2HVHA

Ddctp:o6meg pair in the polymerase active site (0 position)
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 191
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hvhA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hvhA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hvhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hvhA01
1ZQQA 4LD0A 3V7KA 4ECQA 4CEOA 4UB5A 2ZJ5A 4DSEA 2F8TA 4F4ZA 3LPTA 4DQRA 4ED7A 5DB9A 4P4OA 1S1UA 3K5OA 4E1MA 3KHHA 5KGWA 4OVLA 4W5RA 7ICSA 4BDYA 3CM5A 4DG1A 2RDJA 2NRXA 4M42A 1UAXA 4I2CA 3CFPA 4I2AA 4GLXA 8ICCA 1L3VA 1RT3A 2W9CA 2BKEA 1JX4A 4DS5A 4DL3A 2I9GA 2Z1GA 1NK5A 1U04A 1B22A 4B08A 2KQ2A 1IO2A 1K1SA 5HRRA 4M6WB 4DL7A 2F1IA 3M8RA 3KIOA 4YFKA 1JLGA 3VQBA 4AHUA 3EPGA 3MGIA 4YR3A 1WAFA 4I2JA 1JLAA 3AVHA 3DM2A 4DOAA 4DL5A 4IRDA 4Z4HA 3L2QA 4Z6DA 4CEEA 2NRVA 1RBVA 1SV5A 5T7BA 1QTMA 4F92B 5IINA 1G15A 5CWRA 3NAEA 3ZSOA 2V4RA 2E4LA 3HP9A 3MAQA 4FM0A 3VQ6A 1WNSA 3O3FA 4M3RA 1NJWA 5KT3A 3PMNA 2HHVA 2OPPA 4OLAA 1Z00A 3FDSA 1KRPA 5CR0A 1SL2A 3K5MA 4B9LA 3RJFA 4DS4A 3LAMA 3TFRA 3LZIA 2E6LA 4O3RA 1WSGA 4HUEA 5FRNA 9ICJA 3NGDA 1XS9D 3PX4A 5J0XA 3RJEA 4EZ6A 8ICGA 9ICPA 4QCLA 1EXQA 3AVMA 1C1BA 5FROA 9ICTA 3SNNA 9ICOA 4CHYA 3PMLA 2BCRA 4YN4A 4TURA 1T8EA 3NBPA 4JS5A 2MAXA 4E7JA 4DSIA 1RZTA 1WLJA 9ICUA 5J2QA 2DFFA 3ZT3A 4CGGA 3OSPA 4FJGA 5KTQA 4M9HA 4ZHRA 1RT6A 4FM2A 4CE9A 2FC0A 3EW9A 2QXFA 4CCHA 2YNIA 4F50A 4TQRA 3UPQA 1BCMA 1VSIA 3C5FA 3F73A 4K8ZA 1NJYA 1TKTA 3EPIA 5DB8A 5J2BA 3NF6A 1YTUA 2OPSA 3V1QA 4BWMA 4CIEA 1ZQVA 5KFOA 5I3UA 3F9KA 3V6KA 2BCVA 3H8WA 4F4WA 3NGYA 4ZH4A 4CJ4A 4B3OA 3EWAA 1D9FA 4E89A 3C1ZA 4FLWA 4DL6A 2AGQA 4PPXA 2BR0A 1I39A 3RMDA 3KLIA 5DLFA 4KAZA 4CK1A 3OYBA 3HJFA 3H8SA 3MR2A 4CJFA 2W9AA 3KHLA 1ZQMA 1WSHA 2RDIA 3WNGA 2WONA 2IMWP 2XY7A 3B6OA 3MR3A 3T3FA 3V9UA 3KLGA 2ITGA 2C2DA 5EWEA 4I2DA 5CYQA 3KK1A 1LWCA 2VA3A 4CK2A 2RKIA 4YD1A 4H4MA 3V9XA 1KFSA 3LDSA 3QZ7A 4HCCA 3OS1A 3RAXA 2I5JA 4FYDA 3S3OA 3K5LA 1ASWA 4FS1A 3HW8A 4AHRA 4CHPA 2PI5A 3NCIA 3ZCMA 3OS2A 3P83D 1X2IA 1RDBA 3UQ2A 3P1GA 3QEXA 5KG0A 3ZD8A 2ZJ8A 5J2DA 1S1TA 1K1QA 2C28A 4FXDA 1JXLA 3T5JA 4DTSA 3QNNA 1ZQUA 2ZQBA 5HHHA 2IS3A 4UBBA 4DTOA 4LH5A 1JLFA 4KLJA 4F5RA 4FK0A 5D3GA 1TAQA 2W9BA 4F91B 5KFWA 2ZJAA 3L2RA 8ICQA 4GW6A 3V9ZA 1VSKA 4OKEA 3V6HA 3S9HA 3QEAZ 3B6PA 3LP0A 4FLVA 2GV9A 3S3MA 5DKWA 3LAKA 5DQGA 3NF7A 4KREA 3C2MA 3AA2A 1TV9A 2XRIA 2GBZA 2A1SA 1S6QA 1U4BA 5J2HA 2IAJA 2VA8A 2DFHA 2FBVA 5J2MA 3OYGA 2KN7A 3MEDA 2D0AA 5IILA 4EYIB 1RBRA 3DLKA 1SKWA 4J9RA 2HMIA 3RJIA 4B9MA 3WNEA 2C2RA 3ZSWA 7ICIA 3JYTA 1FK9A 1HMVA 3G6XA 2DPIA 1TAUA 1LB2B 7ICTA 4IFVA 3UXPA 4M47A 1COOA 3LWMA 4FLUA 4KLHA 2PYJA 2YNFA 2NRWA 1RT2A 3H4BA 4ICLA 5KFMA 3OGUA 4M0AA 3ZDDA 3IS9A 4GC6A 3MR5A 4IQVA 3CYMA 4Z4EA 2IGIA 3HVRA 4CJPA 2KFZA 2HW3A 1XHZA 3B0YA 4B8CA 4B9NA 2BCQA 5BOLA 1RCHA 3VA0A 4NLGA 2GWSA 3L3VA 4GMJB 3JPSA 3U6FA 1C1CA 4DSKA 4RQ8A 1IXRA 1RNHA 1TKDA 5DBCA 1D5AA 5CYMA 4ZTFA 2JGUA 4ECSA 4RPXA 7ICHA 5KG3A 4EYHB 4M6WA 3M9MB 4RQ7A 1S0NA 3Q8LA 5F9NA 4FW2A 4DFPA 4DSJA 4FS2A 4KRFA 2HNYA 1L3UA 4RQ4A 1D8LA 3G10A 2OPRA 5F9LA 4FCYA 3UIQA 3JPNA 3OYIA 5EWFA 3KD1E 3TAQA 8ICJA 1H38A 5KFUA 5DG8A 4KITB 4XQ8A 3ETLA 4R63A 4LZGA 1RTHA 3BQ1A 1ZQKA 3UXNA 3H8JA 4NCBA 1BGXT 3DI6A 8ICPA 3DLHA 4B9SA 8ICNA 2IDOA 2P5OA 3Q8KA 4IQUA 4OPKA 5KGXA 5HBMA 4CGDA 3SCXA 3AVBA 8ICUA 5HHIA 1TK8A 4YNQA 4UBCA 2JEFA 2IA6A 4FJ8A 7ICPA 3AVKA 5DDMA 5J0YA 3V1OA 9ICAA 2VG5A 4ELTA 3V9WA 1UA0A 4DTNA 2OZMA 4NXZA 1ZQEA 3K2PA 3NDKA 1NOMA 4RG8A 3O3GA 1U47A 2Q0ZX 4F2SA 4CIGA 1ZBHA 3D0PA 9ICCA 4DTUA 1CLQA 3JSMA 4ED8A 1BQMA 4DWIA 4NCAA 4BWJA 2ZE2A 5KFBA 2MUTB 2KTQA 1BHLA 3VQDA 3AV9A 5J2CA 5KRTA 3GQCA 2AGPA 4Q43A 3ZDEA 4F93B 3RAQA 5KG6A 3C21A 3IM1A 4CGHA 3GFKB 5KG7A 3MR6A 4O3OA 1J53A 1S1WA 4M3XA 3QNOA 1XHXA 3HP6A 5J0OA 5KFQA 4DOCA 3HL8A 3RJHA 4FVMA 3RJGA 4JWMA 4JK1A 2P66A 7ICVA 1KLNA 5HNKA 4F5PA 1KLMA 4DQPA 5IIOA 3AO1A 1RILA 4HUGA 1ITGA 4O5KA 4YXJA 4FW1A 3RBEA 5EU7A 3AU2A 3MXIA 5KG4A 4I28A 4O0JA 4CGIA 5CB1A 3PNCA 1XI1A 3DLBA 4RT3A 8ICHA 2G8KA 3QEPA 4QZGA 5KFSA 1HNVA 3O3HA 3MDAA 3ZSYA 3DOLA 4BXOB 3BDPA 4CFDA 1HQEA 4QZ9A 2HVHA 2D0BA 4CJUA 4LVSA 4CFCA 4E1NA 1SL1A 3K58A 4RQ0A 1VSFA 1W0HA 2XCPA 2OYQA 5CY4A 1ZQYA 4GXIA 2HNZA 3IG1A 1EX4A 3VQEA 1F21A 1LW2A 2OA8A 3EZ5A 4PGQA 4F4YA 4JUZA 3MEEA 5KFYA 2Z1IA 3KTQA 4ZTJA 4FJLA 1LWEA 2ISPA 4O4GA 1ZBIA 1NKCA 3WNHA 3TABA 1TV6A 5J29A 3PR4A 1IG9A 2A1JB 4HUFA 5HMMA 4R5PA 2JLEA 1S5JA 3KHRA 2BCUA 5IIIA 3TARA 2X74A 1WN7A 5JS2A 3NF9A 1XO1A 3ASMA 3VQ4A 1RT5A 4Z0UA 4PQUA 3QEWA 2VWJA 4F4XA 3OJUA 2HB5A 3SUPA 1Q9XA 2HHUA 3JPQA 3CFRA 2V4QA 4CJRA 1T4GA 8ICOA 3ZSRA 1MQ3A 3C2KA 4CEFA 4GXJA 1JL1A 4XIUA 4YMMA 4QZFA 3E01A 4MF8A 3MGHA 3OYLA 5KI6A 4DU4A 5J2PA 3C5GA 4CF1A 4N41A 1SZPA 2FLLA 3NGIA 1YT3A 1A77A 2IOCA 4FJJA 4J2EA 3MXJA 2IHMA 2ISOA 5DBBA 2RN2A 4M3WA 3L2UA 4YP3A 2ASJA 5J2EA 3K5NA 4TQSA 3HSTB 5J2NA 3V72A 4KHWA 4P4PA 4EZ9A 5KG2A 3PW5A 2HHSA 1BCOA 4NLNA 3CQ8A 5KT6A 1BPZA 3PY8A 1EP4A 2VG6A 1EKEA 2P6UA 5J0SA 4UB4A 4FJ7A 4FJXA 1RYRA 1VRTA 4RW8A 4FBUA 1JN3A 4LZDA 3C94A 4RPYA 4QWDA 2R8HA 2R8GA 2A1RA 3OYMA 3RMCA 7ICLA 3ZSQA 1VSJA 3RMAA 2KZZA 5SZTA 2RF2A 5L1JA 4PUOA 4YR0A 1ZJNA 3EY1A 3S3NA 2ZTDA 4CJQA 4YG2A 3SJJA 4M3TA 2BPCA 9ICSA 1ZQTA 4G3IA 1ZQNA 3FFIA 4OKKA 2XY5A 7ICMA 5KFXA 4W5QA 1YVUA 4ECRA 1ZQAA 4KHYA 4AHTA 4KHQA 2X6SA 4RQ3A 1NK7A 4JLHA 4PY5A 5JS1A 4Z4GA 4P4MA 1NK9A 5DQIA 4FLYA 1TK0A 4OLBA 3MEGA 4J9LA 2X78A 1ASUA 1B9FA 1WCNA 1RXVA 5KFVA 2B21A 3GIKA 1X9SA 4C8KA 2YHBA 4R64A 4CEQA 1CZBA 3RB0A 3ZT2A 4ID1A 4EEYA 2W8KA 1SKRA 7ICOA 3FYHA 3HPGA 1ZETA 9ICKA 3AU6A 3HX0A 4FJ5A 1Y97A 7ICNA 8ICEA 5DB7A 3AVFA 5K14A 4LH4A 1HUOA 2F96A 2AQ0A 4IQWA 3ISBA 1ZQHA 2G8HA 4FZYA 8ICBA 3QINA 5C24A 4IFYA 1XWLA 4AILC 4IR1A 7ICKA 4O0IA 4M3UA 2Y1JA 1XSPA 3QERA 4DTPA 4YVZA 3SQ2A 1UA1A 5HLFA 3TQ1A 1N56A 1BPEA 2PXIA 3SV4A 3TAFA 1KCFA 5HRSA 1SL0A 2MUTA 4CERA 4Q5VA 1R0AA 4I29A 8ICTA 8ICIA 4DU3A 2PI4A 4RW7A 4M3ZA 4EP4A 1UWBA 4MEXA 3ULDA 2KZ3A 2EHGA 5CHGA 5DGBA 1RXWA 1X9WA 3RH5A 1VRUA 4C8NA 4AHCA 2DFEA 3A2FA 4KLSA 3Q8QB 5DG9A 3N97B 3GILA 3OYCA 1L3TA 4Z6CA 4I27A 3K59A 1VSLA 4TUSA 2FPMA 1BI4A 4DTJA 4M2YA 4KN4A 1ZQRA 4W5NA 5KFHA 4IKFA 1BPYA 1U9LA 3SUOA 4NY8A 4KTQA 3NE6A 4UB2A 4JV1A 3AVAA 3GIJA 1N48A 4OJRA 4DTRA 4O5EA 4CF2A 1VSDA 1RDCA 4ECYA 1ZQIA 4KHSA 4DSFA 2JZBA 4N76A 3KLEA 4BXOA 2BPGA 4B8AB 4I2EA 3Q8MA 9ICQA 3VQ9A 3KK3A 2R8IA 1HUZA 4FJIA 4KV8A 3AO2A 3M8QA 4BDPA 4YQWA 3ALYA 1JMSA 1RT4A 3K75D 3QO9A 3GDXA 2BQUA 4DQQA 5J0PA 3SYZA 2PFNA 1UOCA 1GOBA 3NTUA 3RB4A 1NKBA 3TR8A 1LAWA 3BGRA 2R8KA 2BHNA 4QAGA 2VA2A 1KFDA 1VSHA 5CZ2A 4CF8A 5J0TA 2V9WA 3DMJA 4AHVA 9ICLA 4OPJA 4PHEA 1TK5A 2KZMA 3IHQB 1IM4A 3SV3A 3OYNA 1NOYA 4PHDA 1WAJA 4Z4CA 3B0XA 1A5VA 3NH0A 2H5XA 4MEYA 3HYFA 5L1LA 4I9QA 3ZDBA 5HRNA 3RMBA 4Q45A 2JEJA 4ECZA 4Q8EA 2W8LA 2BGWA 1RTJA 1JLCA 4QW8A 1QHTA 1S1VA 1VK0A 9ICBA 1U49A 4F8RA 5D46A 8ICVA 3ISNC 3OHAA 5DLGA 1MC8A 4FZZA 4CGJA 8ICRA 1GOAA 5KFAA 3GV7B 4IG3A 3V4IA 4HTUA 1S1XA 4N56A 4O44A 4PHAA 3HPHA 4FJHA 4OKJA 4KMUA 4KB1A 4MFAA 3SPYA 3RBDA 5J2AA 4DF8A 3V81A 4XUSA 4DTMA 3M8SA 5KRSA 3V6JA 4RW9A 4KLEA 4CGFA 3I0SA 1KEJA 3NHGA 2XO7A 1ZQXA 3AO5A 8ICKA 1Y88A 1ZBFA 3KLFA 3NH2A 4PH5A 4DL4A 4FLXA 2ZTEA 9ICNA 1JIHA 4DF4A 1ZQCA 4UAZA 4GXKA 4R65A 4J2BA 5HP4A 1IKXA 2B4JA 5KFTA 2ZUBA 1RBUA 2P6RA 2P5GA 2ZUCA 3V7LA 3PW2A 5J1EA 4HVJA 4O3PA 1O1WA 1WSFA 2BDPA 4RUAA 2P51A 1ZQFA 4E7HA 3C1YA 1J54A 9ICXA 9ICIA 2AQ4A 2B5JA 4ED6A 2RPIA 4FK4A 4HHTA 4R8UB 4Y1CA 4CHNA 4RZRA 3OSNA 3TAEA 4YXMA 3ZD9A 5J0UA 4QOZB 4M9LA 3DLEA 5HMLA 1FKOA 3DLGA 3OYAA 1QLNA 1C0TA 1CUKA 3TAGA 3UXOA 4IRKA 2X6NA 4L8RB 3PO4A 2NUBA 1HYSA 1S9GA 2J6UA 1BVSA 1C0MA 5KFGA 3RTVA 4BE2A 1DTTA 1U45A 3G6YA 4BE0A 3L3UA 4F3TA 4RQ5A 1B43A 3AO3A 3LANA 5EWGA 4F2RA 1BPDA 3C6UA 4W5TA 4CK3A 4J9OA 1XSNA 4KLIA 4IG0A 4N5SA 1QSYA 2BPFA 4QZEA 3BJYA 4YD2A 4F5QA 2KFNA 4PGYA 1RBSA 4CF9A 4QZAA 4BE1A 1NK0A 5FDLA 1HJRA 3H7IA 7ICRA 4UB1A 1IKVA 3NFAA 4J9QA 3ZSZA 5J0QA 3VQQA 1KVAA 1JLBA 4M41A 1J9AA 2ETJA 5KFEA 5DQHA 2AGOA 5HROA 5KFFA 4Q8FA 3HWTA 1JXBA 3PW7A 1J5OA 4E19A 2PY5A 4QZ8A 2YV0X 2G8IA 4C8LA 4QZDA 1WSEA 2D0CA 1MU2A 4QWEA 4ID5A 2UVWA 4J9MA 2FLNA 1ZQPA 3E2EA 1QSLA 3QE9Y 3MABA 2D5RA 1S97A 3RH6A 4KPYA 3K57A 2UVVA 3SI8A 3IAYA 4FK2A 4RUCA 4M04A 2JEIA 4B9VA 4N47A 4I7FA 2OZSA 1T05A 4F4KA 2E6MA 5KG1A 4O9MA 5E41A 1Z25A 1HNIA 2ZUDA 3Q8PB 1L5UA 3JPRA 4NLKA 3NGZA 3PW0A 1KFTA 3AVIA 4EBDA 8ICMA 3AA4A 4ECTA 2AJQA 4DQIA 1HRHA 2QK9A 4UB3A 2F1HA 4FZXC 9ICGA 5KG5A 3SQ4A 3VQ7A 3NF8A 4KI6A 2FLPA 3VQ8A 4LSNA 2FMSA 3PR5B 4QZBA 1ZYQA 3DLRA 1BQNA 1TKZA 3C2LA 4CJSA 2DY4A 4DOBA 3DRPA 5DG7A 4I2IA 2WTFA 5HRPA 3AO4A 5KFLA 1NJZA 4O3SA 4IDKA 5J2IA 1ASVA 3QIOA 2WOMA 1N6QA 4FJKA 5DK5A 5BOMA 3SPZA 2PZSA 1TFRA 3P5JA 3LP1A 8ICXA 1CXUA 1CZ9A 5KT4A 2HHWA 1ZQWA 3LP2A 4J2AA 3RRGA 1S0MA 4C8OA 3OYKA 1TGOA 3ISCA 4I2FA 2HHTA 5CJ7A 3I8DA 4CECA 2UVUA 4RQ2A 2QKBA 4DSLA 3DRSA 1ZQDA 2BCSA 1HYZA 9ICVA 3SI6A 1RTIA 4DLGA 3L2VA 4Z6EA 4ED0A 3HO1A 4CESA 2BQ3A 3AA5X 2O4IA 2FMQA 2O4GA 3QZ8A 7ICGA 1EETA 3LK9A 3SQ1A 1KVCA 4MFCA 4TSXA 3PX0A 4NM2A 3MFIA 1Z26A 1T3NA 1LW0A 4O5BA 9ICFA 1TVAA 3QLHA 4FBTA 3AA3A 5J2JA 4X5VA 1DTQA 3K4GA 3TAPA 3RR7A 3L2WA 4R66A 5J2FA 2G8FA 1W9HA 4J9SA 4KO0A 2M9NA 3AVCA 4M9JA 4RU9A 1BPBA 3SUNA 3ZT0A 1XSLA 5J0RA 3KHGA 1C0UA 1XU4A 4B9TA 4E3SA 8ICWA 4O3QA 1X9MA 1WCLA 2B6AA 1S6PA 2R7YA 3O4QA 4J2DA 4Q0BA 1X1PA 3CG7A 2FPKA 3MFHA 2XGQA 4F3OA 3ITHA 1TL1A 2G8WA 3M8PA 3RWUA 2HHXA 4G1QA 3PV8A 3RB6A 3JPPA 3TANA 4NCGA 5FRMA 4E0DA 1A5WA 5DB6A 4DFKA 2ALZA 1REVA 5IIMA 4ELVA 2IHNA 1RDAA 1CXQA 2AU0A 3OHBA 4BACA 2F1JA 4LSLA 4KHUA 4M45A 2C22A 4I9LA 3V9SA 4CJ5A 4PHPA 2XGPA 2VANA 3HXMA 3VQ5A 1I3AA 5J2GA 4JS4A 3C23A 3MDCA 4M3YA 1FKPA 2W42A 1B9DA 4QW9A 2BQRA 1NK8A 3V1RA 4NM1A 3T5KA 2FMPA 5CP2A 5EOZA 4M9GA 2JEGA 2EX3A 4MQ3A 3PUFA 4CF0A 3VN5A 4KTWA 3I0RA 4ECUA 4R8UA 1N5YA 1NK4A 3AVJA 2ASLA 3U3GA 1L3SA 1S76D 5KT7A 3QIPA 3CM6A 2I1QA 8ICYA 4I2GA 1S0VA 1BL3A 5KFCA 2IBKA 4H8KA 3BQ0A 4O55A 2PFQA 7ICEA 4YMOA 1VSMA 3AVNA 1D9DA 4FO6A 4J9NA 4KLDA 1JL2A 2YNGA 5CZ1A 8ICLA 2DTUA 1UT8A 2LSNA 1ZQSA 3KKSA 4Y1DA 1CEZA 1NK6A 8ICZA 3IRXA 3LZJA 2BANA 4HYKA 5J0WA 4MF2A 3OJSA 3H40A 4IR9A 4J9KA 9ICHA 4YR2A 4YFUA 4KHNA 3T5HA 5TZVA 4JRPA 3RR8A 4RQ6A 2KW4A 3OYEA 3OYDA 3AVLA 1BIUA 5C42A 3OVNA 4UAYA 3TAMA 3N4MB 4DFMA 9ICWA 1C1AA 1HQUA 5JUMA 4DO9A 2FBTA 4CHQA 4M9NA 1IH7A 4EP5A 3EYZA 2PFOA 3OYFA 4KTZA 4QWAA 4Q44A 5I42A 3M9NB 4F5OA 4DL2A 1ZQZA 8ICFA 1QSSA 1S77D 5KFPA 8ICAA 9ICMA 1DGSA 2C2EA 3SQ0A 3THVA 3G0ZA 4CJVA 3D45A 3QEVA 4DTXA 3CFOA 3HVTA 4NLZA 2XCAA 4JWNA 1T7PA 1C6VA 1V9PA 1EXNA 1D8YA 2ZTCA 1JKHA 3LALA 3TWHA 1BISA 3C95A 1ZQBA 1LAVA 4QZCA 5L1KA 3RB3A 3ORYA 2QKKA 3RRHA 3QEIA 4YCXA 3G6VA 2IC3A 4DU1A 4FJNA 4Z6FA 4CIFA 3DYAA 2BE2A 2J6TA 3ZDCA 7ICQA 4WE1A 1YTAA 3BQ2A 2HHQA 3SZ2A 5KFRA 2W9CB 4RPZA 4JRQA 3U3YA 1K6YA 4CFAA 2HVIA 1S9EA 2YKMA 2VG7A 4CEBA 3RJJA 3WNFA 4YMNA 3KLHA 1PZNA 8ICSA 5DBAA 3VQCA 4XRHA 3OS0A 2A1JA 3LPUA 1TKXA 4B9UA 1A76A 4E7IA 3TI0A 3T5LA 4CHOA 1KVBA 1WSJA 3BQTA 3HPOA 1SUQA 4KLUA 1ZBUA 3LDAA 7ICUA 1Q8IA 3O4NA 4CJTA 1IKWA 2NRTA 4O5CA 5D4BA 2HNDA 3QESA 1C7YA 5SWMA 1A5XA 2G8UA 2W9MA 4I2PA 1ZQOA 4JV0A 1KTQA 7ICJA 4AHSA 7ICFA 3QEBZ 4H4OA 4FJMA 2P1JA 4ECXA 1Z3EB 4KI4A 3Q8RB 1ZQGA 4GC7A 4MFBA 1Z00B 5L1IA 1IKYA 1DLOA 2Z1JA 4AH9A 3NH1A 4OGCA 3T19A 1RTDA 2PFPA 5KFNA 1JXEA 4QWBA 4FLTA 1KSPA 1JLQA 5KFKA 2NRZA 1T03A 2Z1HA 4BDZA 1HJPA 3L8BA 4KLGA 3LP3A 2XC9A 4QZHA 1AROP 2FPLA 3HM9A 4FM1A 2Q3SA 3HK2A 2OPQA 4RNMA 2YHAA 4RW6A 5KT2A 3OYJA 4KLQA 2GUIA 3MBYA 4KFBA 3RH4A 4UAWA 1S0OA 3V6DA 3LWLA 4KLOA 4CJLA 4ED3A 4DFJA 4MFFA 1BIZA 1HPZA 2ZD1A 4RT2A 3ZSVA 3M9OB 5CA7A 3Q8SB 3SUQA 1QS4A 3ZT4A 1U48A 4CFBA 4HCBA 4BGDA 9ICRA 1B92A 3VQAA 1ZBLA 2LYHA 1NKEA 3C6TA 4PWDA 1RT7A 1XC9A 3DOKA 4J9PA 4O3NA 1GOCA 4KLFA 3T1AA 3PX6A 1WSIA 4CJWA 4K4GA 4CJ3A 5D49A 4JV2A 2YNHA 5C25A 3GIIA 3UQ0A 3RJKA 4CHZA 2DFLA 4KB0A 4GVMA 3OY9A 5KT5A 4KKOA 4TUQA 3VQPA 4I2QA 3KD5E 1JLEA 2BGGA 9ICEA 4TUPA 3DRRA 3ZT1A 4QWCA 4C8MA 1LWFA 4DQSA 4K4IA 1DOQA 2FBYA 4F5NA 3PO5A 4PGXA 1NJXA 2J6SA 4ED1A 4FJ9A 2ASDA 4CEAA 5HP1A 1S9FA 3H08A 3V7JA 4KLLA 4ECVA 3MXMA 1Q9YA 2F8SA 2XY8A 4IRCA 5DGAA 5KFZA 3KK2A 4I2BA 5IIJA 3AUOA 3KKRA 4ECWA 4KLMA 4Z4IA 4LY7A 1BPXA 4I2HA 4QZIA 1LV5A 4NYNA 5DDYA 4P2HA 3PW4A 2OWOA 3VA3A 2ATLA 4EBCA 2FBXA 2XY6A 3ZSXA 4E7KA 1RBTA 3JPOA 2R8JA 1SKSA 5L9XA 3AVGA 3ISDA 3KJVA 4KN7A 5BPCA 5DMRA 4UQGA 1QQCA 2DPJA 4NYFA 4W5OA 1BI4B 4RNNA 4ED2A 1TL3A 4DLEA 1ZQLA 1NOZA 4DMNA 4ELUA 1RPLA 3TFSA 4DEZA 4PA1A 3JPTA 1KDHA 1QE1A 2VWKA 2XHBA 1RYSA 4RNOA 2W9BB 2UVRA 1RT1A 3PVXA 4FLZA 3ZDAA 1FXXA 1S10A 3GIMA 4K4HA 1TVRA 2JZBB 4K8XA 4CEZA 4XA5A 4RW4A 4IBNA 3GV5B 5KFIA 2G8VA 3OYHA 3MECA 5KFDA 4IQTA 3QETA 2Y1IA 4E7LA 4EBEA 3HT3A 4CEDA 4KLTA 1MSWD 1RDDA 5C5JA 1ZQJA 3GV8B 4Z4FA 3H4DA 1HYVA 4RQ1A 5J2KA 1VSEA 5IIKA 5KFJA 2YKNA 1MQ2A 2PYLA 1ZJMA 4OGEA 1UT5A 4CJKA 2ATQA 4CJEA
chains in the Genus database with same CATH superfamily
3F5TA 4LD0A 3AMZA 2FJAB 4ZP8A 3JTOA 1RT2B 4DSEA 4F4ZA 3WIVA 3A8YA 4OZLA 4DQRA 2ZZNA 5DB9A 1KQSR 1S1UA 4E1MA 2H48B 1RTJB 4JYAJ 4W5RA 1S1VB 2RRBA 2C3UA 3C14B 1UAXA 2WF9A 3HVWA 3P4UB 3IO1A 4GLXA 8ICCA 3GL1A 1JX4A 3G8TA 3D2NA 3GBTA 1U04A 4NL9C 3OW2M 4MJKA 2G0CA 2XMUA 3MMCB 1UPHA 4CLSA 1Q86O 3M8RA 4YB5A 2NREA 2ZHAA 2F9TA 3KIOA 2DVIA 4Y3CA 3MGIA 4JN4A 1RA7A 1F3VA 1WC5A 3AJDA 1I1GA 3PIPL 3NCQA 1GLFO 4CEEA 1WSRA 3RG6A 1KQQA 1SV5A 3L5KA 4IH6A 1QTMA 4CRXA 4F92B 4Y0FA 5CWRA 4GV9A 3CCMS 3GLJA 4B3RJ 5K5MA 2V4RA 2A10A 2D1CA 4NYZA 3VQ6A 1T0TV 3O3FA 5J1NA 1IJEB 2DKXA 4MTPA 4B9LA 4OI6A 3Q22A 3ICXA 4DS4A 3NNHA 1TTHB 3CJQA 3IRWP 4B3RK 2ZOMA 1U8SA 2ASPA 1BUPA 1FVQA 2HDOA 4BREA 4ATNA 1N33F 3N0VA 1XS9D 4OMFG 3L4PA 5J0XA 4QCLA 4CWBA 5GAHU 1EXQA 2K4PA 2BRKA 3AVMA 4LFAJ 5FROA 4DU7A 9ICTA 4PXCA 1Q86T 3SNNA 1VQ8N 2LXFA 4YN4A 2JL9A 4JS5A 2HRTA 1BQMB 5A0YA 3W2VA 2XMWA 1WLJA 2DFFA 4FWLA 3BKFA 1DAXA 1YSJA 1YRXA 4LFAK 2G1DA 1RT6A 2G4BA 4CE9A 2FC0A 1UMJA 4CCHA 2L08A 4DCJB 2E9ZA 1TL4A 2H4WB 3L95X 2R2RA 3C5FA 4K5SA 5IXUA 4KIAA 4K8ZA 3PRVA 3PXGa 3CCRS 3V1QA 2MEWA 2NPFA 2NYHA 3F9KA 1G6BA 4FNIA 4ZH4A 4P71A 1IQZA 2HF3A 2JWKA 1NAQA 4K5RA 3SBGA 2DTJA 3OVSA 2R9LA 2VICA 1JJ2M 1LXNA 3H2UB 3HJFA 4AYBF 1YVNA 4PJ0U 4PL2A 4QIFA 3S8SA 2RDIA 5B8HA 2EZXA 1RAOA 3SCJE 3UKUB 3UN3A 4A8FA 2XS7A 4BRMA 2ITGA 5CYQA 7AT1B 1CJKB 4LFCJ 2VOPA 4L73A 1FRKA 4QS8A 2WHOA 1KFSA 3IBPA 2HNZB 3LDSA 2V68A 2NLXA 1U0SA 3S3OA 3D9BA 3IDWA 3HW8A 2CPXA 3F44A 5B0DA 3K7RA 3MEEB 4FWSA 2DL0A 2G06A 3NGUA 3DGPA 2QIFA 3UQ2A 1H2VZ 2HQGA 5ALSA 1S5ZA 2ZJ8A 2NXCA 3MAAB 1K1QA 3LPYA 5ADXA 1ZQUA 4R5PB 4FPBA 3H98A 2RHKA 3QWPA 3DRPB 2U2FA 3CD0A 4UB8U 1RT5B 3CNHA 3QRPA 4WYLA 4B3MF 4GVBA 1RACB 1M5SA 3C19A 2JFKA 2W9BA 5AQVA 1N36K 2LQ9A 5CD4H 3L2RA 3H1QA 4GW6A 3S9HA 1VQ9N 4KHMA 2VIXA 4PRFA 3HKZF 1S7HA 3D2FB 3LP0A 1NHUA 2PIIA 5AKJA 4WJBA 2GV9A 4NLCA 2DNHA 5DKWA 2WVEA 3C2MA 3HT0A 5EE0A 2F8MA 1ZH5A 1X4EA 1S6QA 3J7AP 5J2HA 2DFHA 2Q3PA 2D0AA 1SIWB 1RXOB 1U2CA 2R7TA 4EYIB 4JKAA 1B7YB 1PVRA 2BACA 1WG4A 3LW5C 4U9RA 1FK9A 3SSSA 1SC6A 2DPIA 4FYVB 2OTLS 2AEJA 2H3VA 4KLHA 4FZVA 2H3IA 1NPRA 1RT2A 4LF9K 1EP4B 1VQSA 4M0AA 4LIWA 3CUNA 2QO3A 2IGIA 4LREA 4KX5A 2HW3A 3C14A 4OI1A 4B8CA 5BYQA 2M52A 4JI6J 3CXCM 4HI2A 2GWSA 4UF4A 4GMJB 1C0UB 1VBXA 4DSKA 2MU2A 1I6JA 1DRZA 3PHEA 2J9EA 4JK7A 3BR8A 7ICHA 5KG3A 2JVRA 3MMCA 4EYHB 3M8PB 4GRSA 4RQ7A 2LYBA 1S0NA 5F9NA 3Q89A 4IKAA 1CBKA 4DSJA 3FEZA 4ZPVR 4JI6K 2OSQA 1TUWA 4RQ4A 1HA1A 3CCUN 3G10A 1RADB 2OPRA 4B9QA 2F9WA 3D1OA 1FF2A 4WP3A 3P49B 2AIRB 2LYVA 2J5AA 5E26A 4OYMA 3ZNJ1 8ICJA 1H38A 1KQSM 4KITB 4XQ8A 3ETLA 4R63A 1BGXT 2KICA 3ISND 1ECWA 8ICNA 2NXNA 1YG0A 2IDOA 3OR1B 3Q8KA 1NGEA 3FSYA 1T9VA 3AVBA 1FXRA 2P9KB 4CYUB 1N5YB 1TK8A 4YNQA 4WPAA 4UBCA 3QU5A 4FJ8A 5DDMA 1XMBA 2FJEB 4BR2A 2R7XA 2Z2ZA 1E6VB 1HNWK 5C24B 2RDDA 1UA0A 2CYYA 4NXZA 2Q0UA 1ZAVA 3NDKA 1NOMA 4RG8A 2VD3A 3VEOA 2C2ZB 3DGVA 3IBCB 2WSCC 2XIDA 2LBOA 4K59A 2KSOB 4ED8A 1BQMA 2GAGC 5E3RA 1NNDA 2QB0B 2HK2A 2D3UA 1TYQB 4NCAA 2DGVA 1YJNS 3CCWA 2MUTB 2WW4A 1NMNA 2W7OA 2Q97A 2AGPA 3W5ZA 3ZDEA 3IM1A 5KG7A 3MR6A 3MCPA 3GZ7A 4L3NA 1AUDA 2UUTA 4M3XA 1Q8LA 3BS7A 4TLRA 1GLBG 5J0OA 5LJWA 2Y9UA 3RJGA 5LY3A 1BOTO 7ICVA 1NDLA 1KLNA 3WZ0A 2R4FA 4X2BA 2ZZMA 5IIOA 2CJYB 3AO1A 4PZNA 3IV6A 3RBEA 1X66A 4BC9A 5EU7A 2XEXA 3IUCA 1NJIO 1LNQA 4O0JA 2WHEA 1H3DA 5CB1A 2Q1LA 5E5NA 8ICHA 4QZGA 5C2FA 2CQ1A 1JKHB 3EGVA 1HLUA 4CFDA 4LVSA 4M5NA 4CFCA 1SL1A 4RQ0A 4JK9A 4JKHA 1VSFA 3KFUF 5DDOC 2V8PA 5CY4A 1ZD3A 2HNZA 3IG1A 1EX4A 3VQEA 4XH5A 1Y00A 3I8BA 4FKXA 5BYRA 3BGRB 3MEEA 4M5KA 5AQIA 1FX2A 2QW9A 2QT7A 3F5EA 2OTJN 2YWHA 2EK6A 1OPZA 3PR4A 3R3TA 1PC5A 1IG9A 3VESA 4R5PA 2JLEA 4NA3A 1V4TA 1RDUA 2R7WA 4FOIA 4K4WA 4OZ3A 3VQ4A 1RT5A 1WI6A 2QLXA 2J0SD 4PQUA 3CHWA 2JXJA 4DR4F 4F4XA 2HB5A 3DU6A 3SUPA 2ZFHA 3RRKA 3SMSA 1NJIT 4YDXA 1KDNA 4JI0F 1Z1ZA 1ZM2A 3D2FA 3RGIA 3C2KA 1WELA 5THWA 3N6LA 3GSDA 4YMMA 5AXNA 2KK0A 4W98A 1BMQB 1XQIA 3MGHA 3KJNB 8ATCB 1VQPN 3D54A 3B8AX 3EUNA 1P8ZA 3NGIA 4FJJA 2IOCA 4J2EA 2IHMA 3CC4S 2ABYA 2QRRA 3THYB 4IJAA 1CJTB 4WK3A 1OMSA 1SC1B 1WF2A 4CH7A 3L2UA 1WDDA 1DQAA 3K5NA 4P4PA 4JB8B 3FCHA 2MZ1A 3PW5A 1YBUA 2LQ5A 2G2OA 4B17A 1BCOA 3CQ8A 3TVKA 5ALKA 2Y8YA 1NZBA 1BPZA 1EP4A 2VG6A 5I3QA 1VJWA 1Q78A 3HLUA 1PIEA 5J1EB 3TTCA 1SC3B 5C2GA 1E4FT 1FTCA 1RYRA 4P2SA 2NUHA 2MSSA 5KPZA 1YI2S 1IBLF 4BRIA 4FBUA 4LF4K 4LZDA 4P74A 1OKJA 4RPYA 2Y1LB 5ETQA 3U1LA 5K8OA 3ILIA 1RT7B 5SZTA 2ASOA 5L1JA 2PN6A 4C97A 4PUOA 2EFVA 3RVCA 2GH1A 3LDNA 2MZJA 3TSQA 2G07A 4M3TA 9ICSA 1UP1A 5IM0B 3N6NA 1Q3UA 3FFIA 5E3CA 1MWQA 1MWYA 4CO4A 1GXTA 2WF5A 4PWWA 4KHYA 2M8HA 1FRLA 1R31A 3NP5A 4KHQA 4RQ3A 1VQLS 5JS1A 3T79A 3D6HB 1NK9A 1HX1A 5DQIA 1NPPA 3OTQA 3GYNA 5CA5A 4I67A 3NXZA 2D69A 2VQEK 1RHRB 3GIKA 1Y0HA 4AF1A 1RHKB 2YHBA 4Z94A 1ZA1B 3ENVA 4U8YA 1DRGA 2DISA 2FSJA 3OR1A 1GXUA 2E1YA 4ILMA 1VBKA 3QYPA 1M5KC 3O3LA 1UKUA 1QAYA 1NH7A 1AW0A 4CYUA 4H5WA 5A0LA 5L38A 3BSCA 2IPOB 2PKEA 5DB7A 3QGHA 3TX0A 1N2XA 1SKUB 2OHDA 2AQ0A 3GR1A 1E6VA 5C24A 3QINA 4NOHA 4O4RA 1Y3JA 4ZN3A 1QQNA 4FE3A 7ICKA 2K1RB 4M3UA 3C46A 1JMTA 3HSZA 3T1HF 4ED5A 1XSPA 3PNIA 2KJ5A 5HLFA 3TQ1A 2CJKA 5AQOA 2A41A 3UE5A 2PXIA 2QA4S 2GMLA 2QB0A 4TYBA 1TYQA 3QNWB 2MUTA 4USAA 3C6HA 4I7FB 1T05B 3WU2U 2M2BA 1R3NA 4I29A 4BR9A 2PI4A 3AA9A 1ZXIA 3WC0A 2VDHA 3D6RA 3MPWA 2QMUB 3MECB 1RXWA 4C8NA 2XMKA 4DR4J 3JS6A 4ZCIA 4KLSA 4OX8A 3M6UA 5DG9A 2HSZA 3NG8A 1L3TA 3K59A 4I27A 1VSLA 4JI0J 4M2YA 2UYTA 5ALNA 2VGNA 4YORA 2J4RA 2HSTA 4WQ5C 4KHPJ 4YOYA 4DR4K 4N76A 2HCFA 4C3LA 1IBMF 4BY9C 5HQLA 2EBEA 3KLEA 3W2WB 3I4HX 2BPGA 4I2EA 9ICQA 3VQ9A 1KP6A 4DZ6A 2MZSA 3CMQA 1Z05A 3NAIA 5C2CA 5JTIA 4BDPA 2DNNA 4KHPK 1FVSA 1YJ7A 4HACB 7FDRA 2XULA 1J6ZA 3DRSB 3BGRA 1AT1B 2BHNA 4IH7A 1Q53A 5J0TA 3B8HA 3QT5A 3UPFA 2W2NP 1JNZB 2EC0A 3IHQB 3P45B 3MTKA 1IBLJ 3OYNA 4UT4A 3BO4A 5GADP 2C2NA 1HIYA 3NH0A 1NEEA 2HWIA 2ZH5A 1BLUA 5BPMA 2DGXA 5BJRA 5H1SQ 3POTB 3W9IA 2IRUA 4KBOA 1U6BA 4Q45A 4ECZA 2RU3A 5B08A 4Q8EA 3CI5A 2W8LA 4QW8A 4BRFA 4WWSA 1SV0A 1BE4A 1ZZFA 1URJA 4CGJA 8ICRA 1N0UA 4X66F 3VPZA 2F5GA 5KFAA 4PABA 3GV7B 4N56A 2MZQA 4O44A 5CABA 3J7A1 4W4MA 4DCPB 4MFAA 8RUCA 3CO0P 3O4WA 1TL1B 5LSLA 3GPAA 4UUXA 5BN9A 2B0CA 4KQZA 3T1YF 5EX3A 2ZXHA 1UQVA 1SS6A 3V6JA 4CGFA 1KEJA 2IM2A 2GC8A 3THYA 1CJTA 3UMBA 5E3QA 3VGMA 4HTJA 3AO5A 3ZZTA 2IRXA 3GU0A 4B1YB 4LSLB 4HLBA 4YB6A 3W0LA 2PGCA 2ZTEA 5IT0A 5AQWA 1QUVA 1AXQA 1TELA 5H9EJ 5M1QA 3MOZA 1IKXA 1GEHA 2ZUBA 3PW2A 5J1EA 4ZPBA 2HAIA 4GO5X 3C1YA 1FKAF 4WXWA 9ICXA 9ICIA 2AQ4A 4P52A 1FX4A 1W97L 4A48A 1X6IA 5J2QB 2BV3A 3TTDA 4HHTA 3T1HJ 4Y1CA 4CHNA 2KKPA 4BQZA 2KNJA 5H9EK 2HF4A 4RZRA 3OSNA 3M2UA 2CPHA 3TAEA 2EFNA 3IGNA 3ZD9A 1N61A 5IM0A 4P10A 2PT0A 1QLNA 1AQ6A 1G4CA 3GFHA 4GKKF 2JH7A 2DXFA 3PG9A 2AHOB 3T1HK 3N4WA 5ALVA 3MK6A 2NUBA 1EWRA 3P3DA 1BVSA 1IBKF 2AYEA 4ZLNA 1KWMA 5KFGA 4BGAA 5ALOA 1NH8A 1DTTA 2DH8A 2MMYA 2PEHA 4LR7A 4F2RA 5L39A 5EDWA 2EBGA 2QWPA 2HG4A 3SLCA 3ZZZA 4QZEA 3UD5A 3CJ1A 4YD2A 4WU2A 2KFNA 4PGYA 4BE1A 2VFSA 1BWFO 1HJRA 4CDGA 1HQUB 2W2OP 3W5YA 3ZO7A 5BPNA 1RBOB 4BRGA 3ZSZA 3VQQA 2DGTA 1S72N 2YJEA 4NRTA 3AGRA 4Q8FA 2PMZD 3HWTA 2YWKA 3PIOL 1KVJA 3U7JA 4E19A 3ZYYX 3HVAA 1RB0A 2K1RA 2RRDA 5H2FU 2QZ8A 2EK1A 3I33A 5IZHA 2GNKA 1RKIA 4AE5A 2UVWA 3HVTB 2LA6A 4NJ8A 1VQKN 2VQFF 2ZH7A 3RH6A 4DV2J 4FF4A 4FK2A 2JEIA 4OJLA 3EGWB 3S7RA 4C0BA 4I7FA 4CTAB 4FWNA 1T05A 2OZSA 2BE2B 5HL7Q 1OIAA 5KG1A 4K4YA 1Z25A 1HNIA 1Y11A 3D68A 4OJHA 2X7IA 1WKLA 1HRHA 4DV2K 2F1HA 4FZXC 2LXIA 3GU3A 3R9PA 2Q79A 1DK2A 4PL8A 1PJ6A 3NF8A 4P2FA 2FLPA 3VQ8A 2FMSA 4X66J 2FF3B 3M8WA 1SV4A 2RUSA 5ETRA 3FZKA 3C2LA 4CJSA 4JV5K 5E3PA 1SUQB 2PMWA 2Q36A 2A0FB 2Z58B 2VU5A 1RAEB 1NJZA 3PLAA 4M94A 5DRKA 1ASVA 5AQHA 1IKWB 2EDUA 5DK5A 2MKIA 4RTFD 2GJ2A 2D3O1 4PWUA 4A4JA 1X31C 1HHQA 1RCOB 2PA8D 3DOMB 3W2WA 4X66K 3NUQA 2EC2A 4WZMA 4C6AA 1JCFA 8ICXA 2ITMA 2HURA 5KT4A 4YOVA 1ZQWA 4J2AA 1KN6A 4ES3A 3OYKA 3ISCA 4HACA 2PC6A 3TVYA 3K2YA 1UEVA 5C15A 4RQ2A 4GNIA 4DSLA 3CJSA 3DRSA 2BCSA 4AL5A 9ICVA 1Z1VA 3SSQA 5B0EA 2E1PA 4K2JA 1RTIA 3BGOP 3BPDA 3AJ2A 3OFHA 4KGVB 2FJBB 1RBLA 4CESA 2E1ZA 2FMQA 3H5UA 1WC6A 1WG1A 2FY8A 2ACYA 3ILOA 2XO6A 3L0QA 5ALPA 3RF9A 1KVCA 4MFCA 4TSXA 2LHTA 4J37A 3PX0A 3MFIA 1Z26A 4A59A 1T3NA 9ICFA 4Y2PA 3POTA 2KHVA 3MUMP 3H0LB 3TAPA 2XMTA 3DRYA 4KFBB 2E8NA 3L2WA 4R66A 2G8FA 2FPHX 4M9JA 4RU9A 1LVHA 2ZD1B 3I56S 4GKKJ 5LL6d 2WF7A 2KRBA 2GO9A 5J0RA 3SQOP 4CZIA 2B6AA 2Z0GA 3N9UC 1TMMA 4PWDB 4A2BA 3O9UA 2B4VA 1Z4NA 1IBKJ 2ZBRA 3B4MA 3MFHA 5AE2A 5AE3A 3ITHA 4Y6IA 2F2AB 1TL1A 1U2FA 2P9SA 2YB4A 1RDRA 3R6LB 4WFYA 3MEKA 3RWUA 2AZ1A 3JB9k 3SBTA 1TUUA 4EI2A 2V2VA 3ICLA 4J8FA 4E0DA 4PG8A 1ESVA 4NV0A 4WFNQ 3NMAA 4ELVA 2F4VJ 1RAIB 4OLPA 2VC1A 3QMLA 4BACA 2FLOA 1U09A 1BY9A 5DDPC 2EANA 3BP8A 4LSLA 2C22A 1IBKK 2GGPB 4V1Ak 4J7CA 3OBYA 1JLEB 2YWGA 3DRRB 2CJ9A 3C23A 2W42A 3QJLA 5GMDA 2ROPA 1RLCL 3KNAA 1WUDA 1SIJA 4CLKA 2BH1A 2COLA 1X40A 2F4VK 2NZCA 2PD1A 1RTZA 3QSYB 3O1BA 3KOOA 5CP2A 2RE2A 5EOZA 2V63A 1NNLA 2P6TA 4MQ3A 2W3SA 4FF1A 1SJ4P 1TL5A 3AVJA 2JH1A 2ASLA 2W25A 1ZOTA 3C16B 2F3JA 2VQFJ 1X5SA 2E1EA 3CC7N 4I2GA 4NWBA 5H9FJ 1S0VA 1BL3A 4FSVA 5KFCA 4H8KA 3JXOA 4O55A 3DN9A 4YMOA 1VSMA 2N3OA 2J8SA 4J9NA 5CZ1A 8ICLA 1UT8A 3WXJA 4N7TA 5LOQA 4WYBA 3PRBA 2OEMA 3KJVB 4UOHA 1H2UX 1NK6A 5IV3A 5KAIU 1WEZA 3OJSA 2WBRA 1IR1A 3ATUA 1D0EA 4DX5A 3CB4A 9ICHA 5HN0A 2VCPA 4URQU 5GMKa 4YFUA 2YHWA 1WG5A 3T5HA 2P5VA 3MMVA 4JRPA 2W54A 2GWKA 1TVRB 2HGNA 1BIUA 4RW4B 3KWGA 2BKNA 2J0WA 3N4MB 4A8KA 4UW2A 1HQEB 4DFMA 4BR5A 1YJWS 1HQUA 4DO9A 3EYZA 1Q7LB 1ICEB 1P6TA 2HBMA 4Y2KA 5DJBA 1L7NA 5LJ5Y 1QSSA 1F3FA 1S77D 4A8QA 1R43A 1PGZA 2QXLA 5E2QA 5AXKA 1FDAA 5ALWA 2D4WA 2FJVA 5F8NA 4EIAA 5FIIA 2P9LB 3HVTA 5B0CA 1GQEA 1VCTA 2CQCA 4CBXA 3H46O 3M32B 3WXMB 4LF7J 2D9OA 1DEJA 2VKQA 3G6VA 2HHPA 4DU1A 4FJNA 4CIFA 4CTAA 4QYZJ 2BE2A 7ICQA 1XNQF 3BQ2A 4N8NA 1VLBA 2IVOA 1RT3B 2W9CB 2IVYA 2R3VA 2W41A 4JRQA 2HVIA 2CPRA 3RJJA 3WNFA 4LF7K 3PKYA 4S0MA 4YMNA 1X9JA 1IV0A 4PXBA 8ICSA 1S7IA 4XRHA 1SH2A 2IIHA 4QYZK 2CQHA 4WFNL 5AI0A 2Z8QA 3N4PA 5F0XA 3BQTA 3VQTA 1SUQA 5AIAA 4RBUA 2LKZA 4KLUA 3HDSA 2GVDB 1RAHB 2KHQA 5HO4A 4CVNE 4JI3F 1AFIA 2A1AA 4CJTA 1IKWA 1F2GA 3TA1A 2NRTA 3WXKA 5GIPA 5BR9A 1FO1A 4O5CA 1KL9A 1SH3A 4C48A 3CPWM 1EZZB 1A5XA 3DCAA 3DXKA 7ICFA 3QEBZ 3MM8B 4JMUA 2XNRA 3SENA 2E8PA 3O5BA 2CQIA 4RW8B 4MFBA 4BR4A 1N5XA 1RWUA 4Y2XA 5AQSA 1FEZA 1H98A 5AQUA 4C8ZA 2ILYA 2Z1JA 3CE8A 5GAEU 4AH9A 3C65A 2QWQA 1RUSA 4FLTA 5GADI 2NRZA 2Z1HA 4BDZA 1KC8T 2BJEA 2V94A 4QZHA 4P2MA 3O6QA 3HRDD 3BF4A 3LH2S 2DY9A 2YHAA 2ZVSA 1WWUA 3A1YG 3I87A 4KFBA 2GUIA 3W5XA 1X5TA 2NPIA 3NBPB 4OX7A 3MUVP 4CJLA 5D15A 2ZD1A 4RT2A 3Q8SB 4JKBA 4ZKAA 9ICRA 4UAVA 2LYHA 1NKEA 1NDPA 4PWDA 2D0OA 3VEXA 4ZVOB 2E3TA 2RHFA 4O3NA 4DV3F 2E2PA 2YNIB 4B1VA 1U25A 2G0JA 3EX7B 1WSIA 3CJKA 1ZOLA 4CJ3A 3NOGA 4F72A 4A61A 3VERA 4H54A 3T69A 1TKTB 1WC1A 3H0MB 4QIWC 4ERDA 2NXUA 1QTNB 2A19A 3FMBA 2B9XA 2A2CA 5I3UB 2GGPA 2V51B 3VQPA 2IVNA 1JLEA 3I5AA 4B3OB 1NGBA 3KWIA 4ANCA 4DV5K 3DRRA 2PDAA 4C8MA 4OYBA 2O6KA 4DQSA 1Q16B 1Y3KA 1GLAG 5D4LA 1W7AA 4OCZA 4CT8A 4FJ9A 4P0QB 5IT9Y 1NCLA 9ATCB 3H08A 3N6MA 3LDPA 5I9EB 4ECVA 1RM6C 5BYSA 1CRXA 2VB6A 2F8SA 1U24A 5AK3A 2L9NA 2EI5A 3NRZA 1KQFB 2GELA 4ECWA 4UW9A 4Z4IA 1N54B 4LY7A 3OR2A 1ZBSA 3C16A 1FERA 1DK3A 1J5EF 3FRZA 3THXB 4NYOA 4QZIA 4KGZB 1WOQA 1JROA 2FVRA 5EE9A 4DPTA 2IVFB 2OWOA 1FE0A 3KOAA 3CPEA 1MN7A 3D4JA 1VAZA 3A0HU 3U26A 4A5BA 3I55N 1BXNA 3G25A 1XNQJ 2F7TA 1VQ7S 2VUGA 3KJVA 2DPJA 4NYFA 3RUBL 2HWHA 1X4DA 2HYIB 3V2UC 4UQTA 4ACOA 4DV6F 1NOZA 4ELUA 4DEZA 2LVWA 2AV5A 1YIJN 4UASA 1I3OB 2PSZA 2VWKA 5AQQA 4JKEA 4RNOA 1OJ4A 3FM9A 3ZDAA 1FXXA 1TVRA 2BE9B 4C4TA 2HGLA 2E44A 4K4ZA 4K8XA 4XA5A 4RW4A 5KFIA 4Y2AA 2M7SA 2YPYA 4TKTA 2V6AA 4U67L 1RFQA 2KXFA 1QVFR 4EBEA 4CD3A 4CEDA 1MSWD 4OV1A 1GNKA 2ZIUA 3GSIA 3DLJA 3QT8A 5J2KA 2WAQC 2EKNA 3FC4A 5IIKA 2X1GA 5KFJA 1HW8A 2O8BB 2ZITA 4X4RA 3HHLD 3HX9A 1RYUA 1V38A 5LJ3Y 3CF5Q 2P9LA 3BM7A 4BRHA 3V7KA 2DBYA 1Z1BA 3M32A 4UB5A 4K50A 2WVBA 2F8TA 4ICLB 2B0GA 1IJJA 4ED7A 1PILA 3IS9B 5KGWA 1ULRA 3SMZA 3CM5A 2KU7A 4M42A 5CHCB 4UZCA 5FLXY 4GV6A 2XS5A 1RT3A 2W9CA 1LKYB 4DS5A 3I4PA 1ZD4A 2Z1GA 2HMPA 1B22A 5CYMB 2WZ1A 4JI4F 4FO0A 5E33A 1IO2A 3CEDA 3N79A 3D2WA 3EVWA 1Q82O 4MN4C 2FC9A 3HF5A 1UPPA 2F1IA 2DKOB 3BSOA 1PKUA 4YFKA 4AHUA 3OFGA 2UXDJ 4RW9B 4B6JA 3I0SB 4LIRA 3HBTA 2CWXA 3ISZA 1BA0A 4DL5A 2K8AA 2GVDA 4DV3J 4A8OA 1YJ9N 1HKAA 4Z4HA 4X4SA 1OY6A 1EKRA 4Z6DA 3W1YC 2QMXA 4Q7AA 1J2MA 1IBCB 5IINA 1K0VA 3NAEA 1NU0A 2UXDK 5EE1A 4OD0A 3DI6B 2GOLA 4F67A 4BRNA 3MM8A 1E6YB 3KZBA 4M3RA 6AT1B 3M1FA 4ZLJA 3PMNA 4DB3A 1SPBP 3EE3A 3FDSA 2B5JB 3R5JB 1KRPA 5CR0A 4TXSA 3MCMA 2VFUA 3A8KA 2DD8S 3LAMA 2D41A 5KL1B 4H5RA 2E6LA 1GTHA 3VGTA 1UZDA 4P0PB 3L3CA 2LDIA 2AXTU 3VF6A 3PX4A 3BGLA 3RJEA 1MDUB 1Q82T 4ITSA 4CZCA 4E2FB 3MX5A 4PXEA 4BVOA 3J80Y 4CHYA 3ILLA 2BCRA 5LMUF 2CGJA 1J5EJ 4DR5K 1WORA 2HK3A 2B4UA 1T8EA 2EQYA 3NBPA 2DYAA 2CH6A 4E7JA 2RRNA 3VGVA 1RZTA 1PCAA 3BDEA 4L75A 3ZT3A 3L4IA 4FJGA 3C6UB 4CP5A 4FM2A 2ZH6A 4X4PA 4OQJA 3PFOA 1J5EK 3EW9A 4DUYF 1O03A 2YNIA 2YQ0A 2CWKA 4DV6J 4TQRA 3UPQA 2CPZA 4IOBA 1BCMA 1S1WB 3F73A 2F3NA 3HHLB 1TKTA 2A2DA 5DB8A 4JI7F 2DNKA 3TUJC 2VODA 1T94A 4BWMA 2E5SA 5A8WA 1L7PA 2VJVA 5KFOA 1CZAN 5I3UA 3E9LA 2BCVA 2RMLA 4KR0B 5A6WA 4NX9A 3HHKA 4B3OA 3TADC 1D9FA 4HAIA 4B3SK 4PPXA 1OO0B 4CK1A 4DV4K 2KXHA 1UJ4A 2XNQA 3P5BP 3MR2A 1HNVB 4P0QA 2L5YA 4DV1J 2W9AA 1M5PC 2YX4A 1WSHA 3MN7A 2XY7A 2PEBA 4LBPA 4F36A 3B6OA 1Q8BA 1UVMA 4OYPA 4RWTA 3EXCX 2YTCA 4TYAA 3PACA 3FZFA 3V9XA 4Z2XA 3QZ7A 2AEMA 3MXHP 3RAXA 2I5JA 3THXA 3K5LA 2XMAA 1ATRA 3VEWA 2P8IA 5BN8A 4DV1K 4OYIA 4G6VB 3P83D 1X2IA 3QU4A 3H0RB 2IOFA 4O4GB 1RDBA 2Y0BB 3P1GA 1PYSB 3QMQA 1TV6B 4XAKA 4I6AA 1CSJA 1UAWA 4FXDA 1JXLA 3QNNA 4M5DB 4TU8A 2CNNB 2IS3A 3CIPA 3SAGA 3OHRA 3MM5A 3FC9A 1NB2A 4JI4J 2QL7B 4NLDA 2BDUA 2M88A 2B4OA 2BKPA 3BPSP 2CPIA 2EG2A 3H8YA 4RLEA 3J7YP 2CG4A 4EU0A 1VQMS 2ZJAA 4M1KA 3ELHA 2XMMA 4OJ5A 1PVPA 1JXVA 3OLAA 3V6HA 3AT1B 4UOGA 1LEOA 4G9BA 2UU9F 2VFRA 3QEAZ 1CG2A 1BC6A 1U7LA 1HKBA 3V4MA 2J7UA 2KDOA 3S3MA 2W24A 5AM2A 3QYYA 2HMXA 3AA2A 3BGUA 5BPLA 5EX0A 3FJ2A 4JI4K 2FF6A 1NRKA 3R1LA 2KN7A 2ZXIA 4DPWA 3A5NC 1RGIA 5IILA 1ATSA 3CCUS 1RBRA 4Y0WA 1P1TA 1SKWA 3LYSA 2HMIA 2W7AA 3CDWA 4B9MA 1U0HB 3WNEA 3QPIA 4LQ3A 5CYJA 3M3ZA 2O8BA 3UMGA 2VV5A 5J2NB 1TAUA 2EZZA 1FT8A 3MGVA 1HUXA 3KDOA 3LGHA 5KAFU 2HQ3A 4U7UK 3I9ZA 4ICLA 4DR7F 4JHDB 2GV1A 3ZDDA 3ZX0A 3IS9A 2WB1D 3MR5A 2AP6A 3CYMA 4LFBK 1VRTB 2W6KA 2EEYA 4B9NA 2BCQA 5BOLA 1VISA 5AZJB 3C8YA 3WQPA 4KAIA 1RCHA 3VA0A 2OXOA 1O0PA 2P9NA 1WTFA 3JPSA 3U6FA 5AKLA 1IXRA 5LMUJ 4Q0BB 1TKDA 5DBCA 1MG7A 5CYMA 1PSDA 2MKSA 4HVZA 2ASYA 2CAJA 5AT1B 5F0WA 3M9MB 4BC4A 3CJ3A 1XK8A 2AA4A 1L3UA 4HKQA 3EKUA 3BO3A 4GVLA 1Z2ZA 3A12A 2JMGA 4O3MA 2YY6A 2DHGA 3MPUB 4ISGA 4DUYJ 1XJWB 4ZLLA 2BEFA 5K4LA 2W4CA 1HD1A 2WMMA 2FSKA 3UIQA 3JPNA 5EWFA 3TUZC 5ALHA 1F0MA 4JI7J 1HW9A 4UOFA 1CLFA 3MN5A 1HBUA 3N5BA 3KK7A 2B6GA 4NCBA 3UXNA 3DI6A 4MK8A 3R5DA 1B99A 8ICPA 3Q7CA 2RP5A 4BVPA 1ACMB 4DUYK 4IQUA 4LR8A 4OPKA 5KGXA 4CGDA 3H59A 1ZZNA 3NCRA 1QVGR 8ICUA 2RD5C 5HHIA 3AHPA 1OYEA 2LLZA 1QM9A 2BZ2A 3GIRA 1MROB 2WTUA 2JV3A 5HR7A 3AVKA 2QSFA 5J0YA 1FXLA 2JVOA 3MWPA 4ELTA 4DTNA 1XQSC 4C4SA 3K2PA 3M6WA 3VAFA 3H20A 3NGKA 4X4VA 5ALQA 1T9TA 3L7UA 4CIGA 1R89A 5HMWA 1GMWD 3D0PA 4DKWA 4DTUA 1HNZK 1N62A 2R42A 2KKZA 4DWIA 5M2PA 3IFEA 1KAYA 5KFBA 1T9UA 2KTQA 2XS2A 1BHLA 2V50A 3VQDA 2M3DA 3AV9A 5J2CA 2ZOFA 3WX4A 4Q43A 2P9UB 3LDQA 1OWXA 1RP5A 4BRDA 2CZ9A 2EPIA 3M5RA 4CGHA 3GFKB 3F0NA 1Y5IB 3UN2A 4O3OA 1S1WA 2LDYA 2NXEA 1VQNS 1J53A 1YRUA 3HHLA 4JD2B 3QSIA 4UB6U 3HP6A 2LP4A 4DOCA 3HL8A 3HOTA 2UUBF 2QG9B 3KG4A 4BHQA 3Q0AA 2E88A 5FPDA 2HIYA 4DQPA 3OQ2A 4G9ZA 4M7YA 1RILA 4HUGA 4O5KA 5MAOA 5LSOA 3BV8A 3AU2A 1M1GA 4ZIVA 5F8IA 2CG8A 2CUYA 2H3QA 4ANDA 3PNCA 2G8KA 2HQIA 1HNVA 2VJ5A 5KFSA 3MDAA 3ZSYA 2BVZA 3DOLA 3K8WA 4NLYA 4X4NA 4QZ9A 3QJPA 1T9XA 4C0HA 1MWKA 4KV8B 4E1NA 2CDRB 1F2HA 2XCPA 2OYQA 3KG1A 1YHQS 3DYAB 1ZQYA 4GXIA 4ZPAA 3RFAA 3L4QA 2E2OA 5FPNA 3G6ES 4DPUA 3FUYA 3C15B 1RK8A 3SQGB 4WBFA 4DR7J 3IBFB 5KFYA 1ED1A 3KTQA 1X3MA 3HHEA 3QBWA 4CI0B 2QX0A 3LM9A 2DCLA 4O4GA 2WBNA 1TV6A 3HKWA 5J29A 4OHYA 2PO4A 4M5DA 5HMMA 1U6FA 2ZUAA 3PYFA 3TARA 2X74A 1W7WA 5AXLA 3O80A 1HJOA 5MLCV 5GIOA 3KDNA 4DR7K 4Z0UA 3EZUA 2BM0A 1JLCB 4PG4A 4OJPA 3EVOA 4NL9A 1T02A 2QA4G 2PFFB 1HQ2A 2YX6A 4C4RA 1CQNA 3N5FA 4A2AA 2HOQA 5DDRC 4XIUA 2FZGB 4AFFA 2QKQA 3WHIA 3BB5A 4OO1J 1VRQC 2N1RA 2W43A 3V81B 3KBBA 2VPXB 2FLLA 2QL9B 1A77A 4LVOP 1R59O 2GAHC 3BN7A 2BZFA 3GE9A 2RN2A 1U0HA 2ASJA 4BRAA 3OA9A 2YMLA 2JNJA 5J2NA 4RQMA 4WFBQ 4EZ9A 3QGIA 1FFVA 2B7BB 1HI0P 1H74A 3LPEA 4NLNA 5KT6A 1B4FA 1PK1B 1R27B 3A0BU 4JHDA 4B1XB 2GCFA 2X3GA 3CJ5A 5J0SA 3UDLA 4DI6A 4DDFA 2DITA 2BRLA 1VRTA 1HI1A 5AZJA 2Y9HA 3WBZA 4QWDA 3M2VB 2R8GA 2ZG6A 3Q24A 7ICLA 3W63A 3B54A 2KZZA 3DOKB 1JQGA 4YR0A 2UV8A 3ENWA 1WWHA 3R2CJ 2ZTDA 4YG2A 2A6OA 2XWXA 3R7NB 4KGXB 2KHDA 5AQXA 4F26A 2QI2A 1ZQTA 1KTVA 1VQ6S 2XBPA 1B4SA 1ZQNA 2HWTA 1UCNA 1I51B 2XY5A 2CPJA 4A8SA 4URSA 1YVUA 3VV2B 1RWMB 2ZH8A 1ZQAA 5AM5A 4CM0A 4AHTA 3CC2N 2W3RA 1VQOS 3MMAA 1NK7A 1UFLA 1BG3A 1TK0A 3W8PA 1MNEA 2CGKA 3MEGA 1XNRJ 3DXMB 1WWVA 3FZLA 3D1HA 3SQIA 1WCNA 5AI9A 2XYHB 5IWAF 5EOYA 3RB0A 3ZT2A 4IG0B 5ALXA 3HCXA 4ID1A 3F56A 5BR8K 3FYHA 3S1TA 5B0FA 1VBZA 5CR4A 3LL3A 1MWZA 4FJ5A 2KMDA 4DU8A 3CMAS 4LF6F 1XNRK 1JLBB 7ICNA 8ICEA 4UUWA 3M6GA 4K0KF 1MROA 1Z4OA 3CD7A 3QJJA 3IXQA 1ZQHA 4AL6A 2G8HA 4FZYA 1J5OB 5J8YA 2XMJA 3QICA 4ALZA 1RQ0A 4AILC 4JI5F 1UJ6A 3TVZA 1E3MA 3R5BA 1MU2B 5A2QY 2BJ3A 4KB7A 4A8MP 5L8RC 4C3KA 4DTPA 4ISFA 3DDIA 3SQ2A 3QBCA 2D74B 3TA0A 2E7XA 3OTEA 1UEUA 5CZXA 3LA0A 2FHOB 1LFPA 2H1YA 2C2KB 2PA3A 2EZYA 2XG8A 2PE8A 5ETNA 5E3AA 3EDRB 2P9UA 8ICTA 4DN0A 4DU3A 2DRBA 1QZ5A 5ALIA 4MEXA 1FIQA 3CDBA 2KZ3A 3G4SS 5DGBA 1VRUA 4JD2A 1L7OA 4TY8A 1OQ6A 5K9FA 3A2FA 2V7YA 2CPYA 3EE9A 2ADBA 3OYCA 1UVKA 2FPMA 4DTJA 4KN4A 4KHRA 3CCRN 4FZMA 2MRLA 1EQYA 1FD8A 4K25A 4J9UE 3NE6A 5L46A 4WFBL 1VQ5S 4OJRA 4CF2A 1HBMB 1ZRMA 4R25A 1N6QB 1ZQIA 4KHSA 3QFUA 2XLJA 2KVQE 1VGYA 2LKYA 2CFXA 2R8IA 3U8XA 1HUZA 4FJIA 4KV8A 3AO2A 4YQWA 1JMSA 4JOUA 1KOOA 1YRTA 2GHWA 3GDXA 2YX7A 4DQQA 5J0PA 3GWCA 2PFNA 3TEHB 2EW9A 1GOBA 3C15A 2FHJA 3SQGA 1LAWA 3SK3A 2XB2D 4V19S 3NS7B 3NVVA 5CZ2A 4CF8A 1S59A 3TZXA 2V9WA 4LRAA 3DMJA 9ICLA 1L3KA 4PHEA 1TK5A 3CCZA 1EETB 4KSEB 4EK2A 1WAJA 4Y2QA 1A5VA 2F44A 5HVGA 2FVSA 1S3XA 3ENAA 4I9QA 4EO8A 2ZZTA 5C10A 1Y10A 3N4QA 3PYDA 5HVHA 4MMOA 3J7YI 1JLCA 3KUHA 1QHTA 1VK0A 4KO0B 2EFOA 1SV5B 8ICVA 3ISNC 3D6JA 5DLGA 1MC8A 1SB3C 3K0JA 4JKGB 3HI0A 3AAQA 1S1XA 4JEPA 3CDUA 5J1PA 1L6NA 2ZC3A 3HPHA 4AM6A 4FJHA 3VWSA 4KMUA 1JRPA 2QARA 3FBEA 4MYTA 3RBDA 5J2AA 1H7WA 3V81A 4XUSA 4G1QB 2ZIXB 3M8SA 3IM8A 3CVKA 4Y2RA 4OYAA 5IWAJ 3WKBA 1GMWA 1REVB 2DNQA 3PSFA 5FD1A 2E8MA 5M1KA 1GK8A 5CE3A 3HJEA 3NH2A 3DV9A 2FDRA 2B7CB 4DL4A 2CPDA 4A8XA 5JU5A 2ZJPL 3M7VA 4J2BA 4LF6J 1EX8A 2EAPA 1PK1A 2J8AA 3KZIU 2ZKUA 1RBUA 1VYAA 2DNZA 2OTLN 2P5GA 4YB7A 1VLYA 3V7LA 2G09A 4O3PA 2HBYB 1WSFA 2QV6A 5IWAK 1N5WA 2BW2A 4I68A 4OFZA 3HSDA 2BXJA 2KFYA 3W2VB 1RDWX 4XPEA 4JI5J 3I31A 1JJHA 4R8UB 4DX6A 3VGSA 1S72S 5TISU 5AJ3J 2ZH1A 2GQQA 2E2QA 3M1VB 4ILHA 4LF6K 1RT6B 2CNLB 2W2QP 4YXMA 3QIDA 3HRGA 4NLSA 5J0UA 3DLEA 2PBDA 5HMLA 1FKOA 3IMXA 3CD6S 2MQMA 3RJMB 3D6TB 2BYCA 4YOWA 1DURA 4JI5K 1VQKS 3D0GE 1VR6A 2MKCA 4LSZB 1NLKL 3MM7B 1QAIA 5AJ3K 2WSFC 1FW6A 3GG4A 2JWLA 4BE2A 1HFEL 2YWWA 4BE0A 3G6YA 3L3UA 2UV8G 5CXTA 1WHXA 3AO3A 3C6AA 3LANA 3BYRA 2HLUA 1WD6A 4MIBA 1RAGB 4N77A 2HVZA 4BQLA 4W5TA 1XSNA 1GX5A 4IG0A 1FNXH 1ELOA 1QSYA 5C42B 4H0TB 4F5QA 3TAMB 3AY9A 4CF9A 4QZAA 2I2YA 3WX8A 4UB1A 5CYQB 3EGZA 1YJTA 4B1ZA 2NSBA 3WUHA 1JLBA 2EKYA 2HEKA 1J9AA 1SH0A 4DJBA 4CLPA 1QQOA 5KFEA 2AGOA 5HROA 3OTBA 2CZVC 4YY3F 4UTGA 3WK6A 2Z2YB 3HTVA 3PSTA 3A8IA 2FZCB 1JXBA 1J5OA 4C8LA 4F3QA 3ZETA 1H72C 1MU2A 1OH6A 3J81j 4ID5A 2V5HG 6FD1A 2LEBA 1XO0A 2O8CB 2W04A 3QE9Y 3ET6B 3MABA 2Q4TA 1S97A 4KPYA 1WDTA 3K57A 4OZ0A 2UVVA 3K9KA 3SI8A 1X4GA 2Q66A 5EN1A 2GX9A 3SJHA 4AQYK 5EX5A 4ZITA 4RUCA 4GVBB 4B9VA 3AD7C 1RWVB 2HHHK 4LRFA 1RISA 3F9MA 3QU9A 5HI7A 3EL2A 2E6MA 4WE1B 5AI6A 1YJNN 1VIXA 2JWNA 5G0RB 3Q8PB 1L5UA 1IXKA 3M6XA 3PW0A 1KFTA 1S9EB 3CXCR 2Q6CA 4X65K 3AA4A 4ZJLA 4K4TA 2AJQA 4F0KA 4ZVHA 4AP9A 3W3DA 3KLHB 4U96A 3SQ4A 5AKGA 3MDFA 4DR6J 1CJUB 1RAJA 3PR5B 4QZBA 2KJVA 3HSCA 1SQEA 1B0PA 2AYMA 1QUPA 2DGQA 3AO4A 3JAMU 1NB7A 2BTFA 5T14A 1N6QA 1S22A 3AN1A 3TPQA 2ZH2A 5BOMA 4EEKA 2PZSA 1NSPA 4DR6K 2WF8A 4USVA 2FVPA 1IQTA 4KH1B 1Q18A 2O01C 3KKAC 3N7SC 1WOSA 4YDUC 4H4OB 1N36F 1S0MA 1NDCA 1WHYA 3RSEB 3H25A 1DT9A 2UVUA 1C20A 4DN9A 1ZQDA 2VPZB 1HYZA 4MHVA 2X51A 3SI6A 4K4UA 4M5MA 4DLGA 5EE3A 3ZZ0A 4Z6EA 5AIBA 4ED0A 3HO1A 2BQ3A 4ZPTR 1BNOA 2O4GA 2YXLA 3CERA 1JLQB 4OJGA 4P75A 4OLOA 1EETA 3SQ1A 3CP8A 3ETOA 4OX9K 3UMCA 4IC9A 3I5CA 4USIA 3MCOA 4FWRA 2ILZA 1KHWA 3NVKA 1HIWA 3AA3A 5J2JA 4X5VA 3SXLA 3K4GA 4FPAA 2OPRB 2DGZA 3NS5A 4BUGA 2UUAF 5J2FA 4KO0A 1RWXB 1RAFB 3UDVA 3SFGA 5GAGP 3O2IA 4C8YA 1K5OA 2LMRA 3SUNA 3A3NB 2O1PA 4WF9Q 4ILRA 2XLKA 4LF9F 4JKGA 2PMHA 8ICWA 2CIMA 4ZDNA 1FFGB 4NZ7A 3C6TB 4J2DA 2R7YA 3O4QA 2H54B 2IYGA 3CG7A 3W66A 4MLHA 4M63A 4BC5A 2HHXA 4QIWF 2JHEA 5LSRA 2WVFA 2XHCA 4G1QA 2ZH9A 4NA2A 2ZIXA 2YNHB 4FWQA 3PV8A 5C7PA 3TANA 5AQJA 1A5WA 1CULB 1REVA 5IIMA 1MN9A 3ZZPA 2AU0A 5DM7Q 3OHBA 3CC4N 4KKOB 4I9LA 2KHCA 1WHVA 3NWRA 4LC9B 3FQKA 2VANA 5G5HA 4IJNA 4JI6F 1I3AA 4JS4A 1DGJA 4M3YA 5AQPA 2DHHA 5CCLA 1VIOA 1B9DA 1KKXA 2K3KA 3K89A 4YY3J 4NM1A 3QRRA 5F8JA 4CZKA 2EX3A 3PUFA 2XM3A 2QLTA 3VN5A 4KTWA 4R8UA 4IOCQ 3KK2B 1YI2N 1NK4A 3OBIA 3BZCA 3U3GA 1YK9A 1L3SA 3GE1A 3M1VA 5ETMA 3V5RA 4CH1A 3W60A 1ILYA 4WP9A 2I1QA 4YN3B 4YY3K 3OPXA 1TE2A 3DDNA 4NYPA 4NB4A 2P9CA 3BQ0A 2VYPA 3AVNA 3NVWA 3MMJA 4CLWA 1D9DA 4KLDA 3NGTA 4I56A 3ZC4A 4CJ7A 1VJ5A 4NE9C 3MM7A 1V3RA 1HNWF 4Y1DA 3GCWP 4ZVRB 4HYKA 1GH8A 2O8DB 4MF2A 1F9FA 3H40A 4NXMK 2A6MA 1VQLN 4RQNA 4J9KA 4HR2A 3W64A 1NGDA 5AQNA 3ID6A 5TZVA 2JLGA 2KW4A 5ALFA 3OYDA 3ZEUB 5C2DA 3AVLA 4RX6A 5C42A 1O8BA 3SIPB 4UAYA 5LXRA 3TAMA 5ALMA 2KOBA 4CM2A 1ZM9A 1UHUA 2I6XA 3LGNA 4CHQA 1IH7A 2PFOA 4WZQA 1QQ6A 4WQ5A 4QWAA 3BUZB 2WAQF 3IG1B 2K3IA 2C3MA 5I3PA 5GMEA 5AQYA 3HZ6A 1ZQZA 2V4JA 3MHYA 3UWTA 2G9OA 4U6PA 2V9KA 9ICMA 5A8KB 1N36J 2C2EA 3TP2A 1R8AA 3UFCX 4CJVA 3M6VA 1N0VC 3D45A 2OLWA 1OH5A 3GDQA 4DTXA 2GQCA 2APOA 1FDBA 2KVCA 2O8CA 1V9PA 5B7WA 3ET6A 1SJFA 4KYZA 2J7WA 4DR1J 1ZQBA 3PYEA 3RB3A 3ORYA 3DHWC 2GVZB 4PQUB 3RRHA 2QKKA 3QEIA 2QA4N 4YCXA 5GTIU 2BX6A 2IC3A 2AJ2A 4WF9L 5F2RA 1PUZA 4DG1B 4M5LA 1WHWA 4WE1A 3EXYA 4DX8H 1MMDA 5KAKA 4YOEA 5G0RA 3SSRA 2K2PA 1LKZA 1F9EB 4DUZK 1TUYA 3ZI4A 1S9EA 2D3ZA 1RDFA 4FXVA 3J7ZO 2UUAJ 2G13A 4DR1K 3QFHA 1DXSA 3KLHA 1PZNA 5DBAA 4IYQA 1CJUA 2A1JA 4NZ6A 3OTOF 4LF9J 4C23A 1JLGB 5KPRA 3CJ0A 3TI0A 2QA1A 3CCVS 4CHOA 2HFNA 3F2CA 1S49A 5DM7L 3O1LA 3HI9A 2OANA 3PJWA 3D2QA 2CQGA 2UUAK 2HPUA 2SXLA 2J7KA 1BNPA 2DNRA 2Y0SC 1IR2A 5ELZA 5IV4A 5AQGA 3AM9A 5D6GA 4CO0A 3F2BA 4NMLA 2VG6B 5KL8B 1JCEA 3EEQA 7ICJA 2I0XA 1JUDA 3B4DA 4H4OA 4FJMA 4L72B 2MPUA 2P1JA 4PAAA 4ECXA 1Z3EB 3RSEA 2OPPB 2ZHOA 1Z00B 1YJVA 2F76X 2KKHA 4DV0K 2JFDA 3KZXA 4AD6A 3FBFA 4PUOB 3TUIC 3R9LA 1HR0J 1KXPA 1JXEA 4QWBA 3J7ZT 1JALA 1JLQA 1XC3A 1CVJA 2O8EB 2QL5B 4KLGA 2N3LA 4OV6A 4CZFA 2XHWA 2XC9A 3BR9A 2FPLA 2B9WA 3FFIB 4KE5A 3HK2A 4RNMA 3K1RB 3ENQA 4KPCA 3MZIA 2UUCF 1IM6A 4ZVPB 4KLQA 3MBYA 4UAWA 2WF6A 1S0OA 3TU5A 1VHIA 2F7VA 2RS8A 1HR0K 3IKMA 4ED3A 3SBMA 3M9OB 4F4AA 1B92A 3VQAA 1ZBLA 3VGKA 5M2RA 3C6TA 4ZHRB 1R0CB 5ETPA 4UARA 1HNWJ 1VQYA 3FZBA 1GOCA 4WFZA 4M5HA 4LF4F 2GIQA 3G87A 4YHHF 4CGZA 1TR0A 3PX6A 2XTJP 4K4GA 4CJWA 5FPMA 4DV7K 1M90O 4M5IA 2YNHA 3RBXA 2PMZC 1VDVA 1IWGA 2LQBA 1SI9A 1CULA 4ID8A 2MTLA 3OVAA 2NZ4A 4CHZA 3VF0B 2DR7A 2VDIA 2DH7A 4KKOA 4TUQA 4KGMA 1KS2A 2YCHA 2G0AA 5EXWA 5C12A 2FY1A 2XZTB 3CWJA 2D0PA 2JDJA 2DO0A 3VAIA 4QWCA 1LWFA 1YITN 2A1BA 3GP9A 3H3NO 2RQMA 2FBYA 2ZGYA 3PO5A 4IH5A 5ALGA 5HLFB 2UUWA 2J6SA 2FI1A 3AFGA 3V7JA 4WK1A 1HBNA 4EAHD 1NDKA 2D7SA 5D0RA 2WONB 2MQ8A 2XY8A 2VQEF 3KK2A 1LWCB 5IIJA 4KLMA 2RKIB 2DR9A 5ETVA 4H4MB 3HFKA 1QQ7A 1K73O 3R9KA 1A0OB 3ENHA 1EAYC 5AHXA 2GO7A 1LV5A 3HM8A 3RU0A 1J2NA 4P2HA 3DXSX 4C1NK 3VA3A 2PFUA 2FBXA 4F25A 1RBTA 5D8HB 3TWZA 4P9SA 1M90T 2VBXA 2WB4A 2R8JA 2EAMA 2ZWHA 1S1TB 5SUHA 3ISDA 1FEHA 5BPCA 3QFPA 2CZ4A 3ZXWA 4X4UA 1VQ4N 3GG0A 2O8DA 1W26A 1JLFB 5JICA 4DLEA 1ZQLA 1FD2A 5HOOA 3NS1A 2E9TA 3T7ZA 2Z4PA 1S5LU 1RE1B 3H2LA 2RJZA 2UVRA 2CDQA 3PVXA 4K4HA 3OTOJ 3ZEUA 4ZJOA 2AZ3A 4MKVA 4I4BA 3KLEB 3FE1A 2CJQA 3SCLE 2R7OA 1Y64A 3OYHA 3THPA 5KFDA 3QETA 4PXDA 1DARA 1ROFA 2A42A 4KLTA 2ZHBA 2IAJB 5C5JA 3GV8B 5J2MB 4BCAA 2FJXA 1KHVA 1SCJB 4RQ1A 1K73T 3DLKB 3OTOK 1WACA 2WCXA 3R6MA 5A8KA 2J9DA 4L3KA 2DCUB 1HMVB 1UT5A 4CJKA 4I6MA 4PHTX 3A0IX 4IFVB 4PYDA 2BJ7A 3G71S 2EWHA 3FGVA 2QWOA 4YEAA 4CEOA 5HR6A 1Z4UA 2V2KA 2YQ1A 3LPTA 1D3WA 3IFRA 3QDKA 3E3XA 3PSIA 2GVZA 2DNGA 3K5OA 2F4FA 3KHHA 4OVLA 3MM9B 5ETKA 2BJDA 2XSFA 4LRDA 4FWOA 1TUGB 4DG1A 2RDJA 4AYBD 4YOUA 4CNYA 1FWPA 4I2CA 3CFPA 4I2AA 5CRXA 1X9XA 1L3VA 5F41A 2BKEA 5AKIA 2YHXA 3CCSS 4DL3A 2LEPA 2UUCJ 1LFWA 5HJYA 3M1YA 3D0IE 4O44B 4NMXA 3UE2A 3UNYA 4KX3A 4KHPF 3H2VE 4CT9A 2YVSA 2KQ2A 1K1SA 4G1IA 2NYIA 3GOIA 1XMQK 1X4HA 4WCEQ 2NXJA 1JLGA 4CLZA 3EPGA 2HNYB 4YR3A 3ONQA 4P6QA 1F60B 2N4DA 1WAFA 4IQXA 4DCOB 3AVHA 2F8LA 4IRDA 2QMWA 3C3LA 2UUCK 3WKAA 1N32F 4LF4J 4YHHJ 2V67A 4HT7A 5EUHA 3L2QA 1Z2LA 3HD1A 1R6VA 1P1LA 2ZBIA 2ES6A 2VH7A 1RBVA 5T7BA 1RSCA 1IKXB 1XERA 2WSEC 4BG9A 1RTHB 3HP9A 5T7LB 4FM0A 3TSPA 1UW4A 5HMYA 5KT3A 2HHVA 5JVHQ 2W55A 1HD0A 2OPPA 4YHHK 4OLAA 2ZJRQ 1Z00A 3K5MA 1SL2A 3HKZD 2IA0A 2ZWOA 3G2XA 1G2EA 4P2XA 3LZIA 2MB0B 2LA4A 3M2UB 1WSGA 3CETA 4HUEA 4Y2TA 5FRNA 2RIJA 2VG5B 2O8EA 9ICPA 2VQEJ 4L76A 1SIZA 3IR6B 4C1NI 1X4FA 1C1BA 2MLZA 1S8OA 5F3XB 9ICOA 3NY0A 2QGFB 1FRJA 3FLCO 2QM1A 4AXIA 1HWLA 4O8KA 5GAGI 3FKBA 2MAXA 4BRCA 4RJVA 4DSIA 3MUTP 3VVTA 1DTTB 1U26A 1BD6A 2MQNA 1D8ZA 2NRHA 3QWUA 3GFXA 2ZE2B 3R5CA 4CGGA 3OSPA 3IR7B 3HFVA 3I56N 4K2XA 5ALDA 1HPMA 1M5HA 4M9HA 4ZHRA 3S41A 3JAMO 4WP8A 2CJBA 2YHYA 1VHFA 4UZBA 4M95A 4EFHA 4RPFA 2QXFA 3GZFA 2NYVA 4MKYA 4F50A 1P7DA 3IDHA 3L6QA 4NLRA 2LQ8A 1VSIA 1N5SA 4MK7A 2HBJA 1NJYA 3N7RC 2J76E 1YTUA 2OPSA 8AT1B 2AX1A 4RWWA 2L3MA 1ZM4A 4CIEA 3QUQA 1CC8A 2D3OR 2E5IA 2YKOA 1KLMB 2DKZA 4QPTA 4F4WA 3NGYA 2E66A 2EG1A 3CO9A 2JH3A 3KFWX 4OI4A 1ZAWA 4O8UA 1L8LA 2RQ5A 1KNZA 2GS8A 2OH2A 4FLWA 4DL6A 2AGQA 3IWLA 2BR0A 3GYGA 1K0TA 4NLXA 4ZP6A 3UNGC 5DLFA 4KAZA 3OYBA 3QU7A 4I0WA 2RAQA 3UCUP 3BGFA 3U9DA 3GB0A 3KHLA 5GVQA 4ZJQA 2W40A 1EWQA 1ZQMA 3WNGA 3LM2A 1ZRNA 2WONA 3V9UA 3MR3A 3T3FA 2LCWA 3G96A 3KLGA 3CMES 2C2DA 5EWEA 4I2DA 1LWCA 4LUBA 1N63A 2RKIA 4H4MA 4LF5K 3CCJS 1HI8A 4HCCA 2VL1A 2RLTA 1G99A 1N4LA 1HNIB 1LW2B 4FS1A 4EHTA 3HZGA 4GMKA 3CCLS 4LR9A 1Q4RA 4AHRA 2PI5A 3OS2A 3FCVA 3OXGA 1LWEB 1F44A 1YF5L 2FJWA 2P9IB 3BYPA 2HRUA 5KG0A 1FEEA 3B9JA 1S1TA 1QJHA 2C28A 2ZH4A 3T5JA 1Z6RA 5HHHA 4K4VA 5KNIA 3KG0A 4X64F 1R0BG 4UBBA 1ZA2B 3R8YA 2VBWA 1JLFA 4H03B 1NZPA 2W2PP 4IOXA 4FK0A 1RQNA 1EARA 1TAQA 3OVBA 2OD6A 2ZM6F 4F91B 1H0HB 8ICQA 2RQKA 3V9ZA 1VSKA 4OKEA 1UVLA 3B6PA 1YVFA 1UVIA 2G08A 2YX8A 3O8MA 5DQGA 4KRWA 3NF7A 1N32J 5JVHL 1TV9A 4H4KC 2AJ4A 4V19X 2XRIA 2CRXA 2A1SA 2ZJRL 3EJMA 4ZPCA 1NSAA 2V69A 1YJWN 2IAJA 3VAJA 5E84A 4NPOA 5J2MA 3OYGA 3H0PA 3MEDA 3NKYA 5HQ8A 3T6BA 1WEYA 3VAHA 3DLKA 4ES2A 2FZKB 1U1RA 4OI3A 1RTIB 2FDNA 4DV2F 2KKVA 2C2RA 2MQPA 7ICIA 4EENA 3MPVA 1HMVA 3G6XA 1N32K 2VC0A 4ILGB 4IFVA 4YUDA 3UXPA 4M47A 1OSCA 4KY3A 1TQLA