 4G01B 3B6MA 3Q40A 4GX2A 3PPYA 2MCFA 2FEOA 2GMWA 2VRCA 5TXGA 5JU6A 4JC8A 5D85A 4KYUA 2PJZA 4HKTA 5JAZA 1Y42X 2WIFA 3FNRA 1HYEA 3Q9SA 4MEJA 4MQ5A 4ZAXA 3RJ5A 2EL7A 3EVDA 4GECA 3KDSE 2GJ9A 5DTQA 3ROKA 3TECE 4MMXB 2C5EA 3C41J 4KRXA 4FPXA 2CFRA 3ROTA 1VMIA 2P3LA 3QH4A 5G40A 3R7WB 4WZAB 1F20A 4MQFA 1PR2A 2RBKA 1RC1A 2QYHA 2EIXA 4BNGA 3HVIA 3KQKA 3BK1A 1QK4A 2ZIWB 4KZKA 1P18A 4UHKA 1ZBDA 2QE7D 4ZI5A 1KU0A 2DQSA 1YSCA 2HB6A 3P52A 1R0BA 1UKBA 1L2TA 2J07A 3EIWA 4LY9A 4U7PB 1Z68A 1AUQA 1ESDA 4M8KA 2NVWA 1U3WA 2WM9B 2FMKA 5BWOA 3O2SB 3SXUA 2JIMA 3C3PA 1GL9B 1GY8A 2J59A 2Y0DA 2CEKA 5EUQB 4FT2A 4E08A 4EJMA 4X54A 1Z0SA 5I7RA 5K0EA 3TN7A 2IJGX 3IBTA 2B7BA 3C8MA 5CFOA 1IIRA 4TZKA 1EZZA 1X7ZA 1TMGE 2HU2A 3CPEA 4TVOA 3LCMA 4FE7A 3EDQA 4DQUA 1CETA 1KTVA 1A88A 3AEYA 3PICA 4BMYA 3EZLA 3LDUA 4DNXA 4MUJA 5CG2A 4XJSA 3PNQA 1EVJA 2I4TA 4RDXA 3PF8A 4KO8A 5DWDA 2I4LA 3JQFA 1M6YA 1SHLA 3F4KA 3P0RA 4GRAA 3QP9A 4CLOB 5BSHA 5LIPA 4N76A 4X24A 2PZLA 1EZ1A 1O94C 1FNMA 4B3FX 1KDOA 2PS3A 4V39A 4C1NA 3LTNC 1DDGA 5AVOA 2AXPA 2IYWA 1F4PA 3LGAA 3JWGA 4LV8B 4CM8A 2QT0A 2JHGA 2XRMA 1WF3A 3AVTA 4AO8A 5H02A 3RC3A 3L6OO 3OOWA 2WB4A 3VR4H 1I6MA 4MVXA 3HR8A 3B8HA 4KSYA 2XCUA 2ONJA 1DB3A 2ONCA 5LKRA 5E7JA 3C74A 4GEGA 4N40A 1GPKA 1O95D 2L69A 2PJUA 4HAVA 3B7PA 3WNBA 5DEOA 1VL6A 2C3PA 4KO3S 1NFFA 2XF8A 5LQDA 5DGTA 4Y0AA 4YAIA 1OT3A 1UC5B 4MR9B 1G63A 2Q29A 1R50A 2QJFA 3F67A 1NONA 3IQZA 3F7M