2HV9A

Encephalitozoon cuniculi mrna cap (guanine-n7) methyltransferase in complex with sinefungin
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
248
Chain Sequence
SKTINIRNANNFIKACLIRLYTKRGDSVLDLGCGKGGDLLKYERAGIGEYYGVDIAEVSINDARVRARNMKRRFKVFFRAQDSYGRHMDLGKEFDVISSQFSFHYAFSTSESLDIAQRNIARHLRPGGYFIMTVPSRDVILERYKQGRMSNDFYKIELEKMVPMESVREYRFTLLDSVNNCIEYFVDFTRMVDGFKRLGLSLVERKGFIDFYEDEGRRNPELSKKLGCLTREESEVVGIYEVVVFRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA cap guanine-N7 methyltransferase
publication title Mutational Analysis of Encephalitozoon cuniculi mRNA Cap (Guanine-N7) Methyltransferase, Structure of the Enzyme Bound to Sinefungin, and Evidence That Cap Methyltransferase Is the Target of Sinefungin's Antifungal Activity
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transferase
total genus 90
structure length 248
sequence length 252
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03291 Pox_MCEL mRNA capping enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2hv9A00
2PX4A 1JG2A 3F4KA 2I7CA 3LX6A 2IIPA 3UJDA 1B42A 1G8AA 2YVLA 3HCEA 5FCDA 1JG1A 4YUWA 5K09A 1G38A 4GQBA 5LQKA 2ZCJA 2EG5A 5C0OE 3TOSA 5KQSA 5DXAA 3OPNA 3P8ZA 5C9ZA 5ICCA 3GRUA 2Z6UA 4FT2A 1MHTA 2JHPA 2ZFUA 5FHQA 4HTFB 3FUWA 4E2XA 3PTAA 2QE6A 3M6XA 2G1PA 1P1BA 2OZVA 3R24A 1KPIA 3PFGA 3HCFA 3O4FA 3UJ8A 1X1BA 1YF3A 3FYCA 5FWDA 4AUKA 4IV0A 4DF3A 2PT6A 1NE2A 4AZVA 3UJBA 2I62A 5HZMA 2H11A 3VSEA 5LQRA 3NWBA 1FP1D 3CCFA 4G56A 3M33A 2BR3A 5DT2A 4RVDA 3G5LA 2JJQA 3MB5A 2A14A 2VS1A 1JSXA 5HILA 2EX4A 4O29A 3DXZA 4L7VA 4RVGA 2P3QA 4LWPA 1QANA 3GO4A 3KR9A 1XVAA 1ZGJA 3GRZA 5GM2A 5MHTA 5EGSA 2ERCA 3M6VA 2ZVJA 3B5IA 1M6YA 3LPMA 2PWYA 1X1AA 2AN5A 1QYRA 4RTOA 3SR4A 3DMGA 5F2NA 1FJXA 2ZBQA 4H0NA 4PGGA 3Q87B 3A4TA 4QDKA 5DRTA 5CVDA 1SG9A 3VC1A 4P58A 2NXJA 4MQ4A 1RJEA 3FZGA 4MHTA 4YUYA 4KDRA 8MHTA 3T7SA 3NWEA 5DX8A 2WA2A 4AX8A 3ER8A 3HVJA 5P8WA 3MGGA 3VYWA 4GOND 1L3IA 3KQOA 1BHJA 1HNNA 3CJTA 1DUSA 3KQTA 4PONA 3EGIA 4WVLA 4GEKA 5ICGA 3TLJA 5LQAA 4ZTBA 2ZWAA 3AXSA 2PLWA 2EJTA 3HVKA 1QAQA 5CM2Z 1FP2A 2O06A 3BWCA 3KQSA 1XDZA 4Z2YA 3SM3A 2YUIA 4A6EA 4PYOA 3C6MA 5ICFA 2B25A 2B2CA 3MQ2A 5EIFA 5EHIA 4LECA 3PB3A 2NP7A 2UYCA 2PSSA 9MHTA 2E5WA 5DX1A 3KQWA 1D2HA 3DUWA 5EMMA 2XYRA 5EMJA 1NW8A 3UJ6A 4E2ZA 5EEGA 4LG1A 3I53A 4CXMA 5D1HA 4OX9Y 3ORHA 4U7PB 3EVAA 3MTIA 2CMGA 5K0LA 2H00A 3X0DA 4FGZA 4K6MA 2YXDA 5FWAA 4FT4A 4BP1A 3EPPA 5CVVA 4E30A 4ER6A 2IDKA 3JWJA 5LQCA 4RTNA 3ER9A 1JSZA 4RTLA 2FK8A 3U81A 3ERCA 3K6RA 3I58A 3MCZA 5DWQA 4RTMA 1TW3A 4POOA 2IDJA 2YXEA 4PCAA 2PV0A 5FA8A 3R9XB 1PJZA 5BW5A 3GIWA 5CVJA 3LDUA 1X19A 2B9EA 3G88A 3IHTA 3KHKA 3BUSA 3KQVA 4HG2A 5K0NA 2UYOA 4C4AA 1KYZA 5CIYA 3GNLA 1JQ3A 1SUIA 4XUEA 2R6ZA 2IBSA 3DLCA 3GDHA 4YUVA 2O07A 3UZUA 5EZQA 5ERGB 3FUUA 4RTKA 1X1DA 2UYQA 4FZVA 4E2WA 4CTKA 5E8JA 1NV9A 5HOQA 2GH1A 3THSA 3KPWA 3EEYA 3CGGA 5HIIA 5EKUA 3SSNA 4ER5A 2G8NA 4QPNA 1NV8A 4GOOD 2ZIFA 3DULA 3EVDA 5DM1A 3AY0A 5FADA 3D2LA 4C08A 4CKBA 2BR4A 3CVOA 5GOZA 1M0EA 3P97A 2P1DA 4YUXA 1IXKA 5FULA 3I5UA 3NW9A 5U4XA 3UJ7A 3DP7A 1SQGA 5E1BA 2CL5A 3Q7EA 3KPUA 2BR5A 2GS9A 4Y2HA 3B7PA 3GRRA 3GRYA 3OU7A 3HCDA 3DTNA 1RJGA 1P91A 2AOWA 1X1CA 4R8SA 2Z6QA 3ELWA 2AN4A 4C07A 2OKCA 5EMLA 4V0QA 4RTRA 2UZ4A 4CWAA 3CJRA 5EQJB 3OFKA 5E1OA 3NVKI 5EG5A 4QQKA 2PGXA 4YMHA 5CCXA 3G2MA 4RV9A 5DXJA 2O0LA 1JG4A 1R18A 1ZG3A 1YFJA 3PX2A 1N7JA 2NYUA 4PIPA 1N2XA 2AOTB 5LR6A 3FRIA 3UBTA 1RI3A 2ZZKA 4QDJA 3SSMA 3DXYA 3LHDA 4QTUB 4RWZA 5KS2A 2VDUE 1QZZA 3NDIA 5EVJA 3KR1A 3T7TA 2Z6AA 3EEOA 2R3SA 1XXLA 1RI5A 3G2PA 3AJDA 5DTQA 2YTZA 1P1CA 3RIEA 2HNKA 3RW9A 4C04A 2YXLA 4IWNA 3LDFA 5K8VA 4RTJA 4GC5A 1ZKDA 4EQZA 2H1RA 2O57A 5EZSA 1BC5A 3EVCA 4OA5A 4WXHA 3H2BA 4PYLA 3P9IA 4GUAA 1TPYA 2P3LA 4PNEA 2XVMA 3OCJA 5FQNA 2OB1A 5GP1A 5HIJA 1XCJA 4KW7A 4BLWA 3P71T 1ZGAA 3HTXA 5K0CA 5LQUA 5K03A 5K0GA 2OPBA 4R6WA 4DKJA 2IFTA 3QV2A 1YZHA 4IV8A 1DCTA 2JG3A 3C6KA 3DR5A 3OE4A 1R00A 3FPJA 1P39A 5DLYA 5H02A 1HMYA 2QRVB 3ELDA 4R6XA 2ADMA 3LCVB 3P2EA 4MIKA 4RYLA 4DA4A 3OZRA 2YQZA 5DPMA 3TKYA 4C06A 2DPMA 4X63A 5K05A 3P2IA 4DM3A 4CKCA 4DQ0A 2ESRA 3UJAA 3HCAA 1G6Q1 3KQQA 3LCUA 2C7OA 4YV1A 3DLIA 3JWHA 1VQ1A 1U2ZA 3FUXA 3CC8A 3DMHA 3OU6A 3ELUA 5GIOE 1YFLA 5T6BA 1O9HA 3M70A 4RVHA 3TKAA 4PYQA 4KIFA 3HNRA 4GOMD 1T43A 2I9KA 3UJCA 3HCCA 3R6TA 5IH3A 3KQYA 3LECA 2ORED 4RTQA 1BKYA 1WXXA 5LQNA 3EVBA 3G2QA 2ZZMA 3KU1A 1XJ5A 3KR0A 2JH9A 1YUBA 3A25A 4KIGA 4R8RA 5CCBA 3SGLA 2EJUA 4DZRA 2PXAA 2ZBPA 5E1DA 1D2CA 5CVEA 2HMYB 3TM5A 2B3TA 3BWBA 4RX1A 4EMSA 3LKDA 1FBNA 1IY9A 4E32A 1XDSA 4P7KA 2FYTA 3C0KA 3G7UA 2NXCA 1VIDA 3SXJA 4OBWA 4V0RA 3EVEA 5D1NA 4PWYA 2G72A 2ZIGA 5DRYA 1NBHA 5ICEA 3AXTA 2PX2A 3HA3A 5DM0A 4F86A 1TW2A 4AZWA 4BP3A 2AVDA 4C03A 3EGVA 1O9GA 2JHCA 4MTLA 3TMAA 3KPYA 5HIMA 2FPOA 3GXOA 1L3CA 3DOUA 3G5TA 4M38A 5EHGA 2ZSUA 2AOUA 2GLUA 5KVAA 5GINE 3PLAE 2AOVA 2HWKA 3LBYA 4E70A 3FTDA 2VZ9A 2P40A 3NVMB 1R8YA 2EFJA 1KHHA 3KQPA 4X61A 3GWZA 3MHTA 2Q41A 1EG2A 3TM4A 2PXCA 4EVIA 2AOTA 2HTEA 3ANXA 3TQSA 3CBGA 2ZZNA 2IH2A 3FRHA 1R6AA 3G8AA 1UWVA 4HTFA 2BM8A 3O7WA 5JUWA 2CKDA 5DTMA 2VDVE 3V8VA 1EIZA 3HVIA 2IP2A 3UJ9A 2AVNA 2GA9A 3K0BA 3NDJA 5BW4A 1KIAA 1ZQ9A 2HV9A 1QAOA 1VBFA 3OE5A 1V39A 3UA4A 4BY9E 4Y30A 3OZSA 3BGDA 3GGDA 5K01A 4GBED 5G02A 1RI4A 2AR0A 3MAGA 2F8LA 3A7DA 5BXYA 1NW3A 1SQFA 1WZNA 4M37A 3B89A 3SX0A 5E9QA 2FK7A 1VP9A 1INLA 2NXEA 4CTJA 2V74B 1JQDA 2ZULA 3KQMA 5FQOA 1I4WA 3BXOA 1I1NA 2AS0A 4X41A 5EC8A 5F2OA 2ONZA 4EKGA 3FTEA 1XDUA 4ER0A 4FR0A 1L3BA 1M6EX 3BKXA 4DCMA 1OR8A 1ZHFA 2G70A 2PWPA 3I64A 3LSTA 2QY6A 3E05A 4HRAA 5EMKA 2P8JA 3JWGA 3LKZA 2QRVA 3M6WA 4IKPA 3HEMA 3SVZA 4ISCA 3GCZA 4M36A 2AZTA 4YV0A 3PT9A 3BT7A 3MERA 1AV6A 3T7RA 5M5BA 3FTCA 2VP3A 1YZ3A 10MHA 3C3YA 3FPFA 3T0IA 5HIKA 5CD1A 2QM3A 4RSRA 2BH2A 1XCLA 2C7RA 1RI1A 4M7RA 2JH8A 4HC4A 4C05A 1VLMA 2PKWA 1Q0SA 2CMHA 1KPHA 4GF5A 2P7HA 2ZIEA 4ER7A 3KR2A 3S68A 4QPPA 2ZBRA 2OY0A 2LD4A 2P7IA 3I9FA 4OQEA 2FRXA 2OYRA 4DCGA 2PX5A 4YMGA 1RJFA 2Y1WA 3IYLW 1FPQA 2BM9A 3HM2A 4HH4A 4RVFA 3B3FA 4XUDA 4XCXA 2P3OA 3SSOA 2P41A 3FYDA 5JR3A 2NXNA 3G8BA 1RI2A 3GRVA 3V97A 1RJDA 1SVUA 2WK1A 5E9WA 2IGTA 4PYMA 4QTTB 1EQAA 5EPEA 2AOXA 2C7PA 3R0QA 4FSXA 4OQDA 4KVZA 2OXTA 2IPXA 3EMBA 3TR6A 1Y8CA 1KYWA 4RTSA 1NW7A 3ELYA 1JQEA 5EOVA 3RODA 1IM8A 5E2AA 2DULA 3G89A 4DMGA 5F2KA 5FTWA 4MWZA 1KPGA 4EKIA 4F84A 1VE3A 1BOOA 2YX1A 3DMFA 4X1OA 5LSAA 4E2YA 3UFBA 5LQJA 1YB2A 5HEKA 3DXXA 3P9KA 4YV2A 2HR1A 1N7IA 3KKZA 3O31A 3TRKA 1UFKA 3P9NA 2WA1A 3A27A 2ZW9A 3LCCA 2I6GA 1EJ0A 3HVHA 3G2OA 4E33A 3P2KA 3B3JA 3REOA 2PVCA 1NW5A 2NP6A 1G8SA 2KW5A 3JWIA 3TFWA 4AZSA 1UIRA 3NTVA 2VDWA 3CJQA 3PX3A 3WSTA 2C7QA 3VC2A 3UA3A 3EVFA 3NJRA 1O54A 3BGVA 4FS8A 1R74A 5T67A 1JG3A 5DTRA 2OBFA 2UYHA 1MJFA 3OZTA 5K0EA 4PYNA 3BZBA 1F3LA 4KDCA 3KPVA 3LDGA 5EEHA 2PX8A 1G60A 2ZWVA 3L8DA 3NMUF 4GOLD 2FHPA 4ATNA 3AWIA 2IH4A 1ORIA 3GU3A 1WG8A 5T64A 5KYGA 3ID6C 2XYQA 3GJYA 4F85A 5BP7A 2PBFA 4U7TB 4EK9A 3ME5A 4P7JA 1XTPA 2PXXA 2PT9A 2IBTA 2OB2A 3OFJA 3TPZA 4PYJA 4KWCA 1PRYA 3P9CA 1KP9A 1ORHA 2OO3A 4R05A 4PIMA 3A7EA 3UWPA 2P35A 3LBFA 4AZTA 2GPYA 3PFHA 5EKXA 1G55A 4HSGA 3KPJA 1WXWA 4BLUA 1F38A 3FPEA 3FPHA 3IEIA 3BKWA 3HCBA 2GB4A 3M4XA 3OU2A 2GAFA 4KRGA 3HA7A 4PGHA 5DX0A 5E9JA 1D2GA 2ZLBA 1SKMA 1NT2A 3EVZA 5EIWA 1NKVA 4QVGA 3B3GA 4XUCA 1AQIA 1L1EA 2N47A 4JXJA 4OA8A 4RTPA 2XYVA 5K0JA 4PYKA 4PINA 1KXZA 2JHAA 1Z3CA 2FCAA 3EMDA 4FSDA 3PVCA 5CVUA 1JR4A 1SUSA 4LWOA 4BLVA 1Q0TA 1NW6A 3EVGA 4E31A 5E1MA 4PYIA 3FUVA 3E23A 3BWMA 2ZTHA 4HGYA 3SMQA 4NECA 5FA5A 2ONYA 2B78A 3THRA 7MHTA 3QOWA 2QYOA 4FP9A 4UOEA 2Y1XA 2IH5A 5C1IA 5FHRA 1I9GA 3MTEA 3LL7A 3CKKA 4QVKA 5GIPE 4QQNA 5DM4A 1VPTA 5K0FA 4YUZA 2PY6A 1KR5A 3HP7A 3BWYA 3PS9A 4X60A 2G71A 2PJDA 3BGIA 4B17A 1VL5A 5DSXA 2NNWB 1JTEA 3R3HA 4P7GA 4P7FA 5E2BA 4GC9A 5FUBA 5IKMA 3FPGA 1EAMA 3IV6A 1NBIA 2CWWA 2XVAA 5K0BA 1WY7A 3QOXA 3EGEA 1R8XA 1EJ6A 5B1SA 5GM1A 2BZGA 3C3PA 3HA5A 2YR0A 3MCTA 1JTFA 3DH0A 3FTFA 1L9KA 5E8RA 1QAMA 4A6DA 4ER3A 5KQRA 2XBMA 2K4MA 2AN3A 1AQJA 4OBXA 3FUTA 3LGAA 1WS6A 1VP3A 3E8SA 5HFJA 5DSTA 4CKEA 5GWXA 5DM2A 1H1DA 3E7PA 1AF7A 1DL5A 2AOUB 3A26A 3M6UA 4HGZA 4PCLA 5CUQA 2O05A 2V7EA
chains in the Genus database with same CATH superfamily
1JG2A 5GV7A 1KEZA 3EQ2A 3R5HA 1W87A 1B42A 1N2ZA 3HR7A 3FPAA 3FBGA 2RHBA 3GZNA 4M3NA 4CUKA 5E6UB 3UAVA 2P9BA 3FMOB 1GNPA 3ETDA 2BUCA 2UVPB 1N7HA 2X3YA 3AF1A 2DBQA 3BG5A 3LHKA 4MWGA 1YR8A 4MQEA 2IGBA 4OQNA 3WNZA 1OAOA 3ZE7A 2JLCA 1J1UA 2OZVA 3WK4A 1L7MA 2AFHA 3VKWA 3ZGYA 1G64A 2FG6C 1R16A 2VG8A 4EDHA 2GK3A 2HIHA 3KSUA 5AOCA 3L6BA 4LGCA 4LJLA 4DDTA 5C1DA 3ZDEA 3K31A 4JMPA 3ZU2A 4XWYA 4ZVVA 4CL8A 4QARA 4OIFA 1ES9A 4L72A 1X8KA 5HZMA 3ZD9A 3O1LA 4OAQA 4MCAA 5D6OA 2JAOA 5ITWA 1KS9A 1NU6A 1PP4A 3T34A 1A9QA 1YTUA 1QIDA 2VDRB 6REQB 1WXEA 2ZT6A 4G5YA 4Y1EA 4EF4A 1NC1A 4QYMA 1BS1A 7ADHA 4DOMA 3H97A 3OFSA 3F71A 4IILA 3U1VA 4XR4A 2JI8A 4LV5B 3Q4GA 3QENA 1Z6ZA 4JB8A 4ID9A 2QVXX 4BO7A 4B4UA 4K3VA 4PBSA 1OTHA 4FEYA 2G06A 3V6LA 3P4YA 2Q6VA 4HYQA 3R5KA 2NXJA 2QJTA 3U56A 1P6XA 3U4GA 1NONA 1XKQA 3L1HA 5K8CA 3VTFA 2ZKLA 2WLSA 1AZWA 1ULHA 2JJ8A 3JQQA 3Q7TA 4NH4A 5K9ZA 1PHRA 1Z6XA 2PL1A 3ZZMA 4E94A 2NUTA 5HS6A 3TLJA 4XUGB 2IZZA 5C37A 1FX0B 1Y34E 3OEHA 4MRAA 3UEOA 1SJ9A 1WF6A 3DT6A 3DL2A 4E4YA 2YUIA 1P3Y1 4FZJA 1CQJB 1NT4A 4RVSA 4EI2A 3IV9A 3U4AA 3QEAZ 1FXWA 2VHTA 4Y7DA 1FOEB 1L4KA 1R5JA 3A1NA 2XYRA 4Z4QA 3ZG6A 4XDYA 2Z9BA 4LG1A 1O95C 4PG5A 2J5XA 4WKCA 1G5HA 2E4YA 3MIIA 4B09A 5ALJA 4U7PB 1IZ9A 4BQIA 4V1CB 1GU1A 2VPQA 3MVEA 5DBOA 2IWRA 3GRCA 4P98A 4UVIA 1CX9B 4MYRA 4U9HS 4ND7A 2FK8A 5ECWA 1ZCJA 3K20A 3K6RA 3NIBA 4L5YA 5DWQA 3BBPA 3BHIA 4LV6A 1N1EA 1T2CA 3MTQA 3WZ2A 4EGJA 1CQIA 2PRZA 5BSMA 4TZKA 4GKVA 5JCPA 2J5BA 5JVDF 4AJNA 2C9CA 5I7FA 3G0OA 4ZZ2A 3VDMA 2EKZA 1JQ3A 3A6HA 1SXJD 4BIMA 4P4LA 4QD3A 4QDTA 1JFTA 4FJ1A 1U3WA 2IX3A 4JYMA 3QYJA 2FNAA 4CTKA 1OMOA 2OENG 1JHQA 2A1UB 3ET5A 1GLGA 3U31A 6NULA 1Y42X 4KWTA 1O4WA 5EKUA 3HY6A 2DC1A 5JADA 3P19A 1WMEA 2GJ8A 2R79A 3DULA 4RWEA 2ECOA 3WJAA 5KINB 3NONA 3F3KA 4AO8A 2NLOA 9GPBA 2D00A 4IOJA 2VTVA 1NYTA 4RMNA 5KTTA 1HDGO 1KK2A 3EUWA 2P91A 4G0ZA 2XMZA 1VYVA 2WVGA 4TMKA 4DR3B 1CKEA 2HDWA 3KPUA 1GPNA 2RHOA 4OGFA 2IS4A 2R68A 3OZXA 3OU7A 4ZV7A 1DAMA 2ECFA 2KJQA 3BBLA 4ZANA 4F97A 1EX6A 2ALJA 4OHMA 2WIAA 3AEUB 3I6YA 1S1MA 1GTZA 1NWCA 3LCJA 4OLJA 1CR4A 3Q5DA 4V0QA 3H87A 3TQQA 4D3FA 4YAIA 1MVLA 2RGNC 1YDMA 5EG5A 1PZFA 4A7PA 3X1WA 4DWVA 4BB9A 4V24A 4ZOCA 4AMYA 3IEKA 2O0LA 1RXYA 1CLUA 4N7MA 4Q15A 5TQJA 1LSOA 2AHOA 5CDFA 2QN8A 3CXRA 3MRSA 2ZBFA 1D6MA 2BC9A 3D4PA 2WVJA 4AMVA 1ZMRA 2OORC 1GPWB 3I1JA 3KZ1E 3C3EA 4AKTA 3HP4A 1L5YA 5JSZA 1DJPA 1WOMA 4L5BA 4CLEA 2C2ZA 2WTXA 1ZNXA 5A1TA 1TT7A 4HGQA 4JVMA 3DEHA 1B26A 3C5HA 1ZKDA 4HTAA 4I6GA 3W90A 3VH4A 2O8DB 3PG5A 2WVHA 3CLKA 4MPTA 4OA5A 4JL6A 3G0BA 3OUUA 3SXUB 4QG7A 4L78A 5FQNA 4D79A 2QENA 1I2MA 4ARAA 5CB6A 5IF9A 2AI2A 1GQSA 1ND6A 4TMWA 3IX7A 4ZQIA 3U7EB 4J6FA 3AIOA 3QGMA 4K6FA 4UHEA 3HB4X 4CE6A 4B3GA 3QV2A 4WXPA 1DCTA 2Y1DA 2BOVA 4ND8B 2FETA 3ZDYB 1M10A 1G8MA 3G2JA 3F7MA 3QFTA 3L5KA 3VX4A 4DV6B 1UQRA 4NDAA 3LXMA 4TV8A 3T9CA 1JJVA 1AZSC 1D09A 1F2UA 1JHUA 1KI8A 2AE2A 5JATA 2O54A 1XEFA 2D3TA 4GSKA 4UOQA 1T5IA 3HCRA 5CLIA 5D3MB 5F1OA 3W79A 5DEOA 3QELA 3FOEC 2EKBA 4E22A 2AIRA 2FSGA 3QE9Y 4RLQA 3MFQA 3HCAA 1F1BA 1HG0A 3O8OA 4YV1A 3KSBC 1D8AA 1U2ZA 5AKHA 1D1QA 5JHHB 4QT4A 4RH0A 1O9HA 3J81A 3TKAA 4MR7B 1E6WA 1YIAA 2ZTMA 3LUDA 4AWAA 1J06A 1JVSA 1OX4B 5G40A 1ZBDA 4UD6A 2J67A 4XB1A 4DR1B 2A57A 1B8PA 1CJKC 2OMEA 1QFMA 2WP8J 2YW2A 3M4JA 5DW0A 1KWKA 3VBCA 3H7IA 3CF6R 2DPYA 5BYJA 4Z3DA 5GJCA 4E1VA 1P74A 4IF4A 4B4WA 1L9XA 3A2NA 2LV8A 4YAKA 1M2GA 1Y1SA 1I9CA 3P5SA 1FRFS 1RXIA 3LBHA 3BMCB 1SUPA 2IU0A 1T3ZA 3CUVA 1K3UB 4FR5A 4G5SA 1KU6A 4PFJA 4EB8A 2CDRA 1A0OA 1J0AA 3PKJA 1PV2A 1NNLA 2YXPX 3AFIA 3K9HA 4M9ZA 4NG5A 4PWYA 5DM0A 3R3JA 5ECDA 1FS5A 1J9EA 2PNJA 1P7WA 4DCCA 3F3SA 3OQ6A 4QJ3A 3TI7A 3TDMA 2EGHA 1Z33A 3CISA 3OOSA 4MQUA 2D1QA 5EHGA 5AUOB 2FY8A 3H8VA 3K1AB 5EZ5A 3RU3A 3T94A 1Y7TA 3ZI7A 2FQQA 3CUUA 2Y76A 3FAKA 4YCSA 5KVAA 3QVXA 5GINE 3X2FA 3PLAE 2XGGA 3AEQA 2HWKA 3CM0A 3N07A 1ATZA 1Y4ZA 1KXJA 1DMRA 5L3QB 2GFQA 1WUHS 3AJ9A 1J9ZA 2C78A 4MV7A 1MIOA 5L7YA 1B6TA 4JXZA 1F2TA 3U3MA 1JDJA 3DPUA 3II6X 3N6RA 5JAQA 3KYDB 2C4KA 4LYYA 2VCHA 3LYAA 2VK4A 4QUHA 5A2QA 3CWCA 1FL9A 3G8AA 4IRXA 3TNJA 5JH7F 1K63A 1IBSA 5J3JA 2QTFA 2XVYA 5AVKA 3U9TA 2IP2A 1KEEA 2E4XA 2GA9A 5FF9A 4CL3A 4PO3X 1EA7A 1G66A 2F1KA 2RHMA 4G01B 4BB6A 5A04A 2JASA 2EAUA 5F98A 3Q5GA 1T8TA 1VBFA 3U5ZB 3K9NA 2ET6A 4WLFA 1D2AA 1N1GA 1DTSA 3AIMA 3AU8A 5K01A 4NV1A 1Z0KA 2GN2A 4GBED 1SA0A 3MAGA 1KY5A 2OO5C 3A2KA 3F5DA 3HRKA 5ECGC 4YNBA 2R7KA 5AHRA 3HYSA 1BWPA 3CH4B 3MTAA 4DIMA 1OZGA 4QFBA 4GLBA 4INZA 4NZNA 2QX9A 2QU7A 5CNJA 1EUQA 2VDPB 1UK9A 3H5TA 4JLPA 1SBNE 2W2LD 3RHZA 4TLAA 4G0WA 4IZOA 4ZVQA 1L3BA 1M6EX 4EW2A 4IVPA 5EJ4A 1CUWA 1M5TA 3ST7A 3TLEA 1FFXB 4DCSA 2H06A 1C50A 1N6NA 1IHUA 3W5UA 1KNXA 1L7XA 2E0IA 2ZTLA 2NU7A 4KTVE 1Q6ZA 5IEBA 5KC8A 5KEIA 3RQIA 5JAMA 2PBRA 1G9SA 2H3EA 2OV4A 3GCZA 4EKYA 2ONJA 3DLHA 3E9CA 1T3TA 4YP0A 5JSKA 3UAOA 1DC8A 3HGMA 3I4LA 1FRQA 5HIKA 4IVNA 4L4YA 421PA 3Q9LA 1ZI6A 1XCLA 2OWEA 3FSJX 1GNTA 3HJBA 2XNDD 3MCVA 2WZDA 3N2EA 3CZ4A 5AHKA 3STWA 3RK4A 4HEA1 4JT2A 2XNHA 1Z37A 2ZIEA 1FUIA 1Z8FA 4HSEA 2A0XA 4LJRA 2H1IA 3OSUA 3F6RA 1EZ1A 5TQVA 2RBGA 4LC9A 3PWKA 2VC2B 1OD6A 1A9YA 3PXBA 4QDXA 1SQ6A 3I2GA 3IUYA 4ZYWA 4QULA 4K9KA 4DLTA 5D3KA 1TT5B 4FONA 3IP1A 4FQ7A 3SSOA 4FFLA 1WMDA 1CB7A 1ECPA 3HH8A 1UPAA 2JAQA 4HAIA 4HOYA 1T8YA 3Q2OA 1HDZA 1I2BA 4RLHA 4B76A 1SUBA 2WUDA 1V41E 3WBBA 4KVZA 1AN0A 2XMBA 3EDMA 2JAPA 3T4PA 3RT9A 3WZMA 4ZQCB 2ZAIA 3AUUA 3ELYA 1KJ8A 3RODA 3U26A 5E2AA 4LJ7A 4N5LA 2JIQA 5JD6A 3DGFC 4UATA 1HRDA 4LZNA 4F84A 1X42A 3CF0A 1RMQA 5HE8A 1ECLA 1BOOA 2AG0A 3IP5A 4XPIA 4XQEA 3W9UA 4O3MA 2JJ2A 2PMEA 3PPXA 1E58A 2ZDHA 1Z5ZA 1PCXA 4NX2A 1I4EB 2VBCA 3GCXA 3TUZC 1X0XA 3LNCA 2HO4A 1M75A 2A1TR 3FH0A 1G7SA 4QHYA 4FCWA 2BHSA 5HKAA 2ZBGA 2DF8A 3N6XA 2FSPA 3QQPA 4GYWA 4AG5A 1JDNA 3PX3A 2Q45A 4UPDA 4FNAA 3MTGA 1PTJC 2EYUA 2H1CA 2VPZA 3EVFA 3IDZA 4CU5A 5KYNA 1SUAA 4LW8A 5FBWB 3BGWA 3RHTA 1NVMB 3EA4A 2XEDA 2D4AA 1MJFA 4QXOA 1FLDA 3EXHC 4J29A 3KYIB 1CEEA 1RQGA 1W34A 3N5KA 1YKSA 2OXRA 3M83A 4OIMA 5FNVA 4QHSA 4TT3D 2XCLA 2QMEA 5LJLA 2GLXA 4IZ6A 3AM3A 1XXHA 5T3UA 4CMKA 3D1LA 5E6SB 5EEHA 3UANA 1IIRA 1UKZA 3H2GA 4PTLA 4B2LA 4EUNA 2QAGC 3QUBA 2ZJYA 4KJZA 4CG1A 2QQFA 3PZRA 2BM1A 1QUEA 2R48A 4KMRA 1KYQA 3TSWA 5ILOA 4AG3A 2X5XA 1EB8A 1Y63A 2QGNA 1DPGA 1M8KA 4J0GA 4RO0A 3VOBA 4PYJA 1WB4A 4ZAYA 4YV2A 3A7EA 1I7NA 4GYJA 2R1UA 2DP4E 1WD7A 3TZCA 1GG8A 5KKNB 1XRQA 1CFZA 3KPJA 2I55A 4ZZ0A 2ZR9A 3FPEA 3GVPA 3IUQA 4DE5A 1II8A 3QP9A 2G67A 1Z8HA 2P9EA 4QFDA 5C5CA 2YQ4A 4OUDB 4RMHA 3A6LA 3H6HA 4H15A 4UHBA 3DMPA 3F0TA 3WIBA 2REOA 4W9MC 1WCV1 3AETA 1GUFA 5ALTA 1EX7A 2HXSA 2E2WA 4FSDA 4BWVA 4BE4A 1A8IA 1Q0TA 3A2LA 1PLKA 3C7CB 2PVPA 1C2TA 1X7XB 3H11A 1N33B 2X5JO 3H04A 3DF9A 1DT3A 4AF8A 3WQHA 2GBFA 2Z08A 2YY5A 4FZRA 4RCVA 5HP4A 3LT1A 3PC6A 1F0YA 5TMDA 5FUYA 1CRZA 2QYOA 4K87A 4N76A 4ZRNA 4BBPA 4CDMA 5C1IA 2WHPB 3QW2A 1CR6A 1ZAKA 2GT1A 4NC9A 3I73A 1ZAYA 1C7IA 1O95D 4ERXA 1TRHA 2Z3VA 4WFKA 3UB3A 1MXFA 1KR5A 3HC7A 1P9LA 2G36A 1JHYA 3ASUA 4ZO8A 3A9UA 2QM8A 5CDUA 2ILVA 1P17A 4EEZA 2XUJA 3GHYA 4R1SA 1M1UA 1R9MA 2NNWB 3NDRA 4O0MA 3DWGA 3KL4A 4P7FA 3CN9A 3E1KA 5LZ7A 1GJRA 4IPTA 4J4TA 1NBMA 5JCJD 1NN1A 1S5PA 3RJ9A 5K6AC 1OILA 3V1LA 4G5XA 2B20A 1JEJA 3E18A 3SEFA 2W37A 4DDWA 5HM8A 1IE3A 5EJMA 5JECA 1K7EB 3AF4A 4B6FA 1BSVA 1L9KA 4OM7A 2P6MA 3AVUA 4HAYA 2AN3A 4ZALA 4F4UA 1WB6A 4ZI2A 1OTXA 3KYCA 2RGGA 1VIAA 2J3QA 3A1UA 4UVEA 1SBHA 1T5OA 4PCLA 5DM2A 5AVXA 1JWLA 3R7DA 2Z5LA 1DV1A 1QONA 3B9BA 1DAFA 1ZMXA 2PZLA 2HL6A 3TTUA 5AUPB 4K2HA 5B30A 5BNTA 3T3IA 1Z2OX 2EFGA 1Y89A 3ENZA 4OXRA 4R2WA 3QLUC 4XD7D 1YS9A 2ZYDA 2W6CX 1TYDE 2UZIR 1EM8A 2CK3A 2X13A 3DAHA 4URYR 4RK0A 4AMGA 1QO9A 8GPBA 1XLVA 4E15A 1M2OA 1QM5A 3T5TA 1H85A 1P9OA 3SNKA 4B44A 1JHXA 2AW5A 1P0IA 4KQHA 4BEJA 4HX2A 4F92B 3M5WA 3SQMA 1FDIA 3T0GA 5KYTA 2FZ5A 2Q5EA 1NQAO 4GQAA 1FIUA 3RG8A 3JQRA 3QEBZ 4G3XA 1IXSB 1P75A 2CJYA 2EFEB 3GLRA 1WMFA 2DUMA 1CY2A 1NNI1 1FDTA 3CCFA 4JQOA 4K7JA 4KQ1A 5E4YA 4A5SA 2QTVA 3DZKA 4IXWA 3L07A 4QRDA 1JSXA 4KVGA 1MB3A 5T5QA 5A4FS 5JAOA 1QCZA 1H4TA 4FOTA 3SMVA 4ZVOA 2O3UA 4EA8A 1X8JA 3TIXB 3GO4A 3ONEA 1VIMA 4AZ0A 4FHZA 4UE3S 2UU9B 5MHTA 3GRZA 1LFAA 3FROA 1GTMA 1T4MA 1K9SA 2ZVJA 3VR3D 2GKOA 5LYJF 1YA6A 2HA4A 4MQFB 2CFCA 1HYHA 2BGIA 4BGIA 2BTOA 4W5WA 5HZKA 2F43B 3S2UA 3JQCA 4MRMA 1MTZA 4FFNA 4BKPA 4DA0A 5TPZA 3B1XA 4C3UA 4IF6A 4YCBA 5AVRA 1XV5A 4UDYX 1SKUA 4Z2AA 5BSWA 2ZRPA 3ZE9A 1E4EA 2B92A 1J8MF 2IVZA 4B80A 2IL1A 4BVHA 4PR3A 1SOAA 3RIHA 4F8YA 4CIAA 2HUNA 3ER8A 1UMBA 2IZ0A 5GJVC 1L3IA 2C2XA 5A3JA 3N8GA 1HNNA 4PZPA 3SBXA 4E1BA 1GNQA 2G5GX 1Y9ZA 1IUPA 1XMVA 5F5LA 2FG5A 2P4SA 2PLWA 3AG5A 1CRLA 3HVKA 1QAQA 1Z6GA 4M0FA 2YHBA 2R97A 3KQSA 3PE6A 2VUTA 4A6EA 1SCNE 3WIVA 2I22A 4B47A 3BC1A 2NWQA 5BR1A 4ZREA 5EHIA 5IAKA 4CLOA 2A0UA 1GRCA 1XMSA 4CG3A 2PSSA 1NR1A 2H65A 4J90A 3SHWA 3DUWA 2YCLA 2KYRA 2PR7A 4O4LA 3CXUA 1WLYA 2PKEA 1VMDA 4RA6B 1K9VF 3FJYA 4F46A 2PQ0A 2CMGA 1POXA 4JS0A 2VTDA 2R1TA 2O1XA 4IGFA 1Y1LA 2WD8A 3H2JA 4QQFA 4P9NA 5DLDA 3UXYA 4AN0A 3ER9A 1FRZA 4CEHB 4FHGA 3D7MA 1I3OA 1HG1A 4KYTA 2IEGA 2VF7A 2X9VA 4UNIA 4YJ3B 1VJ1A 2BPOA 3GMIA 3WQSB 3L40A 2ZRDA 3AESB 3TB6A 5JI2E 2ZU0C 3MA0A 4P4TA 4GO1A 3TAUA 4BMNA 3L82B 2I0FA 2NPIA 3C3KA 3HXTA 4NJMB 3RBXA 1IHDA 3D0RA 1KYZA 1O96A 4H7DA 4C4RA 1OH8A 5AQEA 3CTMA 5C7OO 3LM8A 2JFHA 2C29D 5CDTA 2AZ4A 1CF2O 1KMIY 1J2EA 3A3NA 3RTGA 4GPD1 1OZ0A 3IMFA 3AGPA 4KIWA 4KN6A 5EUQB 3IEPA 1KFJB 3THSA 3ZWKA 1DFGA 1FTWA 4LE2A 1R0KA 1EFAA 1PG2A 2BKUA 2WUWE 3AIIA 4AJHA 4CI0B 2BF4A 3NAQA 1XKTA 5FADA 3P9ZA 5IM4F 1MABB 3F97A 3TIFA 1TLTA 4CR8A 3QKWA 1P1FA 4LUCA 2GN0A 3ZYCA 3TS1A 2WUFA 1NLFA 3WIUA 1W48A 3NHSA 5EMNA 1Q22A 3CLRD 1TVCA 1IHPA 2QL9A 4MWTA 3O0TA 4JJAA 4C0AC 3HCDA 4MIEA 4ENPA 5IANA 3COJA 1RTTA 5F4BA 1JKJB 4GPZA 4Q16A 2QPLA 4MYCA 1RRFA 1W0CA 3QPAA 1Y6ZA 2AH5A 4L22A 5DO9A 2BJWA 4ASUA 2C5LA 4B6RA 4B8ZA 1KQFA 5FBHA 1B0UA 1UBMS 3JS5A 3KBBA 5EMLA 4DDHA 2WMDA 3BK1A 2J4CA 5DLPA 3KEMA 5AXCA 3C43A 1IOVA 5TMPA 3FBTA 4OKNA 1NVFA 4LVOA 4N48A 1AV7A 3RVSA 5BWMA 2G5PA 4LQ4A 3NRCA 5IAOA 2NSLA 2W4MA 1OCEA 1XN4A 3D7SA 1YHZA 3WL7A 3UBTA 1CY8A 1KR2A 4GDFA 4M54A 4OB6A 1ISSA 4A8JC 2ERYA 1U11A 1YCHA 1V35A 1A50B 3USCS 1A5ZA 1QVWA 1Y3DE 2R3SA 1I3MA 2GN8A 1K86A 1VIVA 1HDYA 3RW9A 1K92A 1M6VB 4CFYA 3LDFA 2HO5A 4HFMA 4DRXB 4E5YA 1F0PA 1KOJA 4PQGA 4EQZA 3AKZA 2AFIB 2CVQA 2O57A 2TECE 3DHWC 1H2FA 3DHVA 4Q7JB 4WFQA 5JWHA 5M3BA 3UK0A 1UBRS 2V5AA 2C8VA 2P4UA 3K0HA 4RIIA 1XC7A 1BXRB 2AMLA 1U0TA 3EGDB 3WK6A 1J6UA 1F8UA 2ACEA 2H7YA 3BL5A 3EMVA 1BEZA 1LQTA 4RHXA 1B8NA 1XVUA 4CMIA 4DLLA 2LKCA 1XCJA 2YV3A 5AO9A 4QGGA 5TXGA 2Q7OE 1N2EA 5C3UA 3T8YA 4RZHA 4B3XA 4K81B 4HPXB 1S2IA 5KO2A 1M1YB 5BN3A 2ID4A 4KR7A 1AK1A 5TLSA 2VA9A 4C6RA 3UMFA 3I1IA 5FWNA 3A9TA 5H4HA 1ZHHA 3MLEA 4AWXA 4JI7B 1P4JA 1VHQA 1P7YA 3FPJA 1QYIA 4NEQA 1OLXB 4Y2UA 2B1GA 1NXQA 2Q3LA 3ELDA 3E3NA 4H3KB 2FEPA 4D4IA 3H99A 3KOYA 3MBOA 1USUA 3S1LA 4Z7QB 3Q7IA 4NNOA 1N8NA 2DR0A 3OPVA 4CT5A 1UEJA 3EQZA 1WUJS 4HS9A 3V7YA 3GEGA 5K05A 4A8TA 3HVRA 4LX0A 1UPTA 4FB4A 2JD0A 3DLIA 3EDCA 1DTWB 5GIOE 4WLEA 3BWXA 5F3WB 1ADYA 5C2JB 3CX3A 1EEXB 4D99A 1I7DA 3OF3A 4AWBA 1AQNA 1MFPA 1QHHA 2C82A 1O8BA 1H66A 4DUGD 4QM6A 4YRGA 4I2NA 3KVVA 2O7RA 5JEDA 1UFOA 3N28A 4HLQB 5CVEA 2PUFA 1EE1A 2C84A 4QBKA 4C1NA 1NF3A 1TM7E 4FCTA 3TR0A 5KDDA 4EW6A 4J76A 4UMVA 4IIEA 4EKEA 1VRVA 7MDHA 2LWIA 4AYTA 1OLUB 1R4NA 3PK0A 5IJXA 4CKZA 3AXTA 3HA3A 4KODA 2UXCB 4OSPA 5C8ZA 2C58A 2X22A 5JDIC 4EELA 1KZGB 2HIAA 2YVAA 2GZDA 3WNCA 1LW6E 3NQ41 1R0ZA 1WV0A 4OV6B 5C32A 1T3GA 2DTDA 2H6EA 2PUAA 5TMBA 2OE2A 4RKWA 1E1NA 2NZUG 2Q1TA 3REGA 4GRDA 4ENTA 1TXGA 1TYZA 3DQQA 4KLAA 4ZKEA 2PWAA 1VYTA 3HFJA 3O8NA 3ZLTA 1QGAA 2JBAB 4BRWA 5G1NA 3HY3A 1EG2A 5JNLA 1V6SA 2C4NA 3SN6A 3AUSA 2GM3A 1OXMA 3TVTA 2C9OA 1F51E 4IMPA 1HNZB 1Z2CA 3KZNA 3UCXA 4HDOB 2D5CA 1RCUA 2XRMA 4NBNA 1TKCA 4C0WA 4OFXA 3LW7A 1HGXA 3AINA 1IQRA 3GFGA 2VDVE 3GEHA 3QVJA 3W2GA 1KI6A 3RVDA 1GSIA 3Q7QA 4DNOA 4UUAA 2E21A 4MIYA 4LNHA 4N3GA 1N9GA 4FOSA 1FQOA 4YGYA 4TWZA 3FKSD 3BWEA 4Q4LA 3VO1A 1PZMA 1XVIA 1IY8A 2EP7A 1TUBB 2ZGVA 3AYXB 3GGDA 3KZCA 3QTBA 3RIMA 4BFXA 4V0SA 1Z2PX 2HA6A 2J9FB 4U6NA 4KV7A 3PHJA 1DX6A 1ZOLA 1BH2A 3GLHB 1JQDA 1V16A 2BWJA 4UTOA 4YB8A 5HW0A 4TUYF 1SKBA 4BUCA 1BGWA 1PFWA 1YDWA 3RSSA 2ONZA 5JG7A 2B8EA 1JZQA 2WPNA 3K5PA 3R41A 1O89A 3ORRA 1OZFA 4RF2A 4OHVA 2O59A 2DFLA 1B8VA 2Q3HA 4M22A 2G70A 2COUA 1NVVQ 4LN1A 2EIXA 4A16A 4CM8A 5KSOA 4EB3A 1IUOA 2QRVA 1U7TA 4E46A 1KI9A 3A36A 5DBFA 5AOAA 1Q2XA 1SBTA 2X2PA 3SX2A 1U3CA 3GMDA 1E6EA 1M2VB 2XRYA 3MERA 5K0ZA 2NUPA 3IH5A 3ZI0A 1XZKA 3LWBA 5EJEA 1HH4A 5JPIA 3ZNPA 1TAUA 1MBZA 2R7NA 3FWPA 4V38A 3H8JA 3L8GA 4FOOA 5BNWA 3C3AA 4Q1CA 1L4NA 2WTNA 2QUHA 4CF6A 3LTNC 3GJXC 1JWAB 4ZP1A 5L95A 1YD7A 3H3XA 1EFRD 3NX4A 4Q7LA 3UMVA 2VF5X 4GI2A 3Q11A 4N5IX 1PI3A 2OFXA 4RVNA 2EP8A 1L8AA 3IUSA 2W2OA 4YWHA 5KOJB 1RBYA 2LKDA 3FHOA 2FPXA 4Y9TA 4TTJA 4ZGGA 4V0NA 3EXIA 3PA6A 1PEKE 1RKQA 5TPWA 4DPKA 3HM2A 4LF8B 1GEEA 1LNZA 1L4YA 4QM7A 2DXIA 4QUAA 1WEHA 1YXMA 4LCBA 2HHJA 4N0EA 1JI3A 2VP5A 1T0HB 5ABPA 2XITA 3NDBB 1Z6AA 2YWCA 4TS1A 4M9SA 1F4PA 2DT8A 2BFFA 4UARA 4A2QA 2GWRA 3SICE 3FYSA 4UFNA 5FLKA 1ZONA 1E3MA 5K3EA 5KYWB 3IBGA 4YV7A 1NQOA 2GPNA 1E2MA 3OH8A 2NUBA 2RG1A 3RAJA 1U7OA 1L4UA 4JJFA 4MROA 3T3PB 3IHWA 2C3PA 2XQJA 4BZXA 2Z2ZA 4S2UA 3QKSB 3DO5A 4E08A 2DLDA 2E1RA 2O14A 3GGSA 4GH5A 1SPBS 1SU8A 3DUFB 1DQRA 3DD1A 1XEWY 1KPGA 2NTYC 2ZUCA 2BFWA 4TTAA 3DKRA 4MAAA 2XMCA 4EKIA 1JFSA 1RP7A 3ORFA 4Q3BA 4X1OA 3TTWA 3IBSA 3WAJA 5HEKA 2PT7A 2O0MA 1QIKA 3LX5A 3RLFA 2Q5IA 3STVA 3OO1A 3B9PA 4B71A 2JFXA 1Z5GA 2YFYA 3O21A 4ETIA 3IQXA 2P90A 1ENOA 3AM4A 1A72A 1WKVA 3P9NA 3FDZA 2WA1A 2VHUA 4G9GA 2XKAA 4GYKA 5DN9A 4KFSA 3TSYA 5A0TA 2R8OA 3E15A 4D6YA 3KXLA 4URWR 5DNYB 1IBMB 2GO7A 1KGSA 3L8FA 1KAEA 1OJ7A 1Z47A 4G0PA 4OXKA 1OIVA 2OHOA 2JFUA 1P0FA 1E1CB 2R4UA 2FX2A 1BNCA 1DIHA 1QV6A 3T9FA 5BW8A 4NXMB 3RFTA 1MB0A 1DLJA 3ZIAD 4JC8A 2ZBEA 5E4FA 3CRVA 1L7AA 3F9CA 4NK4A 1V37A 2EKDA 3ZV6A 1X7GA 1CS0B 4L95C 2H5LA 3S2SA 1ZM3A 4RSMA 3EFOB 1K5DA 4YCJA 1SXJE 3H83A 4FN4A 2WIKA 2QMYA 2R62A 3KG2A 2OV1A 3QA3E 4R1NA 2CLIB 1W29A 2AKAB 4RACA 5H68A 4B3IA 4HADA 4F6LA 2HMSA 2IA5A 1H0RA 3FZEA 4R5MA 4Z53A 4IVRA 1RS0A 3P9CA 1YR1A 3JYPA 4CU2A 3TOVA 1AA6A 4REMA 1FP4A 1LBIA 2P35A 1DB3A 3Q3EA 4B6GA 4OP3A 4D0GA 3LPCA 4XX0B 4DS3A 5CXUA 1AKVA 2JH3A 3CINA 5EESA 1EP3B 1WXWA 2C5HA 3IEIA 4R68A 1TJ5A 3CNOA 4MP6A 5LU8A 1SIOA 4FGWA 2J0UB 2J45A 4TTIA 4CEIB 4WZ6A 3DE4X 2OFFA 3FCCA 5IAJA 2DZDA 2RAVA 1SUEA 3MS2A 1U2TA 4MUJA 1QTQA 3D31A 4ZCRA 3KWMA 4JVSB 4CLXA 1NQWA 3ZE1B 1TCVA 2KMLA 2A9JA 4ARCA 2RAUA 3PVCA 3ZOZA 2R00C 1UJ2A 1KKUA 1Q1QA 1VKRA 4HPWA 4ZU1X 4CKCB 3MYYA 1N8SA 2BRUC 3NHFA 4OVKA 1U8EA 5C8YA 5CX1A 3EXG1 3S70A 4BIIA 4BVJA 5IX8A 2B78A 2WAYA 1NR5A 2AK3A 3OC0A 4B3SB 2P6OA 2PBZA 4TM8A 3V8MA 3CZ9A 3PUWA 4G0OA 4O6VA 2Y1XA 3QXJA 1K6XA 5JNVA 2IH5A 3UOWA 2Z5VA 1G5PA 1E4YA 3CKKA 3QEKA 3RRYA 3U9LA 3M8KA 1FSFA 5IK2D 1CVLA 1Z4NA 2DE0X 3ESQA 1QH8A 4KE6A 5G3ZA 3GEBA 4CN8A 2WJYA 4HDQB 4JHXA 3R9IA 1QMGA 3CW9A 4NCXA 4GG1A 1Z6PA 4EW1A 4EAAA 1AO0A 1CE8B 3ESAA 4IMRA 4C4ZA 1D2NA 1UK7A 1JEDA 1PZEA 4UE6A 5F52A 1TEZA 4B84A 1IOLA 3FOBA 3LWDA 5GGYA 2ZQYA 1ZMTA 1MORA 2EEPA 3R77A 1IATA 1UJMA 1W9HA 3GELA 4HH1A 4YQEA 2I3ZA 5GM1A 1W47A 4WKOA 4XI9A 3U62A 4X64B 3QE0A 4IXMA 3N2NA 1ZJZA 4WASA 1T5TA 5IVKA 1WSBA 5E8RA 3WTBA 2BF7A 1VKZA 3U9SA 2NZ2A 4J7UA 1L4BA 1U0EA 2R9VA 2WU3A 2Q6IA 2IYSA 1R37A 1ZOPA 4EMBA 3V5NA 3MJ4A 3QXHA 1X8XA 1V4NA 1M66A 1FFEA 3MIZA 3MJSA 3MWYW 4FJ0A 5COBA 3KHSA 2VRCD 5BNIA 1RQLA 5FV4A 3QF4A 1H1TA 5K09A 3C6ZA 1CQWA 3GJ6A 1Z16A 4BLTA 5JANA 2NVWA 1X15A 2ZS8A 4J1TA 2P3SA 1FVHA 5JD5A 1B2LA 2QF7A 2A5DA 4PPFA 1MQ8B 4LYAA 4Y1RA 3KLPX 1C9NA 4S12A 2O2EA 4OJKA 1KPIA 3COVA 3WYBA 1JFFB 5DXFA 3WKCA 3H2YA 1WQ1R 1WUKS 1G3UA 2CXUA 3EE6A 4UXIA 4X3PA 5HTKA 1YF3A 4RM2A 3HSKA 3HE3A 5T8KC 4UHDA 2X0DA 4DSTA 5P21A 4WJLA 5L4NA 1LBHA 1U5CA 4AF6A 1VJTA 2IS2A 1QO7A 2IHZA 1I6MA 1O4VA 4WACA 4RVGA 4O4LF 3R76A 5B1EA 3EN0A 7YASA 3M0EA 4M1WA 5DH9A 2OMKA 5EGSA 2R5WA 3JQ9A 3RC3A 2COEA 4ZEOA 4ZJZA 3K4HA 1XZIA 3W3AA 5AHWA 1DEHA 2I3BA 1UC4B 3D3NA 4LX8A 3PC8C 3SKXA 3FZYA 2I7DA 5DIZA 2HHHB 5CT9A 5DOZA 2ZWPA 3RG2A 3RYFB 1I0IA 2PUVA 4YUYA 2MSLA 1OYOA 3IUNA 4JITA 2E37A 821PA 4ZC8A 2LIVA 3LT0A 4J0HA 4COOA 1XZAA 2V3VA 2RGRA 2BD0A 3U3XA 3ZWDA 1NC3A 3ML1A 3N2GA 4TYWA 4HNVA 1NNSA 4J1NA 5SY9A 2XVXA 3LYLA 5HFAA 5LQAA 2Z2XA 4ZTBA 3TX6A 3WJ7A 4ARVA 4QBFA 1DNPA 2FWJA 3DM9B 4NEGA 2H63A 4OOEA 5ESXA 3SM3A 1HA3A 4PYOA 4QKQA 2JHFA 1T1SA 4ZIRB 1VGQA 1NU8A 2RFLA 3MXTA 4L0DA 5FJIA 1MO6A 4L4XA 3AUKA 2RHDA 2JKYA 4A26A 4JR1A 4I9NA 2G04A 1F06A 1EMDA 3KQWA 4JKOA 1VJGA 2YHIB 3D5QA 1T3HA 2B99A 3UJ6A 1T2UA 2WY2D 4C0QC 2W2KB 3OPYA 3Q0TA 3SYNA 3RYCA 4PSKA 2IHVA 4C0HA 4GLOA 1EP1B 1IN7A 2MU1A 2YNMA 1M2NA 1DKQA 2I67A 3RARA 3PSHA 4JYPA 3TO5A 4D9KA 5B1IA 2X1HA 1KNQA 2EQ5A 4D3DA 4E3WA 2QT0A 4IV5A 4YAJA 3KZOA 5LDHA 2DY0A 3T99A 4D81A 2QOEA 4TYMA 1YL5A 3TNLA 1LQUA 4HLCA 3GQBA 4YGXB 1U3DA 3IDAA 5ESWA 3KB6A 4BAUA 3G88A 3G59A 4P5PA 3G2IA 2QMUA 1ADJA 2ZRLA 4DG5A 1I3LA 2XQFA 3DLPX 4INAA 4ITRC 3SC4A 2QG4A 3GK3A 4URHA 4D80A 1VJCA 1ZUD1 1GAEO 2QG6A 4ZI7A 3N8HA 4OJNA 5HDQA 4N0DA 5EHXA 5HKBA 1M3SA 3YASA 1JXQA 1X14A 3D8NA 4MWBA 3SSNA 3ZU6A 4G9BA 3VPAA 1TMYA 4FMCF 4FJ2A 1HEUA 4MNTA 4XTCS 3RK0A 3ZY2A 1K0UA 1LK5A 2XQGA 1OXTA 5LNK1 4QBIA 4UZEA 2QB5A 1VLJA 1KVUA 3SC2A 4YAEA 5CH8A 4KTTE 1JYFA 3ICCA 2VDOB 1U81A 3HVUA 4FYIA 2DJIA 5BSGA 3I37X 5EE1A 4K8OA 1BTOA 2C77A 4KE9A 1EHYA 1OFVA 5IYZA 1CTQA 3IODA 2GNAA 1PUIA 3KOXA 4DR4B 4PGFA 4CCAA 2VTBA 1P91A 4AJOA 2JRLA 1SCBA 4KREA 5L6LB 2NTJA 3T1YB 3LU1A 4LNAA 3O8QA 4TMTA 1J99A 3HKDA 4GE3A 5D2CA 2CJFA 5EQFA 3TMYA 3RUCA 2BEJA 4PTYA 1OLSB 2ZUTA 2HWXA 3IALA 4A2PA 1ZJ6A 2W7TA 3F6EX 3PFCA 4M60A 3SNHA 1FUYB 1PK8A 4UM5A 4KQFA 2B5OA 2HKIA 1X8LA 4BNNA 2YUTA 1K6IA 3EG9B 2W43A 3DXYA 3DW3X 1N5JA 5NLLA 4TZ6A 5EVJA 2G83A 3QVVA 3PEFA 2HJVA 3KR1A 2DCMA 2ZJBA 4XDGA 2DHRA 2AQHA 3IQFA 2YTZA 4BVLA 5LDDC 1ZZEA 3QHPA 1DGQA 4H4DA 4S1OA 4TSKA 4C04A 1QV9A 1U0JA 3IPLA 1EUDA 2OCLA 2V45A 5L3RA 2JLQA 2G09A 2R87A 5ALPA 3COSA 3RS9A 3H9QA 4P33A 1FC0A 2RHHA 3I04A 4YFYA 4GGMX 1GL6A 3T7DA 3T41A 4AJIA 4KQ2A 3IEUA 4H17A 1A7UA 4W1RA 1RBZA 3FGZA 3CQ9A 4II3A 3ISTA 1OJLA 4C5AA 1M8FA 1V8PA 4KW7A 4WEQA 4BLWA 2IYEA 3L5OA 3P71T 2PMKA 4WN9A 2GD1O 2QYHA 2WPDD 4EJMA 3C24A 1QIIA 1WU8A 3IR5A 3OIFA 4KDEA 2BSXA 4MRRA 1ZNZA 1P19A 1BMQA 1X80B 3GNSA 4Z0TA 2VHJA 3N8NA 2Q4RA 1Z26A 3SG0A 3WICA 1GA4A 1MC1A 2HBZA 4ESHA 5BY2A 3NBXX 1C7ZA 3SM9A 2BAGA 4ZYUA 4KYUA 1M2EA 2HRZA 3QRWA 1E4VA 1ONOA 3B1FA 3ZVNA 2I6SA 5TF0A 2PKYX 3QITA 1JKIA 4W99A 1GFSA 2FF7A 3AB8A 3VUEA 2F64A 1O0CA 1TMOA 2ZQ5A 5EJ9A 1Z68A 3ELUA 4NICA 1IBKB 1TQ8A 3M70A 3W6NA 3OLVA 3GMTA 4JP2A 4KOEC 3S7ZA 4AD8A 3HCCA 3RF6A 3ZX4A 3MZ0A 2JKVA 1MT3A 5B3LA 3LECA 4WZBA 3PWSA 3ZS8A 4H6PA 5EN4A 1JPVA 4BX9A 1EP9A 1CUUA 4OHBA 4ZYXA 1V95A 5I9IA 1GGVA 3SGLA 5EAIA 3EISA 1EXNA 4UHKA 2DFTA 3PJGA 3SZUA 2VPWA 2GEBA 3OQBA 4B4VA 1SKQA 1R0WA 1U7WA 4RHYA 3T9AA 3AEXA 3ND8A 2V6IA 3SZMA 4E32A 2XA1A 1NIPA 4JNCA 4Y8VA 1Q50A 2FYTA 1MH9A 3OQIB 2D1YA 5D86A 2X19A 3UWMA 4A0HA 4NFSA 4FI3F 1IAQA 4L0QA 1TW2A 3SOZA 2WSSA 4QX6A 5CA1A 3IKJA 2YHSA 5H1YA 1NUSA 1WR8A 1L3CA 3IEVA 1KQPA 5H4GA 1D0VA 3C1OA 4QU0A 4JBXA 2QG9A 4GMGA 2R44A 1HYGA 3E1SA 4FNGA 1FUUA 4KO4S 1H9BA 2GPWA 2HXGA 5JSYA 1R8YA 1CP2A 2WNHA 3ESRA 3AERA 5IG2A 1ZD4A 2PXCA 3SI7A 1LVUA 1QRRA 4JKYA 4H35A 4MVJE 5CTAA 1DO8A 2Z6VA 3CF4G 1LW7A 2ARKA 1JUDA 1UWVA 4E4RA 2BKXA 5JJIA 1I01A 1TLLA 2IU3A 3EB9A 3FMFA 3O3CA 4KK4A 5J2TB 3LDHA 2ZUFA 5EFZA 5JNWA 1BFDA 1I4TD 1RAHA 2DB3A 4O08A 2WYWA 4P6VF 1NAIA 3T4UA 4E5PA 3OZGA 3TL2A 1EXVA 2HMVA 4AJ1A 1GUYA 5KNBH 4KQCA 1RMYA 3S8MA 1IONA 1EXMA 1FDOA 3BGDA 1FS4A 2EEZA 2QRQA 1U2GA 4IBOA 1RCFA 4JCCA 4DTIA 3LC2O 1L5HA 4LRUA 4KQXA 1EFVB 2QS9A 3JAKA 4BFTA 3GVCA 2R6AA 4K5QA 1J7JA 2KSQA 5GTDA 5CB4B 2YW9A 4YACA 4JC5A 4EKGA 4TL8A 2RMKA 2QJRA 2I9PA 1KI7A 3COPA 3P0FA 1U8CB 4Y7CA 2P30A 7REQB 4L5IA 4X94A 2O8BA 1P3DA 2VRBA 1XLTA 1HLPA 3L6EA 5DWDA 5ICSA 2X5NA 3Q6IA 1U8YA 1ULAA 3JQBA 4YEDA 1E9RA 2YBEA 3CZCA 2XDQB 4TVKA 3M6WA 3NUZA 4ZT5A 4EFMA 5IKEA 1KSGA 2KLHA 3D7NA 1Z45A 1JLLA 2YV4A 3QX3A 2HPHA 4WNCA 3BJZA 3VXKA 3PT9A 5FV7A 2BGJA 1BDMA 2DRIA 2EXXA 4D42A 3MEQA 2YZ2A 3B1JA 3ZCQA 1LLDA 1QK3A 4D7AA 2A9KA 1IJEA 1YR2A 1XL0A 3B36A 3KXDA 4LVUA 1GYQA 1ZRSA 2I4TA 4X1IB 4DR5B 1L5OA 2PH3A 4ZT3A 1BRTA 4DMRA 1SQ5A 1GQOA 3GUVA 3IAS1 3I9LA 2ZRJA 3ZCVA 2Q1UA 1YKGA 4KQEA 3LX8A 1PZNA 3DBVO 3NNNA 4M86A 1RXCA 2M98A 2VQSA 4QPPA 3I9FA 8OHMA 2GEJA 1VKNA 3H9JA 3M1AA 3LLUA 1MX5A 5JS8A 3JZAA 4DMMA 5DYTA 2BMDA 3RRBA 3F96A 3GVIA 1YOVB 4HH4A 3VH3A 4LNUA 4XUDA 4ZT2A 2CEAA 2WILA 2VP6A 4OTZA 3Q1KA 3R44A 2FW6A 2GZ2A 1A8HA 4MLPA 5ALOA 4U2FA 3WJ2A 2Q6KA 5JS6A 1HLGA 3ZK8A 4DWWA 1NJSA 2ZITA 4PYMA 4TT8A 3H4IA 5B36A 2C7PA 2IPXA 2YVKA 5IAEA 1P1IA 2QD2A 2OHJA 1PJSA 1PFKA 4V3BA 4GMHA 1PAUA 3TLXA 5I48A 1J7KA 2JAWA 1T5BA 1E63A 5BWNA 3FZNA 3W3ZB 4BNVA 1LTQA 2JFOA 4I6JA 4XSHA 3O95A 3NC0C 4KBFA 1W4LA 2FPSA 3NC4A 5BT8A 1AKWA 1CETA 2UUOA 4PLZA 1NKSA 1XZQA 2F90A 2Q9UA 4KV9A 3SPXA 3TW0A 2H2AA 4MI6A 4B81A 3KKZA 4E12A 5IJZA 4CEJB 3QKRB 4D57A 4R1MA 2R84A 3IEXA 2NQ8A 4M9XA 3KEFA 3W5AA 4D45A 1E5LA 1Q1AA 5FB3A 2VOEA 4E33A 2UUCB 1UBKS 4M0PA 2EFDB 2X0JA 4TTQA 4C2BA 1N2HA 1RZ3A 1XD2A 1QF9A 2C5SA 2RARA 3CJQA 4M0EA 4ARIA 3CCCA 1IPFA 4U8GA 2PUBA 2PS0A 3W8RA 1J4AA 3ZZ1A 1GOTA 1BGVA 2C2OA 2IVFA 3C5CA 4MI1A 4MVXA 3L6RA 1YR3A 4TXHA 2B5WA 1T1JA 1O57A 2G7ZA 3OJEA 1YRQA 5C8YF 1FFSA 1ODFA 1ZI8A 2Z43A 3H6KA 4B74A 3GZJA 3L3BA 1DIRA 1G9TA 4MZDA 4ZQEA 4NJEA 2QUIA 3VVLA 1GAXA 1JQAA 5TGTA 1UKYA 5ER9A 1OYYA 1LA2A 4QGFA 4YN3A 5FLEX 4FGSA 3SDBA 3IMGA 3UY4A 3ID6C 2BKLA 2XYQA 3RUPA 5BP7A 2PBFA 3PDIB 3VDNB 2WIGA 1FVOA 2PT9A 1U8ZA 4YMIA 5KTMA 1KP9A 2J3IA 5FUWA 1YBHA 5CNIA 3ZDZB 1Z36A 1PEDA 3PGXA 1R3DA 4Q6BA 3KKPA 3CF4A 5SZHB 4ALMA 5KCZA 1AU9A 1G55A 1XZFA 2ZYWX 3HDHA 4I7EA 3F90A 4LTNA 2PGJA 3M4XA 5K0FA 1HYQA 1E3IA 3DAOA 5CT5A 4KRGA 5IJWA 1J0DA 1NDHA 3IAM1 3KZVA 5M2QA 4EYEA 1LF0A 5IVIA 1ISGA 3H1PA 1NKVA 5CBKA 2QUZA 1KZYC 1ZUNA 1Z7WA 3MC1A 4M7WA 4LZLA 2W0MA 3GUCA 2PUJA 4UZFA 5AKEA 3RB8A 1OB5A 1KMHB 2JHAA 2GCNA 1T5HX 3KX2A 2QNBA 2G9NA 1U04A 2GHRA 2WOOA 3NBKA 4F9GA 2Q8QA 2GTHA 3ESZA 4PFSA 1AKTA 4KXUA 4BNXA 3V9PA 3ZCPA 5IDXA 4W5OA 1IVSA 4Q4HB 3ZV4A 2AXEA 4QASA 3RBVA 3VAAA 7MHTA 3KJEA 2ZAMA 3QOWA 3RSCA 2JCSA 1RWOA 4JDUA 4BFWA 2EOAA 3Q7RA 4C4PA 5C53B 4CUJA 4KO8A 5DM4A 4PQYA 1XRJA 1TVKA 1SG0A 3EOZA 2GPJA 2YWFA 3CCBA 3HZOA 3MTJA 1O6BA 2RAFA 2ZJZA 2L19A 3CE6A 3JQ7B 3GUHA 1TQ4A 2PV7A 3CNBA 4LRTB 5TEWA 3WGOA 1HFEL 2XZLA 1G0NA 2JI6A 1T9BA 4L5CA 1ZD3A 3FPGA 2PKQO 2ZUEA 2V6MA 1IHXA 4LVNA 3INTA 1WCXA 3V4SA 3P0JA 4G5GA 1U4SA 4K05A 3EIOA 5E3HA 3SYLA 4C7JA 2IOFA 4TV9A 1DBRA 3R6DA 4WUTA 1U3VA 3OHSX 4R0MA 4INOA 1B43A 1P0CA 4INJA 3W4KA 2A0KA 2K4MA 3H86A 1VG0B 2C96A 4NCKA 1GZ4A 2J5QA 2WFAA 1WS6A 2XUZA 4MW2A 2A5FA 4EZBA 3OG9A 5ILGA 5GWXA 121PA 2F8MA 2O1EA 2PM8A 4EITA 2HSJA 1MX9A 4F6CA 5HX7A 1PJ3A 1UEIA 2TMGA 4LYGA 5AVVA 2WYOA 2MMGA 4IDFA 1FVFA 5BPHA 5I01A 4ED9A 5ITZB 3F9RA 3KQUA 1RYDA 4CBVA 2YFQA 3Q9SA 4I9UA 3PFKA 4B32A 4AKGA 2YIJA 1FLNA 3HZHA 4GQBA 4HQ0A 4ESEA 2C04A 3TOSA 5AFSA 1XFDA 4IIYA 4L4ZA 4AM8A 2F8TA 2C4WA 4ZYYA 1A27A 4GI1A 2QZ4A 2IYZA 1GKKA 3I5XA 4OJQA 2J7PA 3R24A 1PVOA 1KIMA 1Y9AA 1E1RA 3GFPA 3PC2A 4TYQA 5JT1A 3EMKA 2O5VA 1OREA 3C4QA 1B8UA 1X1BA 2J6IA 4CF5A 2E85A 1JLSA 4DA8A 4D5GA 2CDCA 5HFNA 2TRSB 1RXUA 5AVYA 1NE2A 3UMYA 4EI8A 1W8IA 4KWHA 3ZGXA 2O19A 4AB1A 4AKEA 1QIMA 1CIJA 3KLNA 3M89A 1T9ZA 3G5LA 5HILA 5DNWA 2BFCA 2EX4A 4EO4A 3IKTA 3N53A 2XE6A 1DPFA 3P2JA 1X7HA 1Y6QA 3SBDA 5JZSA 1KBQA 3EC2A 1YI1A 2CMFA 1QGED 3DZCA 3JQ6A 1XPRA 1MHPA 5B4TA 2DWOA 1YGPA 4RGBA 4EF6A 3BA1A 1X1AA 3NWPA 1GPMA 2D74A 3AV0B 1RJ9B 2QRPA 2WUEA 2X14A 4UAGA 4Y2YA 5DGXA 1E3WB 5JVDB 3ZWCA 1W9MA 2H7XA 1ZMBA 4QDKA 4BU0A 2CNBA 3SS7X 4IEFB 2Z9DA 1WOYA 1Y1QA 1XGKA 2P1RA 5LA6A 5P8WA 5IBPA 5I7RA 5BR7A 4MH0R 3IT3A 4J1QA 5IZCA 4P8RA 3B1WA 2E87A 2RI6A 1G2QA 1VSTA 3FOAA 3N6VA 3V8NA 2O3SA 1OH5A 4O8CA 3CSUA 5J63A 4HGOA 1X3SA 2EJTA 1CUBA 3CZAA 3OTWA 2INGX 1P9NA 4Z2YA 2OQIA 2W90A 2EP5A 2P9CA 4GMKA 3UGQA 3ETHA 4DLAA 3IL2A 4E14A 2JDID 4Q1FA 2FN7A 4XB2A 5F1YA 4DCNA 3CZQA 2Y2VA 3E7WA 1UOQA 4X8LA 4G07A 2V03A 2V7TA 2V9ZA 4RXTA 4U0KA 4QOHA 2GEVA 3P9XA 5EMMA 2BVNA 1DWPA 3UT5B 3NATA 2HADA 4OHKA 5CW1A 4DT1B 4OXXA 4F3YA 4NTZA 1ORRA 2B37A 1ZD8A 1XKXA 1RQXA 2R6R1 1X94A 2Y67A 2YN2A 1DI0A 1EUCA 1O0SA 5K0LA 5T4HA 3C7TA 4TLMB 2DLCX 1KHTA 1QYCA 1Y3AA 1A8QA 2GYWA 2P0AA 1W1WA 5IYZF 3ROQA 5JQWA 4RTNA 1GPBA 1Q0PA 4J3FA 3LHFA 4CG0A 5BSFA 1U2QA 3KAJA 2C4UA 1RACA 3DTYA 1MC5A 1H5QA 3IR7A 3UH0A 2V7VA 3ONWA 1A4IA 3QW4B 4S2EA 5FPPA 2GLTA 3OLWA 5PGMA 2CBXA 3KQVA 3RTDA 1E5XA 5BYAA 3WG9A 4QJIA 3DZHA 5BUZA 5JCXA 1F4VA 4H7IA 4I4CA 2QTLA 1IJKA 4MS4B 2DH6A 2GZSA 1G3MA 1XQ9A 2XTAA 3F4LA 1I13A 3HDQA 1T25A 4LRQA 1IRXA 1P18A 4B31A 3LH5A 3KLMX 1B2RA 3TRHA 5CA0F 3GJ0A 3ZWPA 1JEAA 1R6BX 4EA7A 2PU5A 3AY0A 3BQNB 1W4ZA 2VDWB 4JC4A 5JS7A 3LHSA 4L4RA 5C5EA 2FRDC 1RQ2A 1T2DA 2FGKA 2FFRA 3EUFA 2FKAA 1IXKA 1RRKA 4RL4A 5U4XA 1LS1A 3DZIA 2I78A 4RDIA 5HBRA 2C98A 3HYLA 1J1ZA 1CUAA 1Q7RA 3JQFA 1ESMA 1DLIA 4GT1A 3N8KA 5HGXA 1NMSA 1FFWA 5TSDA 4H3SA 1U4NA 1IIBA 1Q83A 3GNQA 2B98A 2WD7B 1GUDA 4BO4A 3I2JA 1Q3KA 2HXYA 4RCYA 3VX3A 2JFGA 5BUSA 1Z4LA 2MHCA 2RONA 4YCMA 3OFKA 3R0JA 2V5VA 2XMPA 4FFMA 4QQKA 1HNWB 3WWPA 1U5BB 1E66A 1JG4A 3A58B 1ZG3A 1U1EA 2M32A 3PFWO 1N7JA 2F59A 4OUKX 5CPBA 5CVCA 4ZO9A 4ZVNA 2RC5A 4EBBA 3HKCB 5AVWA 3AJ8A 1RI3A 4QDJA 1N36B 1TO2E 3LHDA 1HM5A 5IBCA 1T2FA 3NHPA 3NDIA 1HEYA 1W8DA 2WMOB 1LD3A 4JFAA 2IYLD 1XRMA 3CLTC 3Q7PA 3H1TA 1TA0A 1X7WB 4TS3A 3CLVA 2YV2A 1ML3A 1Z62A 4TLEA 3AVPA 4BV9A 5B2EA 2JLXA 3HB1A 4JBYA 1FU8A 3H2BA 4MUHA 2GPBA 1WBDA 1VB5A 1QGDA 3JR7A 1JU3A 3S7TA 5HIJA 1HRKA 2J9XB 1IUNA 5IP5A 4I1PA 3PVSA 3HTXA 3IOYA 3TDNA 1A5TA 1I2DA 1QNLA 1Y8RA 1ZD5A 1R10A 5ICMA 2UUAB 1GRQA 1EDOA 1YL6A 4LMRA 4R40A 3EIWA 2PUCA 2I33A 2W93A 3OE4A 1XRSB 2IF2A 1EVLA 2C5FA 1JILA 5FH9A 3RC2A 4YPVA 3OFNA 5SYNA 4U5QA 1Y0BA 2D5IA 2CUZA 5HJ5A 4B6PA 2Y71A 4ZDJA 1REQB 1ZIYA 5ADVA 5L45A 2DPMA 4RD2A 3TOZA 1V11A 3WDLA 1BWRA 1UODA 4GI7A 5JH7B 1VQ1A 3FUXA 1GCGA 1VHTA 4KSBA 1E9EA 2C8KA 4OLAA 1MZPA 2QEQA 2Z8ZA 3KKQA 3LX4A 1ML4A 1S01A 1WXXA 3ETJA 1C5KA 1QZ3A 2XDWA 4K6KA 4ZOLA 3EXEB 4ND4A 3ROZA 3A04A 3NO4A 4HZGA 3KFXA 4OQZA 3AVYA 3RSFA 4FPXA 4O4JA 1KEVA 4Q3KA 4PX3A 1YDEA 2BFBA 2ZJ8A 2FWNA 4FFRA 1YV9A 1CLEA 3SJ7A 1DOHA 1B0PA 2PN1A 3C8ZA 1ILEA 1QC5A 4MVJG 1RQRA 1S8NA 1XWIA 2J9ZB 4LY3A 5F1KA 2Q27A 4GKKB 2CLHB 3SP1A 2WIJA 3CT6A 3QMWA 5LP6A 5JPCA 4Q47A 4BWFB 1KC1A 2G9VA 3FB1A 1T15A 2FPOA 2XUKA 4BGVA 1NJGA 1QYXA 4PLTA 2NXWA 2CV2A 4O2AA 5AR1A 3DE0X 4NL4H 1JZTA 2VZLA 3KWFA 2QE7D 2UYYA 3L0PA 4NBUA 3QWBA 2FEKA 4K88A 1YRWA 5KVSA 1SKAA 4RDCA 3CG0A 1QB7A 3ZHZA 2VFAA 5EJ8A 5JRJA 3L4KA 4ZA2A 5EUCA 4BRUA 4W9NC 1NRJB 2F1IA 3NFRA 1EWYA 4OHZA 4JFRA 5IKPA 3VO9A 1PWEA 3WLFA 1SVWA 2A5JA 3PUZA 2RH9B 1IDN1 3DWEX 1J0XO 1KERA 1QQBA 1Z5PA 2AVNA 1BAPA 3OQ1A 3MW8A 3V8QA 2R25B 3VR6A 2PBLA 4BMVA 1Q1NA 5JQGA 1JEYA 1VG8A 4QYIB 4C3ZA 1MAHA 1QAOA 1MP0A 2XKJE 3LMKA 2XXAA 3B1ZA 4YC7A 1PT8A 3JYOA 3LUAA 4HJRA 5HR5A 1GKYA 4B4DA 5AVZA 4CZ2A 1S9DA 3V8EA 2R4QA 1XU7A 2EFCB 5KPDA 2EHDA 3MS7A 4IIDA 4KUGA 3WK5A 1G1AA 4KPEC 4MPRA 3AR5A 1L6IA 3KQKA 3U44A 3RU7A 4HDCA 4V0OA 5F2OA 5LIPA 4I8XA 3IP8A 4GX0A 2E4ZA 3VHRA 2HHCA 4PBRA 4QFMA 1IY2A 4OHFA 2NTVA 3V7WA 4MUEA 3E05A 4TX1A 4TL9A 3WYGA 3FTQA 4YFVA 1EBFA 3MWDA 4C4TA 1QTIA 4X44A 4QNNA 1Z13A 5EIHA 3WDMA 3CVVA 2GBLC 2Q2QA 3LCRA 1P2TA 3LUBA 3OBIA 3SJUA 4BKUA 4D82A 4ILKA 5IS2A 1PHPA 3M4YA 3KZMA 5K6RA 4D8UA 4BXOA 5AD1A 5L4LA 3WMWA 3JQAB 3AM1A 4NU8X 1FF9A 5FPTA 4TZ0A 1WHTA 4E07A 2MSCB 3W1WA 2Q0XA 3WA6A 2HQ1A 4PE5B 4F06A 3TLAA 2BH2A 3MMNA 4AMBA 4AXXA 2PKWA 4LY9A 1G8JA 4D8WA 1A9OA 1XNRB 1U1IA 1ZX1A 3DDWA 4CV1A 2WM3A 2BGRA 5ED4A 4GOKA 3U7QB 4YUWA 3UH1A 1RAAA 3TG8A 3LO5A 4JGBA 4K1XA 4WGGA 2JFQA 3H1BA 3A1TA 4L9SA 5IASA 1NYLA 3L7MA 4R2IA 3WB9A 1P3JA 2J8ZA 5HKKA 5IHPA 4AS2A 2L82A 4B45A 3L6OO 2P3OA 4O1MA 4BZWA 2P41A 2Q4TA 4CCWA 4PLGA 3UV6A 3FNFA 3GRVA 3VKUA 3L8ZA 2EL9A 4OLHA 2WK1A 2HSEA 3BJIC 3MWGA 4UDNA 4TGLA 3MTBA 1SBCA 3SU8A 1PKXA 2ZI6A 4WZAB 1J00A 1QG6A 2AN1A 3IDFA 1BHQ1 2C2HA 4R69A 2GUGA 4XQCA 2VPPA 5I9SA 4AW9A 2HK8A 3SF8A 3AI7A 5GZ6A 4GPTA 3UT6A 2R6HA 4HWRA 2JFYA 3AHDA 2WWHA 1EE2A 4W5HA 2D8AA 2ODEA 4CUZA 3I5MA 4HBGA 2YYYA 4M8LA 1TKRA 1Y98A 3HQ4O 4KYIB 1L5NA 2BYTA 1BJTA 2YMQA 4TL6A 3SEAA 1QG2A 1NJ6A 3MT0A 1V8FA 1ZXBA 2Y1CA 4JMLA 5DYWA 5CDHA 4WLVA 1X86B 1U7ZA 4XKJA 3VR2D 2P2GA 5A71A 4KJXA 2E4UA 5GJBA 1GZSA 2XPCA 3SYMA 5JWRA 1WZCA 2NZWA 1G6OA 3EFEA 5BVHA 5IJ0A 4BV3A 2R1ZA 3TFWA 3H2SA 1SZJG 5KYYA 1O95A 1C3OA 1GSHA 1OWLA 1PDWA 3UA3A 2R96A 1WXDA 3IJ5A 3CR8A 4WH0A 3WNDA 1RM0A 1R74A 4MVJA 1EFDN 2CEKA 5CLGA 2V0GA 4D4JA 3AFHA 1W5FA 2QY9A 2XYGA 1U1GA 3PGJA 4JX8A 4ZT4A 1DRJA 1D07A 3VISA 3ZK7A 1KS2A 3BZBA 4OREX 2QA5A 2JGMA 3WGLA 2ZCUA 3JYLA 5K45A 3FMIA 3CH6A 4CLDA 2V58A 1B23P 4DIDA 3GP3A 3AIKA 1ZOSA 4IIJF 4GOLD 4JR0A 2QXYA 3ETNA 1YZGA 3IDSA 5F77A 5DYNA 3UT0A 4CI9A 2IT1A 2X0IA 5A9SA 4ZEMA 4JJ8A 3GLGB 2HCFA 1XTPA 3S2FA 3CBQA 2NIPA 3WGJA 2EZ9A 3SZOA 4JSTA 4OI0A 4E5SA 1P2VA 5F7XA 1D6NA 4X1KB 1AIPA 2I91A 4IDPA 4WXEA 3KQHA 4QJBA 2O2SA 3PQ7A 1BDBA 4ZJYA 4BJ3A 2QU8A 1EVZA 1K8YB 3FWZA 5LIRA 4XD7A 3FPHA 5AJWA 3BOSA 3CSDA 4L50A 1AB5A 2GAFA 2Q5JA 3WQBA 4Q3OA 1Z0FA 1SRRA 2ZRGA 3EZ6A 4BVGA 4ZAGA 1LJ8A 2HHLA 3D0OA 3HB9A 3FY4A 5F73A 3U13A 1KI3A 2XYVA 3G49A 4ONEA 3WXBA 1XZBA 3OKPA 1NP6A 3HWRA 4DLBA 4EJ0A 2QTWB 4A3SA 2F1HA 3WZLA 3DOEA 4AZ3A 1I3KA 3V4FA 3PPVA 3UHJA 3W8FA 1V45E 2JJ1D 3K53A 2ZTHA 5DASA 3UV7A 2YYAA 4AF7A 5FA5A 5FWXB 5KOHA 4QNRA 1EXDA 4EP1A 2RJOA 3I01M 1TQ6A 5IXSA 2C9DA 2H17A 3MCAA 4FP9A 4BDSA 1U2EA 3THWB 2IUYA 4Z4GA 1LDBA 1KY2A 1PTKA 3FWYA 3ZD6A 1C9KA 4HQRA 5KU7A 5E2IA 4Y6RA 5EWJB 5KYVA 1XZGA 4F7DA 3N5CA 1ANKA 3FLAA 1PK7A 3PS9A 1GXSB 16PKA 4BQSA 4QUJA 3O9ZA 5DP1A 5MGBA 1Y82A 2WSMA 2CB9A 3GJSA 4Q4AA 3U40A 4CRWB 4GC9A 1JJFA 1NN0A 4JJ7A 2BHTA 1Z38A 3A1CA 2BBOA 1V5GA 3MCWA 4MGEA 4YT5A 3AF5A 4BWYA 4CIYA 1Z34A 4DJFC 4W8HA 4PLCA 5E95A 4LOAA 1GPDG 1XDBA 1GN8A 2P68A 3T5DA 5LYJB 3BXEA 2XB6A 3L6UA 4ER3A 5KQRA 3SZRA 1CNFA 1GG2A 3WYEA 4ZAZA 2BMFA 4GLJA 3WLKX 1H5UA 2NQTA 2QVZX 3B8EA 3PTLA 1R4MA 3LX6A 3PKIA 3FDFA 3GFSA 1JG1A 3ZGNA 2AWNA 1W5SA 1WMBA 4U3JB 2X4LA 5FOXA 4ACBA 4A92A 5HZHA 1G38A 3PGA1 3GUUA 2B2NA 3BL6A 4BCDA 1NATA 4EJSA 3PQCA 1WSDA 5EVCA 4KN9S 5ICCA 1PJTA 3OIWA 5EJAA 4BP9A 4KXFB 4PAOA 4E2XA 1Q0RA 1TB4A 4N01A 3PTAA 3ZW9A 3AOEA 4H9GA 3UGTA 4ALIA 2GCOA 2Y1EA 1I14A 2AN9A 1OFIA 3V4OA 3WGVA 1CPYA 2IHNA 3MUFA 3D6TB 1VL6A 3M5PA 4ZJUA 1NFRA 3P4XA 2CXOA 4AZVA 3WA7A 1VLLA 2JIOA 5A4KA 2OXCA 1WKBA 2ES4A 3I45A 1QF6A 1DZ3A 4N4AA 2REQB 3T38A 4G4GA 3IOMA 4UEQA 1I5RA 3A6FA 2DGDA 5CLJA 2KI5A 1OU0A 1W1IA 2CXXA 1VJDA 2HI0A 4N0PA 1ZGJA 1DRUA 3FZQA 5FIUA 1R0SA 4Y6OA 4YREA 1UAAA 3FCOA 5HF6A 3I83A 2AN5A 3K8OE 4I4NA 1NKTA 4L2IA 3SR4A 2QD3A 2ZBQA 1T4GA 1DIAA 4IM7A 1NVWQ 3OZEA 1U0NA 1FYDA 1NLMA 3BIWA 3OHPA 2CXRA 1RRMA 4P58A 3WSWA 2FMHA 4PM4A 2ID8A 3OQVA 3RV3A 2JLSA 3DCIA 4XB6B 5CPFA 5AJTA 1DX4A 1K8ZB 4FFVA 2WA2A 4Q5IA 1MO5A 2YMLA 3JTMA 5DX8A 3IXMA 3W6UA 3TG2A 4M1TA 1SVSA 2AUMA 1SQ0A 5JSFA 4LXYA 3K72B 1A5AB 4W5JA 2P2LA 1ZJYA 2POCA 4OQ4A 3DYVA 4RE5A 2CF6A 4L73A 3RNOA 2FTKE 4FSHA 4HI0E 4YQZA 3T1HB 5JSZB 1UPFA 2O3TA 4RXMA 1D6JA 1ZINA 6LDHA 1D4ZA 4CNQA 4PQEA 1C4KA 1CY7A 3O94A 4C7KA 1T2NA 3C6MA 3N2KB 5BQPA 3TLZA 5ALVA 4PX9A 5JAIA 2FPPA 2OTCA 3PB3A 1B1CA 3RCBA 1Z4JA 1QFXA 4Q1AA 2E5WA 4KPFC 1SU6A 4WOBA 4ZOBA 4DCUA 2HQSA 3E7XA 1H2YA 2VPXA 1LQ2A 4GP6A 1L7QA 1C9MA 3B38A 4CXMA 3ZWXA 4YRAA 2R60A 3ANNA 2DQ4A 3EVAA 3ORHA 4U9UA 1HBJA 2VJOA 4US0R 1LXCA 2ZTVA 4LDJA 3DVSX 2CLOB 1SCUA 4EAQA 1OI2A 3TCXB 3LY9A 1AX9A 1YR9A 4IXTA 3EF1A 4F4CA 3NFYA 3MD0A 2WFLA 1YBVA 3LP6A 3QM1A 5A6SB 3TBFA 3IHTA 2WOJA 4BO9A 4PQFA 4DXHA 3FPLA 1MX3A 4EEXA 2BL4A 5B12A 1AHPA 5CIYA 2NN3C 2R6ZA 2PFSA 1W0KD 2WW8A 3DPSA 2F8SA 3RASA 2MCFA 2O07A 2BZSA 1KL7A 2WHXA 3O8OB 2BFMA 1NBOA 5EWMA 5KDLA 1TMKA 4YY3B 1D6SA 3BFKA 4LSWA 2J4DA 4U63A 4GMXA 1R0BA 1A9PA 5DYGA 5BWLA 5IUNC 1I7PA 5J58A 1P5RA 4NOMA 5CFPA 4C7MA 1DSSG 2B4AA 1ZLXA 1K4MA 3JQDA 2VP4A 1QMPA 3MSXA 5HIIA 3R7NA 1B41A 1NV8A 4QPNA 1P60A 1BW9B 1R88A 4XIIA 2WJIA 1B6SA 3SQXA 2O5EA 1L7NA 3EVDA 2CXSA 2WKWA 2HREA 4Y9UA 3GARA 3IMEA 1SZPA 4KQMA 1E3TA 1PUJA 2NM0A 2ORVA 3O2NA 3HEAA 2GBPA 4DLKA 4WK0B 3DOJA 3GCGA 1RIFA 4RZXA 2WSBA 4P53A 1XHEA 3VSAA 4OXNA 2QL7A 2V0NA 5A6VA 4R2MA 5JDCC 1RWNA 2BR5A 2J09A 1R2QA 4TRMA 1H2BA 5ALLA 1KZ4A 2I54A 4MV8A 2WAAA 1RJGA 3A4IA 4MR9B 1PBTA 1IBRA 1O6CA 2PO5A 2BUBA 1RWMA 3B13B 1TFRA 3IAEA 4WK2B 1C0KA 2E9SA 2XUGA 1XJ0A 2AA3A 3OJXA 4HEA6 4NZYA 3PXGA 5JCOC 4Y6QA 1XZ8A 3TQRA 1E2BA 3EXFA 3QXSA 4CWAA 1XELA 2GM9A 3MELA 4GOXA 5JXGA 4BMZA 5KUTA 3AEQB 5CB8A 2D13A 2HAEA 2CE2X 3QLEA 2PRSA 4V1CI 1FP6A 3Q9UA 2GZRA 1ZL0A 1XVVA 2VJMA 1MIOB 4WERA 4ZO6A 3TI9A 1R18A 1F2TB 4UTRA 4YRJA 5DNVA 1CDZA 1MU0A 3B2EA 4L28A 3MMPA 1E61A 4C78A 1VLVA 2J0VA 1DBWA 2KB0A 2ZB2A 1GUAA 1FVXA 4ALNA 2HYIC 1FFYA 4RSHA