2HV9A

Encephalitozoon cuniculi mrna cap (guanine-n7) methyltransferase in complex with sinefungin
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
248
Chain Sequence
SKTINIRNANNFIKACLIRLYTKRGDSVLDLGCGKGGDLLKYERAGIGEYYGVDIAEVSINDARVRARNMKRRFKVFFRAQDSYGRHMDLGKEFDVISSQFSFHYAFSTSESLDIAQRNIARHLRPGGYFIMTVPSRDVILERYKQGRMSNDFYKIELEKMVPMESVREYRFTLLDSVNNCIEYFVDFTRMVDGFKRLGLSLVERKGFIDFYEDEGRRNPELSKKLGCLTREESEVVGIYEVVVFRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA cap guanine-N7 methyltransferase
publication title Mutational Analysis of Encephalitozoon cuniculi mRNA Cap (Guanine-N7) Methyltransferase, Structure of the Enzyme Bound to Sinefungin, and Evidence That Cap Methyltransferase Is the Target of Sinefungin's Antifungal Activity
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transferase
total genus 90
structure length 248
sequence length 252
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03291 Pox_MCEL mRNA capping enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2hv9A00
1XDZA 1DL5A 3JWGA 3GJYA 2C7PA 2AOXA 3GDHA 4ER3A 2O07A 5EIFA 4Z2YA 5P8WA 1RI4A 3HCFA 2E5WA 5EHIA 3FUXA 2BR5A 5C9ZA 4PWYA 1O54A 3I58A 4CTJA 5G02A 2N47A 5K0CA 1NW7A 3MTIA 3LDFA 3PFHA 5B1SA 2IDJA 4OBWA 1JG2A 4X60A 4CKBA 2ZCJA 3DH0A 3FTEA 1H1DA 1OR8A 3C3YA 3GU3A 3EVAA 4FZVA 4E33A 2H1RA 2O57A 2NP7A 4YV2A 2DULA 2GAFA 3GIWA 4P7JA 4ER6A 1I9GA 1L3BA 2PX2A 3FTCA 3I53A 2VDWA 1JTFA 5GM2A 3EEOA 5CVEA 3B3JA 4FT2A 2QM3A 4PCLA 5FCDA 3EVBA 1PRYA 2C7QA 5FA8A 1UWVA 5DSTA 3IEIA 2AOUB 2OB1A 3DUWA 3Q87B 3GRUA 3E23A 2OO3A 4LWPA 5E1DA 5HIKA 2PXXA 1X1BA 1NW8A 3G7UA 3E05A 3T7SA 2EG5A 2IBTA 4PYLA 3BWMA 3ELWA 2IDKA 2ZWVA 3NDIA 5E1MA 4GQBA 3I5UA 2I7CA 4ZTBA 2AOWA 2R6ZA 3NW9A 1R8XA 5BW5A 2ZLBA 5CCBA 1Y8CA 1FJXA 2AVDA 4M7RA 3THSA 3THRA 3GRVA 2JH9A 3KPWA 4F85A 5IKMA 2NYUA 4FGZA 4GC9A 5LQRA 2BM9A 4GC5A 2PLWA 1XCJA 3BKWA 3KQVA 2JHAA 5HIJA 2HR1A 1R18A 3AXTA 2ONZA 2ZSUA 3A7EA 2CWWA 2EFJA 3LCVB 3P2IA 4FR0A 5U4XA 5LQUA 5K0JA 3FPGA 3IHTA 4FS8A 4OA8A 1AF7A 3TM5A 3LDUA 5FQNA 3SSOA 3TOSA 2BH2A 2ZZNA 3I64A 5EC8A 5KQSA 4HRAA 2QRVA 4OX9Y 5E9QA 4GF5A 4DF3A 1N7IA 3FUTA 4QTTB 1XXLA 3M6UA 4BP1A 4YUXA 2QE6A 3DP7A 3HNRA 2PSSA 1NT2A 3CGGA 3B5IA 3LECA 3OPNA 2CL5A 4RVFA 5E9JA 4QQNA 3WSTA 5LSAA 2NXCA 5FULA 3VSEA 3CJQA 2Z6UA 1ORIA 1G8SA 3TFWA 3K0BA 4EQZA 5ICCA 2OPBA 3REOA 3G8BA 2AN4A 2OXTA 3KQWA 4DM3A 3C6KA 4C06A 3P9IA 5D1NA 5F2OA 2AN3A 3DLCA 2HMYB 1QANA 4DKJA 5BW4A 1EQAA 3HCDA 5KS2A 1VL5A 3EMBA 1FP2A 2EX4A 4OQDA 4R6WA 1INLA 3R9XB 2QYOA 4RTQA 3KQQA 2YR0A 5FHQA 4ATNA 4YMGA 3GGDA 3LGAA 3CBGA 2VS1A 3KU1A 4YUZA 2ZTHA 5CCXA 3ORHA 3KPYA 3OU7A 4FSDA 4X1OA 5KVAA 5KYGA 5LQCA 1XDUA 4C4AA 3EGVA 2PWPA 2Z6QA 2NNWB 3LHDA 3M6XA 1D2GA 4GUAA 2PWYA 4Y2HA 1I4WA 1YFLA 3LX6A 3ELUA 4LG1A 4RTRA 1N2XA 5K0FA 1X19A 3SXJA 2ADMA 3MCTA 5CVVA 4C07A 3BGIA 2BR3A 3O31A 3M6VA 4IV8A 2P3LA 2PJDA 2AN5A 3A4TA 1NKVA 3L8DA 5F2KA 3SMQA 5KQRA 4E30A 1SKMA 3TR6A 4K6MA 4A6EA 2CMGA 4XUEA 2I6GA 1DCTA 4KVZA 2BM8A 2XBMA 4RTOA 3P2KA 1WG8A 2YUIA 3C6MA 3JWJA 4EKGA 3NDJA 2PVCA 4RSRA 5E1BA 3BGDA 4MTLA 3TKAA 2OZVA 3JWHA 1VP9A 5DM4A 2JH8A 4PYKA 5T64A 3LDGA 2XVAA 3NVMB 5DWQA 3DXZA 3KQOA 3MHTA 3M6WA 2UYHA 1VPTA 3KR1A 2NXJA 2YTZA 2EJTA 2NXNA 4QVGA 5EQJB 4G56A 5ICFA 1YB2A 1KPGA 2G71A 1B42A 4EKIA 2FK7A 2ORED 1F38A 3HP7A 1JR4A 5FA5A 1R6AA 1ZQ9A 2A14A 2V74B 1IM8A 1MJFA 2B25A 3EVZA 3FPHA 2P7IA 2HNKA 3DMHA 3MTEA 5C1IA 1O9HA 3HCEA 3M33A 3SX0A 3UJ9A 4E32A 2P1DA 1YFJA 5EMLA 3A25A 5GIPE 4H0NA 4V0QA 1VQ1A 5DT2A 8MHTA 3OZRA 1RI1A 5DPMA 3ELDA 5EMMA 3OE5A 1ZG3A 5GP1A 4L7VA 3DULA 3ID6C 3B89A 5DM1A 1RJFA 3PB3A 4KIGA 4EMSA 3AXSA 5E8JA 4GEKA 4E2YA 5EPEA 1X1CA 2IFTA 1YZHA 3NTVA 1BHJA 3HA7A 4PIPA 2AVNA 5LQJA 2PT6A 2XYQA 2PT9A 9MHTA 3P9CA 1WZNA 3B3GA 4GOND 2NP6A 1R8YA 3NWBA 4FSXA 3H2BA 4PYQA 3GXOA 3OZTA 3M70A 5EVJA 1NBHA 3BWCA 3QOWA 3A7DA 4AUKA 2P35A 3HVJA 4YUWA 2HWKA 1P1CA 4CKEA 2IH5A 3V8VA 3NWEA 2ZBPA 3OE4A 3LCCA 4A6DA 3TQSA 4AZSA 2ZW9A 1NW3A 2UZ4A 3HTXA 1SVUA 1RJGA 3FPJA 1I1NA 3NMUF 3TRKA 1TW2A 5JR3A 5HIMA 5DX1A 4PNEA 3BGVA 2IP2A 2B3TA 2UYQA 3KR2A 4PGHA 4CTKA 4AX8A 3HEMA 3PFGA 3ANXA 4V0RA 1L1EA 2IGTA 4XUDA 4X61A 2FYTA 3C0KA 5EGSA 1KP9A 4LWOA 1BOOA 4HC4A 4KDCA 5EMJA 5ICEA 3GRZA 4IWNA 1HMYA 10MHA 3BWBA 3PX2A 1R00A 2Z6AA 3T0IA 5CUQA 4E2WA 3PX3A 4R6XA 4E2XA 5K05A 4P7GA 2UYOA 3G88A 5K0BA 1WY7A 2PKWA 5M5BA 4RTPA 1O9GA 5EHGA 1P1BA 1NW5A 2F8LA 4PONA 2OY0A 4XUCA 5D1HA 4MWZA 3RW9A 4ER5A 5K03A 2PV0A 3P71T 1NE2A 4KIFA 1KYZA 2B9EA 4QTUB 5FUBA 3S68A 1VLMA 1UIRA 4P7KA 4QDJA 4F86A 4QDKA 2WK1A 4LECA 1N7JA 2GH1A 5GWXA 3UA4A 2BR4A 3EEYA 2G8NA 3UA3A 1NV9A 3MAGA 4PCAA 4X41A 4ISCA 2XVMA 2IPXA 3SM3A 3UJ6A 3FTFA 3P97A 1R74A 2BZGA 2IH2A 2ZBQA 1RJDA 3DR5A 3IYLW 5H02A 1G8AA 5K8VA 2P7HA 2HV9A 3GRYA 2ESRA 3M4XA 5MHTA 1JSXA 4HTFA 1IY9A 2FPOA 5LQNA 2PBFA 3FZGA 2H11A 3OU2A 2ONYA 2ZFUA 2B78A 2ZZMA 5ERGB 4AZVA 1FPQA 2YQZA 4XCXA 2AOTA 4E31A 3OU6A 5EG5A 1ZGJA 3EVEA 3SR4A 3LPMA 5EKUA 4HGZA 4YV1A 4GOOD 4PYMA 2QRVB 2WA2A 2C7RA 1ZHFA 4PYOA 4P58A 1SUSA 2XYRA 2PGXA 3FUUA 4Y30A 1WXWA 1X1AA 3CKKA 2PX4A 3UZUA 4OQEA 5DM2A 5GIOE 1UFKA 4HH4A 5T6BA 3MGGA 3FTDA 2ERCA 1V39A 1Z3CA 4RX1A 2EJUA 3EGEA 1BKYA 5GOZA 2K4MA 3DTNA 5E1OA 1AQJA 2I62A 5K0EA 1NW6A 1YUBA 3QOXA 4DA4A 3HCCA 5EZQA 4FT4A 4U7TB 1P39A 3G89A 4F84A 2C7OA 2OKCA 1L3CA 2R3SA 2V7EA 4AZTA 4DZRA 5EMKA 2G72A 1L9KA 4YUVA 1P91A 3LKDA 4QPPA 3R0QA 1JSZA 4UOEA 3LBFA 5K0LA 2AS0A 5JUWA 2UYCA 3SSMA 3CJRA 3MQ2A 4GBED 3KHKA 3O7WA 4DCMA 2YXDA 5LQAA 3FUVA 2PXAA 2P3OA 3VC2A 1G6Q1 2ZIFA 5DX0A 1KIAA 5EEHA 3KQPA 5EZSA 5ICGA 1VBFA 1X1DA 3AJDA 4IKPA 2OYRA 3FPEA 3P2EA 3NJRA 4M37A 1EAMA 4WVLA 1M6EX 5HZMA 4RTJA 4EVIA 3GNLA 2YXEA 2ZIGA 3KQMA 3GO4A 4EK9A 3SGLA 3CCFA 4C04A 4WXHA 1EJ0A 3ELYA 1ZKDA 3B7PA 3KPJA 3PLAE 3FYDA 3A26A 3UJ8A 4NECA 1HNNA 4CXMA 3E7PA 3CVOA 2GS9A 3QV2A 2AOUA 3GRRA 2NXEA 3EVGA 3ME5A 2VP3A 5CVJA 4GOMD 1EIZA 3BKXA 4KDRA 2B2CA 2IIPA 1BC5A 3BZBA 5DLYA 1DUSA 2XYVA 5EOVA 1U2ZA 3G2MA 5HIIA 3TPZA 2FCAA 4BLUA 1Q0SA 2G70A 5DX8A 2CKDA 2PXCA 3DXXA 3UJCA 3GWZA 1EG2A 5K0NA 2HTEA 2YX1A 3EVFA 4PINA 5FWAA 3AY0A 3PVCA 5CVDA 5C0OE 4MHTA 1AQIA 3EPPA 2IBSA 3OFJA 3DMFA 3V97A 3BWYA 4RTNA 3ER9A 3ER8A 4C03A 5FQOA 5T67A 1TW3A 4C05A 3KQYA 1JQDA 1XDSA 5FWDA 4ER7A 3Q7EA 4RYLA 3EVDA 2VDVE 3UWPA 1G55A 5EIWA 1WS6A 5DSXA 2GLUA 1AV6A 4YV0A 4RTMA 1QAMA 1ZGAA 2ZVJA 4RTKA 1JG3A 2PY6A 2LD4A 3R3HA 4R8SA 3DMGA 5E8RA 3I9FA 3EGIA 2ZZKA 4U7PB 3LSTA 5K09A 3OFKA 3NVKI 1FBNA 5FADA 3UJAA 4DQ0A 4OA5A 4YMHA 3FUWA 1YF3A 3OCJA 3G2PA 1G38A 4RVGA 2G1PA 3P9KA 3UJ7A 4BLWA 4QPNA 3HCAA 2YVLA 3KR9A 4HGYA 5CIYA 2YXLA 2ZWAA 5LQKA 2OB2A 3VYWA 5CD1A 2O05A 5DM0A 4JXJA 4X63A 3X0DA 5BXYA 1XTPA 3PS9A 7MHTA 1KYWA 3DXYA 5DXJA 3GCZA 4M38A 2ZBRA 4RV9A 1SQGA 2ZIEA 1IXKA 3EVCA 4KW7A 5CM2Z 2PX8A 3JWIA 5E2BA 5EKXA 3BT7A 1SUIA 1QAQA 3KKZA 4YUYA 3BXOA 3TMAA 3OZSA 1Q0TA 4GOLD 1WXXA 3RODA 3R6TA 5FTWA 2P8JA 5GM1A 4KWCA 1ORHA 4PIMA 3LBYA 3A27A 1VIDA 4B17A 4M36A 5IH3A 5HILA 4POOA 1G60A 5LR6A 2FRXA 3FYCA 3KR0A 3U81A 3UFBA 3RIEA 3TM4A 5K01A 4E70A 3SSNA 3HVIA 1QZZA 1M6YA 2AOVA 5DTRA 3T7RA 5EEGA 1RI3A 2O06A 2OBFA 4RTSA 3UJDA 2DPMA 1XCLA 4BLVA 4E2ZA 4R05A 1VE3A 5BP7A 4RTLA 3FRHA 1KR5A 1RI5A 5DRYA 4MQ4A 4R8RA 5E2AA 4KRGA 4PYNA 2IH4A 1KXZA 1MHTA 5DXAA 4MIKA 3AWIA 3HA3A 3IV6A 2VZ9A 2FK8A 3PTAA 1KPIA 1TPYA 5DTMA 3F4KA 3KQSA 3O4FA 1F3LA 1KHHA 2AR0A 1XJ5A 3G5TA 3R24A 2KW5A 4RVDA 2P41A 4C08A 3BUSA 4CKCA 3VC1A 3FPFA 2Y1WA 3HA5A 3HM2A 3MB5A 1SG9A 4O29A 4HTFB 2O0LA 3CJTA 4ER0A 1QYRA 5HOQA 2Q41A 3KPVA 2GB4A 1JG4A 2H00A 1JG1A 1FP1D 3FRIA 4PGGA 3EMDA 1NV8A 3LCUA 1SQFA 3DOUA 3K6RA 4FP9A 1YZ3A 1XVAA 3G8AA 3LL7A 3MCZA 5CVUA 1KPHA 3T7TA 3G2OA 3TKYA 2AOTB 3MERA 2AZTA 2Y1XA 2FHPA 1T43A 4OBXA 4RVHA 3HVKA 3LKZA 4HSGA 3UJBA 3CC8A 4CWAA 3UBTA 5FHRA 5F2NA 1QAOA 4HG2A 3D2LA 3KPUA 5DRTA 3TLJA 2CMHA 4PYIA 4PYJA 2QY6A 1RJEA 4DCGA 4AZWA 3C3PA 3B3FA 4P7FA 1PJZA 3P9NA 1JQEA 3E8SA 2P3QA 4IV0A 2JG3A 3P8ZA 2JHPA 2PX5A 1L3IA 3PT9A 5DTQA 3HCBA 1EJ6A 1NBIA 3SVZA 2GA9A 3G2QA 2I9KA 4RWZA 2JJQA 3ERCA 3KQTA 5HFJA 4DMGA 5K0GA 2ZULA 5E9WA 1RI2A 4BY9E 5HEKA 4BP3A 2GPYA 1JTEA 3G5LA 1VP3A 2VDUE 3DLIA 3HVHA 1D2HA 2JHCA 4QQKA 1M0EA 5GINE 1D2CA 2P40A 2WA1A 1JQ3A 4QVKA
chains in the Genus database with same CATH superfamily
4GOXA 1XDZA 3HEAA 1JYFA 4HQRA 1KQFA 3DV9A 1STOA 1GLVA 2GX6A 2QI9C 1X86B 3N86A 2Y92A 3FLMA 3NTOA 3P5BA 5EHIA 4WZBB 1TJNA 3VQTA 3ZU5A 2F17A 1E2IA 5K0CA 3V33A 3K0SA 3GEDA 4Q1DA 3LRXA 3PEEA 5LP1A 2GPNA 3LYLA 3OQPA 2XKAA 2QJTA 4J75A 3F8WA 4IICA 5EWMB 2HI0A 1TL7C 2H1RA 1GFIA 3WGYA 2PIAA 4JDUA 2BW0A 2QM8A 3BE5A 1Q15A 3NDBB 3GAAA 3OPMA 1DXOA 3N07A 3KC2A 1GRCA 3JQ8B 3OKCA 3WADA 4PC7A 1T1IA 1DQNA 3RYIB 1U3TA 3E81A 1A71A 5GM2A 1KHTA 2IXDA 3R6WA 4ZCRA 3EVBA 3MWEB 3MJSA 4G0MA 4H3VA 4NY1A 4TV9F 5IZCA 3WLNA 2JW5A 3UMBA 4MMZB 1JDTA 3B6KA 1WUYA 5HBRA 3MTQA 4XASA 5I3CA 3GRUA 1E0JA 1NNI1 4UNPA 2DVMA 5CNKA 3S2FA 3MELA 3GDGA 4GI7A 2X9LA 3ZXIA 2IDZA 1ZI9A 1KYVA 3NAQA 3VPHA 5JNSA 2XWQA 1X8KA 2QVCA 5IDVA 3P0EA 4YO7A 2IYSA 2ZLBA 4Q9JA 1TECE 3D64A 1F8UA 4G6ZA 4O4HB 3WZ2A 1IAQA 5A4AA 4EYGA 2XYGA 3EFBA 1XCJA 1MAVA 3QU9A 1H2EA 4UKDA 1NQVA 1DWQA 1AZSC 3WI7A 4FR0A 5LQUA 1OC2A 5EERA 1C1XB 2B4RO 1P1HA 3CUUA 3BHIA 4M1MA 4W1QA 2IZ6A 1C50A 5FQNA 5AKGA 2H7XA 3GLKA 1QIHA 4LX0A 3THYB 4UVDA 4ZKDA 2RBEA 4N18A 1SVLA 3FUTA 3Q3EA 4AX4A 5CT4A 2MMCA 1EHIA 4IHKA 1UXIA 5P21A 4X7RA 3I32A 3I4CA 3KUDA 4PZEA 4YCLA 2YHSA 1E3QA 4JJIA 1R16A 2WU4A 3WSTA 2WJYA 2F1OA 4TL7A 1JPNA 4CIWA 4M0FA 2QR5A 4OK6A 1ORIA 1KOFA 3DOJA 3EXAA 3K0BA 4Y2YA 4M6WB 2ZUDA 2IKQA 4HFJA 3EC2A 4KKXB 3AVOA 4NYMQ 5F2OA 1F2UA 5KNDD 1NI3A 1GO2A 4G5HA 4WA7A 4MA0A 4OHMA 4DDTA 3RRBA 1VL5A 2H17A 3AVWA 4MKGA 4BAZA 2YZ7A 4MQMA 4F4IA 5KWEA 3NORA 2H1LA 1Z36A 4EZBA 3I9KA 4UZEA 2XRZA 2BI4A 4FYYA 3KHTA 1XEXA 2ZTHA 3F7TA 1OLSA 4RUKA 4TQ9A 5ALPA 4WASA 3RFVA 1HZZA 1WHSB 2VO1A 5LDHA 1YH3A 1J2JA 3H16A 2R7MA 3M6XA 1WY5A 2PWYA 3AW9A 2O20A 3PYLA 1OGIA 1R6XA 1VYUA 3HDHA 4LFBB 5KYYB 2FPSA 3LT5A 1UXOA 1X7XB 2FZVA 1NBWB 3ISVA 5FWXB 3C3DA 1TEVA 2J3QA 5H80A 4QGAA 1X80A 2ZB3A 3GEPA 2PCLA 4G9EA 3EQ2A 4UBIA 5D3ZA 1BA3A 5IARA 1K5PA 1YDGA 3HCRA 4JSYA 1C0IA 2AYZA 1JAYA 4QJBA 1V4BA 4ZOBA 2LRHA 2PAFA 4LOAA 4YP6A 1QIKA 1T29A 4IEIA 2GPSA 1Y9EA 3OMLA 3ST7A 3DNMA 1YS2X 1A8PA 3LX8A 2J8ZA 4N40A 1GITA 2GJKA 4F4CA 1OSNA 2BLLA 3JZFA 3A70A 2EGUA 2YICA 5ALSA 2VK2A 4GM0A 3BH0A 2V98A 3ILVA 4M0CA 1W0KD 2NXNA 3GUHA 2ZS7A 4NFHA 5BWCA 1ODSA 1K63A 3A37A 4RACA 3FR8A 3VVBA 4ZZ1A 4EUSA 4AKGA 2PX6A 3HJHA 4JJ8A 2J87A 1Y3IA 4HYEA 4YCJA 2ZPUA 3F4LA 4QEZA 4TTVA 3FXAA 3C8HA 4XA8A 1JR3A 1OFHA 2HNKA 3DMHA 3A9RA 2BH9A 4Q4DA 5L6MB 4RFVA 1RKUA 3PNPA 1T9BA 2GEJA 1CUGA 1BHO1 2OCIA 3P0JA 5GIPE 4R40A 1W94A 2Q3JA 1LDBA 1FXUA 3KLPX 4M54A 4BKUA 3MPOA 3SC6A 4KQXA 5GP1A 3DUFB 5IC6A 4OIFA 3MT7A 1T9AA 3G2LA 4MUEA 4N1AA 2AFVA 2IOYA 3U16A 3PPVA 3OP1A 4E2YA 3ENKA 1R7RA 1D8TA 1UPFA 3R5XA 3TSAA 1BHJA 3DMYA 2COUA 4J6EA 1V9CA 3DE6X 4TKVB 4RESA 1P75A 3PNLA 4CLRA 3B51X 3T9FA 3SVTA 3A4VA 1AB6A 1MABB 2D06A 4ZEOA 4UNNA 3ZZUA 5C5CA 4CI0B 1R8YA 2FA9A 2JVIA 3H2IA 4R84A 2V7QD 3OEED 2A9OA 2GTHA 1JJBA 3H2BA 1FFAA 3IBYA 4KO3S 4N7MA 3IVXA 4UE6A 1RBMA 5JSZB 2XMGA 2WF6A 4LZNA 1U7UA 2K2WA 4D9HA 4YUWA 2UVQA 4FS3A 2HWKA 1P1CA 1IATA 1WMDA 3V8VA 2C3OA 2LR0A 2IH5A 4EM6A 5EUMA 1ZOIA 5LDGA 1F4VA 1FJ2A 1ETHA 1SOVA 1UEIA 3L7CA 1KK0A 4ENUA 2IHBA 3A32A 4EITA 4RD4A 5DWDA 5I7OA 3KR2A 4PYRA 5FRDA 5JS6A 5G4KA 1TM3E 4HGRA 3ANXA 1MG0A 2AE2A 3RK0A 4QM6A 3IDFA 3LT1A 4YQZA 4C6TA 4J1QA 4X6YA 3X44A 2IGTA 3FPCA 1T8RA 3WMRA 2QW8A 3GPIA 3QW2A 2AD1A 3L6EA 1QFZA 4OXIA 5I7FA 1F48A 3NOXA 2HQOA 3EEBA 3OTGA 1FLAA 4I9GA 3ONFA 4Q4AB 5AKLA 3PX3A 1UMDB 4RO0A 5DI3B 2OBBA 1CUAA 1GU0A 1GYRA 1XO1A 2XHZA 3CUYA 3GLSA 3L7LA 1L9XA 3Q7SA 4QASA 2OGTA 5IC5A 1BROA 5T41A 5HKBA 1NE2A 4FIZA 1KEZA 5DHSA 5FUBA 4I3HA 3U6KA 4PXSA 4HLUA 2ZSJA 5J1TB 1O8CA 4DLRA 4B3XA 1ZLYA 2GHRA 2AQIA 1CZKA 1XN4A 2YZNA 2JCYA 3DBVO 1JU3A 1VE9A 3BCHA 4XOIA 3ZE0B 5KJEA 3LDAA 1D09A 1E3LA 3BMQB 4C43A 4EPWA 2UZ4A 4X41A 4ISCA 4RHEA 1P31A 1Q44A 4MV8A 1NXTA 3EZ6A 1JIIA 1Z7BA 2QENA 4TUYA 2VP6A 2X5JO 4IJ6A 3BH6A 2CYAA 3RIYA 5FH9A 1D6MA 1VSQA 5DW0A 4V03A 1P2UA 5F23A 5CT6A 2YWBA 5JHGB 2VOEA 1PT8A 3WB0A 3HJBA 4BE4A 5LQNA 1H2XA 5I8WA 4EO9A 2EBUA 1G9TA 1E5LA 2PRJA 2X7JA 4P3NA 1H5UA 3RASA 4LVUA 2DOKA 4P8RA 5ALLA 3DMNA 2AOTA 3LUCA 1LDNA 1Q3TA 1GTJ1 2XNDA 3P4YA 3AMVA 3LKVA 5IVPA 1JJAA 2H4JA 2J9YB 2MT9A 4JLUA 5TQ0A 3B1KA 4KDFA 2LKDA 3K09A 4GDFA 1C2TA 2A1TR 2QLTA 2WD9A 4JLSA 5CTJA 1WXWA 3CKKA 2BSAA 4BVAA 4DBLE 2QBYA 1WVIA 1OTXA 4N9QA 3TEFA 1UBNA 3GN1A 4KK3A 4Q02A 1N2ZA 1V5EA 5MF6A 2JGKA 1GGMA 2FFQA 4OUKX 1XOIA 1XTKA 2OOKA 3FFAA 5FOSA 5GV7A 2G5CA 4CIBA 3PGMA 4QDXA 3S7ZA 1IBLB 4HFMA 4D3YA 2Q9CA 4IHJB 4PAOA 4XWGA 2ZT7A 3JYLA 1FRVA 2QN2A 2XF2A 5LKRA 1REQA 2LNDA 4Q9KA 4XGKA 4UARA 1HNXB 4F84A 1D2RA 1JLLA 1KAEA 2BJHA 2R3SA 2R8XA 2V7EA 2YYSA 3H2ZA 3M7IA 2G72A 3OO0A 2FX3A 4DZRA 4CBVA 2EGHA 3PUZA 5EPUA 1ISRA 1DVRA 1P9LA 2AS0A 4R2XA 1MX3A 1W36C 3RVQA 4ZI5A 3TH5A 3D6TB 3KL2A 2A5GA 2HU7A 3IDOA 3IODA 3KTOA 2O2EA 3I01M 4PG7A 3LO5A 3NHYA 4JUCA 1CNFA 2JFNA 3E03A 3GFPA 1KTIA 3QVKA 5F98A 2PUGA 1DQPA 4RTJA 4ZQIA 3OPVA 4V39A 2ZIGA 3LZDA 1P9OA 3ASVA 4FDVA 1H3NA 3V6LA 3AV3A 4MYRA 4OEHA 1S6YA 1PR3A 2FPUA 2H8GA 1TT5B 2I4RA 3AR2A 3HY3A 4LYJA 3OVMA 2X23A 1DDOA 1BZYA 2PZBA 3IUEA 3IBSA 1NN0A 2YWHA 1M1NB 1UWKA 3B9BA 3ABRB 3GRRA 2VTBA 1JS1X 2WTAA 1Z74A 5AP9A 2IF2A 9LDTA 1ENOA 3RYFA 1HR0B 3K4PA 4FMBB 3C4VA 1BS9A 5FL7D 4TTAA 3GH3A 3WRYC 4BKRA 2B20A 4RQTA 3TTUA 1YWGO 4ZT7A 1WW8A 1TC2A 1U0RA 3LRPA 4UAJA 4UBJA 1PF7E 5KAPA 3OCWA 4JBLA 3WWOA 4AJNA 4EI2A 3BWXA 2R6DA 3GOQA 4LV6A 2YX1A 1KFEB 4WECA 4US2R 1XK6A 3Q7TA 3MTBA 2ODEA 4OHKA 2WKRA 4YRGA 3DQPA 4YAIA 4LZOA 2GCIA 1L7RA 1XRSB 2X9GA 4JQZA 3QY0A 1XTJA 1H9AA 3MSCA 3NM4A 4RK0A 1DQRA 3VYSB 4FYHA 3TVTA 2IY9A 2YWRA 3ORQA 3NRCA 3FLAA 1PJQA 2A6PA 4M2LA 2GLUA 1CJCA 1P5ZB 2D4HA 3M9LA 2IZZA 1J00A 1ZGAA 2B3DA 2GD6A 4F6RA 1E3SA 4YB8A 4NV1A 1ZL0A 5BT8A 4M1YA 2IS6A 3K9WA 1DTWA 3EGIA 4U7PB 1QC5A 1SCUB 4Q3AA 5LC1A 4DNXA 4GECA 2C9YA 2CHEA 2EVWX 2HJVA 5FADA 3UM9A 2P9GA 3HFJA 1MC1A 3FUWA 3R41A 4S1TA 1DG1G 2BBSA 2JLBA 2VEDA 3H2GA 3MZ0A 4GYKA 1Y3CE 4G1BA 3G5AA 4BE9A 4Q7QA 5HFNA 1WV1A 4MQFB 1R8QA 3HR7A 1UP6A 1UINA 3AESB 4UREA 1QYCA 4DCUA 4NL4H 3DCJA 4HGNA 3KVYA 4O4IF 3IMFA 2UVPB 4YMVA 2AE1A 3D0QA 4I14A 1UFQA 3CT6A 1TAHA 2GF0A 1U2RA 4GVLA 3Q6NA 4EPRA 4F5ZA 1C8LA 4XPIB 4NU0A 3ZIAD 4FLFA 4EB6A 4Z4FA 3MIIA 1PNRA 4ACAA 3HN7A 1OI4A 1O97D 1VIDA 3FFWA 2FW6A 5IJAA 1DAHA 1SJ9A 3I9NA 4FYWA 4QYWA 2ZR9A 3V80A 4A2QA 3AU8A 3GG2A 1YQGA 3AYZB 3A2MA 2FH5B 4PN7A 5EMHA 3D1VA 3JQ9C 4LBYA 1I0ZA 3B6JA 1WBDA 4Q7KA 2O3SA 1M2VA 1VMKA 3E9CA 2VJDA 3PXXA 2GF9A 5FBHA 4C0BA 1E6CA 3WK4A 4BRZA 1ZGCA 4MW5A 2XUFA 1A8IA 3MQFA 4GH5A 4A4DA 4IDNA 4BNHA 3OZVA 4RTLA 4M55A 5EJ8A 1C7ZA 2BF4A 4KJZA 5BQXA 1QRTA 3GVHA 4MQ4A 3PUXA 2WV9A 4AG5A 3FBGA 1JV2B 1IRIA 1I1QB 3BTVA 1V9LA 3AONB 4JELA 1KJ8A 4OL0A 4RELA 3VO8A 2QN9A 1E1RD 3OTQA 4X91A 2C4VA 2WNSA 4TV9B 2ZJ0A 3A1VA 2AI2A 1EXVA 4FJ2A 1Y3AA 2C61A 4MB6A 4ZHQF 1WPQA 4YMUA 2ZSBA 4FOLA 4QHYA 5TY0A 3HUDA 4U6QA 4QGGA 2RJNA 2HHAA 2FQQA 2PKXA 2PZ8A 3EZNA 3H75A 3IIIA 1IPHA 3D8HA 1JQKA 1XAJA 4FK8A 4FPXA 4KMSA 4RFSB 1R8SA 3A1TA 2JAHA 3LU1A 1QM5A 3LD9A 1HL3A 1IWPB 4LZAA 2ZM5A 3LLCA 4ZQBA 4GR9A 3TZ6A 3ZDAA 2I66A 3AL0C 1Y37A 2C7GA 4F5YA 1ZJZA 2HMVA 3G2OA 3CVYA 1RXCA 2AZTA 3T3PB 2FHPA 3UJBA 3H84A 4E13A 3ZWQA 3L1UA 4I1SA 3TXXA 2JH3A 1K4KA 2VZEA 2JAUA 3F90A 2G8LA 2GCGA 3UHOA 1FDUA 1IBCA 4JZKA 2BUAA 4KQEA 3BIXA 3RYIA 4BECA 2O5EA 2XNJA 1R1DA 3P9NA 2G06A 4W7SA 4CEHA 1USVA 2Z08A 5JASA 4HXEB 1Y7HA 3F5MA 4RVOA 1BSVA 1ECBA 4JCOA 5SY4A 3T35A 4Z1MD 4YDQA 1YRAA 2PSDA 5JXJA 1TK9A 1RAAA 1WIWA 2CJYA 4Q6BA 2ZBFA 1KARA 4K9PA 1VP3A 3ZZNA 5K0TA 4L22A 2XX3A 4OJYA 2GSDA 3GDFA 4TVSA 3KZ1E 3PI6A 4QBFA 4ADSG 5FV7A 1H0RA 2XCQA 3C6YA 2BHTA 3ZE8A 2V7TA 2ZK7A 3CMMA 3ZGVA 2XCTB 1XKQA 2QOEA 3D4PA 5A7HA 4E22A 4B7ZA 3L77A 1DCMA 1T6ZA 1ESDA 2BR5A 3AHGA 4WN3A 5JEDA 3PJGA 4PLTA 3B38A 2N47A 3M2PA 2J9FA 2VRCD 2DF8A 3KT6A 2CVQA 2ILTA 4ZJUA 1SCJA 4MUGA 4OHYA 5FXMA 1PZFA 3DKRA 4IMJB 1JDJA 4U2BA 2X0EA 3UMRA 5ITZA 1UP7A 3UMYA 2GAFA 4RF5A 1XLVA 1XK7A 2V5VA 1I9GA 1WDKA 4OFWA 3T4XA 4KE6A 3M6MD 2I6SA 3VV2A 3CNQS 3MJRA 3WIUA 4DSNA 5AW9A 1C9DB 1QIIA 3RQSA 5BSVA 3OJOA 1UOPA 3ICEA 1R6DA 1XEFA 1JN0A 4GMKA 1W76A 3IP5A 3AGPA 4K8OA 4MVXA 2NU9B 3CF4G 1KBQA 1F7VA 3HKBA 2H4HA 3WGNA 3N2KB 5JO0A 1E2KA 1JLSA 2DWCA 2ERXA 4J29A 4JV5B 2OO3A 2C0CA 1XVVA 2J07A 1CUDA 3CB4A 1N6NA 2J7PD 2NGRA 3O7MA 4RGVA 3UC5A 3SNKA 5AUPB 5KTPA 3N5CA 3INGA 4ETIA 5IAAA 4ZQCB 2WJVA 4B7AA 1ZLXA 4JLKA 1J7JA 5JZSA 5AOAA 3N39C 4V3BA 1LSSA 1E60A 3CLVA 2GETA 2XWJI 5I5EA 1FX0A 3JVVA 1Y8CA 4O33A 1XN1A 1H2FA 4MITA 4BNDB 1NQXA 5D5HA 3B7GA 3SIXA 5KTTA 4GC5A 3RUPA 3FZYA 2OO5C 1SGWA 3FDZB 3L01A 1QK5A 2FPIB 4M22A 2AQKA 5DCUA 3RHFA 3K1JA 2O8CA 2WFAA 4PZYA 5DYGA 1ZEMA 1DKMA 1EWQA 4FC6A 2O7QA 3ELBA 3ZUPA 3EDQA 1VKZA 3HU3A 3COPA 4N03A 2QVBA 3Q2KA 3SBXA 4ZYWA 5IDWA 3R7FA 4H7DA 3CUEF 4YPOA 1DKOA 1T3SA 4RZIA 2P6OA 1PJSA 3B3AA 3PWZA 3V4PB 1YU9A 1H5QA 1SBNE 3EYAA 3LYAA 4EECA 4AMYA 5THXA 3B5IA 1MB3A 1K27A 4Z53A 4B9AA 4C4OA 4HDOB 1YVDA 4EWLA 3RSGA 1Y4UA 2Q2NA 3F4BA 3PRYA 1W581 5EZYB 1RWWA 5LZ9A 5ALYA 5CFLA 5CXUA 5LWQA 4RD1A 4NCBA 5ICCA 5FP0A 1K7EB 1QORA 4DNPA 1G5IA 4DVJA 1FNNA 3CW8X 3REOA 4BNGA 1C3XA 2V7XA 4OHWA 4MI1A 5I9SA 1J2UA 3DPUA 3P9IA 4F3CA 1U7HA 5A2QA 4UHDA 2HNAA 4O1IA 1QANA 2CXXA 3VR4D 3VC3A 2IY7A 1QH1A 4EEXA 5LU8A 1E6LA 1OX6A 3OJLA 1UODA 5KS2A 1RVDA 4FXOA 4HAIA 1LVGA 4X20B 3NHRA 2E18A 1RWNA 5BQFA 1NMQA 2C5AA 3LUPA 3MN1A 3SF8B 4Q7LA 2WIFA 3UY4A 3MOIA 1ZD1A 3USES 3T1VA 4C2BA 1FYWA 2XOEA 3NYIA 5J2TB 3TJRA 4AROA 3NT2A 4RNDB 4A8HA 1CHNA 1Q1EA 1SUEA 4OL9A 5I7UA 2ZKLA 4QG7A 3DBHB 5CK5A 1MOQA 2QJOA 1ZA2A 2BR3A 3U7FB 5FV4A 2C2MA 3C48A 4FWBA 4DLZA 3OPXA 1EUDB 3AUJB 1G8JA 1IU9A 3TQFA 1C30A 2HM7A 4XUEA 5JZBA 1X42A 2JEOA 4EG5A 4OXRA 4JJAA 3U1BA 1LPNA 4C3OB 1T4DA 1MQ9A 2B92A 3JQ6A 1C0LA 3G8CA 2XBMA 1BQEA 2NTYC 3L6OO 1WR8A 4MK4A 5BN5B 1NBME 3BGDA 3TKAA 5ADWA 3KETA 4WT7A 5CCDA 4EPVA 1RHUA 4ZOLA 1NPTO 4F56A 2AFHB 4HQFA 4N5MA 3NRBA 1YOBA 2IEZA 3KQOA 1AO0A 4R4JA 3MT8A 4KG7A 2J08A 1EUCB 3AERB 3DT8A 1G5QA 4OGKA 5K4AA 1YKSA 4UBMA 4DTCA 3SAJA 1UOEA 3L6CA 3L0PA 2QRJA 1P2GA 4QG3A 4N8EA 1U0JA 3IQWA 3KAQA 1E9VA 2ZIWB 3D43A 2ONJA 4X66B 3U19A 4I81A 5JBQA 5KQPA 4C0KA 5AI4A 2QPOA 2FW0A 2F1JA 5FPKA 3S8YA 2ZAMA 3L4SO 5DM60 2AJ8A 1BXKA 2C78A 2SICE 3H9UA 4N49A 3OZRA 2LV8A 4QL3A 3ROQA 4IXTA 4EBFA 3RJ9A 1JQBA 1MW8X 1XKXA 3PD7A 4KP7A 1RJFA 3PFIA 2C4UA 2DP4E 2J9XB 1NN3A 3QKSA 2GBCA 4E08A 1X70A 4M46A 2PH7A 3G2HA 3TQOA 1CUXA 1GILA 2WM2A 4YLEA 1IUPA 4CFZA 5EUCA 3ZQ6A 1ZITA 3P9CA 3H17A 2J6CA 4JOSA 4F6CA 1J99A 1IYZA 4MS3A 4MWOA 2FUG6 2AV6A 3DCIA 3NQ41 1ZNWA 1L1QA 4TUYF 3IUBA 1FRQA 2MHCA 4N8DA 4TRJA 1CUVA 4YWHA 3TNLA 5IX8A 1GG2A 5JDIC 1GSAA 1SC4A 3B53X 3E9EA 4YNBA 4FYKA 3AJ9A 4BC0A 3DCNA 1BEEA 4RS3A 1K3UB 3WA7A 3HJAA 2O8EB 4ABTA 1I30A 1NGSA 2XQIA 4KXVA 4NEHB 3WLQA 1J49A 1QO9A 4R1NA 4DEYA 5C8YF 5B58T 2CCKA 2GDZA 3N8KA 2WZDA 1GG8A 5TJHA 4AX8A 3PFGA 1UPXA 4AMBA 5K8JB 4FBGA 4YJFA 2VPWA 1A50B 1I6WA 4MVCA 5E3IA 4EW3A 4RDIA 1AKRA 3S1AA 4HK4A 5ECDA 1QHHB 1KZ6A 3LHSA 4KQFA 2ZBDA 4KHPB 5HRAA 3UC9A 1B6RA 3W78A 3OHPA 5JNWA 5KC9A 1Q1QA 4FQ5A 5IHXA 1Y8QA 4QJ4A 2XGOA 1BOFA 2JGJA 2PE5A 4GO1A 4L5AA 4WINA 5D7BA 3DV0A 3G88A 4QRIA 2HSGA 4RIEA 2PKWA 3GGJA 1H8HD 1QRAA 1FRNA 2EFHB 1B8UA 3H1FA 2PKQP 4JBHA 5C32A 2PR2A 2BKLA 1N6HA 3H6KA 1JHUA 3IIJA 1SUPA 2C9MA 1LBSA 3EJWA 5CTAA 3S68A 3Q0TA 1ZA1A 3ZCUA 2BKVA 3FTPA 2HSJA 5FA6A 4QGSA 2WK1A 5D3MB 4B3TB 1DGQA 4GLOA 3WNDA 3OCXA 5KTYA 1MZVA 1RSZA 2K2QB 2UZAA 1XWFA 3DZ8A 1IQUA 3GAZA 1KI6A 3W7AA 3K0FB 4X3CA 1XF9A 2FF7A 4YDRA 2GBPA 2CVOA 3CPJB 3ZV5A 2E4XA 1B43A 3GRAA 1NW9B 3KZXA 4I6EA 3SF0A 5LWHA 1X7WB 2P7HA 4ZJPA 3HB7A 3M4XA 1JBKA 3FIUA 3I5YA 1YS1X 4U39A 2VOJA 3GR6A 3SX2A 3GW8A 1FS6A 4UDYX 2B37A 2ATCA 2JJ1A 3HCWA 3LLSA 4ESEA 2ZRKA 4R8VA 5L3SA 2R4QA 5A0VA 2H63A 5ERGB 3DVQX 4E31A 3OU6A 2WPNA 1PFWA 4CL8A 1F51E 5BR4A 4YV1A 1YJAA 3LP5A 4PRLA 1BG6A 1LKZA 3GP3A 4PWZA 3CY6A 2WMYA 3GBPA 1JWLA 4PYOA 2FXVA 4GX1A 1EDZA 3EZYA 1ULSA 3HDTA 5H0IA 1R64A 4MB2A 4BTEA 3AHFA 4C87A 4QXOA 3I8XA 1BFKA 1B4DA 1SZCA 2GBFA 3JYOA 3CINA 1M1NA 3EB9A 1NSFA 2AC7A 1XMSA 3NS7A 1O96B 2ZCVA 3IPAA 1VXRA 2R8RA 3NB0A 3QLVC 4FNGA 4ZVUA 2I67A 3A6EA 1NJFA 2OD2A 1JYSA 4B3JA 1OA0A 4HR7A 4DFDA 1A1VA 5CLFA 3M5PA 4QPPA 2QRQA 1PWZA 2P75A 5ALWA 4UOEA 2HHCA 1ZCAA 2IEIA 2QU8A 3GG9A 4KBGA 5JATA 2UYCA 3N05A 4PS0A 2CC2A 3RRFA 4B3MB 1H05A 4PBSA 1XZQA 5KU7A 3AEQA 3LJKA 1VHTA 3ASUA 1PJTA 1G6Q1 5EEHA 2IBMA 5EZSA 4KZKA 4BN0A 2WD8A 1A3CA 4JP3A 1OROA 2KI5A 4X1KB 3WIDA 1P1JA 2X6RA 3F3YA 3O26A 1QGOA 1GRRA 4CHGA 3IL2A 3R7SA 5F4ZA 1JALA 4D3DA 1ISFA 1B00A 3UG6A 3CCFA 3NX4A 5E2IA 3VR5H 3NEAA 2W4IA 3SJUA 1P9WA 1PP4A 2F48A 3OY7A 3P9YA 1A8SA 2X1VA 3DTVD 5EFZA 4BO0A 2D00A 3KJQA 4DA6A 3HO8A 1HNNA 5DFAA 3GFOA 3O8NA 1IOWA 2IYAA 1EMDA 3BS4A 5AI0A 5KNDH 2GPWA 4WOPA 2QYHA 3CF4A 4M83A 4HWSA 4BO9A 2I2CA 2P9JA 3IP9A 1RLMA 4ZVRA 2IHYA 1P0PA 1QVRA 1UP4A 4D96A 1OTHA 3BMOB 1R50A 1U31A 4KDRA 4O3FA 1AG9A 4XR4A 1EXMA 5AW0A 1UZMA 2GXUA 1G16A 2AG6A 1U99A 2P68A 1F8XA 3RK1A 1N0HA 4NVRA 1YQEA 2H5LA 1XVIA 2I4OA 4OU5A 3V48A 2WHPA 1WTAA 2X4LA 3OJ0A 3UJNA 4J4TA 2G9NA 3SS7X 1ZH6A 1O77A 1R0CA 4ZANA 2FEAA 2P11A 2O23A 4JJGA 2WNIA 4GICA 1XRRA 2KB0A 5BYJA 2X4GA 4LYAA 3DFMA 1KFJB 4IY1A 4J2TA 3R75A 4ZJYA 3ESRA 4BO4A 2F9MA 4KR7A 5A1JA 1MH9A 1RXSA 2G25A 4ZHQB 4L85A 5AJHA 1QP0A 3QLUA 2B1IA 3KVRA 2AW5A 3IPYA 4JWKA 1USWA 2FX2A 5HP4A 4PZDA 1BVYF 3SYMA 1LSJA 2DH6A 2LD4A 2PQMA 1DO2A 3CPSA 4KSYA 2JIZA 2ZZKA 2W9XA 4P38A 3X1MA 4B8WA 4CQLA 1M6NA 5K09A 3ZV3A 3NOOA 2AK3A 1L8OA 4I0WB 4PHFA 2LTAA 5KVCA 4KPFC 3P9KA 4JAVC 4P3KA 3HDGA 4IGEA 1A77A 1RAGA 1YRBA 1ZMXA 1PL6A 4H1UA 4MGKR 4NARA 4FUQA 1Q0ZA 5AJWA 1HYGA 4UMDA 1T9GS 2AH5A 2WD7B 4EYEA 3V4FA 2VNAA 2YW2A 3KX2A 5DGTA 4Z4QA 4DV2B 3DMTC 2ZBRA 4G26A 4HDSA 3PZRA 4DLNA 2GEVA 2XTJA 2FWJA 2EKPA 2JCBA 2P5SA 2V8OA 1QAQA 3KKZA 3L0YA 1DAPA 3Q3CA 3SJCA 1Y7TA 2Q9UA 2PTHA 1DCKA 4FZ3A 4KYUA 4D4GA 1LUAA 2GVDC 4E1BA 1Y9ZA 2FEWB 1PLLA 2P8JA 3QHPA 5GM1A 2FWBA 4D0LB 2HA4A 3ND6A 1NI4A 5TIIA 3B6MA 4B17A 4POOA 3G68A 3GJSA 3SBDA 1X8LA 1NOKA 1R0SA 5FTNA 3RIEA 3WKDA 3KQLA 3UWDA 1MXHA 5K6TA 1UWLA 3C1TA 4MPJA 1Q3HA 1W8DA 3QA9A 2KYRA 2BGNA 3R5JA 5JLAA 1RXWA 1T5TA 2GLTA 3FHLA 4KOAA 4WKOA 1P80A 5JFGA 2W6OA 4QYMA 1SIOA 4RTSA 1N36B 4WUTA 1Q0QA 2PQ6A 4P0PB 1OLUB 2QRKA 1YB7A 2W11A 1PR0A 2YJ3A 3BXPA 3N3AC 4GI2A 5JZ9A 2AQHA 1KJ9A 1DU4A 3I1JA 4HMPA 2XR1A 2J0UB 2DERA 2DG2A 2BDUA 3NIFB 1T25A 4I55A 3FG9A 4J16C 2Q8QA 3VO9A 4KUEA 3C8MA 1C1HA 4UDNA 2WM9B 2V7GA 3DPIA 2JLCA 3Q5EA 3JY6A 3ROMA 1JQJC 3CURA 1Q11A 1KMQA 1A98A 1LBHA 1YI1A 2X8LA 1W93A 3G5TA 4CUZA 3NKLA 2KW5A 1CRQA 2P41A 1KH2A 4DUYB 4C08A 3DXFA 2Q49A 4MQ5A 2P9BA 3ZHCA 4EY4A 4YGYA 4F72A 1G6HA 1SG9A 1JLKA 3CU5A 3RJMA 3TTXA 3TLBA 1UBOS 4K86A 4NZZA 3SFTA 1W29A 4DUPA 5EJ6A 1YS7A 5C4MA 5HKKA 3JQCA 3DF9A 1GAWA 1DFIA 1WMEA 4KWHA 1G2PA 3NG1A 1O0CA 1RS0A 1XVAA 3L7DA 3L0SA 4UQPA 3W05A 4Q9AA 1ZK2A 2FZCA 3LX5A 4NJOA 5DEIA 4CEIB 2ISQA 5TARA 4HSGA 3UTCA 4N7RA 4U7GA 4DT1A 1ZM4A 2CJWB 5FJJA 2GASA 2VWGA 4BASA 2PO5A 3FAKA 2FFRA 5KOHA 3UAZA 1AHIA 3SHOA 1UJ5A 1ZC3A 1GTMA 1RJEA 1LRLA 2ZYWX 2YVUA 3FLEA 3QVSA 4DILA 3R1IA 2JG3A 1JQEA 3HM9A 3P8ZA 3K72B 4HLDA 1QX3A 4JR0A 3WK6A 4LGMA 3BSWA 3HZZA 1KEPA 3ROXA 3PRHA 5ILGA 3I4LA 5KHAA 3STTA 1CYEA 3ZKAA 3N1UA 4BMSA 5IXSA 3G5LA 1U0BB 2VNJA 1ZQ1A 4UJ3A 4IOMA 1U0LA 2WT8A 1M0EA 1NQTA 3HDVA 3UQYS 3HACA 2NU6A 1CJUC 5FPHA 4TTSA 1CEQA 1T0JB 2RKBA 4IQ4A 2I3BA 5JT1A 1CRLA 2ENUA 1YACA 3T3DA 3FI0A 4JHLA 2IYYA 1NSTA 2IXAA 5C9ZA 3PNBA 4F5WA 3C43A 3GT7A 3V4VB 5EFOA 2XZTA 4MKIA 2FN3A 5ANRB 5LLDA 2AMVA 3V8PA 2BZSA 2HW8A 3GFGA 3JWEA 4S12A 2BF7A 3VO2A 3FTEA 2J46A 4FZVA 1LEHA 1HDZA 2XOKD 1N6LA 3QE4A 4ER6A 5IZ4A 3L7NA 3WTBA 2C0QA 5K6AA 3BSSA 3OJFA 4MH0R 5FPQA 4H77A 2CNOA 3OOEA 3I53A 4J6FA 4FFLA 3RVRA 3PGKA 1ZESA 1NWCA 2QM3A 3ENNA 1PRYA 3OZBA 4NFSA 4J0JA 1UWVA 4J0GA 3JPWA 2W2KA 3VPDA 3TNYA 2J7KA 3QLJA 4EA8A 3ZQUA 1NKSA 4RJ2A 1OZHA 3DWFA 2JCXA 3G7UA 2CMDA 1BS2A 2MYPA 1UZUA 2BJVA 2W2QA 4JLPA 1JZTA 4MCJA 2IBTA 4RPLA 1XZPA 2PUEA 2H1FA 5E1MA 1MC4A 5B53A 1JHZA 4CI9A 4LMRA 3QMMA 1II8B 4IXMA 1BRTA 4I8DA 3ZE2B 3QNMA 3G5MA 1NMSA 2B99A 2NTVA 3OKAA 2JCSA 4DQUA 1M1YA 3LMKA 3N8HA 3TOCA 5J2UA 1ECJA 1RFLA 1AY0A 4U6SA 1SXPA 4EJMA 4MULA 4UUQA 2NZVG 2ZR0A 4RIIA 3OF2A 2CNNA 1ENPA 3KDPA 3LNTA 4XOUA 1WO8A 1VKJA 5NULA 3TW6A 2VHUA 3TOSA 3OICA 2FFHA 3TBKA 4AT1A 1CJMA 1Y1KE 2BM0A 4QNRA 3LXXA 4TS1A 4WZAA 4G0PA 4DBZA 2FU5C 3KOYA 1TFUA 4UFPA 2POQX 4LS3A 2VPPA 1NVXQ 4MRMA 3U0BA 4ID3A 1U8EA 2SKCA 2X76A 4RVFA 5LBIA 4BQEA 1JA9A 1KL7A 1J8FA 4XSHA 3FZEA 3T5CA 1N2EA 4ZOLF 3RFXA 4ZO7A 4ECAA 2I8CA 1U8TA 4AN1A 5JXHA 4QJ5A 5FF9A 3WWDA 1FLNA 3G8BA 3P9XA 1R5NA 4TMFA 4W82A 3R7LA 1XMOB 4BWFB 3RFUA 2VYVA 2ODAA 3DLCA 3IO3A 3MD9A 3PX7A 4GE0A 4AF7A 2JD1A 4D74A 1SPXA 1KMHA 4OAQA 4II3A 2H2GA 4BMZA 5KKCA 1T15A 1SD2A 3DWGA 3GI1A 4YMGA 4KE7A 2GD1O 1HA3A 1SKQA 2PL3A 5AQEA 4JI2B 4MW7A 1NR7A 3ORHA 3KKKA 4DMCA 2QUKA 4WCFB 4EA7A 2VQEB 3OFVA 5A04A 1C81A 1JG6A 2JANA 3AB3A 3HB4X 1C8VB 1XSEA 2OHOA 2QRGA 4D9EA 1FSGA 2A5LA 2WHRA 3HUTA 1XMXA 4U63A 2PNJA 2AF4C 2V4ZA 3VVLA 5A1TA 5AOBA 4HAVA 1U8CB 5C8YB 2BKAA 3EIOA 5D7NA 2FZKA 4DIDA 4PPYA 2VF2A 4LF4B 4E30A 1SKMA 2JGMA 2PBRA 2P6NA 4KVZA 2PYDA 2C83A 2P6MA 3ZD8A 2PX3A 4UEJA 4HEJA 4CPDA 1FXSA 2FUEA 2G77B 3C87A 4CG3A 2DFKB 3AKYA 1VP9A 2DR0A 4ZCQA 3AQ4A 2XUHA 4BMVA 4N5LA 1P4GA 4ND3A 5LZ5A 1F2VA 1IWOA 1T8PA 1EE2A 2R96A 4NOKA 4PFQA 4CMHA 1JR6A 2XDYA 1V8OA 1X87A 1E0KA 3SJZA 4CFSA 4IWXA 2HK7A 1P6UA 3HVRA 2R6R1 4UBNA 1UQUA 4G5FA 4N41A 2AMYA 2O0HA 4LMBA 4ZGGA 3LW8A 3LYUA 1AT1A 2HLDA 2B25A 3EVZA 3MQ4A 1IY8A 4P5EA 1N2CA 3IOEA 3NBZC 4TL9A 1WU8A 3TD6A 4A1OA 2QW1A 1QR6A 5BMVF 3F8TA 5KOJA 4BS9A 3JTEA 1PN3A 3A4LA 3QBDA 2A0UA 3RB8A 3IVRA 5DPMA 3HN2A 3P2OA 1XQ1A 3STYA 5EA2A 1HL7A 3DZJA 1WJGA 2W7TA 3JYPA 1JBEA 4IGKA 4KQHA 1HV8A 2IIQA 4MKRA 5LBTA 1YZHA 2IUSA 3V7NA 3KTAA 4LTNA 4DHWA 4Y2QA 5CDGA 4D5GA 2Q2OA 4NK4A 1M5UA 5JNVA 4RXMA 5LLSA 4GPD1 5KCMA 1W4AA 3KB8A 2OCBA 3RVPA 4LIPD 4GOND 3LVFO 5EE5B 5YASA 1LNQA 1ZD3A 2V9CA 3EOBI 4CQJA 4RGYA 3CPHA 5LCXA 5BXQC 5C5IA 3QBTA 4F4DA 4KO2S 1FS5A 4X8HA 3LPCA 3FR7A 3TPFA 3MHPA 1UKZA 2Q2QA 1OOEA 3BVPA 3TQSA 1N5JA 2AJLI 3ZH2A 3OD5A 5A6SA 1WDWB 2YVQA 3QJYA 4FEEA 4BNLA 2ZRMA 4KXUA 3ZV4A 4BFWA 4WNIA 1TW2A 2IXGA 3RUAA 3ZHVA 3J80A 4HDNA 3I0MA 4AWAA 1L0BA 1J8VA 1XPJA 2Z9DA 1ULHA 3NUQA 3IPRA 4ED9A 1Y7LA 2A86A 4FEAA 4OXYA 4CJXA 2BSXA 3A4NA 4IVNA 3B70A 3I9LA 5T57A 1QMPA 4HQ6A 3C0KA 1N0VC 4M1OA 4RNCA 4CL3A 1DG3A 1KZYC 5EMJA 3WWEA 1BHSA 1T91A 1Y8AA 5AKHA 5ICEA 2OCKA 2VDKB 3ZY6A 3WMFA 3B2EA 3T0IA 4KB5A 4R31A 2O1WA 4J1TC 2P77A 5K8IA 1ZD8A 2V0NA 1CZRA 4LFAB 2ASEA 2DFTA 2OY0A 5TPWB 2YN2A 3AEZA 2QQFA 5FPSA 5KJCA 3QUTA 4HKTA 1KYZA 3T9DA 1T3HA 4C1BA 4TV8A 3NM5A 1T6XA 4E94A 3TGLA 4LJLA 2OQVA 4ZVSA 1F6WA 2YY7A 1F6BA 1OV6A 2GH1A 2IYEA 3L5KA 2NUTA 5I9MA 1N57A 1F2TB 2NVUA 4CYMA 3UF0A 3SM3A 2FW7A 1V6AA 4XIFA 1O95C 2BZGA 2YC4C 2ZITA 2CD9A 1N6RA 2FW9A 3K2IA 5I7EA 3U9LA 4GS5A 5E0KB 3AUXA 4WXMA 1AE1A 1KF0A 4H35A 2BCEA 4HTFA 4YK7A 3CVUA 1IVYA 1YV9A 4WNYA 2HA6A 3WYCA 4EGQA 4OBBA 4Y7DA 1P1KA 1PS8A 1GZ6A 2ONYA 2Z57A 1NUHA 2ZFUA 3OOJA 3VDRA 1DZIA 2OUIA 4IJWA 5KINB 4ZOEA 3CWZA 1QQTA 4JFRA 3NNDA 2WSSA 3WP0A 1E1QA 2XCIA 1KVSA 3BDIA 1NZDA 5EJFA 4ZAXA 3R8FA 4B44A 2BFNA 5J5AA 1FVHA 1HFEL 3W2EA 3BULA 5EUQB 4PQGA 4AXXA 3Q11A 5LIRA 3H3FA 3QNWA 4U7JA 1BD4A 1BCRA 2WG0A 1KMIY 2YFHA 4UAUA 5IVIA 3IIMA 3EGWA 3VISA 4D9MA 1HTTA 2RC5A 2Q3CA 3BE8A 4MLZA 3FTDA 3GJQA 1V39A 1NFFA 1YL6A 4MMXB 3FKQA 4JJEA 3DWIA 2YMLA 4MQEA 3EX7C 4X5OA 4MIOA 5EHNA 1FMTA 2NZJA 4R01A 3STUA 4OP1A 1X39A 2FZWA 2G88A 1L7XA 4AYXA 5B7PA 2G0TA 3KJHA 1Z47A 4BQRA 1FQJA 3ADKA 2R48A 1JSZA 5HWSA 1R0ZA 3D3WA 5EKTA 4B3IA 2ALJA 4EKDA 4CG1A 4NMXB 4BO5A 5K3FB 2HJHA 2OBNA 1U0TA 3ACBA 3HJTA 3LK6A 3FMFA 3OE1A 2UZ0A 5ICGA 1FSFA 2Z9CA 4ZIRA 2P6UA 4QD3A 2OYRA 1KWKA 4CMGA 2HWWA 1NTOA 1A9QA 1LSUA 5JBIA 4OP2A 3CBQA 3VR3D 5BNWA 4Y9SA 1AZWA 1TA4A 4KN6A 3JQAB 4Y1RB 2NUPB 4KQMA 3ZN2A 1V48A 3SGLA 2R60A 2HCJB 1T5HX 1KVRA 4M0EA 3ZTWA 2BDTA 1QQ6A 4HWTA 2A78A 1Z7YA 2O2HA 3BORA 4AIRA 1RC8A 5JCPA 1T5IA 2EYUA 3C85A 3QUQA 1HG1A 2TSYB 4LZJA 3SKXA 1DP4A 3NP9A 4N0QA 3PYXA 5MGBA 1XF1A 4D4MA 3C8ZA 4IJKA 1PS0A 3QF4B 4TMTA 4DREA 3HBNA 4ZMRA 4B5KA 3JYHA 3QV1A 1VYVA 3VHLB 1UADA 1ZJ5A 2I2AA 1L7QA 3MWKA 4KO8A 4Q3CA 4TT3D 3V7YA 3BKXA 4F4JA 1E2PA 3Q0IA 3RC9A 3ZUGA 4EJFA 1DUSA 1HE4A 2QVYX 2XYVA 3G2MA 4UUMA 2VHVA 3AOEC 5AIBA 4D25A 2NX2A 2ZU6A 3HYRA 2G4CA 2AX4A 4ECEA 2YV5A 3G9QA 4XTRA 1Q12A 4GP6A 3AY0A 2PMCA 2JLRA 3Q8LA 1N3IA 3H3XA 3F6PA 3HEBA 3QQPA 1GEEA 1KE1A 1S3SA 1KP2A 2W6MA 3N2GA 2VAMA 1XDSA 1NYRA 3AB8A 4Q3NA 3IR6A 5K5EA 2OORC 3BK7A 3L1HA 4LTDA 4YRIA 1X92A 1WS6A 1B0UA 1SPBS 2XQJA 1BVUA 3F6BX 2C77A 2AXNA 1TNDA 4E09A 1VLLA 2VHCA 2ATXA 1I01A 2QLMA 2ZVJA 2OZEA 1OJLA 3AHDA 1VGRA 1Z7WA 3DKVA 3I01A 1GNTA 3QVUA 4GGMX 4Q7MB 4DANA 3L4KA 1AZTA 5CDYA 4YRPA 2M6LA 4R71A 2D7DA 4B33A 1FDWA 4CT0A 3BF7A 4N6GA 4ZK6A 2QTTA 1TMOA 2XXBA 3JZAA 1G3UA 1DIAA 4ASUA 3NO4A 3IUJA 4JA2A 4LBZA 2EERA 3PC7A 1Z2NX 3FKSD 3LUFA 1RXYA 2JGEA 3FOAA 4DMHA 4LF9B 1KYWA 1ZUNA 3UCEA 4CCYB 1ZXBA 2VNSA 3U17A 2X22A 2P9YA 5BR8B 4EL5A 2H65A 3JWIA 4QDTA 4GYJA 1US8B 4CF7A 3FCXA 3TFOA 5F7XA 3I72A 3AF5A 2B6HA 3WNVA 1P44A 2XQFA 1NL3A 2B61A 1T9ZA 2RGXA 2WIKA 1Y6QA 1RQRA 2JDIA 2X0IA 1QCDA 2ZUCA 3FCYA 3OO1A 3HZHA 2R79A 3R6TA 1W4LA 1XDGA 4RDCA 4X7PA 1SXJD 4KACA 2QVZX 1BE0A 1CJVC 3QVLA 4BB0A 1YK1A 1X14A 4DWJA 5CBPB 2RH9B 5LR6A 4NZNA 1PGNA 1GYPA 1I5OA 4QBGB 3PLRA 3WB9A 5JWOA 3AUUA 3QW4B 2P69A 1RCFA 2BBWA 3PHJA 1E59A 4FFWA 5FBKA 1MN6A 1QZZA 1P0FA 1WNFA 2WAYA 5SY9A 3TJZA 4BO1A 5FNVB 2ASVA 4BZWA 3O4JA 3CHYA 3LW7A 1ZIYA 5M29A 1G21A 1YE3A 1QDUA 2Z5FA 4HB4A 4ARUA 3QENA 5KDDA 3QH4A 3PYMA 1G3QA 2PUJA 2NT4A 2PAAA 4WBNF 1XCLA 2NPOA 2ZYUX 1ML4A 3SEAA 1JR3E 3VO1A 3AJRA 1QFMA 2VUSA 3WFIA 1KC1A 3VVMA 1IHOA 3IUNA 4J0FA 4MWDA 3E4CA 4KRGA 1VJ0A 4WMLA 1SQSA 4O02B 1J1UA 5AUQA 5HF6A 3WDSA 3AWIA 2PLRA 5ECYA 4KNYA 4A15A 3HP4A 1KPIA 1VHQA 2VRWA 3E9YA 3U49A 4DRYA 1AO3A 4AZ0A 1M74A 3WRYA 5JFOA 1B6SA 2J3DA 1LRJA 2W2NA 4PLZA 2Z2XA 1E1NA 2O6HA 3W4KA 4O8ZA 2Y1WA 2OV8A 4KHZA 5LOVA 1YZUA 1QTIA 1R9NA 2VDMB 1VXOA 2JGLA 1TJPB 4OLJA 4PLYA 4U8GA 2I9PA 1I80A 5E6SB 2VT6A 4JOBA 2Y8EA 1LY1A 1NWHA 3WLMA 2YJ4A 1YZ3A 3CPEA 2I6XA 3BXZA 2WJIA 4GX5A 1Y1SA 1THMA 1KPHA 2RHOA 3GELA 3OI7A 5CM8B 3H8VA 4OBXA 4UHBA 4XVUA 4RVHA 2PHZA 4H6WA 1GU1A 1KH3A 4EIWA 3OD1A 5F2NA 3RHZA 3EDOA 4L8FA 2IU4A 1FDSA 3OOYA 1XLUA 4LC9A 2HT1A 3HUFA 3FNRA 4LHVA 5TSDA 3TLAA 1YFKA 5BRNA 3BSYA 1O5TA 3I9JA 3ZHXA 2KQUA 1DMSA 2HJWA 3B7WA 3C14C 2D2VA 3FFBA 4KJXA 4P6VF 2VRBA 4R51A 4RWZA 3X2EA 4FFSA 3D8BA 3WGTA 2HRDA 3PK0A 5G1NA 1W88B 4KIWA 3LPDA 2D0PB 3AKZA 2FSGA 3IEPA 4RHUA 5FOVA 1TXGA 2D7JA 3CZ4A 1SN7A 4X45A 1BN7A 3LZ6A 3GV0A 1G5TA 3RKUA 4DR1B 2HDWA 2CXQA 1Y1PA 2EFGA 3I9V1 2WJ3A 4H1HA 5J2UF 1CY8A 1M34B 1XRQA 3ZWNA 4QARA 3RT1A 3TQIA 2BGUA 1WCXA 1ZMOA 2Q4OA 2JD2A 3AUYA 3EA5A 4PWYA 5TVGA 4F2GA 1I2CA 4AW9A 4EGFA 1FRZA 1MX1A 5ALDA 3MTIA 3JVUA 4KV9A 3JS5A 4IJUA 4OBWA 3SKYA 5BN3A 4IX1A 4R1MA 5JAUA 1DKRA 1DX4A 1RWKA 2IKSA 3VHXA 5JJ5A 1RLJA 4IDPA 4IIFA 3FLBA 4LCEA 3HJCA 3AL3A 1UKVY 4FHEA 3RBAA 2DULA 4P7JA 4QUKA 4PQFA 1RYDA 3FTCA 3QYAA 2F90A 3IELA 3W5AA 4UOZA 1NP6A 3L04A 4XI9A 2BEVA 2V7PA 4ND8B 1NA5A 1OB5A 2MYNA 2R85A 3IKLA 4U7WA 2PMFA 2XSZA 5EYPB 4JYCA 2DRIA 1S2MA 2VBIA 3JQ9A 2Y6UA 5KTRA 3HWSA 4LWPA 1ZUHA 4M21A 3TIIA 3WWCA 4AMVA 3QE9Y 1KY5A 5KSZA 3VJMA 3LCJA 3LGXA 1X0XA 4DADA 2DWQA 4X94A 3TLZA 5DLEA 4W5TA 4KLCA 3U3OA 4DM4A 1RC1A 5B5SA 1GG9A 1ABEA 1H42A 5CLLA 3RUEA 5CDTA 1C0EA 3ZJYA 2FF5A 4GQBA 4IIDA 1OWMA 4J7AA 2L82A 3NV9A 3SJAA 5D3KA 5KX5F 1LX6A 3N8IA 2PUWA 3QYJA 4WEQA 3H8WA 3U9TA 1FJXA 1L4YA 3ZU6A 3KPWA 1YKFA 1U8XX 4AVYA 5U9CA 2BM1A 1RAFA 1EP2B 1ZUWA 1Y7PA 4PTZA 3A3YA 1J8QA 3A7EA 4WLVA 3ZWKA 5EZ6B 1YA8A 1GAXA 1NU8A 1KI2A 2E89A 3HXMA 3AP2A 4LYYA 3WWPA 3BFKA 1BYUA 4DR2B 5LMUB 3QPUA 2ZZNA 2I2DA 3OM9A 4HQOA 4DS3A 3D0RA 2CLCX 5CCEA 4XCQA 1NQWA 4L4SA 3WKEA 2F1IA 4MPDA 4TKMA 5E7IA 3L84A 1DFHA 3R0JA 1UC8A 1UZLA 2L2QA 1Z0AA 5EY5B 5BMVB 1U2PA 2PSSA 4N47A 1IH8A 1ECFA 3JZMA 4Y1EA 4IXDA 1N2SA 3OBIA 3NIWA 4TTJA 3ZOZA 2AEMA 5LD2C 1TCAA 2SCUA 3AR6A 3ITEA 3OQ1A 5NLLA 3UT5B 4TN1A 4V0LA 4AP5A 5JYCA 4XWTA 4BJ6A 1YRLA 4YRFA 2RHBA 4BVHA 1HQKA 2OXEA 1RHQA 4UHKA 3WYDA 1DHRA 3B3QA 3EMBA 1H3FA 2NQ2C 1CQIB 2W2TA 4HH1A 1INLA 1O94D 1JAZA 4MUNA 3GLGA 4AI6A 3K5IA 4DA8A 3KQQA 1U3FA 3L0CA 4GQIA 5AO9A 4IDGA 3WMGA 1RZRA 3KU1A 1LLQA 2CFRA 2O59A 1FDTA 4PX2A 5DGHA 4QATA 5KVAA 3KZOA 4HBZA 2ECFA 4JVMA 4U5XA 2WF9A 4XIGS 5FR2A 5HUHA 8AT1A 1U0NA 4KK4A 1KJQA 3S2YA 4RTRA 4ZYZA 2JKVA 1GPBA 2G1JA 3Q3IA 1MIOB 1WCYA 4R1OA 1AB5A 1EK1A 4M99A 1P4RA 1HYEA 3PA8A 2JK0A 2B69A 2W98A 4NX2A 3S2EA 4P4SA 4PRKA 4IQ0A 3SMQA 1SZPA 4B75A 5U1PA 3EODA 2W93A 2G0NA 2Z1NA 3C7KA 1V4VA 2CLKB 3V8NA 3B6ZA 1XPOA 2VWHA 4E46A 4U00A 1XRJA 1MB0A 3PQ6A 4CL0A 4TRNA 4EKGA 3QE2A 5CB4B 3WB2A 2JBWA 1CK4A 3N0XA 4BV3A 1TJYA 1JEOA 3WVNA 1VIYA 2JZCA 1CVRA 1UAYA 3OMWA 4PFKA 5KKAA 3R9KA 2BFOA 4MV7A 1RHMA 3T7AA 2QPAA 4BGIA 1FNMA 1JMYA 3ZY2A 2VP5A 5ELMA 4PY2A 2Q5HA 4O8CA 1PDWA 1OXMA 1D07A 3IO5A 2QMYA 1IJBA 2P8SA 1B41A 3VZSA 3I5MA 3OKPA 4JT2A 3IXMA 2V7WA 1BJKA 3GYBA 4FNAA 4RV4A 4ZA2A 1HSOA 1YVUA 2A1IA 2FQYA 2V7BA 3LLUA 3TQRA 1DARA 4GSYA 2P4SA 2AI1A 4IS3A 4D42A 2XCRB 1EUYA 3IT3A 3WIBA 3LT4A 1IUOA 2F9LA 4DIBA 3VGPA 2OO5A 1VL1A 1LXCA 1MC5A 2R5WA 2RHJA 3RBXA 4DMLA 1X3LA 4PVCA 3GT4A 5KC8A 1CXZA 4XJSA 4I1OA 4YQYA 3P9PA 1MAWA 2CSUA 2VPYA 1P1FA 2FN4A 1PT9A 3HB9A 3EVTA 3KL4A 1HDRA 2AVNA 1FCJA 1UJNA 2WSYB 5CJJA 3SQLA 5KWIA 1I10A 1SB9A 1J1IA 1CVIA 3D3JA 3JALA 2ZRBA 3KJZA 3LC0A 4IGIA 4YP0A 4UMFA 4ES6A 3K8YA 1I6KA 3T9BA 1SAYA 3H5TA 1ZPDA 4W4TA 3NHZA 2IIBA 5AJUA 4A2PA 2JIOA 2GNAA 3M70A 2F3SA 4YA6A 5CW1A 4CMIA 4PSCA 4R2IA 3UPTA 3SQDA 2Q0HA 3WL5A 2R6GA 5AJYA 2VH5R 3CZCA 2WIBA 4LJ7A 4L9SA 4BNKA 2YC2C 3W2HA 3OE4A 4AXBA 1F2TA 4CKEA 1U3VA 2I4NA 3MJ4A 5HUJA 3RS3A 1SXQA 3VZPA 1WV0A 4Y6LA 3AF1A 1U5BA 2NXWA 2YIDA 4O25A 4WXEA 3TCXB 3AM4A 5DX1A 4C7OB 1G41A 1C1DA 3PFNA 3EFOB 2NQTA 4NU8X 4RF3A 4XQ9A 1PKXA 1SBZA 1UM9A 1TJ3A 2PR7A 1LB1B 2Z3VA 4L4XA 4AJKA 4XUDA 3RG8A 3TLYA 1A9RA 4X1YB 4X61A 2BMEA 4JBIA 4HHEA 5CG2A 10MHA 4KDCA 3GRZA 4IWNA 3CLHA 1R37A 4NMWA 4YREA 4DCJA 5JVDF 4Y2VA 2OBMA 3FDIA 3PGLA 5KNDA 2AR7A 4P33A 4OTZA 2WG1A 4TWJA 4AUNA 4DIUA 4WFJA 5M5BA 1O9GA 3RW9A 1T9DA 3BFXA 3V8RA 1Y1TA 4MVJP 3EG9B 5CT9A 1QGUA 1TYEB 1D2AA 2PV0A 3CLUD 3VKUA 4AJ4A 1G20A 5EP1A 4B2LA 4UHCA 4DCTA 5CFMA 4YMIA 4UM9D 3BCUA 2EZ4A 5EJ7A 3QHAA 5JAIA 4CGZA 4DNOA 1V45E 1IJFA 3H5LA 3D5EA 1ADBA 2Z8XA 4DN6A 1DRKA 3B36A 1NV9A 1DJMA 2YXPX 2H59A 2JFFA 3MWLA 1RXIA 3MWDA 3ANSA 4GPBA 3R2JA 3AY3A 3GLFA 1HNWB 2CFSA 4HNAA 2GWRA 3D7SA 3G79A 1CRPA 5H02A 2VPTA 3EBLA 2YBEA 2R11A 1Z5GA 3IA7A 4G86A 5REQB 5HTOA 1P6QA 2GVNA 2PO7A 3ZY5A 3I6IA 1A9OA 2O5RA 4OHPA 1LVHA 3E7FA 1VSBA 4LK3A 2M6RA 4OHRA 5DE3A 3O1IC 1JQAA 5ELLA 3TX6A 5JXWA 1YCDA 3DBRB 3CSUA 3EBPA 2J1LA 4UHEA 3RWBA 4EG4A 1Q20A 3V9PA 1GPDG 2WAOA 2IYQA 3EAFA 4ZPXA 3KS9A 5IJZA 2WQZA 1ELOA 5PGMA 2EP8A 3L6UA 3VU9B 1GPNA 3M1YA 3GCWA 2C96A 4TMZA 2O8BB 5KCZA 2JFGA 4Y1RA 5MN5A 2GUGA 1SXGA 2AKAB 1P7CA 3C74A 4UTVA 3AETA 1M2NA 3BTOA 1O0SA 2DX7A 3KVVA 1X1AA 3DQQA 3COVA 1W0KA 1PJBA 3UAVA 1IHPA 1SZDA 2PANA 4L8GA 4AICA 3G1TA 4LRTB 1VBMA 4BZZA 4RD3A 4PTYA 3AR3A 3HCPA 4K26A 4TVKA 1N5IA 3UAYA 4L5IA 1WXGA 1KVTA 3OLVA 4PZLA 1KSJA 4OQXA 1J2RA 4UTZA 2I62A 5BR1A 3OQOA 1NW6A 1ULTA 1ULAA 1MV5A 2A94A 2GN9A 2Q6KA 4OFBA 4RA9B 5CHEA 1YD7A 5LP6F 3IRVA 2QUBA 3DBIA 3HABA 4FM9A 1MB2A 4L2IA 1CY1A 2R00C 5AUOB 1HLPA 1MBZA 3JQEA 4DYDA 2PKRA 2ZTLA 5AVTA 1E7QA 2ZAGA 3IESA 3IDSA 4W7HA 3BTSA 2WHEA 5JDIA 2IV7A 1R0YA 1D4AA 1WHTB 5J5CA 1U1FA 3AJDA 3AI7A 3MOSA 3FPEA 3I6ZA 4EHLA 4Z6KA 1YK0A 2Y2VA 3FVQA 4N9WA 1M6EX 4OJMX 2V8BA 4CM7A 4QAJA 2J41A 4ZHSA 2QT9A 3S55A 3TRDA 3OEEA 4MUIA 3U7JA 1Y1RA 3UBMA 4GE3A 3B7PA 1KAGA 3TLMA 1Z4IA 1IUNA 3BM5A 3MOGA 3GX1A 4X3OA 3TI7A 3UT6A 3ZXUB 5AVQA 4URHA 3IQFA 4U9UA 2D1YA 1Z7GA 1RJ9A 3HJNA 2QZSA 5I4CA 2HFKA 3K0AB 4MROA 3QMWA 1NXQA 2D3WA 3PQ8A 4COKA 1CY4A 2CLDX 2NXEA 5LUAA 1IG0A 1NBOA 2PDAA 1Z6YA 2O9JA 2WTEA 4D5EA 5JFTA 3EIQA 2FMXA 3KLNA 1T0HB 1TLFA 5JAQA 1RE1A 4CT5A 1R4NA 4OATA 2IIPA 5ED4A 4AURA 2P2LA 4B6PA 2WVGA 1Z5VA 2AGVA 3NRJA 4RORA 5HA5A 2WIJA 4KCGA 5D8DA 1ECCA 2Z6VA 1KEEA 1OWOA 1LD3A 2DR3A 1XTZA 3I6YA 5CVDA 1AQIA 3VFDA 1K5HA 2M1XA 3RCBA 5E6RB 2I8AA 3WK9A 4QOHA 4XH9B 4MWEA 3QLEA 4ND4A 1PQ4A 3JAMA 4C4YA 2VKTA 1NIJA 3TTSA 3AR4A 1NY5A 2OFWA 1A9XB 2X0NA 4PNPA 2E6UX 5H70A 3QEAZ 2JFXA 1AJEA 4F9FA 3EWNA 4NE9A 4ML3A 1WD5A 1XWIA 2CJFA 4YJ3F 1R4MB 1QAMA 3C6BA 4P93A 3COJA 5FEMA 1HZJA 1YIOA 3U61B 2OM6A 4FGJA 2H31A 2G1KA 3CZ9A 4JC8A 4RTKA 1XGKA 4ALJA 2QYSA 1JG3A 1N1MA 1TQ4A 2FQWA 3PNOA 3PR2B 5L7YA 2NU8B 3KFVA 1MRSA 1RWOA 2BV3A 2FEXA 3A4YA 3FHOA 4H1VA 4QRDA 5TNXA 1BMQA 1OHHD 1QH8A 1ZAKA 4OAPA 2VZ0A 4HOYA 3SZMA 3I28A 1TK3A 1XTRA 4OA5A 4LWZA 5CA1B 3IUMA 3GPCA 4URFA 1AGYA 4POAA 3T1HB 4O1MA 4GR5A 2JGNA 5AXDA 2Z5GA 3ANNA 4UPVA 1MR3F 4FYVA 4G4JA 1VHLA 1Y9JA 3E4DA 2EIXA 1CR4A 5CDFA 1X2EA 3DOEA 4H15A 3GIDA 4CODB 2GYWA 5K0SA 1Z12A 1CULC 3F6SA 4DMKA 1U3UA 1SQGA 3QLVA 1OZGA 1OBCA 1SUFA 2G7ZA 3LLVA 3R5HA 4J3FA 3HJFA 1JDBC 4D56A 2D54A 2B4TO 3BXOA 3TMAA 4G1CA 4H7HA 1D1QA 5DTIA 3G5UA 2GQ0A 2E82A 3V4ZA 3DL4A 4B87A 3IKTA 5HXAA 4RHTA 5C5EA 2IHTA 2R87A 3QX9A 1G60A 1M34E 1YGYA 3D2CA 3IOCA 5BV2P 1JEYA 1XFDA 2F3TA 4NHEA 4LK2A 4RA6A 3S27A 2VI5A 2IZOA 2PK3A 3A11A 4H7EA 3W0LB 1B23P 2PJZA 1ZJJA 3NEYA 1FYEA 3EK2A 3MJVA 3GZNB 4JGIA 3RNOA 4AB1A 2WOJA 2J3HA 3KDSE 3DAPA 1AC5A 1SXJC 4ZVKA 4B46A 4RMNA 4YJGA 3V1UA 2DAPA 4CQMA 4JXXA 5EIBC 2GN0A 1VE3A 4K7JA 4P4UA 1NAHA 1ST3A 3GLHB 4KQKA 2FKAA 1SZJG 2NVBA 2PGAA 1NURA 4UXJA 1Q0PA 3ZBPA 2QVXX 1JIVA 4IRUB 1K5DA 3JQGB 4KQ2A 3RM3A 3D81A 2R0QC 4OM8A 2FMHA 2GNPA 1XTUA 3KQSA 2W2OA 1F3LA 1NU6A 3K6SB 1CS0A 1QONA 2A9VA 2QNBA 4DIOA 1P4HA 1XZKA 2Q9BA 1KNQA 4YRAA 1GL7A 2Q4TA 3NNNA 5L4LA 1ACLA 3FPFA 4R8LA 4DNQA 3SLKA 4KXNA 2O0LA 5HOQA 1QYRA 4LYDA 4X1IB 1EA5A 4CLOB 5G0UA 2BHLA 3Q9UA 2ATEA 1IY1A 5IP5A 1JDPA 1NV8A 2WFZA 3KZVA 3R5TA 1SQFA 1EVIA 5KX5B 3UNXA 1TIPA 2EZ8A 1ZNXA 5FL7A 2PGIA 1M2FA 1I1HA 4CTNA 1JFVA 5IN5A 4NZOA 1NTRA 3RBZA 4BLQA 4E5PA 1H6AA 1HOXA 2RAUA 3C3BA 4YXFA 3SYNA 2IXTA 3NAZA 1L7VC 1QE5A 2CMHA 4EYOA 3WLLA 4CF5A 1QQ7A 5H81A 4I99A 4F5DA 1K88A 2WJAA 3QKRB 1TX4B 4DAOA 2OG1A 1KZGB 4DA0A 1F9AA 3I04M 2FRDC 3D6UA 1PFQA 1FJHA 1RADA 2Q4RA 4GWLA 4NEGA 4BVBA 4QOFA 1KQNA 1ISHA 4KDEA 2GKGA 2FEMA 3ODGA 3PC2A 5F7ZA 1J5EB 3RTEA 1XX6A 2QMZA 3UAXA 4BGDA 1TYBE 3OJEA 1ZIDA 1EPUA 4ERNA 4ZQEA 2VT3A 2C5GA 4ER3A 3K32A 4BQNA 3O9ZA 4MYHA 4RK4A 2RGNA 4Y18A 3KYDB 1YZVA 2YN0A 1J90A 2CL0X 4FKBA 4LW8A 5CVCA 4GR4A 1UBHS 2ERYA 4C4ZA 2AG1A 3H83A 5CXQA 3ITKA 5JS8A 2X5KO 2VHJA 2Y66A 3ES9A 2ZCJA 4KPEC 1A5ZA 3CF2A 4BYGA 3EVAA 1NUPA 3E9RA 4UTXA 3OLXA 5ALEA 1GTRA 2IYVA 4MW6A 4EL0A 1X1EA 1YOVA 5F9MA 2BTEA 1DJPA 3IMKA 1EVZA 1Q91A 1O4VA 2C99A 4OMCA 4R1TA 2H18A 5IVDA 3WQBA 1GL6A 3H7IA 4F45A 1Y8ZA 1IG3A 1PJCA 2VDWA 1B3BA 1VE6A 1SVMA 3UAOA 3ZNNA 3SC2A 4OHXA 2AL7A 3EXHC 5TVKA 4C0WA 4PQRA 3BX1A 2JGDB 3HMKA 1P4AA 2OQ2A 4MW1A 1TUBA 3R7BA 3UB2A 1U7PA 5HIKA 4DJEC 3E7DA 5HDBB 2I71A 4CR6A 5JQGF 1JMVA 3OOSA 3UW3A 3W5BA 3T7SA 2UKDA 1KIMA 1ZM2A 3UK7A 3RIGA 3S2GA 2PYIA 2XAAA 4FC7A 3QNUA 2X1HA 4TL6A 1ZI6A 3C24A 1QIMA 3ZDEA 4C14A 4BP9A 5GVSA 3TBHA 1I9CA 3PC3A 3RANA 5EJ4A 1QF7A 3D7KA 4ZCLA 1DQYA 1PEAA 4J16A 4C9BA 4DRXB 2AVDA 3PUVA 4O2AB 4F85A 4P81A 5A03A 1AA6A 4EDFA 2F8TA 3GJXC 4RH3A 1UOOA 2W2LA 2HF9A 3LO8A 4X7MA 3VHRA 3FF1A 3K96A 4E21A 2R2AA 3PCTA 2W5UA 4RK5A 2CVHA 4X44A 3BIOA 1V71A 4GUDA 1OQAA 2I55A 3STWA 1VPEA 3FMVA 4LJRA 2EGGA 1D8AA 1RYMA 1ZI8A 1NVEA 2FP4A 2RCNA 2VA9A 3W4JA 4E4RA 5IT5A 4CV2A 2QV7A 3JR3A 4H6XA 3PGJA 2D8AA 4AJ1A 5T7BA 1BA2A 1E1RA 5JPCA 3TG8A 1E9FA 2NSDA 2ORVA 1Q14A 2GJ8A 3FPLA 2FMIA 1M73E 2WJJA 2XWPA 3K94A 1E5DA 3CGGA 4FILA 2CBZA 2H1WA 4HDKA 1KJIA 2B9VA 3AOGA 3K35A 3OMXA 4FW8A 4JBXA 5F73A 2C29D 4JLMA 4Q9DA 3RV4A 1BEUB 1NP3A 4LXUA 4MLPA 2VNKA 1B76A 3KO8A 1T8YA 2VCEA 2FWPA 4D9FA 3P5SA 5IG2A 1I7NA 1X7HA 1P0CA 5F4BA 5T3YA 1QIEA 2B1QA 1TVEA 4GKVA 4LISA 1JUDA 1ZM7A 2HO4A 4ILKA 2ZSHA 4CM8B 3AB7A 1LSOA 4DV4B 2QLJA 2XA9A 1PJLA 1SCNE 2FWMX 3F5SA 3L4BC 3ZDBA 4DXAA 2JJ8A 2QQ5A 3ED5A 3SIPA 1OPXA 1XRNA 2QYOA 2OM2A 4PZUA 3VA7A 2NZYA 2I54A 3ZKWB 1CS4C 1UDXA 3ND8A 3MLAA 3T5TA 2OENG 2HSWA 4ZI7F 4B4KA 1T2VA 5AVUA 4C2UA 3PXEA 1TZ2A 2XODA 1L7OA 4R83A 1AQUA 4Y2HA 1Z82A 3WAGA 5JY1A 3ZWDA 1EJ2A 3M83A 1GQ2A 2Q5LA 4Z1MA 4TTPA 4ZZ0A 4ON9A 1P18A 3HY6A 2ADMA 1U2EA 1IOZA 1V1MA 3R20A 3O31A 4IV8A 1QYIA 4P36A 1OT3A 2ZUBA 3QSGA 2CMKA 4C3ZA 4OQMA 2AN5A 5ESRA 2RE8A 5IKPA 4QUHA 3VU1A 2H85A 4PXAA 2I6GA 4WLOA 3VAZA 4IFTA 3HADA 2BM8A 2OEPA 4GMFA 4NJMB 4NYIR 4MAMA 3JWJA 1PWEA 5CA0F 1S8FA 1B6TA 2HRCA 4ZAWA 1W8IA 2LVBA 1U7OA 3K30A 3P7MA 5JVDB 3GFBA 2VRCA 1QE0A 1RNLA 1UBSB 1VRWA 1GNQA 3HDYA 4ZCSA 1PQPA 1CUSA 2OZLA 4F38A 3M6WA 2BI8A 2QR3A 3ZNOA 4AP9A 1GPH1 2OKGA 2W6IA 2IUFA 1ZJYA 4QVGA 4PGFA 4B7UA 4XJXA 4CIAA 1K5GA 5EJEA 7REQB 2FK7A 4LPSA 4Z86A 2C00A 2C97A 4AP6A 3WGIA 2VNIA 2C4MA 3EXEA 1W30A 2D0IA 3ZNQA 4ZCIA 2A9QA 1L8AA 1QPZA 2QXTA 3CRZA 5C46F 4DR4B 5A62A 4WLNA 1UC9A 4IEEA 4MUAA