2HV9A

Encephalitozoon cuniculi mrna cap (guanine-n7) methyltransferase in complex with sinefungin
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
248
Chain Sequence
SKTINIRNANNFIKACLIRLYTKRGDSVLDLGCGKGGDLLKYERAGIGEYYGVDIAEVSINDARVRARNMKRRFKVFFRAQDSYGRHMDLGKEFDVISSQFSFHYAFSTSESLDIAQRNIARHLRPGGYFIMTVPSRDVILERYKQGRMSNDFYKIELEKMVPMESVREYRFTLLDSVNNCIEYFVDFTRMVDGFKRLGLSLVERKGFIDFYEDEGRRNPELSKKLGCLTREESEVVGIYEVVVFRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational Analysis of Encephalitozoon cuniculi mRNA Cap (Guanine-N7) Methyltransferase, Structure of the Enzyme Bound to Sinefungin, and Evidence That Cap Methyltransferase Is the Target of Sinefungin's Antifungal Activity
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transferase
molecule keywords mRNA cap guanine-N7 methyltransferase
total genus 90
structure length 248
sequence length 252
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03291 Pox_MCEL mRNA capping enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2hv9A00
3HCCA 2R6ZA 3H2BA 3PTAA 1ORIA 2AOTA 5E2AA 5FWAA 3EVGA 2IP2A 3P8ZA 2ONZA 3HCAA 4X41A 2Z6UA 5IKMA 3P97A 4K6MA 4DQ0A 1G8SA 2CMGA 2AOWA 3KR9A 4RVFA 5F2OA 4ATNA 4RTSA 2PX5A 1QAMA 2PX2A 2ZWAA 2YR0A 4PYKA 2IH2A 3KQVA 2H1RA 5P8WA 2XVMA 3C3PA 3LDFA 3Q87B 1B42A 2O0LA 5EIWA 3E8SA 5B1SA 2AOXA 4OBWA 2VP3A 4E30A 2HMYB 3A7DA 5EVJA 3LGAA 2PJDA 3CCFA 4RVDA 2B9EA 2YXLA 4G56A 5H02A 5HIJA 4HH4A 3SR4A 3P9IA 1G55A 1JG2A 1EQAA 5CVJA 4HG2A 1YZ3A 3SVZA 3MCZA 4PIMA 2ZULA 4M7RA 3BZBA 3OU7A 5EKXA 1INLA 2UYCA 2XYVA 4IV0A 2ERCA 5EQJB 3NVMB 3BWYA 2N47A 2C7PA 2AOTB 3I9FA 5DXJA 3S68A 5LR6A 1UFKA 1KR5A 2AZTA 2OO3A 2GPYA 3A7EA 3K6RA 2PBFA 3KPJA 4QQKA 5DRYA 3BGVA 2C7OA 2G1PA 4GBED 2BH2A 4BP3A 2B78A 5GIOE 2DULA 3M6WA 4RSRA 1M6EX 5D1HA 3V8VA 1DCTA 3LBYA 2O05A 2K4MA 3KQTA 4QPNA 3A27A 2NP6A 2VDWA 1Q0TA 3IV6A 2Q41A 4HTFA 2BZGA 2PXAA 3EVEA 3C6MA 2JJQA 3OZTA 2GLUA 4RTRA 1M6YA 3JWIA 5JUWA 2OB1A 1I9GA 4EMSA 1I1NA 4GF5A 4P7FA 2PSSA 1IM8A 1G8AA 1T43A 5K0LA 2JHPA 3ELDA 5BP7A 3E23A 3BKXA 3V97A 5DPMA 3OFJA 3HCBA 3I64A 4L7VA 4PCAA 3CVOA 5EEHA 5CIYA 3PB3A 3VYWA 3O31A 4DCGA 4AZVA 2P1DA 3LCUA 5EEGA 3KQYA 5ICCA 4RTPA 1JTFA 3M6XA 3KPUA 3KQPA 1VE3A 1WY7A 4R8SA 4R6WA 2E5WA 1RI3A 4MHTA 5KVAA 3G88A 4CKCA 2JH8A 2FPOA 1NW3A 3KQMA 3UJ6A 5K01A 3E05A 4RVGA 4OX9Y 4ER3A 5GINE 2GB4A 4HTFB 10MHA 1NBHA 2YUIA 2NP7A 5EHGA 1PJZA 2CMHA 2UYQA 4XCXA 4GOLD 2JG3A 2BR3A 2BR4A 5EZSA 5GP1A 2EJUA 1P39A 4H0NA 1JQDA 3SMQA 5FQOA 2CWWA 2H00A 2EJTA 2IDKA 2ORED 1RJDA 4KIGA 4OQDA 3P71T 1SUSA 4PCLA 1I4WA 5IH3A 2OBFA 4PYMA 5EKUA 3REOA 3M33A 5CVEA 1ZQ9A 5E9QA 2P8JA 4AZWA 3AY0A 4E33A 3OE4A 3FTFA 4NECA 4QTUB 3UZUA 3UJ7A 4QVGA 3HVJA 4RTNA 5FQNA 3P9CA 4P58A 4BLWA 1R18A 3B7PA 1G60A 3BGDA 1ZHFA 4EKIA 4C05A 3DOUA 2PWPA 2NXEA 2O06A 3G5LA 4YV2A 3ER9A 2ZZKA 3C6KA 2I9KA 1FJXA 1QYRA 4PINA 3FPEA 5GIPE 2ZZNA 3TFWA 3LL7A 1RI2A 1FPQA 2YXDA 5FCDA 3EMBA 1YB2A 4BLUA 3DMGA 1DUSA 3GO4A 3MCTA 1EJ6A 1SUIA 2G8NA 1N7IA 5DM0A 4O29A 2ZLBA 3GRVA 3SGLA 3FUXA 4PYJA 4CWAA 3G89A 3NJRA 2AN4A 4IWNA 1XVAA 1JTEA 1NV8A 2ZWVA 3ANXA 5K0CA 1L3CA 1ZG3A 2P3QA 3FUTA 3EGVA 4YUXA 3KPVA 3VC2A 3UA4A 1NW8A 1KPHA 3VSEA 3NDIA 2PWYA 5FADA 4P7JA 4JXJA 3T7TA 3FTCA 4HGYA 2QRVA 1YFJA 2WK1A 3DUWA 3QOWA 5FHQA 3BWBA 5CVVA 2ZCJA 4OA8A 3ELYA 3ELUA 5CM2Z 5FWDA 5KQSA 1X1DA 3B5IA 4GC5A 5KQRA 5LQAA 1U2ZA 2O07A 2P41A 2G71A 5E8RA 4KDCA 2FCAA 2PVCA 2FK7A 2ZSUA 3G2QA 2JH9A 3UFBA 1MHTA 2QE6A 2OXTA 4KWCA 5FULA 1FP2A 5DRTA 5LQNA 3ELWA 4C08A 4KIFA 3UJCA 1TW2A 3I58A 9MHTA 2NXCA 2QRVB 5LQKA 4PGGA 4U7PB 2ONYA 4EKGA 3GGDA 3UBTA 3GIWA 1G6Q1 3BT7A 3G8AA 3R6TA 1JR4A 2VDUE 2AOVA 3Q7EA 5EMLA 4DM3A 3OPNA 3PFGA 3TRKA 1VBFA 1JQEA 2NNWB 1BHJA 3K0BA 4XUEA 3SX0A 7MHTA 3G2OA 3EVCA 3DH0A 2C7RA 1HNNA 1EJ0A 2IPXA 3GDHA 5ERGB 1IXKA 2P40A 5F2NA 1WZNA 3G2MA 5T6BA 4FT2A 4LWOA 4OQEA 4RTMA 3NVKI 2BM9A 1XXLA 2PKWA 3AXTA 1XDUA 3EMDA 2PXCA 3KR2A 4YUVA 3LDUA 4C04A 5K0BA 2FK8A 3CJRA 5EG5A 4PYNA 2AOUB 3EEOA 3HA3A 3R0QA 3LCVB 4HSGA 1RJGA 2AN3A 3QOXA 1D2CA 1VPTA 1ZKDA 1VIDA 3PVCA 4QDKA 4QPPA 4RTOA 2UZ4A 4PYIA 1EAMA 2QYOA 5DTRA 2IIPA 1DL5A 2IH4A 3AXSA 4DCMA 2OYRA 3LHDA 2UYHA 4X60A 4CTKA 1ORHA 2YXEA 3SSNA 2DPMA 4BY9E 1PRYA 4LWPA 2GS9A 4DF3A 1FP1D 3DTNA 3F4KA 3NMUF 5K8VA 3L8DA 2KW5A 3DXZA 4A6EA 2LD4A 5C0OE 4FS8A 1SG9A 4E2WA 3PFHA 4RVHA 1VP9A 1WS6A 3FZGA 4FZVA 4Z2YA 2PGXA 3A25A 1H1DA 5EGSA 3HVHA 5K0NA 1X19A 1ZGJA 2BR5A 3BUSA 4GC9A 4UOEA 2PY6A 5GM1A 3BWCA 3IEIA 5GWXA 3EVAA 3UA3A 4YMHA 3LECA 2ADMA 2BM8A 3THSA 3HTXA 3HEMA 3BKWA 3DMFA 3KQWA 4E2ZA 3FRHA 5DX8A 1RJFA 3DLCA 1KHHA 4C4AA 1EIZA 2XYQA 3B3JA 4PNEA 3KQOA 1AQJA 3NWEA 3MQ2A 3QV2A 3GRZA 3D2LA 5KS2A 3CC8A 2PX8A 1BC5A 3LPMA 5M5BA 3RIEA 1YZHA 2CKDA 4FP9A 1V39A 3CBGA 1NV9A 3CJTA 3A4TA 4DZRA 2EX4A 3G2PA 3MAGA 1JG4A 3I53A 4OBXA 1O54A 5E9WA 4MTLA 1KXZA 1RI1A 3O7WA 3GRRA 3I5UA 3JWGA 4X1OA 3SM3A 5D1NA 1NBIA 5HEKA 5HIKA 3GXOA 3FTDA 3FUWA 3B89A 5DM4A 3P2KA 3THRA 4WXHA 5DM2A 1X1BA 5EPEA 1OR8A 3UJBA 4DKJA 4GEKA 4RWZA 3HCEA 3OZSA 4PWYA 5GOZA 5LQCA 2C7QA 3C3YA 2ZW9A 1R6AA 4E2YA 3IYLW 4R6XA 4AX8A 4GOMD 1MJFA 4PYOA 1L1EA 3NDJA 4GOND 3TKYA 3KR0A 5K05A 2F8LA 3GRYA 3LSTA 3MTEA 3OCJA 4X61A 4CKBA 1R8YA 3HA5A 3JWJA 5ICEA 3DR5A 1RI4A 4KDRA 5U4XA 5EC8A 4EK9A 4RTKA 3G7UA 3ORHA 3DMHA 4C03A 5ICGA 2Y1WA 1Q0SA 1QAQA 5CCXA 1KIAA 3BGIA 3CKKA 3EGEA 1TW3A 3EVBA 3HVIA 4IKPA 5E1DA 3HNRA 5EMMA 2HR1A 3UJ9A 1KYZA 3MB5A 2P7HA 3UWPA 1EG2A 4R8RA 2JHCA 1JG3A 2OPBA 4LG1A 3SXJA 4XUDA 4ZTBA 4PYLA 1UIRA 2EG5A 2Y1XA 2WA1A 2A14A 4FSXA 1NW7A 4PGHA 2EFJA 5DX0A 5DX1A 3T7SA 3VC1A 5HIIA 1WG8A 1JQ3A 1KPIA 1L3IA 3DXYA 5K09A 2FHPA 4YUYA 5MHTA 2P3LA 2CL5A 5LQRA 2PX4A 5DT2A 4P7KA 5K0FA 2ZFUA 4A6DA 3GRUA 5EZQA 3UJAA 4OA5A 2OB2A 2ZTHA 5E2BA 3ERCA 4IV8A 1RJEA 3JWHA 2VZ9A 5BW4A 4FT4A 3OZRA 2ZBQA 4YV1A 5E9JA 3A26A 3FRIA 5E1MA 2FRXA 1QZZA 2ZIFA 3DULA 3IHTA 5DSTA 3UJ8A 5K03A 5T64A 2IH5A 1VP3A 3GCZA 3OU2A 5FUBA 4YV0A 3P9KA 4F84A 4ER7A 2I6GA 5CVUA 2FYTA 2H11A 4U7TB 2OZVA 4RTQA 2AS0A 1KPGA 2YVLA 3LBFA 3ID6C 5E1OA 2G72A 3T7RA 3FUUA 5DLYA 5HFJA 3FPJA 2P7IA 3NTVA 4PYQA 5CUQA 5DXAA 4QVKA 3EEYA 1ZGAA 3TLJA 2P3OA 3KR1A 2QY6A 4DMGA 2ZVJA 1VLMA 1L3BA 1NW5A 3EVDA 4QDJA 5LSAA 2B2CA 4AUKA 3G8BA 3PT9A 2PLWA 4LECA 2AN5A 3LX6A 5BXYA 2ESRA 1F38A 3OU6A 4PONA 1F3LA 4XUCA 1XJ5A 4M37A 3M6VA 4F85A 2ZZMA 1WXXA 4GUAA 3FPGA 2IFTA 1QAOA 3FPFA 4ISCA 4CXMA 5EOVA 3BWMA 2PT6A 3SSMA 3AWIA 4YUWA 2AVNA 1G38A 3B3FA 1AQIA 4P7GA 2ZBPA 3GNLA 1VQ1A 4AZTA 3M70A 5DSXA 5EHIA 5JR3A 1SKMA 1AF7A 2GAFA 2I62A 3KQSA 5EMJA 4RTLA 1VL5A 2AR0A 4CKEA 5FHRA 1XCJA 3KU1A 1P91A 3LCCA 5BW5A 3P9NA 2OKCA 1FBNA 3DXXA 1HMYA 2ZIGA 3PX2A 1N7JA 3AJDA 3B3GA 3FTEA 1YF3A 3ME5A 4EQZA 3OE5A 3O4FA 1NT2A 1UWVA 4E2XA 5C9ZA 1IY9A 1SVUA 4RTJA 3MHTA 2XVAA 2PXXA 3HVKA 3MTIA 3OFKA 4QTTB 4Y2HA 4YMGA 2HNKA 3TR6A 4FGZA 2IBSA 1P1BA 3R24A 2YQZA 4AZSA 1X1AA 3MERA 5LQUA 3R3HA 1JSZA 4GQBA 5G02A 2Z6QA 1BKYA 1X1CA 1Y8CA 5HIMA 2XYRA 2G70A 1D2GA 3TM5A 3PLAE 3KPYA 5EIFA 4FSDA 1L9KA 4KRGA 4M38A 4E70A 3ER8A 1P1CA 2AVDA 2VS1A 3C0KA 4E32A 3EPPA 1JG1A 1NW6A 5DTMA 4GOOD 5DTQA 3RODA 3LKZA 4R05A 2V74B 3E7PA 3RW9A 2NXJA 3GJYA 4HGZA 4MQ4A 4BLVA 4YUZA 2Z6AA 2AOUA 2YX1A 3EGIA 3TM4A 3U81A 1SQGA 3KKZA 5HZMA 1KYWA 1XTPA 3PX3A 4EVIA 5DWQA 2GA9A 5K0JA 3NWBA 3LDGA 3TOSA 5DM1A 4CTJA 4HC4A 3DP7A 3G5TA 5CCBA 3LKDA 5KYGA 2QM3A 2HV9A 2B25A 2IGTA 3GU3A 2VDVE 2UYOA 1WXWA 4HRAA 1YUBA 5C1IA 2YTZA 4E31A 2NYUA 2R3SA 4ER5A 5EMKA 3KQQA 5K0EA 1TPYA 4MWZA 4FR0A 1RI5A 1XDSA 2ZBRA 5GM2A 3P2IA 3M6UA 4B17A 2I7CA 1M0EA 2NXNA 3T0IA 5FA5A 5CD1A 3UJDA 3WSTA 1R8XA 2GH1A 2JHAA 5FTWA 3PS9A 2V7EA 4F86A 2PV0A 1AV6A 3TMAA 4V0RA 4QQNA 2ZIEA 8MHTA 2O57A 4RX1A 5LQJA 4DA4A 1O9HA 5HOQA 3BXOA 3TQSA 3KHKA 3HCFA 5HILA 3HCDA 3SSOA 2HWKA 5E8JA 4ER6A 4BP1A 4ER0A 1YFLA 3TPZA 5FA8A 3P2EA 1Z3CA 1NE2A 1XDZA 1NKVA 1O9GA 3EVZA 3FYCA 2B3TA 3NW9A 1KP9A 1SQFA 1R00A 5T67A 5E1BA 3EVFA 3X0DA 4MIKA 1BOOA 5K0GA 3KPWA 1XCLA 4RV9A 3FPHA 5CVDA 1R74A 2P35A 3M4XA 2XBMA 4V0QA 5F2KA 1N2XA 3MGGA 4WVLA 4Y30A 3TKAA 2WA2A 3DLIA 4M36A 3R9XB 5ICFA 3FYDA 4KW7A 1D2HA 3HA7A 3FUVA 4C07A 4PIPA 4C06A 1JSXA 4X63A 2IDJA 2PT9A 4RYLA 3CJQA 3HP7A 2IBTA 1QANA 3CGGA 3GWZA 3HM2A 4POOA 4KVZA 2OY0A 2HTEA
chains in the Genus database with same CATH superfamily
2B3DA 2BELA 1JKJB 2R6ZA 2ZRNA 3MTGA 2LKCA 3PUVA 4JUBA 3RFFA 2C8KA 2YXPX 3UMMA 1DHRA 4JB2A 2WLSA 1JEQB 3Q9NA 1SXJC 2C4TA 3UWSA 5BR1A 5KOHB 3RSHA 3T5BA 3MMPA 4FNAA 4DQUA 3O8LA 3HABA 2VDJA 2FRDA 1Z12A 1G20E 1DEHA 1E1YA 1FQOA 2WWWA 3HLYA 3KLBA 4HR7A 3NAQA 2H1RA 2HU8A 2WHYA 1OLSB 2XXBA 4II3A 4L22A 5IULC 2OHOA 1WDKA 3DOHA 1FSGA 1U1FA 3CRVA 3Q88A 3LGAA 2PJDA 4CCSA 2UZAA 1ODLA 1GKKA 3ZE7A 4E7PA 2ZWIA 3NHWA 1DBQA 2DFKB 3DT6A 4Q4LA 3RHFA 2HMWA 3G6WA 1F8GA 2KYRA 1E4EA 4L0DA 2VJNA 2QNIA 1T8TA 3RWOA 3SVZA 4YP7A 1A97A 2R2GA 5KYUA 3JYQA 4OJYA 1Z2DA 1ETHA 1NM5C 4A0FA 4B73A 2C04A 4L4XA 3RJMA 1Y9JA 3TUZC 3EWAA 2JBAA 5BYBA 1JMKC 1A9OA 1Y3HA 2I71A 2JFUA 3EH2A 1ISJA 4O2BA 1ZU5A 1Z5WA 1BMDA 3GLGE 5H3LA 2O8EB 2FN4A 1QOQB 2DKNA 1YK0A 1SCUA 4F5ZA 1I7PA 1LTHR 2DULA 2BGUA 2D0IA 1N8NA 1TZ2A 3PT5A 4M86A 3ZG6A 2VJYA 4AN1A 2RK4A 2ZB3A 3JAWA 3LIPA 2RCYA 4YP0A 4G07A 4XGQA 4LJSA 4U00A 2PNJA 4NEHB 3SJBA 3LXUX 3N2KB 4P7BA 5BQ5A 3TLMA 3KKPA 3RYCB 4KR2A 5B3AA 2LUOA 3BM5A 2PUBA 2E82A 3G13A 3V7YA 4B4DA 1U0FA 5FAXA 1F17A 1GNTA 3DV2A 1I9GA 3F4LA 2HMUA 4D9CA 4BNYA 4NMWA 1AZSC 1O95D 3WIBA 3WKCA 4DCCA 4JYAB 3QF7A 4CV1A 3V97A 3ADKA 4Y2VA 1K6XA 1JBEA 1F0NA 4Q93A 3CTPA 4ZYTA 2KQUA 3GFSA 4PXSA 1BIFA 5F3RA 4HGRA 5HGXA 1ES9A 3A9CA 2I87A 1A5TA 2FQYA 2F1IA 1CJKC 1SUBA 1DEXA 1R9MA 2R6R1 2ST1A 3QKSA 4AUEA 3GZNA 3MQ4A 4KLAA 5C7OO 2XUGA 1XDWA 3S2YA 4U0KA 2OYSA 2CYCA 5L53A 1I2AA 5KREA 2GM4A 4UM8B 2C9MA 1T9DA 5EXPA 5DH9A 2YV5A 2CSXA 3O82A 4UAGA 3Q0EA 3VH3A 2FR8A 4IR7A 1W85B 4X8LA 1KZGB 1KI6A 1VSUA 1MXHA 3KAQA 2EJTA 3BFPA 3E0QA 5SV2A 3WSVA 4Z51A 3B6MA 4WCFB 4UU0A 1W36B 1QR6A 4I5IA 2O2YA 3GZNB 1K0UA 2EQBA 3COPA 4PCLA 1TQ2A 1W9HA 3GJXC 3KLPX 3BN3A 4GRDA 4J0QA 5I7EA 4U02A 2C8VA 3A6PC 5DEOA 3FCYA 5KNBD 5KTTA 2BKUA 3BRSA 1FMLA 1MJGA 3H3JA 4K0RA 5CT9A 3O5AA 4TKVB 1X7XA 1ZM4A 2NTYC 3MMNA 2M1ZA 5JQWA 3V1MA 1BRMA 4ARVA 3TLGB 2NZUG 1O8CA 3FDZB 5HTKA 1XCOA 2DHDA 5B53A 1U5CA 4M8NE 3GLQA 1C4XA 1WUHS 3H9BA 3NAMA 1ZL0A 1PGOA 1Q0LA 1PEYA 2FPGA 2F7SA 3EOAI 2EP8A 1BROA 2NVBA 1KA9H 2RGYA 5DM70 3MTAA 2VJOA 2YVQA 3HBAA 4BV3A 4XGRA 2VLBA 4EAQA 2ZJ5A 1YDMA 1KI2A 2ZT7A 2PO7A 3O0DA 1A5BB 4XQCA 4XWYA 1P9NA 2C20A 5IAKA 5BYJA 1QFSA 4NBVA 1T2DA 1XVAA 1NV8A 2ZVPX 4ZI5A 1GL6A 4JK3A 1QX4A 3S70A 1TO1E 4ZGGA 1H5UA 3O1JC 3X1DA 4Y7CA 3KPVA 3VC2A 3RROA 1ONSA 3NS7A 1MB9A 4YRKA 2WLTA 1QMGA 4C2TA 2IT1A 2W0SA 3GJSA 4WKNA 2WK1A 3GLHA 1ZVVA 1D5WA 2NTJA 1AO0A 4ZU3A 3KG2A 1VMKA 2QTWB 1IE3A 2H9IA 4L1KA 3T34A 5TPZD 2O2ZA 1XGKA 2HDOA 3LSYA 4IEIA 5KQSA 3CO5A 2P2DA 1IB6A 3OZIA 3DB1A 5FUYA 1Y4UA 5I01A 5GV7A 4TV9F 3U1TA 2WP0A 4LGYA 4KEAA 3G7SA 4Y2GA 4X95A 1FUYB 1CUGA 2DFTA 4L15A 2Y0BA 3EN0A 4XIFA 4B2LA 2WNHA 3F3SA 5EVCA 1CUAA 1GNLA 1NDUA 4FWTA 5HUHA 3W5AA 2W2LA 2X3UA 4FQ7A 2FUNB 1G6Q1 3CZRA 1Z28A 2AOVA 2ZS8A 5DNYB 1LPSA 4G4SP 4BNJA 4RM2A 3GCGA 4WK0B 5BRJA 4KBYA 3PCRB 3UB4A 2R65A 2CJPA 4KK3A 1S9HA 2GHRA 2CDCA 1P75A 3GDHA 1GG5A 1Z37A 2PT7A 3V8PA 3W5IA 2Z30A 5A9SA 4I1PA 5HR5A 5BN5B 4DLVA 3G2MA 3LGSA 3NVKI 5A5DA 4W5HA 5DLEA 4ZAWA 3GRAA 4MVJD 1XDUA 3EMDA 1WBDA 4GR9A 4BO4A 1JG7A 4XWKA 2ZYRA 3CJRA 1TF7A 3OEHA 3NALA 1TF5A 1FMFA 2FMUA 2R6JA 3HNOA 5G0UA 3QHAA 1DC3A 4OI4A 4HF7A 1IXSB 2AN3A 3AF1A 3OEED 3UAVA 4OQXA 3DEKA 1BQ3A 2D62A 1IN5A 1HOXA 3MQFA 3WADA 4DABA 5BRAA 3SK0A 4GXTA 1NIJA 2FI1A 1EAMA 1NXQA 1QORA 3Q9UA 3VR1A 1LSUA 1ODJA 1C3VA 5I7UA 5B12A 2PGAA 1HKUA 4H4EA 3ITEA 4CU2A 1DKOA 5C7YA 2HBYA 1SVMA 1WUIS 3ETNA 4YROA 3U13A 4B4OA 4E2WA 1S8OA 4FMDF 1OIXA 3M6IA 3HDTA 1XK7A 2PGXA 3VSDA 2V98A 2QXYA 1EVKA 3NEAA 1BN6A 3HVHA 4JIMA 3S4YA 1NHWA 4B6QA 4JBWA 4L57A 4DDTA 4L9AA 5JYBA 4F9FA 2A9OA 1XV5A 2J67A 3ZHVA 2ADMA 1DIOB 3RJ5A 3ROXA 4Z86A 3QKWA 4WOPA 4FNMA 4EX6A 4QTYA 1VA4A 2R96A 3L46A 3M1YA 4HZGA 4EY6A 5CDYA 2FOLA 2XCTB 1MT0A 4NLLA 4IGEA 1DP4A 1LJLA 3N8DA 3OZVA 3AT1A 5JSFA 1PK7A 1GFSA 3SJUA 1QP4A 3R23A 3WAGA 2HF2A 4OREX 1DEKA 1KXJA 3AF0A 3EIFA 1IHYA 1BX1A 2CFTA 4QJ3A 1V7PC 2BJHA 2OBXA 2PSHA 3F0TA 4FP9A 5CB4B 3KV3O 1Z35A 5D85A 2HWUA 3V4PB 2EBFX 1L7QA 3KKOA 4BKOA 1N32B 2FPIA 1M2HA 3ISJA 2Q0XA 1YONA 1M2OA 3KEMA 1GL9B 2FZLA 5GAJA 3T4UA 4MTLA 3D0KA 3ZHZA 1Z13A 4FILA 1RI1A 2CHQA 2NZ2A 3I5UA 1ILWA 4H1TA 3U3ZA 3WFZA 1FFYA 3GG9A 3DDHA 2RGNA 3HJFA 4PN3A 4ZCQA 1W59A 5CFQA 1ACMA 1Z0KA 1NI4A 4KXNA 4Q6WA 4D2IA 3GGGA 2VZEA 1NN0A 2PMWB 4E5YA 3BK7A 4L78A 3ANTA 2FG5A 4ZOBA 1B1CA 3ZK9A 3FBWA 2B6HA 4ZOLF 1FNNA 4YR9A 3PZRA 5FBZA 3RBXA 1L1EA 2VYNA 5B3JC 4KV9A 2F8LA 3KTAB 3VJRA 4UFPA 4Y67A 2ZUSA 1IOZA 3WMEA 1ZXBA 1E1QD 4LPSA 2VSXA 4QC2A 4A1OA 4G5GA 4XYLA 4PR3A 4KMOA 3P9ZA 1U7ZA 2I22A 4WFIA 4Y2TA 1RPNA 1KIAA 3GLVA 3QXGA 3TCKA 1TW3A 3W1VA 4CQMD 4DA8A 2GBGA 5MN5A 3RKUA 4MR9A 1BS2A 2X8JA 3RKRA 3WKDA 1GKIA 2WJWA 4XX0B 1JG3A 2OHJA 4LG1A 4AMYA 3O2SB 4Z9AA 2WVHA 3I42A 4FSXA 5KTKA 1QYDA 2EFJA 2HK8A 1EFTA 4C4XA 3PL5A 4CF3A 1ZC4A 2GN4A 2YL2A 3LAWA 4O63O 2XWPA 3WY9A 5JO0A 2ZUCA 1BQEA 5CB6A 1BKSB 2P3LA 2PZ8A 4BRSA 4K26A 1VPWA 1CU1A 3P32A 4CJXA 4KSBA 1SKAA 3JQ8B 3QFTA 4ETMA 1RS0A 5B64A 1WABA 5TMPA 1UKYA 3W1EA 1QF9A 4PGAA 4PU0A 1KI8A 4ID3A 1EH5A 3LP8A 4QJBA 4CQLA 2FZWA 1Y98A 2C07A 1DX6A 3DULA 3RS2A 2HI0A 4YQFA 2AGVA 3GCZA 1TLTA 1O9BA 2WD8A 3UXYA 4HV4A 4FE3A 3PTLA 2X9QA 3N7AA 2HWXA 2HJWA 1DFHA 1PJSA 2VP4A 2ZI7A 4FN4A 4H77A 5ESDA 3EMKA 4I50A 4U7TB 3IT0A 4DXHA 3I39X 4HO1X 4QUAA 3WGHA 2F43B 4G9EA 4M8SA 1LV7A 5ES4B 2V6BA 4BATA 3EGXA 1JJBA 1USKA 5THXA 2PQ0A 1F7VA 1FTSA 3EIOA 3K73O 5FTMA 4M7WA 4BWFB 2OR3A 2JCVA 4JU9A 4WY8A 2DF8A 1JQAA 4K9SA 4K1XA 2NN3C 3EIQA 2NM0A 1DV1A 1V6CA 1ZUWA 3HADA 4U2KA 3RK4A 2QQ0A 4AUKA 1E79A 3VVMA 2JI4A 2J07A 1YHYA 2GJAA 2R1TA 3H75A 3QMMA 1ZVMA 4C4SA 2F4VB 1EWVA 4MI1A 3TLYA 5KOIA 4OATA 1EJ2A 1WO8A 5EOVA 3SNHA 3DGFC 1YWGO 3LWNA 2RAFA 4K9NA 4NFHA 3WGMA 5FFFA 5FFNA 3B3FA 1AQIA 3D8NA 1EFVB 2VIIA 4S04A 2VXBA 4FDLA 3K0EA 5DBHX 6PFKA 3JU3A 2IYXA 3L8FA 3H5LA 2Q9UA 5LMUB 5ADVA 3DD1A 4UDXX 3KVRA 3RVQA 5JJ5A 1EUDB 1FJHA 4RY0A 2H3EA 3P4YA 4RPHA 5AKZA 5A4KA 3ZN2A 5F5XA 4FLMA 3TR0A 2OQRA 4Z4CA 4YRRA 1YF3A 3QG1A 3VPXA 1C81A 4I46A 5B4TA 2H1WA 4CN9A 3U4IA 4ALNA 3O8OB 2WQ6A 1TC1A 2BSAA 1RC0A 3U7EB 5FOUA 2PKYX 5DCLA 2VTBA 4DUZB 4OHXA 1V1RB 4BUJA 4Q4CA 2RAUA 4M9CA 3GQBB 3R24A 1ODIA 3R7BA 1OAAA 2Q3FA 3FWZA 1UCFA 5H8WA 3W5CA 2DXIA 3UW3A 3E70C 4D8XA 3QWIA 2XA1A 2XYRA 4RL6A 4NPHA 1GYRA 5DGTA 1LI5A 1KU0A 5G3ZA 5JARA 5CLFA 1F2TB 4M21A 4N7RA 4MYCA 3RSSA 2WG2A 1O89A 2B1JA 5IKXA 2YOGA 4CM8B 3TQRA 2EKPA 1E6EA 2W2OA 4JUCA 4RCYA 5A3JA 4YUZA 2X4DA 1EFRA 2F8MA 5FWYA 5EIXA 5AOAA 1KBOA 3LA6A 5J3JA 1WHTB 1RM5A 4WXRA 1QZXA 5HZMA 3EA4A 1RYYA 1XXHE 2X9VA 3BL8A 1R4MA 3PFWO 4Q0MA 5HZGA 3RSLA 2BUBA 3TB4A 3KLMX 3PXUA 2D3TA 5EKDA 3H05A 5BT8A 4PM4A 1YI8A 1B6TA 4RJJA 4I66A 2BFDA 2JGAA 1DAHA 2YZKA 2ZBEA 3C2QA 4ZK2A 4UUNA 4O4HF 4PHFA 1MVNA 3MHPA 1VCNA 1S4QA 1PL7A 4J0KA 1OFVA 4YLGA 1PL0A 2WIJA 3NI2A 1RI5A 2YOHA 1XDSA 3EYAA 3HDYA 5IT4A 4QAJA 4O2LA 2YFKA 2B4YA 1YRAA 1ULHA 4QDTA 5KJ1A 3D3EA 3IJRA 5C8YF 3OJOA 3B6IA 2VSNA 2WICA 1LW7A 5FTWA 1SCAA 3ZBQA 5TGTA 1RRFA 5AVRA 4D4HA 5T6MA 2WP8J 3HPRA 3Q0TA 2HO5A 4ZI7A 3RC3A 1Y42X 2FVYA 3WGKA 1GNQA 1N6KA 5EUQB 2O23A 2HWKA 5ARDA 1N6OA 3EK2A 4I4NA 4Q3OA 3PRKE 1DQNA 1E2FA 4J4BA 2VWQA 3BORA 1NKVA 1U2RA 2PL9A 4GZ3A 3CX8A 4EA9A 3P7MA 3VISA 1PYGA 3NW9A 1MFPA 1PR6A 3TLEA 5KCMA 4UREA 4HHEA 1UT6A 5A5EA 1ADGA 3DBHB 3F7OA 3OLQA 3PPXA 2XUZA 1FX0B 5L4LA 4NCAA 1PD0A 3CXRA 3N5KA 2P35A 2ZYWX 4ZI3A 1G7SA 3D0RA 1N2GA 1PNTA 3NNDA 4J0CA 4QHTA 1QG4A 4DG8A 3LUGA 3BMNB 1NXPA 4RDXA 3F97A 4K6OA 4EW1A 4QDOA 5E7JA 5HCIA 4IDEA 3G82C 4Q9DA 1N92A 4UMFA 4YBZA 2OG2A 2J7PD 4AJOA 2X14A 1A2OA 4W5QA 4JEUA 4ILKA 2ISSD 4V3CA 2A78A 1TPZA 5CG2A 5HKKA 3RTEA 4NBNA 2OCKA 1CNMA 1M1YB 2HLNA 4ZO8A 3QLEA 1ZHOA 3C1AA 1OCEA 4XFDA 1VBMA 2OYCA 1JEJA 1P72A 2YIVX 3HCAA 4JLVA 3TLGA 4Z9XA 2FEAA 3ILSA 3EZFA 3IVGA 5LBTA 2OCGA 3B1JA 5F2OA 1GLGA 4ZGBA 2PX5A 3EISA 2UZ3A 1TVKB 1HETA 4JBLA 3OQHA 4UUQA 4NV1A 1FTWA 3C3PA 4P84A 1A4IA 3N28A 4CKEB 3THWA 1AKWA 4DPKA 2QJRA 4FGKA 4B6EA 4EUNA 3HFRA 4RPIA 1SCQA 2ECOA 1QS0B 4LDNA 3VUFA 2MYNA 4ES6A 1XU9A 3N75A 1M1ZA 1YVRA 2FZCA 1YZ3A 3W6ZA 4K9PA 1GPAA 2QI9C 3E9DA 4BWVA 2R87A 3S2SA 3QJYA 2IOFA 2IWRA 2YW9A 5BN4A 1PV4A 1FX0A 1RD4A 1XMSA 1ONPA 4QU9A 4BNVA 5LR6A 3C8HA 4PC7A 4JXXA 2IY8A 1KOFA 2PBFA 1IOVA 3LY9A 2OFOA 3E7FA 3T41A 4GBED 4M55A 3O4IA 1E0KA 1M6EX 2Q45A 3ER6A 2VDKB 1DCTA 4IDCA 1TB4A 1TMGE 1C9MA 4EJ2A 3IILA 4ED9A 3IV6A 2X58A 4GXNA 1FFCA 2PXAA 4A2WA 3U56A 2JJQA 3N6RA 4URYR 4C0LA 3OP4A 1A5ZA 4EL5A 1IB0A 1JFLA 3KQHA 1LPNA 3AW9A 4A2QA 2GK3A 3PNQA 2C2GA 1FDWA 4KI7A 4YS6A 4UTOA 5EJ6A 5LA6A 3HB4X 3ZV4A 5HSGA 3NFRA 5HBRA 3H5OA 4IG9A 4JKYA 4RESA 1D0VA 2W6JD 1H23A 3OECA 2AZDA 2J46A 4L5YA 2RHRA 3HCBA 3KT6A 4WLEA 4W6ZA 4CM6A 2B20A 5KJ6A 4MW0A 2VTDA 3HGQA 2VK4A 4JWKA 4PTZA 4OP3A 2I4LA 5JJKA 4JB0A 1AQYA 4JT4A 2J0SA 4MPJA 1I5EA 4JBXA 4GI3A 1LJUA 1K89A 1E7RA 1TL7C 3OBIA 3PYMA 2IYQA 5ALPA 5IEBA 2HJ9A 3BXEA 5KJCA 3KQMA 1J9EA 4OTZA 2E4YA 3VTZA 3FHLA 2GB4A 3KJZA 4R8LA 5FI1B 3W1WA 2A1TS 5EXSA 1V5FA 4DQLA 2NP7A 1NDQA 4JYZA 4ZT2A 1AGXA 1Y82A 3OQIA 4B5LA 5I9NA 3UUWA 5EUCA 4PHCA 5FUWA 5K0SA 1MBZA 3EIWA 2ORED 3G7NA 4I4LA 2UZ1B 2EGUA 1D2MA 2PHZA 2QN3A 4HJRA 2WFLA 2ZIUB 1P7VA 1V8PA 3O3NB 4M88A 3DE5X 3DM9B 4OV6B 4OXNA 5ALYA 1KDZA 2DUUA 3FCSB 1I7LA 4K6FA 4WKGA 5EKUA 4CKWB 4EECA 1AKVA 2HB6A 5CVEA 4JVMA 2D4AA 3ED1A 5J1TB 3UQYS 4XWTA 4C7VA 4I1OA 3OE4A 3ONEA 2AG1A 2ACKA 3GJ5A 2FDXA 3NLLA 4RA9A 3L8EA 4QZVA 1Q95A 3CX3A 1AK9A 2WIGA 3HYLA 2QGNA 3RS8A 1FLDA 1HDOA 1FUKA 3K6SA 4G4JA 4F3TA 2PMKA 1TQ6A 2HRDA 1G60A 3RTDA 1L7RA 3DEFA 4I1UA 1V35A 3NHYA 2Q5OA 1BH2A 3SMVA 2F1RA 3G5LA 2EZTA 3QOYA 5EJEA 1A9PA 5LBUA 3TZ6A 3GQBA 4YRTA 3FFTA 4G41A 4YAJA 1F9EA 1T1JA 4LXTA 3CUKA 2LIPA 4DJAA 4R0MA 2BAGA 4FFLA 2ALJA 1RZRA 3KTFA 3QA3E 4N0EA 1DIBA 1KVSA 2X9GA 4L4ZA 2ZRAA 3M82A 3BMOB 3L6BA 4C0QC 3L1VA 1XLTA 3A6FA 2I80A 4E5PA 5CT5A 3FHTA 1VLJA 3BBPA 4DFDA 1JILA 4LN1A 5J4LA 1FQJA 2O3UA 1ZXLA 3Q72A 1ADFA 1JTEA 1Y3FE 1XX6A 2JF0A 1UUFA 4BN4A 1ESCA 3THYB 1ZG3A 2XE7A 3NPMA 1QWOA 1CUZA 1MN6A 1S3GA 1Q20A 1V11B 3IPYA 4KG7A 5EIBD 3ROQA 5L40A 3FFWA 5M29A 3GLFA 3TB6A 2VYFA 5IXSA 3F5MA 1WB5A 1ZMOA 1FDOA 1VB5A 4K2AA 2REBA 4RFVA 4A8HA 2H92A 4CKBB 3BIOA 3QOWA 3B85A 4ZHQB 3TG2A 1CKEA 4NJMB 1DTEA 2ZCUA 4OA8A 3O8QB 5AHXA 4EY5A 2ZCJA 5FBLB 3VU3A 3H1TA 3T7IA 3KJNA 1ZW6A 1M8PA 4DR5B 2I7TA 1TZBA 4WI1A 3E8MA 1BX0A 3ZX5A 2QSJA 1DIRA 2JVJA 1MHTA 2GNAA 1H8EA 1KHTA 2QT9A 1FPMA 4IZHA 2HA2A 1S2OA 4ZI2A 4DJTA 4BECA 1H9AA 4HAUA 1H8HA 2XQFA 3FCXA 4HP8A 4MPRA 2QZ4A 3KUCA 1O95C 1C1YA 3L7DA 4ME6A 4TWZA 4WFQA 3ZV5A 2J9YB 3R6TA 3F73A 3C7TA 4XQGA 3KVVA 5E7MA 2RHJA 1TOAA 4L3WA 4XDYA 4D9NA 1V2HE 2CZQA 4LQLA 7MHTA 3JPWA 3G2OA 3B1KA 2FSHA 3JY6A 3MB8A 4MW4A 4LNUB 1KQNA 3TF5A 5H1YA 1T36B 5AW8A 3KOUA 1G21B 4GDMA 3WRXA 5C51B 5BPFA 4D0GA 4QASA 1E3TA 1DJNA 1GNPA 3QI2A 5FPSA 1C2TA 3JQFA 5K20A 2JGKA 4AF8A 3ITDA 1JHXA 3PA6A 1NMZA 2JJ8A 3QLVC 1VSBA 2XMQA 5DBOA 3IE2A 3K4HA 1UKBA 1WX1A 4ARBA 4ERNA 1ULTA 2ZRFA 3UGJA 1D2CA 2XMZA 4MINA 4MQ6A 4OFXA 4BJ3A 3QWHA 2X41A 3EGXB 1BW9B 3E2MA 3QX7A 4JUAA 4YRIA 3PEWA 4J6EA 5A4IS 3AXSA 1KJIA 4NVRA 2CK3A 5CM9C 3AJEA 5JWRA 2XF8A 3HMQA 4MYRA 1RW4A 2YN4A 1OLUB 1KNQA 2GS9A 1FP1D 4GP7A 1HRDA 4BDTA 2IP1A 3AP1A 3KWFA 4MVJP 3TG8A 2Z2JA 2BDUA 3O4JA 4RHUA 3GPBA 1YCFA 4YACA 1GGMA 3VKVA 1X2BA 1MPTA 2O8EA 2IKSA 2JLSA 1KRHA 4HEHA 1JBQA 1H1DA 2QM0A 2ZYAA 3A1EA 3ZLUA 4PPYA 1NNUA 5AXAA 5IKOA 1QS0A 3RIMA 1C30B 2GN6A 4L0MA 3ZHQA 1KKMA 1ABFA 1X80A 1RAGA 1R5BA 1NMSA 5J2UB 1G6KA 2AL7A 4BZZA 4B3XA 1E62A 1XLWA 5FBWB 1NLMA 1DFIA 2N46A 3KQWA 3GJ3A 3VOBA 4JI4B 1DHTA 1SVOA 2BP7A 1KOLA 4XYGA 3H04A 1SBHA 4IDDA 5LP6F 3QV2A 2K5UA 2WDZA 1T4CA 4IIHA 2P2GA 3MTDA 4NHOA 3FOFC 1QE3A 1WQ1R 2RIPA 1ECFA 3OCYA 1A1VA 1GZ3A 4NYMQ 1XHLA 3PI6A 1GZ4A 1U1GA 1V39A 4LI3X 4K6KA 4FZ5A 1Q22A 2XDQA 4K6HA 3ZQKA 4B2IA 1ADBA 1PGPA 5FOTA 2QX9A 3I53A 3ZDBA 3OPXA 1JA9A 1NTOA 1P18A 3I92A 2H06A 4Z2AA 3K6KA 4TZ0A 3QVLA 5JRDS 1LBIA 2B8TA 3UUFA 4O4JB 3ZWOA 1PS0A 3NKVA 2CCJA 3EZNA 3PFFA 3SLRA 2XQGA 1SBCA 1DPGA 2BI4A 3NZEA 4RKYA 5LD2C 1YB6A 3KQLA 4F2DA 4QICA 1PD1A 3D3KA 3ZCSA 1A9ZA 3MWYW 1EZZA 2JCSA 2R7NA 4JC4A 1TO2E 2YJGA 4PCUA 4C7BA 5JI3E 3KQNA 2JAPA 2AKAB 3QBVA 2AW5A 3CLSC 5C35A 4K3VA 3RH0A 2QD1A 2FMIA 1M9NA 5SYMA 1A8HA 1Y8RB 4P4UA 3EXHC 1IJBA 2GF0A 3NDJA 3QIAA 3KR0A 2WU8A 4PE5B 4UATA 1NBME 5IJAA 4BX2A 5JS6A 2QTFA 4B3RB 1YJXA 3NX4A 3OSUA 2Z6QA 2EP5A 4DLYA 3ORHA 1XZIA 4CEJB 3RRFA 3TLKA 1ZD2P 5CCXA 3HP1A 1TEVA 4BWGA 4UNIA 1UDBA 2FZ5A 3VZQA 3USZA 4ZI7B 2WV7A 3F8SA 1Q6YA 3TL2A 5JNUA 4HI0E 3O73A 3AB3A 3T0GA 4D42A 2BFFA 5BRNA 3KE8A 1QB8A 4KP7A 5CB0A 1ONBA 1I30A 2D5AA 2PBRA 2W00A 1PBNA 4US0R 2ORIA 1U8AA 5AOVA 3ZJ4A 4WPGA 4E4YA 5DT2A 1M34B 1WW3A 4ZCTA 1UP6A 3K72B 4RZIA 3CNNA 5JJIA 4WOJA 3ZV6A 4IV8A 1JSCA 1K5GA 2YHBA 4FT4A 4LWZA 2B9VA 3W7VA 1P74A 1KK1A 4OMCA 2A0XA 1OZHA 1P3DA 1HTTA 1ST3A 2HU7A 2Z0MA 2WT9A 5DSTA 4DLTA 1VP3A 2WTXA 3VBEA 3ICOA 2QTTA 5K03A 3MUFA 4KFRA 2O8DB 1U0TA 1MGPA 3A04A 1ETUA 3L41A 3MBKA 4Q9AA 2ACVA 2WU0A 1EGVB 4UNPA 1CQZA 1P1KA 2R8RA 5LL6P 1MO5A 1Q14A 1VE7A 1R0ZA 1V9CA 3KUKA 4I36A 2ZJ1A 2AN1A 3GGCA 1FP4A 2FOIA 4GNRA 4W63A 2ZBFA 4XYMA 3VKUA 5HKKD 2CBGA 1KKLA 4PEVA 4XIGS 1X1RA 1OA0A 2SKEA 4UU8A 1KI7A 1PR5A 4V1CI 3M3DA 1GPDG 2DCUA 3HSSA 3IIEA 1B8NA 1GVNB 2H2HA 3NTOA 3OZDA 3PPYA 4GKBA 3IKTA 5CUQA 1WUJS 1AVTA 1SVNA 1LLUA 2G04A 1LQUA 1UOOA 3EXFA 1P6XA 2VHWA 1I7SB 2JLBA 2ZVJA 4X62B 4BO6A 4X0EA 3RE1A 1AUPA 1DX4A 2YHIB 2DKOA 1OUMA 1EK1A 5E0KB 3L1KA 3RWBA 1M0WA 3LIIA 5ECGC 5LKAA 4KQMA 4YP1A 1YZGA 2YDYA 4D3FA 1RYNA 2CB0A 4NBSA 5BURA 2ZZMA 1G2OA 5BUCA 5DGDA 4CXMA 4RABA 1NZDA 2EU8A 1AH2A 4DQDA 2A88A 2WU1A 3D2CA 4MDYA 5EIOA 2FLVA 2FQ1A 3T06B 3X1WA 1K97A 1R3DA 2XUOA 4IIYA 3QKRA 4OB7A 1H3EA 4B76A 2JI7A 1H5NA 1CUEA 5EHIA 1SY7A 3OTIA 4HWOA 4OOFA 1XXHB 5BN4B 2PMEA 4L72A 3LCCA 5HNKA 4B2PA 4KODA 2WM8A 3NBZC 1XJWA 3R09A 4K28A 5JVDF 3Q3HA 2RE8A 5LZ5A 1K7FB 1XCBA 2Y0DA 2O19A 2WMYA 5K6TA 1O8BA 1SVUA 1A69A 4BBAA 4RTJA 5KSYA 2CDRA 2V6MA 3PPVA 4AL4A 3E1GA 3QLUC 1P5FA 1G7RA 2CVPA 1TVKA 1FMCA 5LQUA 5AUPB 1ODCA 4QBFA 4UCWA 3R0ZA 4NG4A 1EWTA 5AI9A 4QU0A 4AW9A 2WOOA 4FB5A 1J99A 4PLTA 4Y9UA 4ZODA 2OORA 3VR0A 1M83A 1PR2A 1EKXA 1ZOIA 2D0OB 1M8GA 2HCJB 3IAFA 3ER8A 4INJA 1A7KA 3G2LA 4N5LA 1LPBB 4EELA 1SQSA 2ZKIA 3GT0A 1JG1A 3UTCA 5DTQA 2H1CA 3LFUA 3RODA 3WLHA 2BGNA 2Q0QA 2PT5A 1U3DA 2QVCA 4NV3A 4F4IA 3BWVA 4V24A 3NNSA 2W6JA 4R2KA 3TNFA 3KUXA 3ZWBA 4OAPA 4C4PA 5JH7F 3WK8A 5AMXA 1MKYA 3D6JA 3JVEA 1Y3BE 4B7ZA 1PTJA 4A03A 5AW6A 4K3UA 4IQ4A 3H11B 4V0OA 5CCBA 1W2GA 1FU4A 1AZTA 1YR6A 4FR5A 4JC5A 1HL3A 2FRVA 2PJZA 4WESA 1GQFA 3ZH9B 4DAEA 3OLCX 5DN6A 4I9GA 1SZPA 4W5WA 1ZUNB 2TMYA 5C1IA 2V5UA 1QX3A 2OPHA 3CVXA 2BI7A 2Q46A 3KS9A 4PZLA 1H2HA 5J2TF 4YP9A 3IVAA 3G8DA 1AKMA 4YMUA 3M6UA 1Z4MA 3A9VA 3B52X 4YMWA 5E6RA 1EWKA 2EGGA 4ZAVA 5KDLA 4BX9A 1OA1A 2JIDA 2PSJA 1I01A 1LVGA 2AMYA 2CXSA 2HUPA 3R0XA 5LMCA 3AVWA 2RGWA 3B6EA 1GTSA 4KQ9A 5ISMA 2BTQA 4C88A 4B3HA 4IVRA 4LDAA 3N2KA 2OHVA 2ZIEA 2MR5A 1TX4B 1H85A 3FIJA 4JA0A 4KGXA 4AULA 3KZOA 3TQSA 1O96A 2JDIA 2WWIA 1YB4A 2DX7A 3L6DA 2XMGA 4EJ6A 4XASA 4WCFA 1YFLA 2QRNA 3SEZA 3HE3A 3W04A 4AFNA 3E2IA 1AKYA 3S6JA 1U9ZA 3OJXA 3Q6MA 2DWCA 4MGKR 1MG0A 1QIHA 2H1HA 3ZWNA 5BORA 3V1LA 1LS1A 1SD5A 1X39A 2CNBA 3AB7A 3AM5A 3KPWA 4R83A 4EYOA 4BO3A 2NU6B 4LVNA 2QQEA 4V0QA 2DEUA 2CJFA 1PDOA 1YZQA 2GBCA 3L7AA 1T9HA 4KW7A 4PBRA 3U17A 4YB8A 4PIPA 1E5DA 1KYXA 3OMLA 2IDJA 2JFZA 3M6LA 5I6DA 3HKBA 2IBTA 1WW2A 1DJMA 3CGGA 1H94A 1RP1A 5LC1A 3BF7A 1QVVA 2OXIA 3T12A 5KYUB 5LMNB 1DO2A 5LUAA 3LBIA 1SB9A 3DDCA 2C2MA 1GRNA 1SZJG 2J7KA 3PEEA 2CXQA 4E51A 2E2WA 5AUQA 2HIAA 2HZ7A 1PEAA 4JOQA 4K05A 5U1PA 3TZKA 1KF0A 4Q7QA 2RHTA 4ZU6X 3IKLA 1XMQB 4NE7A 2PDAA 1EDDA 3V7FA 2CMGA 2VRNA 3BVPA 3JD1A 3PGKA 4GW3A 3W6OA 5HKBA 1WMBA 1QAMA 2XTJA 3KVNA 3DWIA 1VPVA 3JQAB 2X7XA 4N5NA 1ECCA 1KEVA 1X1SA 3GCXA 3F46A 4X7MA 1FW8A 1V8OA 4RVDA 5JT1A 4RZ3A 3ROPA 5HS4A 2G07A 4AY5A 2H8KA 5JCJD 2EOAA 2GNPA 6NULA 3EXHA 5G1OA 4KK4A 1OTHA 2YDXA 3IOCA 4FU0A 3NT5A 4MV9A 1IJFA 3JR7A 4Z1MA 1CSEE 1O94A 2IYTA 3QUCA 3RDPA 1LDBA 3GD7A 2ERCA 2FF7A 1AQLA 2OGUA 1YJQA 3HV2A 3QTLA 2H4HA 4ZMSA 1T2AA 2HBRA 4J3JA 5KDOA 2X19A 2XE4A 3N8NA 3S68A 3KSBC 2C7OA 2G1PA 2KHZA 1UAGA 2VUTA 3ETGA 1MB4A 3ZE8A 1ZH4A 2PH1A 3V00A 1KQGA 5GIOE 3DBOB 2GCGA 3W5SA 4A92A 4R2HA 1FX1A 3LBYA 2QW8A 2K4MA 1RPZA 4B3MB 1XZDA 1S2MA 1D1PA 2O0KA 1FXWA 2VOJA 4RD2A 4YQZA 4ZVVA 2FA9A 3RFXA 3TOCA 3X1XA 1BDHA 2CD9A 1IEXA 4RVOA 1E8NA 1KMQA 2DFNA 1Z75A 2RC5A 4MKFA 3SHQA 4OI0A 2PKQP 3VTFA 1Z0IA 1VXRA 3INGA 4GECA 2P8SA 4PLVA 3CLHA 3IXLA 5KOHA 2R84A 1J2YA 2GZRA 1SXJA 3ZE9A 2WE8A 1UJCA 1GFZA 2HC9A 1SULA 4WXEA 3LLUA 3JAKA 3CVOA 2WSSD 2CBZA 2OV2A 4EDFA 1RJWA 5BMOA 3ABZA 4U2CA 2RGRA 4L51A 1YU9A 2DSNA 4XIJA 5EEGA 4DCPA 3KSZO 5ILGA 5HMLA 5EZYB 1XVLA 1O57A 3RUFA 2W8ZA 3AF5A 3FNHA 3UFXB 4JC0A 3I72A 1XWWA 4TLBA 2WI8A 4CLDA 3AHCA 4NFLA 1JDBB 4HLDA 3BTUA 3VUEA 4QRIA 1V4BA 2P9ZA 1H9BA 2DBQA 3HFJA 4MGIR 3X1MA 1HE1C 1UH5A 3TTXA 2HPZA 1JU9A 1Z6GA 2IXGA 2VPZA 3HLKA 4BB6A 3GPLA 2FEOA 1GU7A 2FCRA 3RUHA 1E6KA 1JQDA 3VGPA 3FUCA 3AWDA 4IO0A 2BP7B 4ZCLA 1KMCA 3LHIA 4UUOA 2IZ1A 3MFYA 6ABPA 3KJQA 4C0BA 2Y27A 1CWUA 5JZSA 1SUSA 2BCGY 2WUVA 3TLCA 1WF6A 2LWIA 3R6GA 5FKJA 1BS9A 3ZXIA 2ATXA 5L3SB 3I5XA 2GARA 4NU6A 4CF5A 1G63A 2QTVB 3EUWA 4UHBA 1WXIA 4QTUB 2VDOB 4DLXA 2EJWA 3Q40A 4DQXA 4MLCA 1JA1A 2CHGA 2XECA 2NUTA 4DNQA 5B7NA 1Q0HA 3WRXC 3J80A 2XEXA 1RWKA 3FWNA 4U7DA 1UXGA 2C5BA 2X13A 3AP3A 5D5PA 2O8DA 3O4GA 4MS4A 1PR3A 2LRHA 3ENVA 3O26A 4XGNA 3PQ5A 4BE9A 2P0EA 3F7NA 4Q3DA 3CY6A 4WY2A 5G0TA 4CV2A 1KH1A 3P0RA 5GIPE 4BLRA 2VH1A 1XMVA 4MA0A 3NRJA 2H3HA 1JZSA 1EJBA 4EHBA 3SFVA 1B8OA 3QVKA 3ICPA 3MWDA 2ZRIA 1E89A 1ZD5A 3HDVA 3UMCA 3KVOA 4I4TF 1ZU4A 1C41A 4KXQA 4MMXB 3T3OA 3CRNA 1BD3A 4QJ5A 3H99A 3AHFA 2F6RA 3S8EA 2IHUA 4WT7A 2C2OA 2XDWA 3OZCA 3SY8A 2YOFA 2VN8A 4LVCA 2CBXA 4QPJC 5KWIA 2I67A 1WXQA 3T15A 4KE7A 3ST7A 2YBDA 1T36A 1UFOA 2NG1A 2WAYA 4B87A 5FWNA 2RH4A 1XOIA 3C1OA 3FTCA 2SCUA 4MO9A 1MB0A 1VKNA 3E6AA 3CLTC 2AJTA 4B6PA 5A1TA 3RF6A 1GZSA 4FFSA 3CUVA 1ZEMA 3AEUA 4QJ4A 1T9GS 1N9GB 4HYTA 4ITUA 1I7NA 2DY0A 2E3JA 1I4DD 3AM4A 2OBNA 3NASA 1P0IA 5AVUA 5FULA 4J1TC 1C7ZA 4HXFB 1XLTC 3UJCA 1JHVA 5D8DA 5KJFA 3AUTA 4RMJA 4QVIA 2AIRA 1NJ2A 3ZNNA 1XVVA 2G67A 3GGDA 3G2KA 1IWOA 4XXHA 3EFHA 4M7PA 5ALQA 4WINA 4QBIA 5EMLA 1U5AA 4BVKA 1CQWA 1MAAA 4Y2XA 4MB0A 3UB2A 3EEBA 3UMRA 6ADHA 1WVIA 1DDGA 2ZRDA 1LSJA 1XBTA 1RAIA 4Q4JB 1SN7A 3COVA 4LUCA 4R1QA 1KIMA 5J40A 1NUHA 2FPKA 4AKTA 4H1UA 5FR1A 3SLGA 4HY3A 4B6OA 4YCNA 4FT2A 1U7OA 3CIOA 3WLOA 2PKWA 3I3OA 1SCBA 3ZXUB 3SDSA 2B7LA 3KR2A 4WZAB 4DCOA 2ZJBA 5TF0A 2FK8A 1GQYA 1MU0A 1XDBA 3IXMA 4LK3A 4RMNA 2NTNA 3VAAA 1I6MA 1H3FA 4BVBA 3P9SA 2OEPA 4FUTA 4C0XA 5KTPA 1T0HB 2UUAB 2W93A 3FM9A 4IQFA 3KOWA 1JL3A 1KRXA 2O2JA 3KAJA 4AURA 1NPYA 1K06A 1RBMA 3AR8A 1NOJA 1OYOA 2W2QA 4ND5A 4F3CA 3A2MA 4F2PA 3HUEA 3RC1A 1R8QA 2VYND 1EX1A 1RQNA 2ODWA 4PZCA 1E1KA 2P2CA 4LXXA 3TW6A 1T8WA 3SYMA 1K86A 1PWYE 2VJQA 1YT5A 4GP6A 1D1QA 3C39A 3CX4A 4IVQA 4TLAA 6Q21A 3AHGA 5JZBA 2JBAB 4EHLA 4CLOB 5EZYF 4TUYA 2EFDB 4WKBA 5I45A 1NLZA 3OP1A 3A25A 1YIAA 3CMMA 3JARB 4GYWA 3L0SA 2W6OA 4D45A 1U7DA 4DCSA 4L5JA 4N8DA 5IAOA 4E22A 2XCLA 4MUKA 2BTQB 4I1RA 2UVPB 2BRUA 3SU8A 1QGED 1ST2A 1L4MA 5AI0A 3GGSA 3BKWA 3L6OO 3T9BA 4ESEA 3FRHA 1RT9A 4FOPA 3RJ9A 4C3OB 3F6BX 4PQEA 4C4AA 1H69A 3RV3A 1R50A 3KQOA 1H1LB 1T8RA 2C9YA 4X7PA 5TJHA 1VJGA 1QE5A 1SB8A 1ZEJA 2H85A 3ECCA 3IEUA 5DYWA 3ZJYA 5KS2A 5KU1A 1ZINA 3VR2D 1G18A 4DXDA 2LCQA 3WNVA 3BCSA 4L07A 3TRFA 1XF9A 4ZAFA 2G9VA 2EX4A 4I19A 4BTEA 4HMPA 4O4IA 4JNCA 3DKVA 2ZYTX 2Q07A 3HR8A 2CZCA 1KSJA 3V1KA 2XB2A 5FEMA 4LVOA 5AM3A 2OD9A 1X70A 4QXAA 1Q3KA 1T8UA 3SM3A 3QW4B 4CG0A 4BKQA 1RNLA 1GDDA 4EB0A 2C95A 3RK1A 4DV4B 1W49A 3K9CA 3B89A 3WQSB 1SOUA 2BCJQ 3NAGA 3PJFA 2C4VA 3A28A 3FI9A 4HZIA 4LJ7A 4V0KA 2VJLA 1N3LA 3PXBA 3KIPA 4JSYA 1UKAA 2H51A 3QKIA 4MQFB 3RAFC 3MTJA 1OXXK 1HDYA 4OH1A 4AX8A 5CNMA 3PDIB 2K87A 2P62A 4AQDA 3Q7PA 4LI0A 1P9LA 4G5OA 4QO7A 2XBLA 3HXQA 3DBIA 2VUSA 1R8YA 2GEDA 3ZGXA 2NAFA 4UD2A 3VI4B 2C5SA 1X13A 2OO5C 2CXUA 1QAQA 2JHFA 2OM2A 5FNVA 5ITVA 1Z8NA 4HBZA 2PGJA 1GZVA 1M2KA 3R3SA 1JE0A 1QCDA 4D8TA 4KUHA 3DOIA 4XM1A 2ANCA 4ENPA 4YAKA 2Y1XA 4R84A 1F06A 1E94E 2NYRA 2PYDA 1P31A 1P2BA 3VC1A 2H8GA 3ZCXA 5CA0B 8GPBA 2E0IA 1KPIA 1O4WA 4D43A 5BSRA 4C7JA 4GZ6A 1C1DB 4RACA 5AO9A 5CA1B 2PX4A 3S2UA 2XUHA 4LYGA 1A82A 4WESB 3OJLA 1L4YA 3QX3A 4H0CA 3GYBA 1C80A 1UBUS 5AK0A 4KR3A 2H52A 4U9UA 1CE8A 4FFBA 3OZBA 4D4JA 2HWWA 1H9CA 2VH2A 4BZQA 5E4YA 1YCHA 4WBNF 1YHZA 1RU3A 4URVR 3UJ8A 4KVFA 2QG6A 3VM6A 1KEPA 3EW7A 1YULA 1ZI8A 3O1LA 3T52A 1E6WA 2IH5A 2VZ0A 2EDCA 3VVLA 1VE6A 4DWOA 1CIPA 1L5SA 1ZWKA 3PNMA 3SZMA 2HF7A 2JARA 1A2BA 5EYPB 2FYTA 3E48A 3UWOA 4WUVA 3W9BA 4DV6B 4P33A 1UWCA 1NXWA 5KEIA 2AN9A 4O2RA 3JQ9C 4J6FA 4XX0A 4KAAA 1MGOA 2GKOA 1XPOA 5C3MA 1XZAA 3RVSA 1UKCA 1CNEA 1JXOA 4RJIA 3DGEC 2PLFA 3KB2A 3M6MD 3RIGA 4B3FX 1QGZA 3FUUA 3JYPA 3BD9A 3CSUA 1W93A 1NZFA 4HGNA 4LK2A 1P2UA 2QL6A 3KYIB 3TLJA 3FYUC 1N6LA 1QLWA 1U2GA 1VJ0A 3D3WA 3DWFA 4Q1CA 4UFNA 3TRDA 4G2NA 3VZBA 5LSAA 4NXNB 3KV1A 3G8BA 1MX1A 1XTBA 4PG4A 1ZK1A 3PLRA 3GVHA 5FV7A 3GJ8A 1I36A 3AL2A 3CEMA 3M83A 4NZMA 3WRYC 4EM6A 2Q0SA 5LDGA 4B45A 5EESA 1PEKE 5A04A 1QZUA 1DAEA 1SBTA 2NZVG 3PFBA 5KIAA 5L3VA 3IP8A 4QU5A 2FDRA 1QFYA 3E1SA 1W5EA 3B1YA 2QP4A 3L18A 5JRZA 4UNQA 4JHXA 5C5DA 4KRXA 4LTNA 2QVXX 2R1UA 4Y2JA 4AZTA 5C8ZA 2F62A 2GPTA 2WAXA 4KJZA 2GAFA 3LC1O 4TVKA 3PF9A 4PC2A 3GWGA 1KH3A 5FHRA 4RH3A 5HVNA 1YDGA 4MITA 2F8SA 4OI1A 1N7JA 4ARZB 4ASUA 2QJFA 1CY7A 2LPMA 2GI4A 3A1CA 2FX3A 2QBYB 4GX5A 3ZR4B 1P5RA 2MINB 3ESYA 1HDRA 3O4FA 4MVJH 4A2PA 1RLJA 3F6EX 4IJUA 4KGVA 4MI6A 3UTDA 2YMPA 3URKA 4Y6GB 4IIJB 2BL4A 1O87A 1R8JA 1TKCA 3MERA 4Q9IA 5G02A 2JLVA 4AZ3B 1J1ZA 1DCFA 3HZOA 2YWFA 5KYTA 1RXCA 2JIOA 3EUEA 4G5YA 4LRYA 3KPYA 3IAM1 1L9KA 1UDAA 2YQ5A 3K35A 4LHSA 4QOIA 1KEZA 1L5KA 1X1QA 2V74B 1QH0A 3GFTA 2A1UA 2VUUA 4QGFA 3RW9A 3ZVKA 1KZ9A 5B2EA 4AWAA 2AFIA 1L4HA 3FSEA 4CMAA 5JDCA 4C1BA 2WSSA 3IAHA 1AHPA 1Y6JA 3K31A 4JZYA 5K0JA 2V7QA 3I73A 1II9A 3TOSA 3G0HA 1NU6A 1P29A 4ROTA 4ZMBA 1WR8A 4K2HA 1IN8A 1L4KA 3NM5A 5DNDA 1CUSA 3CNLA 4FFPA 4LGVA 4JI2B 2JJ2A 5AKGA 3A1FA 3HQ4O 3SKYA 1Y1TA 3D7LA 3W5VA 4BNLA 1B8UA 1IUNA 2FMHA 4KPUA 1AZLA 5BPHA 1B26A 1N5OX 2XXAB 2NTEA 4Y6RA 4QUDA 3IFSA 4KREA 4RWEA 2BFFB 2WEKA 1KMHB 2GUWA 4CCYB 3DZKA 4EA8A 3NTXA 3HV0A 1BU8A 4Q19A 5L3RA 3P2IA 3W77A 1NUPA 5IVKA 2BCEA 3DZJA 1F6BA 2BZSA 1WQ3A 3K0CA 3ULKA 4Y98A 3T3NA 4D80A 5ALDA 2HPVA 4OGGA 3AHDA 3FMVA 4HVTA 4U7HA 2OXEA 5BYAA 1XEWY 1OBCA 4FGLA 4D9FA 4US2R 2QN1A 4BE7B 1CQIB 4MUAA 1DO8A 1OH6A 2GPBA 5KYYA 2PIAA 4IJVA 4J0IA 1G7TA 3KHKA 5EFOA 3A9WA 1XDDA 1ZK4A 4TL8A 5B4UA 1JXMA 1HFJA 3Q41A 3OI7A 2LDXA 2V8BA 3Q1LA 4U6NA 2HJVA 5KC8A 2VAWA 1QP7A 1VSVA 2EFEB 3DCJA 4DA4A 1PW7A 4HAYA 1WVMA 3ZE0B 3VDRA 5FBKA 3EVFA 4DB2A 3HYNA 1PJ4A 1R74A 3AV0B 3CRW1 3M4XA 1W5FA 1N5JA 3MW8A 4C29A 4YR7A 1QR2A 2NT3A 5ALWA 4RXMA 1AGRA 1XI2A 2JGMA 3T3IA 1TYCA 2P9FA 4I8XA 2R97A 1HQKA 3DWGA 3JYNA 5EMHA 4ZZ2A 2O5VA 3TI7A 4BFWA 2VQFB 2L18A 3U7JA 3FVTA 1N5DA 2ZQYA 3FDFA 3RVDA 3MJTA 2O8CA 1NUUA 2V96A 4XDZA 4UEOA 5AHWA 4ZCPA 1UM9B 3DD5A 4BO0A 4F9TA 1BAPA 5CLJA 3OAAA 1NIPA 2GFHA 4WERA 5E2AA 4FINA 4WAUA 2VRWA 3DEAA 3WB9A 4FC7A 1IG0A 3AR4A 3NJ4A 5IKMA 3ZDQA 3DKIA 4EVRA 1ZCBA 1FFGA 1YQ9A 2PUAA 4QXMA 2WTAA 3X2EA 3KFVA 1ORTA 1T5IA 3JASA 2Q6VA 3PQ2A 4FFBB 5JATA 3THXA 3KKKA 2INGX 3LVFO 3TSOA 4ZALA 1ISHA 1OX6A 3AY6A 3KD2A 4TV8A 1KYVA 7AT1A 4N9QA 2V7VA 4OBWA 1GM5A 2ILVA 2E5LB 3D0QA 1BW9A 4GVPA 2CMDA 3LK6A 2AI1A 2B9EA 2YXLA 3LF2A 4FXOA 5IXYA 2ARKA 2QTGA 1TJNA 2I99A 2R47A 4BMYA 1JG2A 3V8NA 5M2QA 4ANFA 1CEXA 1ZN8A 3C97A 2IHJA 4AO6A 3R2JA 3SE0A 1PE0A 2XTAA 1CPYA 1UKEA 1Q7RA 3IMGA 2O59A 4C78A 1LCIA 1KTVA 3U9SA 1HG1A 1ISFA 1Q1AA 3NDRA 2Z1DA 3X1YA 2AOTB 3P27A 4F46A 5C32A 1XVIA 2HK9A 2C4HA 4QRDA 1I0ZA 2KBEA 2Q1WA 1K8RA 3GYGA 3K3PA 4UOQA 5AXDA 4OYYA 2QAGA 5REQB 4DHWA 4KZPA 1OHHD 5FV4A 2IIBA 3TXAA 5JEDA 1CUIA 1U90A 2IK8A 2ZJYA 1WCXA 3K05A 3W3AH 4NH0A 2VHCA 1Q0TA 4GAEA 3UPDA 4M9QA 1OIWA 1R27A 1U8UA 1X7YA 2NO4A 3NHFA 5F33A 2Y1OA 3EFEA 3ZIAD 2XCOA 5JUWA 3OLVA 3HLTA 2W71A 3L7CA 1PGNA 2O8VA 3EZ7A 1C5KA 2G36A 4HYYA 4MQMA 1IY8A 4TVBA 2C2HA 3PFKA 3G5UA 2I8LA 3FNBA 4EB6A 4N01A 3G49A 1H2AS 5DHFA 3V55A 2C03A 4YWHA 3VYWA 2I66A 3UHPA 3ZYZA 3RB8A 4EWLA 4F91B 4RTPA 3UF0A 1JTFA 3PSHA 1N8KA 1ZCZA 1WY7A 4R8SA 4AXXA 2QLTA 2R7LA 1W6UA 2XW6A 3G88A 4BTLA 2V7WA 2GZ1A 1GTRA 3W3AD 1Y9ZA 4KVAA 2FJUA 1P7YA 1SVIA 3F71A 2Q2NA 4GM4A 5C80A 1DWPA 5JALA 1PJZA 3ONDA 4HKTA 3JATA 4EFKA 4E1AA 1W0KD 1ACLA 1VYUA 2VQDA 2VCHA 2IU0A 3ZNQA 1NVAA 3BMOA 4PFJA 3MJFA 4JQZA 3R7SA 4F93B 2PA3A 2WWRA 2VDLB 3FWKA 1POXA 3PC6A 5F4BA 4B3DA 2CNNA 4MV3A 4W5JA 1W30A 3F6SA 5IH3A 4J90A 4Z99A 3FPSA 3SF0A 2FN8A 1OH8A 1MQ9A 1RM0A 4CDGA 2IW3A 2IPLA 2F3RA 4HRXA 1EXMA 5B6IA 1LV8A 4X71A 3FTFA 3WZMA 1UK8A 2JFWA 4EOGA 1Y7HA 1YBMA 2QU7A 4UQLA 4QVGA 4NK4A 1FRNA 3LZDA 3W9UA 1MIHA 2L19A 2OILA 3MCUA 3KXDA 3WKBA 4DLSA 1HR0B 1DQPA 2WW8A 4XTCS 5J43A 3EDRA 2JFHA 2P4EA 1B3BA 3WIEA 4DANA 4EHNA 2GSWA 4ZVPA 1M3SA 4HS9A 1B74A 2XBUA 4MW5A 3RRMA 3WYAA 2PUEA 4GYJA 5HZKA 4TXNA 1YRWA 4BMZA 1RVDA 1LLCA 1N0HA 2UUBB 2OFXA 2YWJA 3ONFA 4XVQA 1AHHA 1RLOA 1B3RA 1VL8A 4XJSA 3MXTA 1PDVA 4CUKA 1EJ6A 1KWKA 1QVAA 3EZ2A 4EAAA 2RIRA 4PYRA 5CT8A 3K71B 5BW8A 4PYJA 3LW7A 5KYNA 1E5QA 3G89A 4CM4B 3IOEA 4IWNA 3EZGA 3SFTA 2QUBA 2CK3D 4E5KA 5H4HA 4RLFA 3GVPA 1NN1A 4KTTE 4RFSA 1NDHA 1H3NA 1PFQA 3UA4A 1KPHA 4EKDA 4OHKA 2D0PB 3DONA 5CLLA 3H11A 1VFNA 4HGYA 3VO2A 3K4PA 2JC3A 2OQIA 4I9UA 3SWWA 1GVHA 1K5PA 1N2CB 2BM0A 3U44A 1KYIA 1DMRA 4FYKA 4DRYA 2J48A 3R75A 5AVKA 1GYPA 1VMIA 1OVGA 1QG6A 2A59A 2P41A 1J0EA 3H3XA 3IPRA 1I32A 4M0UA 1BGVA 1G8MA 1Y7PA 1FTQA 2KLHA 3SZ3A 3E7XA 3I9NA 1ECGA 1GPKA 1T2VA 2HXGA 2PZFA 2D2FA 5LA6B 4CE6A 1E2EA 2HA6A 4ZXPA 1Q44A 1IXRC 2M98A 2QMEA 1R12A 3AGPA 5JAIA 3SQXA 4HLQB 2PVSA 5EA2A 2WJGA 4CFYA 1D6MA 2JI8A 3AOEA 4F12A 1VJCA 1LQTA 1EE2A 1Z8HA 3L1JA 1I13A 1C9DB 5HM6A 1Z5GA 4AY3A 1VLLA 3I9OA 1EHCA 5THKA 2Q1XA 3NCHA 3NUGA 4Q1VA 4NZNA 4P4LA 3NTQA 2O7RA 2PYIA 3R1IA 3RSOA 1T3ZA 2QD4A 2NPIA 4HX9A 1WZNA 3BWDD 1SHUX 2QQFA 2BM9A 1XXLA 3AXTA 3PUJA 4RHTA 3FBGA 4GBJA 1T1GA 4X1IB 5C1DA 4PYNA 1OC4A 2JGLA 4NAUA 2H5JA 2W6NA 5JXWA 3J7AC 1C4OA 1IVYA 4EG5A 1ECJA 3MD9A 1HG0A 2XOKA 3QVVA 1JAZA 2VO1A 4FJ0A 4ZQGA 4KQHA 3ZGNA 1DL5A 1R3UA 3RS5A 1F3OA 1DAKA 1QRAA 2SCUB 3WQRA 5JS2A 4B47A 4AKIA 1QO0D 4CM7A 2BBOA 4YYEA 3FOBA 4XFKA 1AV7A 1Z0ZA 2Z2ZA 5C34B 2YHIA 5TDHA 1MO6A 2HLPA 4CYMA 4OBEA 1RAAA 3RC9A 5K8VA 1E58A 2C4WA 4R1NA 3B6ZA 1XP5A 1X6VA 4LRQA 2IYNA 4RZ2A 1NRXA 5LWHA 2E48A 2QKYA 1E9RA 3WK7A 4CHTA 4KBGA 1MOPA 3DOFA 3X43A 2I4OA 1CS4C 1YA4A 1OGIA 2VBIA 2YYSA 4ND6A 4JZKA 5EGSA 4XDGA 5HM8A 4GPIB 3C1TA 3GELA 4M1TA 2PY6A 3S3TA 5GM1A 4Q34A 2B36A 3JWEA 3UMVA 1YVUA 1ZJ5A 2LNDA 5AM0A 3DBRA 4TYYA 3GP8A 2XR1A 2P4UA 2UYGA 1M67A 3IDAA 3PQ8A 1E1CB 4PLHA 4QSHA 1H0HA 2XXAA 4EP1A 5IYZB 4PNEA 2OO7A 1KSHA 1AQJA 1C9KA 3FDJA 3WWYA 2IS6A 5AIAA 5F9HA 4K9MA 3ZDFA 3HCPA 3BAZA 1M6WA 2C58A 1BWSA 5BW6B 4CT4B 1M2EA 5ENVA 4ZHQF 1YASA 1XNQB 1H2XA 3AJRA 4DLWA 3P9QA 4DDHA 5K4AA 3MAGA 4GS5A 1LI4A 1JG4A 2A7XA 3I6BA 3VR3A 2QNRA 1OIVA 1BSVA 1QFZA 2FW0A 3CR8A 3FG9A 3H2HA 2XITA 5CYPA 4YP6A 4F2HA 3LY5A 5FWXB 2HHHB 1D2EA 3CH6A 4ZV9A 1A96A 2D7JA 4EL0A 2AK3A 2QRLA 3STHA 1NVGA 4M0MA 4BEVA 1CHDA 3LS2A 3L4KA 2PWZA 3VZDA 1PSZA 2VEDA 4RIEA 4ZIRB 3ZDYB 4MQBA 1X1BA 1OR8A 4X6LA 3OZSA 5FLYA 3S29A 5IYZF 1TIPA 1WRBA 3C3YA 1LX6A 3BE5A 4V2UA 2AC2A 1F2VA 4DEYA 1HNWB 1P17A 1JN0A 1AUQA 4P86A 2JFNA 4NC9A 4PZYA 2C00A 3RF7A 5EZ6B 4DBZA 3PFCA 4JITA 2OSVA 4ZT5A 2R8ZA 1RHUA 1NC1A 1VPLA 2J0EA 3EQ7A 3MAAC 3O1IC 1IN6A 1HXHA 2GZSA 3AIIA 3NANA 4PR0A 5B55A 3ZLVA 1FA9A 4WZBA 5IUNC 5BQFA 1WNFA 3EVBA 1BE8A 1XU4A 1N3BA 3TQOA 2XB4A 4B3IA 2EKBA 1QRUA 4QUJA 2P7HA 3EXG1 1HE8B 3UWPA 1UBJS 3R7WA 3RYFA 1STOA 1BMQA 1FL9A 3PITA 3RFTA 1KO7A 4TMFA 1CRPA 3QUQA 4GKAA 5DX1A 1QIFA 4RK6A 1CQJA 1UT8A 1KY4A 1K7CA 3C7AA 3K15A 4NESA 4TT3D 2GN0A 1NP3A 4PLWA 4P7KA 1JP7A 1U3FA 5FWYB 3RYTC 4Y2PA 3ZKAA 4C5AA 4DG5A 4W8GA 2GPAA 3Q7TA 3FSJX 4CEHA 4WGFA 8AT1A 1T6NA 5EE3A 1M8KA 1EK6A 3E3AA 2IXAA 1G9TA 1MMFB 1TFRA 4AQ7A 1R4NB 4MEJA 1S2IA 1GSOA 4Z9BA 5I47A 4FMCF 2WHQA 3ZGVA 3P9KA 1XSEA 1WMFA 8LDHA 1B00A 2OAP1 3OF2A 1BOFA 1TAUA 1HQCA 2TS1A 2Z2KA 1PFYA 4RK7A 2Q3MA 4W8OA 1ELOA 3KT3A 1PJ8A 2BZ1A 1TF2A 3I8XA 1LNSA 4IIJF 3OC0A 2YXNA 4HWRA 4KN6A 2W2NA 1GAXA 4CZ2A 1QKJA 3FGZA 3I1YA 4JLDA 1Y8RA 4OLJA 5DASA 4QEDA 3H17A 5DLYA 3K2EA 3OSZA 3IR6A 2P7IA 4TTAA 5ALXA 2CYBA 3QU4A 5F73A 3KR1A 1FVHA 2GHIA 2MOKA 3HY6A 3N1UA 4KQGA 4GX1A 5NLLA 4EJMA 5HG0A 1NW5A 1YS2X 2VHZA 1OLUA 3I6IA 3IBCA 4Z0NA 3UYKA 4S2EA 1W47A 1KYYA 3OLYA 3ILVA 3LYLA 2C0QA 4PONA 4YK7A 1QLHA 2L0XA 4WIAA 1BE0A 4F60A 5DKFA 2C2KA 4CQLB 4WD3A 4AX4A 1SO8A 4L73A 1UBHS 3SQMA 2AD5A 2MIIA 5CA0A 1E7MA 1JKXA 2GBPA 4AP6A 5BV1A 3HBFA 4HXEB 3FR7A 2ZBPA 3PNYA 4LHYA 2PA0A 2W9XA 2DFDA 2QD5A 3DAOA 2IOYA 3NIGB 5EMJA 5M7EA 3GDGA 2UVDA 1JHYA 5T4HA 3WMWA 3WQBA 1Z4OA 3GEPA 5JSUA 1JQ5A 5FI0B 4W7IA 5AI4A 2HJSA 2X8WA 3AJDA 3D31A 3IUQA 3OPYB 4MWCA 1SRRA 421PA 3HHEA 4WJKB 2C54A 3L6EA 3R8CA 4HVAA 4CVNA 4JQCA 4E12A 5EN4A 4M60A 1L5YA 1BMFD 1R0SA 3JVVA 4QFCA 5GVSA 4EJSB 4D96A 2QSUA 3W0LB 3BIJA 2CCKA 3BSSA 3GFPA 1Q1EA 4UE3S 4GQIA 3R3HA 5E3HA 4D56A 1FFDA 1RYHA 3G0IA 5HIMA 1E69A 1YRLA 5DNVA 1SOWA 1G2QA 5EE0A 4B32A 3IJ5A 4JKOA 3WWEA 3PKJA 1V25A 2EQAA 1BD4A 2X4GA 5AHKA 4IOLA 3CKYA 3FZYA 3JTMA 1H2YA 3JS5A 3UK2A 3HKCB 4KPGA 3O9MA 3N74A 1MZVA 2AMFA 4PZ0A 4R05A 4UBOA 3RG8A 2VPYA 5L7TA 4EI7A 2OAQ1 4BLVA 2Z6AA 2DPGA 2Z09A 1W9MA 3TM4A 2PD3A 4W82A 1CYDA 1P61B 3RVMA 5A1JA 5LB4A 2B35A 2OV3A 3CZQA 4DRXB 1QHHB 1UXOA 3H16A 3URMA 3OPYA 3Q7SA 5A4FS 3WJ1A 1I6WA 1K5HA 3CLTD 2UUPA 5M34A 3IP5A 4L2IB 5I4CA 1JYEA 2XVYA 4L27A 2M1XA 1I1HA 4YRSA 3DF9A 3AR6A 2Y9MB 1L5NA 1FFWA 1XT6A 1WXWA 4H6XA 1O94C 3LLMA 1WKBA 1GNVA 4MKRA 5CP8A 1QU2A 1T2FA 4DCNA 4AP5A 4DIFA 1T2NA 4KIUA 1WEKA 2V58A 2NV2B 4U2EA 5IAEA 4V03A 3H2SA 2I6QA 3KX2A 4R9NA 3JALB 1W5BA 5FOXA 3SYLA 2NW6A 1P4AA 3EG5A 1MR3F 3HWRA 4IJ6A 4BQEA 5BXQC 3I2HA 1X1TA 4W1RA 3LYUA 4N40A 4OHUA 5JCJA 5H83A 3SJCA 4EBBA 1WUTA 1JIIA 3CA8A 3LCJA 4H7PA 4QWWA 4OQZA 4RA6B 5EJFA 4KITB 4LW8A 2IX3A 3MBOA 1WXGA 1N25A 1NXTA 3SN6A 1WP9A 3WMGA 5DHPA 2GA8A 3BXOA 1APBA 1UC4B 4O33A 1TM1E 1XVUA 4R41A 4EUEA 1IYZA 4ER6A 3DV9A 1BDJA 2PS3A 3G5MA 4WZBE 4DDMA 3WA7A 4HWTA 1ZYUA 2X4IA 3GZ4A 3L1IA 4CIXA 4OMDA 5C46F 3R5HA 3SSAA 4MHSA 2IUTA 3HR7A 4H35A 5GGXA 3N07A 4UC0A 1FYWA 1AT1A 1QV6A 5J47A 1ODKA 2D13A 5CIWA 1VXOA 3KEFA 5B7QA 3E5HA 4JAVC 4ML3A 1C7JA 4Y30A 2WZQA 1BHQ1 2AHRA 2WA2A 2XAAA 3DLIA 4LHXA 4AS1A 1N5MA 5DVZA 5ER6A 1GUAA 5IANA 3UK6A 3HEAA 2FW6A 4Q3NA 2A9VA 2H31A 3UN1A 1CUWA 1GT91 2PRJA 4P35A 4FB4A 3Q10A 1KY5A 2WJIA 1UJ6A 2R0QC 4FFMA 1IBLB 1YZUA 2WM2A 3TNYA 3AK4A 3N2YA 3AEQB 1Z4QA 4CQNA 2OESA 5FWAA 1J49A 2IP2A 4JSTA 1XCGB 2CFRA 4K7JA 5EWJB 3WIDA 5JI2E 2H4XA 2GD0A 4NR0A 1EZ4A 1M6HA 1YC5A 4WEOA 3HJCA 5IF9A 2AOWA 4FFRA 2R6HA 4QOHA 3OX4A 4CFZA 3F47A 1ZSNA 1VE9A 3LQKA 4YRFA 4F3RA 4C2UA 4KB5A 3H86A 5P8WA 2Z5GA 5AJXA 3ZW7A 2O0LA 2FZKA 1JR2A 3KOYA 1L6IA 3ZU4A 2WUDA 5D00A 2D7DA 1Z6ZA 1W29A 4UNNA 3K6SB 3TXXA 4RADA 3V4SA 1U3UA 2FSUA 1HSZA 4HB3A 7GPBA 1DINA 4AIIA 1ENZA 2VDNB 4GXQA 4KWTA 1YTLA 4KAFA 1ZQ1A 1BJRE 1AGNA 3K8ZA 4JLBA 1XMOB 5EKXA 2PTHA 3OU7A 5CTJA 5EJ9A 2POQX 2XD4A 3NYWA 4YNBA 2I1LA 5KHAA 5A7GA 1UPAA 1YZTA 3CNOA 1UFKA 2R11A 1ATZA 4HEQA 4PTLA 1RQ7A 3CKLA 1VRWA 1XQYA 4J7UA 1EB9A 4MR7A 4OQLA 4WNIA 5I4BA 3UPTA 3QTTA 2O05A 3GNQA 4LF4B 4D98A 3K0AB 5CYOA 2YICA 1Z8FA 4MVJE 4EQ6B 4P5PA 3CN9A 4PRLA 1ZR4A 4KIJA 1RJ9A 1EP2B 2Q4BA 3P4UA 3WL4A 1MD9A 1M75A 1C7RA 2I9PA 2IXBA 3T5MA 4TV8B 3LQYA 2QRJA 4ZO4A 3DHWC 3FOZA 1EUQA 4D4IA 1A9XB 1THGA 3D4BA 1JWAB 2AMLA 2IBMA 1A95A 3MUNA 1U28A 4FHCA 1XNGA 3IVRA 3L49A 4MRRA 4O4LF 4PBSA 4DIBA 5LQMA 4B6RA 1D6SA 3KHSA 5JCZA 3TJRA 5BP7A 3PGXA 1VRCA 2UVQA 3E23A 4FDMA 4P2GA 3LQFA 1IQ0A 2FSVA 1JJ7A 4X1IA 2ATEA 3QYFA 4TRMA 2BFBA 3DNPA 3REQB 1YSCA 2P1DA 2FGKA 2LXNA 2QTVA 4YRQA 1CQPA 3EGDB 3WL6A 1H2WA 2XQIA 1SCJA 5BUSA 2D00A 3CT6A 1YRBA 5JO9A 3LFHA 3KPUA 1FXUA 2A5FA 1UKVY 1N7HA 3AF2A 3WLTA 4MW9A 4DBVO 4BEWA 4BQSA 3HKEB 5DTEA 1NVVQ 2FPOA 4IH9A 4HOYA 3L5KA 1RRKA 1Z5PA 5A3RA 1IHPA 1JAYA 2VCYA 3PNKA 5A03A 4OU4A 2Q4EA 4Z8YA 2MYTA 3M5CA 1ZY2A 3QVGA 4FHEA 1MABA 4EUHA 4ZJPA 5JPCA 4EITA 4CUJA 4H0NA 4CF6A 2ABWA 3W34A 4XD7A 1QH8B 1KJJA 1DJPA 4X54A 4FCVA 2GAAA 2PZKA 2R25B 2XKJE 3PTZA 3BK1A 3HUUA 2Z04A 4CDNA 1IBMB 3I0NA 1Y8QB 4F7WA 2ZJFA 3FR8A 3BE4A 5AKKA 1T3HA 1DU4A 1HT3A 1GN9A 1G4UR 2YJ3A 5EJAA 2D2XA 5HYVA 2P8JA 4L6AA 4TMKA 4G6ZA 2JI6A 1FXSA 3Q2IA 3ZDCA 2PRZA 3FZNA 3VDNB 4J2TA 4P58A 3N53A 2ORWA 1XRPA 4RLQA 2OMKA 3GF4A 3R3UA 5JDIA 2CL7X 2YWGA 4M9SA 3H8SA 3JYHA 5TQ2A 2PK3A 4C7XA 1SKUA 5FUVA 1TCAA 1DTWA 2OG1A 3K1ZA 2ZZKA 4UDNA 5IJ9B 4DLPA 1YS7A 5TVGA 1OLOA 3UGKA 1RRCA 4RY9A 1NVVR 1O4VA 2BGMA 1I3CA 3DDOA 3H4IA 2JLXA 5B30A 3HJUA 1G7CA 2EDAA 4RPGA 3EMBA 4CLRB 1A8UA 3H9QA 3PNLA 5CURA 3TZEA 5CYGA 1N7IA 5K7SA 3CRRA 5I7RA 1M0SA 1ECLA 2RI6A 3HRKA 4F8EA 2CLLB 1SKYE