2HVHA

Ddctp:o6meg pair in the polymerase active site (0 position)
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'
total genus 191
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hvhA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hvhA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hvhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hvhA01
2HVIA 3CM6A 2JLEA 3THVA 3AVBA 7ICQA 4FJ9A 4ID5A 2BPGA 2P5OA 4CJWA 1A76A 3K57A 4MFFA 3OYGA 2VG5A 2YNFA 1Z00B 2LYHA 3KIOA 3OS2A 4F93B 3MAQA 2BKEA 2OZMA 4KLTA 1J53A 3D45A 1JIHA 3QESA 4JS5A 1IKWA 4Z4GA 3RBEA 4B8AB 5CJ7A 4DTJA 4PUOA 3AO1A 4NXZA 4JLHA 1C7YA 3RMCA 4PA1A 9ICVA 3TAFA 4DTSA 1Z25A 4FZZA 1XWLA 1YT3A 4E7LA 3M8QA 3K2PA 4FS2A 4QZIA 4ED3A 3IG1A 3FYHA 1X2IA 2FPLA 3G6VA 5EOZA 7ICSA 2VWKA 1IH7A 4CEEA 4KHNA 2XC9A 1VSDA 2DFFA 4DQSA 3IHQB 8ICSA 7ICTA 4Q45A 1ZQXA 2D0AA 4NLGA 4Z6EA 3C5FA 5E41A 3QZ7A 1SUQA 3SUPA 4I2BA 4BE2A 3RB0A 3WNEA 3C1ZA 3NHGA 1QSYA 4BGDA 3RJIA 1QHTA 4F4KA 3HSTB 4OVLA 4EBEA 3HYFA 3OSNA 3JPQA 4I2DA 4MEYA 4KN7A 1TGOA 1S0NA 3VQQA 4ZHRA 4BDZA 1L3VA 1D8YA 4PH5A 3T5KA 5KGXA 4IRDA 4OJRA 4KLDA 4OKEA 1TKTA 4B9TA 4F91B 2KW4A 3F73A 3MEDA 4F3TA 2I1QA 1K1SA 4JV0A 1W9HA 2IS3A 5D3GA 3TANA 1KSPA 4ELTA 3OS0A 3HVRA 3PV8A 1RTJA 1ZQJA 4E19A 5HLFA 1LWCA 1CZ9A 2DFHA 4Z0UA 4KTZA 1XU4A 3PW5A 4XRHA 4F5OA 4CJLA 3ASMA 3N4MB 4N76A 2C2DA 2C2EA 2MUTA 2ITGA 3IRXA 3M9MB 4ED6A 3TABA 4L8RB 4NYFA 3L2VA 2NRVA 4E0DA 1KEJA 3RMDA 4EEYA 4BXOB 3Q8QB 1TVAA 1IG9A 1NK7A 4FXDA 4QZEA 4DFMA 3V1RA 4IBNA 3M9NB 2ZTDA 2W9CB 4DSKA 4DLEA 1RTHA 4C8NA 3LP1A 3V1QA 1ZQRA 3HWTA 2W9BB 1S76D 2PFNA 1CXUA 3KKRA 4KHYA 5J1EA 2B5JA 3ZDDA 4M3TA 4QZFA 8ICTA 3ZDBA 1MQ2A 4X5VA 4YXMA 4UAYA 3OYDA 3NF7A 4EZ6A 4ECYA 1ZQCA 3QEXA 4NLZA 3NGYA 1ZBFA 4CIEA 4M6WB 1C1BA 4MF8A 3MBYA 3HJFA 2WONA 4LZDA 1FKPA 1LAWA 3AVCA 3T5LA 2RN2A 3ZCMA 3ETLA 4RQ5A 1WSGA 1TL3A 3QETA 2GUIA 1HPZA 4PHDA 3PMNA 5KG0A 4O55A 3F9KA 2F96A 2GV9A 3AO4A 1S5JA 5DK5A 4JWMA 3L8BA 2NRXA 1VSKA 4CGJA 3L3VA 2AGPA 1K6YA 9ICHA 3RAXA 3GQCA 5KFAA 4CJEA 1GOAA 3ZD9A 5CA7A 3Q8RB 4J9KA 4DU1A 5J2FA 4BE0A 1S6PA 1TFRA 3SPYA 5CZ1A 4E89A 3SQ2A 4EP4A 4IG0A 5J0OA 3Q8KA 4BACA 2BPFA 7ICPA 3TAPA 4W5QA 2Q0ZX 4FLZA 4RT3A 1S1XA 4O4GA 4FJ7A 5CP2A 4TURA 3HXMA 3C23A 3VA0A 4UB2A 1V9PA 4MQ3A 4FJ5A 8ICPA 4EYHB 1IKVA 2AJQA 1SL2A 1ZQYA 8ICEA 2I9GA 2BHNA 3SUNA 3EZ5A 1TKXA 2B6AA 1ZQTA 5DGAA 3L2QA 4F2RA 4KLOA 3SQ4A 4DQIA 3CYMA 1BPZA 4CJPA 3N97B 7ICVA 4FJGA 5EWGA 4EBDA 4CFCA 4CJTA 1ZQWA 2YNGA 1BPDA 1BQMA 4KHSA 1I3AA 4RQ6A 4DSJA 1C1CA 3ULDA 1BHLA 4TSXA 1C0MA 1ZETA 3ZSYA 5KFLA 4KTQA 2VG7A 5J2KA 3SYZA 1KDHA 1HQEA 5CYQA 3OYFA 2FBYA 3ORYA 5KT5A 2A1JA 4JS4A 2E4LA 2D0BA 1NK9A 1RZTA 4CEBA 1JLAA 3OYAA 2UVRA 2KZ3A 4KLHA 8ICCA 7ICHA 5DDYA 3MR3A 4O5KA 1B92A 2B4JA 4O3NA 9ICNA 1J5OA 9ICRA 4GMJB 5DBAA 1ZBUA 4UB1A 4RPZA 2EHGA 3AA3A 3Q8PB 3H7IA 3SJJA 3MDCA 3S3MA 1ZQLA 5C42A 4HVJA 5DLFA 1HUZA 4UB5A 3PO5A 4IQVA 4FLUA 2VA3A 1JLBA 2KZMA 3G10A 4FZXC 5IIOA 3AVKA 3LP0A 3VQPA 3WNFA 7ICNA 4TUQA 2E6MA 4FK2A 3G6XA 4PQUA 5IILA 3LANA 4ECXA 1ZQHA 3SCXA 3CG7A 4JV2A 3TFRA 4YFUA 4DLGA 4IDKA 7ICGA 5KG4A 1JLEA 3DLBA 4AH9A 3QEAZ 5CYMA 3ZSOA 3NGDA 5KT7A 2P51A 4RQ1A 3PX4A 4F2SA 2D0CA 2YV0X 2P6RA 3QERA 3CM5A 3NGIA 4CF2A 4M3RA 3SUQA 3GV7B 5I3UA 2HVHA 5DQHA 5JS1A 3O3HA 5J2PA 1S6QA 4K4HA 4CE9A 2NRWA 1NKCA 5KFEA 2PI4A 5BOLA 3ALYA 1RBSA 1VK0A 1H38A 4IKFA 1RBUA 1D9FA 3C95A 3ZT0A 3PR4A 2FMPA 7ICKA 1B43A 5DB8A 2ZE2A 1TK8A 5HROA 2XGPA 4CHQA 3S9HA 4RW8A 3WNHA 2OPQA 4CJ4A 1Q9YA 5DB9A 3NGZA 4PHEA 1L5UA 3RJJA 5KG5A 2X74A 4CJVA 3OYKA 1QTMA 4O0IA 1ITGA 3DYAA 2G8WA 2JEJA 4M04A 5F9LA 1XHXA 1YTAA 4CEAA 2W9BA 1S1WA 3VQDA 4DOAA 1EP4A 9ICXA 4M3WA 1NJYA 3H8SA 3LDAA 4MFBA 3CFOA 2BR0A 5L1LA 4FLYA 4YMOA 1XSNA 2DY4A 3C21A 2IDOA 1WCNA 1JKHA 3JYTA 4KITB 5J2AA 4DL3A 4M6WA 1KTQA 3MEEA 5EWEA 5FROA 1JLCA 4KLMA 5HRSA 4RQ7A 1NJXA 5TZVA 3MXMA 1T03A 2W8KA 4MEXA 4I2AA 3DRPA 3KK2A 2BCQA 5DBCA 4XA5A 1BCMA 1CEZA 2ZUCA 3L2UA 1NJWA 5EU7A 4O5EA 3SV3A 3O3FA 5C5JA 1WSEA 3L2RA 1L3TA 3KK3A 1QE1A 1RNHA 3NFAA 5IIMA 3RAQA 1RCHA 5KFIA 4O3PA 3V6KA 3OYCA 5KFTA 4PGYA 1VSLA 3TAQA 5D4BA 2FBVA 3LAMA 5HHHA 3BQ0A 1T05A 4ED8A 4M3YA 1VSJA 2VA2A 4ED7A 1COOA 5FDLA 5J2HA 3AV9A 2ALZA 3IM1A 4FK4A 3ZSRA 1QQCA 3OYIA 3HPGA 2E6LA 1T3NA 2BANA 4KLGA 4E7JA 3V4IA 3LWLA 1ZQFA 4I2GA 3RRGA 1ZQAA 1JXLA 1L3SA 4ECZA 3AVAA 1PZNA 4CJ3A 4OGEA 1BI4A 4KI6A 8ICAA 2Z1GA 1ZQMA 5KFBA 3PW7A 2G8UA 1SZPA 4TUSA 1NK4A 1WSHA 1ZJMA 2YNHA 3K59A 1O1WA 3H8JA 2IA6A 2ZUBA 5J2QA 4UAWA 4DL6A 1Y97A 1RXWA 3LP2A 1MSWD 4M9NA 1ZQZA 2Y1JA 3V6JA 2PFQA 1BIZA 4QWBA 3FFIA 1BPYA 3NH0A 5J2JA 5DQIA 1WN7A 4CERA 3B0XA 5J0WA 3ZD8A 3QNNA 3HK2A 3CQ8A 2R8GA 2LSNA 4KO0A 4QW8A 4I28A 4Z6CA 3M8RA 3MR6A 4IQUA 4I2IA 1U49A 3ZT4A 1JXEA 3B6OA 4KLFA 1KCFA 1Z00A 1C0UA 4MF2A 1D5AA 3HPHA 4M9HA 3G6YA 1RPLA 3ZDCA 3VQ6A 2VANA 2UVUA 4NCBA 5D46A 4F5RA 2AU0A 1G15A 3CFRA 2OPPA 3RR7A 1JLGA 3WNGA 1SL0A 4ID1A 3V7KA 2O4IA 4CEQA 4GXKA 4CECA 2Z1JA 4QWCA 3NCIA 2V9WA 3BGRA 4DU3A 3AA2A 1HUOA 7ICFA 4EP5A 4FJNA 1BPEA 4QZCA 1RT3A 1HNVA 2OZSA 4CJKA 3O3GA 4CHZA 4I2FA 4JK1A 3VQAA 4I9QA 3OYJA 1HYZA 2BCRA 2C22A 4IFYA 3AU2A 3OJSA 4QZBA 5J0XA 2ISOA 2W9MA 4FS1A 3T5JA 4M41A 4YNQA 2WTFA 1ZBIA 1ASUA 4YQWA 4P4OA 2MAXA 3TI0A 2IBKA 5KT6A 3ZT3A 7ICOA 2W42A 3NDKA 3O4QA 2KQ2A 4FJKA 4EZ9A 2BCVA 5DG8A 9ICPA 2FMQA 1RBTA 4GW6A 1TKZA 3V6HA 4FLVA 4PPXA 3VQ8A 2G8FA 4KHUA 4WE1A 4P4PA 3L3UA 1BVSA 1AROP 1WAJA 2A1RA 3G0ZA 4RT2A 4XIUA 1ZQEA 4CJFA 4DL7A 4DEZA 4YG2A 2G8IA 1LW2A 1U4BA 1IO2A 4DMNA 2IHNA 2J6SA 2YKMA 3NH1A 4P4MA 5KG3A 1CZBA 2R8JA 7ICUA 4FLTA 5KT3A 3FDSA 2HB5A 3SPZA 1LB2B 4UAZA 3NF9A 3GDXA 8ICNA 4DTOA 1XI1A 3LPUA 4DTXA 7ICEA 5HP1A 2JGUA 3QIPA 4KLIA 5KFUA 4M3UA 4XUSA 3KK1A 3EY1A 4UB3A 1HRHA 4W5TA 1UWBA 1ZQDA 3VQBA 4YXJA 1UT5A 1BIUA 1T7PA 4Z4HA 3TR8A 3P1GA 3DRSA 4O3SA 3TFSA 3OJUA 1X9MA 4KFBA 4CEZA 4RZRA 2GBZA 4B08A 4R63A 1WSIA 3OSPA 4LSNA 4F50A 4DO9A 4CESA 3V81A 5BOMA 1REVA 4YMNA 5J2DA 4G3IA 2BQ3A 5K14A 7ICJA 4R8UA 3JPTA 2Z1IA 4ZTFA 2DPJA 4B9NA 4RQ4A 4HCCA 4I2HA 3RH5A 4ECRA 3LP3A 1FK9A 3K75D 3IS9A 1X9SA 1NOYA 2KTQA 2Q3SA 3MECA 3KD1E 4CEOA 5T7BA 2ZTEA 2OPSA 5J29A 4RUCA 5KFGA 4HUEA 4YR0A 3E2EA 1KFDA 1C0TA 1NKBA 2A1JB 3HT3A 4DSEA 5KG7A 4DSFA 4CGGA 5J2CA 4M45A 1JLFA 1WSFA 1KLMA 4ZTJA 2JZBB 1ZQSA 1RBRA 3K5OA 2FBTA 4CJSA 1LV5A 3AVHA 4O0JA 1ZQVA 5J0YA 5BPCA 1VSMA 1UA0A 4DS4A 1TK5A 2BCUA 1LWFA 3MR5A 3DLGA 1ZQGA 3D0PA 4I29A 1ZQKA 3DMJA 4FJIA 3UIQA 1U04A 1RTIA 1RT2A 3OVNA 2HHSA 1ZQBA 4LSLA 1XS9D 4E1MA 5EWFA 1YVUA 2ZJAA 1RILA 3GIJA 4MFAA 4Y1DA 2YNIA 3HL8A 1NK0A 1TL1A 4BXOA 4KLLA 4J9NA 4KLEA 4J9SA 4DTNA 2HNYA 4F92B 4YVZA 8ICBA 4HUFA 2IC3A 1QS4A 4TQRA 4DL5A 3LZIA 1A5XA 2PY5A 4KREA 5KFQA 5KT4A 3H4DA 3T1AA 1Y88A 1ZJNA 3GV8B 2YHBA 3LK9A 1ZQNA 3KTQA 9ICJA 1Q8IA 3KD5E 4ECVA 4YR2A 2EX3A 2IOCA 5KFCA 3VQEA 8ICYA 4F5NA 2KN7A 4GLXA 1N5YA 2FC0A 4OKKA 2XHBA 2HMIA 4JRQA 9ICKA 3RJKA 4F8RA 3KLIA 4H8KA 1I39A 4NM1A 4OPKA 4Z4EA 3Q8MA 2V4QA 3C94A 4QZHA 3QEBZ 4NCGA 2ZTCA 3PR5B 5KFZA 4DS5A 5HMLA 1RYSA 1RT5A 3AO2A 4LVSA 1ZQUA 3QIOA 3MXIA 4KPYA 2G8VA 4J9QA 1NOMA 4CHOA 5J0UA 1F21A 1KFSA 4ELVA 2M9NA 1CLQA 8ICWA 4DF8A 1N48A 3MXJA 4RQ0A 2VA8A 4KAZA 4N41A 4CIGA 2FMSA 3NBPA 3C2LA 1QLNA 1LAVA 5J2MA 4B3OA 1KVCA 2RPIA 5L1IA 4PY5A 3GIKA 1UOCA 3ZDAA 4N47A 4CF1A 4DTMA 5FRNA 1EX4A 4W5RA 1RBVA 1LWEA 2ZUDA 1KLNA 4CGHA 2HHQA 4KN4A 4I9LA 4N56A 3UQ2A 4K8ZA 4QZGA 2H5XA 2F8SA 1NK6A 3OY9A 2ATLA 5CR0A 5CZ2A 2ZJ8A 2BDPA 4B9VA 4QZ8A 4ECQA 9ICTA 5KFFA 1B9FA 4RQ8A 7ICRA 3GIIA 3ITHA 1C1AA 5KRTA 2OYQA 2KFNA 1RDDA 3M8SA 2ISPA 4E7IA 3AO3A 1XHZA 2ATQA 3SZ2A 4R64A 5DG9A 1TKDA 1BL3A 2VG6A 2F1JA 3H40A 4IQTA 3V9UA 1NK8A 3RMBA 9ICMA 4O3QA 9ICLA 2QK9A 2OPRA 4AHCA 4OLAA 4KLSA 3EYZA 2J6TA 4DFKA 3KHLA 5L1KA 3AVGA 3DOLA 1EXQA 3AVLA 3QO9A 1HJRA 3AA4A 3I0SA 3RB4A 3MFIA 3HP6A 3ZSWA 4G1QA 4Z4FA 5KT2A 3BQ2A 9ICUA 1RYRA 3ZT2A 3T5HA 5KGWA 3ZDEA 5KFSA 3RH4A 3T3FA 3PY8A 2R8HA 4Q8FA 4CF0A 1BCOA 4J9MA 4P2HA 3U3GA 4FCYA 3RMAA 1IM4A 1KVAA 4ICLA 4KHQA 1TVRA 5C24A 1WNSA 4FYDA 5KTQA 4OGCA 3I8DA 1JX4A 4FO6A 4I2JA 3BDPA 5I42A 3LALA 2KZZA 3TAEA 2MUTB 4PWDA 2RDIA 1S77D 3E01A 5KFVA 2XGQA 2P6UA 1VSHA 4ED0A 3B6PA 4TUPA 5IINA 1TV9A 3C6TA 5KFWA 1VRUA 4M9GA 4I27A 7ICLA 4FJ8A 1JL2A 4RW7A 4HHTA 4M0AA 8ICMA 4CHYA 2PFPA 3T19A 1EETA 4Z4CA 4HUGA 3OHAA 3V9SA 1KRPA 1DLOA 1S9FA 1R0AA 1ZQQA 1D9DA 5KG6A 4CF8A 4F3OA 3ISCA 2JEIA 3PW4A 4I2EA 1MC8A 1GOBA 1VSEA 2PYJA 4CCHA 2D5RA 1BQNA 4QOZB 1LW0A 2VWJA 3H8WA 3QEWA 3RB3A 1RT6A 2OWOA 8ICVA 3PX6A 4O3RA 1UAXA 4W5OA 4F4XA 4KLQA 5KFJA 3C2KA 3EWAA 4KB0A 1ZYQA 5KFKA 1JLQA 2X6NA 4LY7A 3AVJA 4CJRA 4DFPA 4YD2A 3TAMA 2HHWA 4KTWA 1JN3A 3SI8A 4GXJA 4CGDA 1XSPA 1ZQOA 4Y1CA 3QEIA 4FZYA 1EKEA 3PW2A 4RNNA 4Q0BA 3DRRA 1B9DA 4DTRA 4PHAA 3V72A 5JUMA 4RNOA 4QWAA 2PXIA 4NLNA 4M9JA 5C25A 1L3UA 3QZ8A 1S10A 3AA5X 3LWMA 2BGWA 3RWUA 4GXIA 3RR8A 2BPCA 3KHGA 1S1VA 4CIFA 4UBBA 3GFKB 1C6VA 3SV4A 3MGHA 2FPKA 1A5VA 4LH4A 4QAGA 8ICUA 2YHAA 5CY4A 5CB1A 1RT7A 2AQ0A 3RBDA 9ICWA 4O5BA 1VSFA 3HX0A 4R66A 2BE2A 2DTUA 3JPNA 2ZQBA 5KFRA 1S9GA 2F1HA 2OA8A 2G8HA 3BQ1A 2NRZA 4DSLA 4YFKA 4RU9A 2IHMA 2XY7A 1MQ3A 5KRSA 4CFAA 3PO4A 4O9MA 4DQPA 3QEVA 3GILA 4C8LA 3HW8A 2XY8A 3OYMA 4GC7A 3JSMA 3KLEA 4M3XA 3NH2A 3OYEA 2RF2A 4ECTA 5J0PA 3NF8A 3S3OA 5IIIA 1RT4A 9ICEA 2UVWA 1U9LA 3SNNA 3EPGA 4J9PA 9ICGA 1QSLA 2QXFA 3Q8LA 1EXNA 1SKRA 4I7FA 4Z4IA 4B9MA 1RDCA 4J9OA 2KFZA 8ICQA 4AILC 5KG1A 4RPYA 3VQCA 3RTVA 4CK1A 2W8LA 3UPQA 4KLUA 1B22A 2FLNA 4J2DA 4JV1A 4FW2A 4R5PA 2ASJA 4IRKA 2ASLA 4KV8A 4R65A 4JRPA 4CJ5A 2DFLA 4BWMA 4DOCA 4ECUA 2JEFA 3JPSA 3DLEA 3V1OA 3P5JA 5DQGA 4W5NA 4TQSA 5KFOA 4GC6A 4EBCA 1RT1A 4QWDA 2HHUA 5KFNA 2FPMA 5KFXA 1TAUA 4ECWA 4B8CA 3KHHA 4CFBA 4RW4A 4OLBA 3DOKA 4I2QA 4Q43A 3TARA 4B9SA 3MFHA 3KLGA 2BGGA 8ICRA 1XSLA 3DLHA 3HPOA 4C8MA 1W0HA 2XY5A 3LDSA 2IGIA 3ISNC 5JS2A 2P5GA 5SZTA 5F9NA 3JPRA 4O3OA 3H08A 2R8KA 1ASWA 3QEPA 4UB4A 8ICLA 4NCAA 1S0MA 4QZDA 3ZSXA 4F4YA 4DSIA 3HO1A 4HCBA 1D8LA 4FJLA 2C2RA 1J54A 1YTUA 4YP3A 5J2IA 3EPIA 4J2AA 9ICSA 4RW9A 3VA3A 4KHWA 3MABA 5HHIA 3QE9Y 2NUBA 1Z26A 5HBMA 3K5LA 1QSSA 1S0VA 1TV6A 4Q5VA 1X9WA 3DLRA 4PHPA 4UBCA 4HYKA 2YKNA 2B21A 4FM0A 3IAYA 4LZGA 3SQ0A 3MR2A 4NYNA 4YR3A 4QWEA 2DFEA 4OKJA 3P83D 4DU4A 3SUOA 4XQ8A 7ICMA 5HRRA 3PVXA 4E7HA 4M42A 2F1IA 4CK2A 1ZBLA 5HMMA 3RRHA 1U45A 4CJUA 4M9LA 3KKSA 5KFHA 4YN4A 5J2BA 5KFPA 3GV5B 2P1JA 3JPPA 4H4OA 3OYLA 4C8OA 5CHGA 1WSJA 1WAFA 4CGFA 2QKKA 3JPOA 3HVTA 2FLPA 9ICBA 3UXPA 2HNDA 4K4GA 4K8XA 1N56A 8ICXA 4IQWA 3MEGA 4IG3A 3C6UA 2G8KA 3Q8SB 4RW6A 4AHVA 3BQTA 4DTPA 1HMVA 4RNMA 4UQGA 3RJHA 5KI6A 1RDBA 3MDAA 2XRIA 4KB1A 1IKYA 3LZJA 1HYSA 4Q8EA 4FM1A 8ICGA 3TQ1A 4PGQA 1S0OA 2JEGA 4FLWA 2C28A 5DG7A 1A77A 1ZQIA 2PI5A 4CHPA 3OYHA 3PX0A 4FM2A 1MU2A 5KFMA 3V9WA 1HNIA 2O4GA 3OS1A 1N6QA 7ICIA 3M8PA 4CEFA 3DI6A 1WLJA 2WOMA 3ISBA 9ICQA 5D49A 4LD0A 2PYLA 5SWMA 4M3ZA 4AHUA 3ZSVA 4RQ2A 2R8IA 4CK3A 3DM2A 3BJYA 4KRFA 8ICOA 3PMLA 8ICFA 3HP9A 4B9UA 5J0RA 4R8UB 3OGUA 4KI4A 1HJPA 4O5CA 1DTTA 1FKOA 4YCXA 3NE6A 3VQ5A 1WCLA 3AVMA 4DQQA 3OYBA 4CGIA 4DG1A 1BPBA 4DF4A 4DTUA 3V7JA 3OYNA 4PGXA 2W9CA 1NJZA 1TK0A 4FJXA 3TAGA 3S3NA 3CFPA 4B9LA 1SKWA 4QZ9A 3KLFA 3DLKA 4AHSA 5DBBA 3VQ7A 1Z3EB 1BI4B 1NKEA 3L2WA 5HP4A 5HRNA 2RDJA 5DDMA 1KFTA 3PW0A 2PZSA 3KHRA 5J2NA 4DQRA 4FJJA 2GWSA 2HHVA 5J2GA 3ISDA 4ED2A 2I5JA 1UA1A 2W9AA 4C8KA 5KFDA 4I2CA 4J2EA 3U6FA 2PFOA 4NLKA 4H4MA 1DGSA 1GOCA 3NTUA 9ICAA 5HRPA 4OPJA 1FXXA 4IFVA 3C1YA 1UT8A 3UXOA 4M2YA 5IIKA 4JWNA 1VSIA 3V9XA 3I0RA 3C2MA 2QKBA 3NAEA 1ZBHA 4YMMA 4BDPA 2IMWP 4O44A 4Q44A 3MGIA 4KKOA 4HTUA 4EYIB 4ECSA 4FBUA 4Z6FA 1RTDA 1RDAA 4FW1A 1S1UA 4RPXA 1ZQPA 2BCSA 1JL1A 1HQUA 4LH5A 4E3SA 1A5WA 8ICKA 4QZAA 1SL1A 3A2FA 4FK0A 3V7LA 5KG2A 1NOZA 2XO7A 3KJVA 3K4GA 4J2BA 1DOQA 3QINA 4FJMA 4FJHA 3SI6A 3SQ1A 1S9EA 2IAJA 4BWJA 8ICIA 4CFDA 4RUAA 4CHNA 4J9LA 4I2PA 2RKIA 3M9OB 4QCLA 3OHBA 8ICHA 3QLHA 3V9ZA 4AHTA 1CUKA 4ZH4A 4ELUA 3UXNA 2AGQA 2V4RA 3VQ9A 1ASVA 1IKXA 4FBTA 4QW9A 3ZSQA 1BPXA 1T4GA 2Z1HA 1NK5A 3AO5A 8ICJA 5J2EA 3VN5A 2X6SA 2HHXA 1IXRA 1U47A 3PNCA 2XCAA 3RB6A 4KMUA 3H4BA 1DTQA 2BQUA 4MFCA 3VQ4A 1RXVA 4CF9A 4F4WA 4JUZA 1U48A 1JXBA 5IIJA 3K5MA 5DB7A 4NM2A 3AU6A 3EW9A 2BQRA 2ZD1A 1S97A 2P66A 3V6DA 2J6UA 2FLLA 2X78A 5L1JA 4IRCA 4N5SA 3RH6A 9ICIA 2Y1IA 1J9AA 3RJEA 3AVIA 3RJFA 1BGXT 4F5PA 4FVMA 3O4NA 1KVBA 3TWHA 4RQ3A 2ETJA 5DGBA 5DB6A 4KLJA 9ICOA 5DKWA 1XO1A 1TAQA 3ZT1A 3LAKA 2UVVA 2JZBA 4DL4A 2XY6A 3K58A 2XCPA 4DWIA 4IR9A 3KLHA 4ED1A 2NRTA 4J9RA 1T8EA 2HHTA 2R7YA 5CWRA 4DOBA 3B0YA 4IR1A 4E1NA 3AVNA 1X1PA 1BISA 4FLXA 2FBXA 3NF6A 5HNKA 1XC9A 2HW3A 1CXQA 4CJQA 4E7KA 3AVFA 5J0TA 5DLGA 2F8TA 1JMSA 3UQ0A 4F5QA 9ICCA 5DMRA 4K4IA 4M47A 3GIMA 3C5GA 4YD1A 3PUFA 3LPTA 4AHRA 4RG8A 5FRMA 2HNZA 2ZJ5A 5KFYA 3AUOA 3QNOA 1VRTA 5L9XA 4BE1A 4GVMA 4DFJA 1K1QA 4BDYA 4NY8A 4DL2A 9ICFA 4F4ZA 1Q9XA 2ASDA 3K5NA 3RJGA 1HYVA 1SV5A 5J0SA 3U3YA 1SKSA 1S1TA 5J0QA 4Z6DA 3HM9A 2A1SA 2DPIA 2AGOA 3ZSZA 2AQ4A 4CEDA 8ICZA
chains in the Genus database with same CATH superfamily
3KK2B 3CM6A 4FPBA 3RG6A 1RAFB 3K9KA 3THVA 2VL1A 2CWXA 5HMWA 1JCGA 2F4FA 3UDCA 2P5OA 2OTJN 4DQ8A 4RU2A 1X4GA 1A76A 3DOMA 4OZ0A 2YNFA 3QYYA 1WKLA 1Z00B 1R8HA 4F0KA 2YI1A 3OS2A 3SD7A 3GJQB 4F93B 3PXGa 3VAJA 3HOSA 3AQPA 3D45A 2Q6CA 1JIHA 1KHVA 4JS5A 4UUXA 3A3NB 3QFHA 5AQFA 4Z4GA 4KGMA 3MOZA 3RBEA 4B8AB 1C1CB 5AIBA 5AQWA 4RR5A 2GIRA 2EI5A 4LF4K 4OJ5A 4WFNQ 1ZS6A 2DIVA 4RBTA 1LNQA 1FWPA 1XWLA 3FCHA 4Z2XA 4IOAQ 3AH6A 4E7LA 4Y2MA 1TL4A 1OSCA 2DEIA 4ED3A 3VGSA 3FYHA 5LOQA 3G6VA 5A8WA 5SUHA 3RW7A 3G4SN 4YY3K 4CDGA 4CEEA 3R2CJ 1VAZA 5AI0A 1VSDA 1PYOB 4DQSA 3IHQB 3CMAS 7ICTA 2CUYA 2B9EA 1KXPA 2D0AA 3D2NA 1CS4A 4FZNA 3C5FA 1UJ5A 3D66A 5E41A 3QZ7A 4LF7J 4I2BA 4HH1A 3GG4A 1Q16B 2IY5B 5A2QY 1QSYA 1FK9B 5BYQA 3VQTA 2DT9A 3RJIA 2GX8A 2ZEJA 2BJ9A 2E9RX 3LPEA 1EKRA 1TL7A 2IJFA 4EBEA 2HEKA 1UFWA 1TFYA 3OSNA 2P9EA 2YX4A 2PO4A 4KN7A 1TGOA 3VQQA 3H7HB 3MM7B 4PH5A 1OYDA 2Y1RI 1YJNN 4OJRA 3GCWP 3AD7C 4OKEA 2YY6A 2CAJA 1PYTA 4JV0A 2V2VA 2VQEJ 5D3GA 4QR1A 4OQJA 5C2DA 1ZQJA 4ZVRB 2E7WA 2DFHA 1IXKA 5BN8A 4Z0UA 1CI4A 2PA8D 3ETOA 1N5TA 4N76A 1UCVA 2B0CA 1GT8A 2C2DA 2C2EA 2XZDB 3J7ZO 3HT0A 3IRXA 3FRYA 2BOPA 1C2PA 5AQQA 3FZHA 4BC5A 3L2VA 2K8BB 3Q8QB 3IDHA 4YOEA 1NK7A 4QZEA 4IBNA 3M9NB 2YMPA 2RU9A 4I7FB 4GKKK 3RRKA 2ZGZA 4DLEA 1OH7A 3LP1A 1CC8A 2GQQA 1CJKB 3TZYA 5H9FJ 3H5SA 5AI9A 1UVLA 4AYBC 1S76D 1CXUA 1CJKA 1VS3A 4M5JA 1U6FA 3VTIA 1U2FA 8ICTA 2IM2A 2EQYA 4X5VA 2U2FA 3GU0A 1XNRK 2L9DA 4YXMA 4YS2A 4DR1F 1ZBFA 2G0AA 3SAFA 4NLSA 1QUVA 1VGYA 3MBYA 3FCWA 4JI1K 4LZDA 2ZIVA 1XBWA 4WU3A 3IWXA 2HRTA 1NU0A 2RU3A 1XMOF 2XI2A 2OGUA 4ZPBA 1L7NA 4I69A 1TL3A 3O6QA 4G1PA 4NCGB 5BYSA 2YX6A 3E01B 1F60B 4UY85 2IJNA 2F76X 2F96A 2GV9A 1PVPA 2FUG9 3AO4A 2EFGA 2WSEC 5AE3A 1JLEB 3L8BA 2NRXA 3F44A 1O6XA 1VSKA 3CSKA 4CGJA 4LFCK 3L3VA 2W43A 1K6YA 3D2FB 1YRUA 2MSSA 2K4EA 4ZDNA 4PZVA 3O6WA 3C0BA 5HVHA 1TFRA 3D4JA 1R0AB 2I5JB 3W61A 1HKAA 4AF1A 1SH2A 4UUWA 2CGKA 3VC8A 1ATNA 5J0OA 2QARB 1TL7B 4A62A 5DDRC 4DUTA 4O4GA 1J27A 4UZCA 2VHGA 5F3XB 3TU5A 1BWEA 4TURA 2MY7A 3HXMA 2Q31A 1RWUA 2D74B 4X4SA 5ALUA 4EYHB 2RRNA 3MCMA 3I28A 1SL2A 3JAMU 2XICA 4NJ8A 1Z1BA 2I9GA 1DBDA 4ZIVA 5FPDA 1ZQTA 5AIAA 3L2QA 1KVIA 3D2WA 3FEYB 3CYMA 4DQIA 5FDLB 3N97B 5BR8F 2FC8A 2XWXA 2JLGA 3HVTB 3M1VB 3UKUA 2MKYA 1LXJA 1CC7A 4RQ6A 1FF2A 4TSXA 2AZ1A 4ED4A 1B7FA 3P31A 4JI8J 4K4TA 4KTQA 2WK4A 4C1NK 1HQEA 5B09A 1SC1B 1H72C 5CYQA 5CR4A 1F2GA 3CCVN 3GCXP 3GPAA 3NVWA 2A1JA 2VQFJ 4LF8F 3DRPB 1ZM4A 4LVNP 1IG6A 3AODA 2DK2A 2XYHB 3HHLB 4CI0B 1B92A 2NV3A 2I2YA 4DV6J 1SJRA 3SQOP 1KAZA 1W2BM 4GMJB 2CWKA 1O08A 5DBAA 2QWQA 1DQ8A 3MGJA 2UV8G 2EHGA 2YX8A 4KR0B 3HTVA 3MDCA 5DLFA 1GFWB 1S6UA 3VEWA 3LUYA 4LSLB 4FLUA 1HBMB 1NGIA 4FZXC 4YOVA 4B3SK 1GLBG 3RUBL 3CDWA 3VQPA 5ALIA 7ICNA 2XLKA 1C4AA 5EHHA 4BR4A 3D6HB 1QD1A 5HVGA 3SCXA 2RE2A 4LFAK 3VWSA 5AFUA 2XS2A 4RW7B 4AYBD 5ALPA 4C80A 4BC9A 4AH9A 5ITHA 4WFAL 3OFGA 1YITN 4FP9A 4PZOA 2D0CA 2YV0X 1FX2A 2E1EA 2QE5A 1VQYA 3ZX0A 5THWA 3IAM9 4JI7J 1GLEG 3SDEB 4KB7A 1NI3A 2HVHA 2LKZA 4OYAA 3C6AA 2D41A 3I82A 5J2PA 3P5TL 2QL9B 4K4HA 4CE9A 1XERA 2PI4A 5BOLA 5AXMA 1U0HA 5KAKA 1H38A 4IKFA 1RBUA 4IL6U 3CNQP 4DR1J 5CHCB 1B43A 4QIVA 2UXCJ 2XGPA 4CHQA 1ED1A 5AQTA 2QSWA 3WNHA 1HBNA 2OPQA 1RLDA 3C15B 3BBFA 2KH9A 2C3OA 3ONQA 2HRYA 2HFVA 1L5UA 3RJJA 2X74A 4ILJA 3ZTOA 4Y0FA 3I56N 2O3DA 3DYAA 3OW2R 2JEJA 4M04A 5F9LA 3H45C 4OJLA 4CEAA 2OMOA 3VQDA 2GVDA 3Q7CA 2VIXA 1EP4A 3I9ZA 4LF4F 4M3WA 3H8SA 2PN6A 3NMRA 3LDAA 4QZVB 1FTRA 3QX7A 3WZ0A 2P8IA 4YMOA 1XSNA 3C21A 2IDOA 4CO4A 2CKWA 3QMQA 3JYTA 3BSNA 5IT9O 1O51A 1YI2S 1SCJB 5DS7A 2DHGA 5EWEA 1HQEB 1S3XA 4KLMA 1Y64A 1TE2A 4RQ7A 1SV0C 3L7UA 2NLXA 3O5TB 3CIZA 5TZVA 4IFEA 4I2AA 3NS5A 2KHOA 3DRPA 5M1QA 2BCQA 1CEZA 3VAFA 1UQVA 3NS6A 2XMUA 3O3FA 1WSEA 3KK3A 4BHQA 3MMJA 4KHPK 5KFIA 2MRLA 3N7PD 4JBCA 3CO9A 1VC6A 2KFYA 3MTKA 1X3NA 1IWGA 2E7VA 1APSA 2VFRA 3TAQA 2PMHA 1CVJA 2FBVA 4LJMA 3BQ0A 1T05A 4DX8H 5B0AA 2VA2A 8ATCB 3QBXA 1LFWA 4OYPA 4ANDA 2RJZA 2WSCC 3DRRB 3M1VA 2ALZA 3A12A 3IM1A 2EWHA 1MMDA 1GMWD 3CHWA 2BANA 3Q2TC 1Q53A 1WHXA 1DT9A 5U47A 2D3UA 1O13A 3AJ1A 4GKJJ 3B8AX 5FLXU 5LMNF 4OYBA 5CXTA 1PZNA 3AB2B 1BI4A 1RT7B 4KI6A 4GVLA 5KFBA 4I6AA 4CLZA 3Q0AA 1QH9A 2G8UA 2L08A 1WSHA 3CF5L 2YNHA 1JCFA 4NXMK 2ZUBA 5J2QA 4UAWA 4DL6A 3PIPL 3LP2A 2DBYA 4OHZA 3EVWA 2I6WA 4A4JA 2GHWA 1IIPA 3P49B 1BIZA 3FFIA 1HNXK 3TJ9A 3VZHA 3NH0A 4G1IA 4XO0A 1WN7A 5ETMA 4DV3J 1JK9B 4WZQA 4CERA 4P2FA 2MHEA 1A0OB 1VIXA 2H3QA 4CM0A 4MIAA 3QNNA 1TL3B 3BGFA 4R0JA 3CQ8A 1MN8A 4QW8A 4I28A 3MR6A 5A76A 2MZTA 2Q66A 5GAHU 3QO9B 4DUYJ 3BH6B 4AL7A 3D2SA 3EJMA 4UAUA 4USMA 4B3MF 4BROA 1C0UA 2E5LJ 2R2SA 5ALWA 3ZDCA 2VANA 1HARA 2WF6A 4R0EA 2VKQA 3VALA 1DEJA 1N34J 2AU0A 4F5RA 3H0PA 1HI1A 1H2VZ 3VGTA 1G15A 1SL0A 4DFDA 1OS5A 2CJXB 2ZZTA 4QIFA 3A5OC 2DGWA 5F3ZA 4JI2K 1L7PA 2R7RA 4C0BA 2DH7A 4ZOHC 1UW4A 3Q89A 4P0PA 2RRAA 4EP5A 1BPEA 3O2IA 1HNVA 4NA2A 1YJRA 4ETZA 4X84A 1A6LA 4IFVB 1Q4RA 2V0NA 4GRSA 3O3GA 1Y10A 1V6HA 4JK1A 3CD6N 3QWUA 4X65F 4I9QA 2RQMA 3OYJA 2BCRA 4JK9A 3UCGA 1X4BA 1VLYA 5J0XA 1WOPA 4Y65A 1UPMB 1ASUA 2IBKA 3TI0A 4LF9J 2W42A 2CPJA 4FJKA 1XNRJ 5C2FA 1NDPA 2FMQA 5BPMA 4GW6A 3AQOA 2WHOA 3H42A 2H48B 4HTLA 2G8FA 2JWNA 3C14B 1U24A 2VPWB 3B82A 5IV3A 2L5YA 3OQ2A 3ZTPA 3AMZA 2A1RA 2WVCA 3R6GB 1D3WA 4DL7A 1U1KA 5I9EB 3UMBA 2ZIUA 2WF7A 4H54A 1LVHA 4DEZA 3GFYA 2KVQE 2GUPA 4FSVA 5TKWA 1Q8KA 3CPEA 4M5KA 2J6SA 3T1YK 3B4MA 2AJ1A 5KG3A 2R8JA 4CLUA 4FLTA 1SXEA 4ZCIA 3LL3A 1OW5A 2E5IA 4NO7A 3V6DB 3D54A 4RUHA 1LB2B 3FQKA 3LDPA 2JV3A 1FDNA 1SKUB 3HVAA 4DR1K 3LPUA 1KQKA 2UXBJ 1FD2A 3QIPA 4NYPA 1RDFA 2KHVA 4M3UA 4M5NA 3EY1A 1F9HA 1LW0B 2C2ZB 3UPFA 2MZJA 1HNWF 1ZQDA 2I5HA 4Z4HA 2EFQA 3DRSA 3TFSA 3OJUA 2FSJA 4KFBA 4DR3J 5B5EU 2IDEA 2PDAA 4DR3K 2ZBIA 4BRLA 1OVYA 1HBOB 2K3IA 4NRTA 5AKLA 4PPDA 2OEHA 5BOMA 1LWXA 1W25A 3GSIA 1FA0A 5K14A 2BQ3A 4QOTA 4BRMA 1N5SA 4I4BA 1BY9A 1JLBB 3IV6A 4HCCA 2ZDPA 3RH5A 3MMVA 4ECRA 2Y1LB 2I7NA 3FSXA 1Q78A 2JDJA 3IS9A 4JKBA 1X9SA 2KTQA 2X1BA 2FVRA 1FJGF 4CEOA 3CJ1A 1VQON 5ADXA 5HANA 2Q0UA 9ATCB 4RUCA 4CT9A 1GXLA 4HACB 5GINA 4LBHA 5LMNJ 3R5CA 1WUAA 1WEYA 4NEZA 1T3OA 1NDLA 4DSEA 5KG7A 2G1HA 5LMNK 1EP4B 1WSFA 2F7VA 5F8LA 3NGSA 1T9UA 2FJWA 3OR1B 3C8YA 3K5OA 4CJSA 3AVHA 3DXKA 4O0JA 5BPCA 1VSMA 3N79A 5J8YC 1UA0A 2BCUA 4YDUC 1LWFA 4JAXA 3D0PA 1ZQKA 3LVVA 3UR0A 1RT2A 3P5BP 4N77A 2A3VA 5H9EJ 1H73A 8RUCA 2Y0SD 2OPRB 1QQMA 4E1MA 5LMUK 2ZJAA 1RILA 4KHPF 2HIYA 2YPYA 4MFAA 4PWDB 3MCPA 1N5XA 3HL8A 2IC3B 1TL1A 1RZMA 2LYVA 4KLEA 1V3RA 1WTFA 4J9SA 2AW0A 5ALJA 8ICBA 4HWIA 1HNWJ 2D0OA 1CJTA 3KXDA 3GJRB 2KVSA 4R79A 4ILLA 1IG8A 2PY5A 4KREA 1RABB 5CYMB 5KT4A 2AP6A 2RDDA 1Y88A 4IFYB 2YHBA 3LK9A 3F56A 1ZQNA 1MMNA 2FHJA 4KBIA 3KD5E 1LKYA 1QCKA 2IOCA 4OJ6A 1NZPA 5ALYA 2VJVA 1GEHA 2A18A 3UVJA 3CB4A 3VQEA 3PHTA 4KGVB 3W5YA 4F5NA 3QLHB 4GLXA 2W2PP 2FC0A 2GNKA 2HMIA 2XHBA 2E5LK 2RKIB 1WSVA 2MKSA 4TY8B 4F8RA 3O08A 2V4QA 3C94A 3CDUA 3QEBZ 3PR5B 3MI7X 2W25A 1RYSA 3AO2A 4KSEB 1ZQUA 1B0VA 3S8SA 2Z30B 2I9SA 3J7YP 1WEZA 3ZZUA 4CHOA 3DLLL 2RQ4A 1F9EB 4YY3J 1F21A 4AXIA 2E9TA 4ISEA 2GEMA 1RKIA 2M9NA 2AXTU 3FEZA 4JI5J 2F9JA 3CXCR 2ZIWB 2KHDA 2ZOGA 1KAYA 3MXJA 4QIGA 2H1YA 2OMLA 3C2LA 1QLNA 4B3OA 4IG3B 1QAJA 5K9FA 4F25A 3KWMA 2R3VA 4N47A 2F8KA 3M2VA 3TVKA 2F1FA 1RBAA 4W5RA 3D28A 4CH0S 2RHKA 1RBVA 4F9OA 4OCZA 3AAPA 3EVOA 5F41A 4CGHA 2HHQA 4KN4A 3UQ2A 4FL9A 2H5XA 2GMJA 1N6QB 3VGKA 2ACMA 3B4DA 3HF5A 4QZ8A 3L9ZA 2YMLA 3H8MA 4ECQA 2P9NA 3CJBA 4Y2SA 5KFFA 4X66K 1EIYB 1N32F 3P96A 7ICRA 3GIIA 2HS4A 2F2AB 5KRTA 3KKAC 1RDDA 3M8SA 2ISPA 2QV6A 1S72N 3ZZTA 4NMLA 3L7OA 5KPTA 2D7SA 3SLCA 4WJBA 3RMBA 3V9UA 5AZJB 9ICLA 4JI4J 2A3JA 3SQGA 3UE5A 1VLOA 4CM2A 3EYZA 2J9DE 2HWIA 4K0KK 2J6TA 2YKQA 3QSIA 1QZ6A 3CCUN 1EXQA 1M1KT 3ISND 3I0RB 3QO9A 1HJRA 3G6EN 2HURA 2J0XA 3RB4A 2Z2YB 4G1QA 2AMCB 2G06A 1Y3KA 2YX7A 2FJ6A 1T11A 3KZXA 1VQKS 3Q8YA 2UUBK 3T5HA 5AJ3F 3CC4N 1IR2A 1G1XA 4USUA 4CF0A 1NPRA 4DUYF 3QNMA 1IM4A 4ICLA 1KVAA 3A8IA 4KHQA 2E1AA 1U0HB 1WNSA 5BRDA 3I8DA 4LF6J 3BDPA 2AYMA 1D1UA 4DV5J 2W2MP 2GCFA 2LVWA 1JLCB 3BZQA 5LMUF 1M90T 4PAAA 5I42B 2RDIA 4HTJA 1WG4A 4BX9C 2OH2A 2XGQA 1VSHA 1ZBSA 2EWSA 3A4TA 3B6PA 4XH1A 2CQ1A 4I27A 2UUAK 2YY3A 4C1NI 1JL2A 2QLWA 4Y2KA 4DV2K 2YWHA 3A13A 4DPYA 2PFPA 3QAUA 2G1DA 1EETA 2CVIA 2OYYA 4EENA 4UAVA 2JEIA 4LREA 3PW4A 1JJ2M 2XNQA 4DV1J 3AARA 5F3TA 2CPHA 3F5TA 2BKOA 1LW0A 4ES2A 2W24A 5ETQA 2VWJA 4K42A 2A40A 3OXFA 1Q86O 5A2QU 2CGLA 4O3RA 4KH4A 2K8AA 1FRHA 1NO8A 4A47A 5AXKA 2D8CA 2H5JB 4F3MA 3HZEA 1OH6A 1YJ9N 1ZYQA 4BRAA 2M3DA 3TPQA 1JLQA 1N36J 2X6NA 2QWRA 1RT5B 4ED5A 2J0SD 1DTQB 1VK3A 3BO4A 2P9CA 3D7EO 2NSCA 1XSPA 5B0FA 1ZQOA 4Y1CA 4DR5K 5JLHA 2EVZA 2P9GA 3DRRA 1WTBA 2KE7A 2HNDB 1HKGA 2YVSA 3F2KA 3G71N 4OIXA 4M9JA 1F5AA 1M1GA 4DR7F 2RF2B 1S10A 3GU3A 3ZZRA 2D3O1 4IO8A 4X4OA 3ATVA 4AD6A 4GXIA 4QIEA 2BPCA 1X9XA 1PJ5A 2HHHK 1PK1B 3WKDA 2HQCA 4Z7CA 2EAPA 2HFUA 2IVNA 3MGHA 4L72B 5EVZA 4LH4A 4OYIA 2KV2A 3FVYA 8ICUA 1U1RA 5CY4A 2QKQA 3L95X 1P9YA 4IH5A 1SWWA 5MLCV 1VHFA 2YH1A 3T1YF 3HX0A 1BE4A 5EE9A 1Q1KA 4KV8B 4C9DA 4FXWA 2ROGA 2KT3A 2F1HA 2OA8A 2I7PA 3BQ1A 4RU9A 1REVB 3TA2A 4RPFA 4X4QA 5KRSA 4CFAA 3PO4A 2FVSA 3LM9A 3QATA 2NPFA 1RWXB 1M90O 3QEVA 2FD2A 2QSFA 4IO9Q 1HNXF 5JVGL 1N33F 2XY8A 2UYTA 4Y2JA 4GC7A 4M3XA 2O8DA 2PGCA 1LKZA 2GMHA 3NH2A 3OYEA 5J0PA 1M5OC 5IIIA 1RT4A 9ICEA 1F9FA 4OYWA 4WCEL 3U1LA 3EPGA 5J1PA 2LU2A 1QSLA 3TWZA 4NYOA 4USTA 3Q8LA 3OXLA 3OR2A 4B9MA 1FHTA 2KFZA 2QA4N 1RE1B 4C3KA 8ICQA 1KLMB 2HSTA 5D0HA 2ABYA 2MZ1A 4JKHA 2W7OA 2VKRA 3F2DA 3UPQA 4CK1A 3HJVA 3VETA 2ATCB 1RBLA 3KJNB 3QJPA 4FW2A 4AQYJ 5DJBA 2QLXA 2DFLA 5KL8B 4EX6A 4BWMA 5LXYA 2JEFA 2CVEA 4FPIA 5GAHP 4HH0A 3NCRA 5CRXA 4FN5A 4ES1A 4CWBA 5JTIA 1H2UX 3BGOP 5ALOA 1RTIB 2F65A 4Z94A 1UVNA 3DJCA 2ZKUA 5KFXA 4B8CA 2HAFA 3KHHA 2JC0A 3ET6A 1YJ7A 2FVCA 4Q43A 3MFHA 3C15A 2CG4A 1UVMA 4LRFA 3M2RA 1XSLA 4MAKA 4A8KA 2DYAA 4OPAA 2F40A 2IGIA 1AUDA 4HI2A 3ISNC 2W6KA 5JS2A 4LIWA 3GIRA 3WX8A 4V19S 1S8OA 3IRUA 2YNGB 1TP7A 4OJGA 2R8KA 3QEPA 3CJ8A 2Y0BB 2ZH2A 4QZDA 1KAXA 4FJLA 2C2RA 1J54A 2A41A 4M7YA 5AQYA 2XM3A 1RUSA 4RW9A 3VA3A 4NYZA 5HHIA 4YMEA 2IYIA 3TTCA 1S0VA 2DITA 3QMLA 1X9WA 1K8KA 4X4UA 4HYKA 2B7CB 1S1XB 1RU2A 3ILOA 3SQ0A 2HKEA 2ZM6K 3EGVA 4YR3A 3P83D 3CJ3A 2YHWA 4HVZA 3SUOA 2CQGA 1VQ4S 3I8BA 2PBDA 4IH7A 4NLVA 4CK2A 3RRHA 4WXOA 3KKSA 4ZLPA 1N8RO 3HKZD 4LSNB 3KOOA 5AKYA 2YHYA 4XEIA 3WC0A 3UE2A 4Y2QA 3OYLA 5CHGA 2QKKA 3ULEB 3IO1A 2PMZC 2QM1A 3IWLA 9ICBA 3HRGA 1N56A 1FXLA 3MEGA 3THXB 1DJ0A 1IV8A 2G8KA 3FBBA 3PRDA 1WHVA 4DI6A 5AI6A 1HMVA 2OFHX 1AB8A 2V69A 3MDAA 3I55S 1JRPA 3A0BU 1Y5NB 1S59A 1VI7A 3RW6A 4B3MJ 1RWMB 1K5OA 1T9WA 3HRDD 1S0OA 3HSJA 4FLWA 2DGSA 1ZQIA 1IJFB 4RO0A 2BMBA 3V9WA 1KKHA 5J1EB 1CQMA 1HNIA 3W0LA 2KLAA 1CLFA 3OS1A 4P71A 5C15A 1XMBA 3C46A 3IGVA 1B4SA 3DNCA 1TFWA 2Y8WA 2NREA 5JMNA 2W03A 3AGRA 3HHLC 1OPIA 2PYLA 4M3ZA 2CNOB 2J8SA 3L3CA 4CK3A 2W2QP 3EGNA 8ICOA 5AQMA 2GW8A 3PMLA 8ICFA 2KI2A 4UY8O 2HSEB 3J80U 3OGUA 2HBLA 5C42B 5IWAF 1AFIA 4FYYB 1DTTA 3JAMO 1HNVB 2LHTA 3HILA 1WC6A 2ZC4A 2UXDF 1BPBA 4DF4A 1RCXB 4DTUA 3V7JA 4ZVFA 3M32B 1O5JA 4AUKA 3BF3A 4PGXA 1TK0A 1M1HA 2MY8A 2IOFA 3HJEA 3KLFA 3DOMB 5DBBA 5B66U 3VQ7A 1RJJA 1HQUB 4HACA 5J2NB 2JR5A 1NKEA 1SVDA 3E8OA 5DDMA 3PW0A 2KSOA 2H5IB 2G09A 1PSDA 3GP9A 1M5SA 1VQ6N 4MFBB 3F2BA 2GMLA 2GIQA 5AI5A 3ISDA 3QFWA 3K9JA 2VICA 5AM0A 2F9WA 4OYMA 4NLKA 2XNRA 1SV0A 3R3TA 4X66J 4AQYF 5ETVA 1ATSA 3IA0A 3THYB 1VCTA 1KQSM 5AKEA 4OPJA 2K2PA 2KHCA 5L9NA 2YJFA 3T9ZA 2E2PA 2QLBB 1F0XA 5IIKA 4JWNA 2K7KA 3HSZA 3R97A 4CLTA 1WC3A 2H3FA 3I0RA 2R2RA 1QQNA 1EZZB 2DRAA 2HFZA 2CQHA 2OEJA 1ZBHA 4BDPA 3MGIA 4KKOA 1VQ5N 2DGVA 4KC5A 4Z6FA 2EK6A 5HQLA 3WX4A 1MN9A 2MKCA 1CRXA 2VG5B 4OX9F 1GQEA 4PWUA 1WKKA 1VDVA 3IP4B 1Q7YT 4WK1A 3K4GA 2JJ4D 1BA1A 4JP8A 2UUCJ 4ACOA 4FJMA 2IAJA 8ICIA 4RUAA 3ATUA 5C24B 4DPTA 2B6GA 2PEHA 1VBKA 5E3RA 1YDLA 2XMJA 2CJBA 2R7VA 1Y00A 4QYZJ 1GH8A 4ZH4A 3UXNA 4ILGB 4JOUA 3WEEB 1HIWA 4QW9A 2DNNA 1BPXA 3KJFB 3AO5A 5AQIA 1NNEA 3ENWA 3IR5B 2V68A 1RDUA 2HHXA 3DYAB 5KAIU 3G82B 1WWVA 3PNCA 1KD1T 5B7WA 2CQBA 3MX2A 3VQ4A 2O8BB 2WUSA 4MKVA 2NLWA 2YTCA 1VQ9N 3AN1A 2XI9A 5IIJA 3I5BA 2WZ1A 4NM2A 5ALLA 3MM6B 1S97A 2P66A 3AD8C 1DGJA 2FLLA 2APOA 1TZ0A 3U9ZA 3RSEB 9ICIA 1ZD2P 3RJEA 5AE2A 1E6YA 5JRTA 4F5PA 2VWBA 3I5AA 1KVBA 4IDKB 2J8AA 3TWHA 4FZMA 1FDBA 2LA6A 2ETJA 1KHWA 1URRA 4CO2A 3K8VA 4QIWD 1TAQA 2MU2A 5ALXA 2G08A 2UVVA 3HKWA 2FHMA 3ENBA 4U8VA 2XCPA 4DWIA 4IR9A 1J5EK 1GLFO 4ED1A 3FFIB 4YOUA 2HWTA 4WFAQ 3K7RA 4PCQA 4C3MA 5JLFA 2VOOA 4N8NA 2YWEA 4ZJQA 1Q18A 1P7DA 2QXLA 2FBXA 1XC9A 4DCJB 3E9OA 1M5HA 2DO4A 2QEXN 5J0TA 2J0QD 3Q22A 1JMSA 4F5QA 2IBOA 1BLUA 3GIMA 5G5GA 2QWNA 1WG8A 4DX6A 1KONA 1JLAB 5K5MA 4RG8A 2HNZA 2NYHA 4IOCL 1NLVA 3UVJB 4BE1A 4DFJA 1DK2A 3SMZA 4DL2A 4DZ6A 4F4ZA 4P0PB 3DU5A 2FF6A 5HK4A 3NGUA 3U1NA 2FY8A 5LJWA 1SKSA 4U96A 4Z6DA 1CJVA 2A1SA 2DPIA 4K25A 2W4PA 2B43A 4JI1F 2JLEA 4MTPA 2VBXA 3AVBA 2KIVA 3N4WA 4ILMA 2BPGA 2ZJPL 2DQNB 4CJWA 3K57A 2OJ3A 4DX5A 5GMKa 3TSUA 2MYFA 2YKMB 2Z56B 3KG4A 2DL0A 3AQFA 3RZAA 3HI9A 3KIOA 2D3ZA 4ZJOA 2BKEA 1ELOA 3NVYA 1NJIO 2OZMA 4BY9C 4XH4A 3MEGB 1J53A 1SJ4P 3PYFA 3O8WA 2KYXA 1K73T 2M9KA 2COLA 2ADCA 3FC9A 4TYAA 3MM5A 4DTJA 3V2UC 4JLHA 1C7YA 2VDIA 2DR9A 4PA1A 4V19J 2VBYA 1OYEA 2HBZB 4LR7A 4KHRA 4J37A 3CJRA 2JL9A 1VBYA 1X66A 3GMGA 5IT0A 3DGPB 4B3SF 1TELA 1E3MA 3T69A 4QZIA 4LF8J 4CZGA 3DV9A 3IG1A 3W3DA 3KHYA 4WF9L 2CPFA 1S6OA 3HHDA 4NLXA 7ICSA 1T03B 1VBZA 5GAEI 2CADA 4JI3K 5A6PA 2YWGA 4C0ZA 4RX6A 4XDDA 3ZETA 1NH8A 4NLGA 4OZ3A 4IXCA 5F0UA 1P27B 5ALKA 4PKDB 2LMRA 3RB0A 4K4VA 3W2WA 2CNLB 3IP0A 2E7XA 3BO3A 4LBIA 5AI4A 5F8JA 2MZQA 4MIBA 1CZAN 2AF6A 2MHNA 4F4KA 2GIFA 3HSTB 1J2MA 4RKUC 1RG6A 1S0NA 4BDZA 1L3VA 3OUYB 2YWFA 1OH5A 3DRSB 4GO5X 4EELA 5KGXA 4MLEA 1GK8A 1TR0A 3MPWA 3NUQA 2CPEA 1KQGB 5AKXA 1SS6A 3UM9A 5IV4A 3H6EA 4GKKF 2AYEA 3TADC 4B9TA 4F91B 3F73A 4F3TA 5BR8K 3R1XA 4B3RF 1K1SA 1KSPA 3OS0A 4DCHA 4IC9A 4DV7F 2QGFB 1RTJA 4E19A 3T79A 5HLFA 1XC3A 2MKIA 3GR0A 4K2XA 2AJ2A 4KTZA 2NXUA 1S5ZA 1U09A 4RL1A 1HKCA 3IKMA 2UUAF 4CJLA 3PYGA 5BPNA 4JN4A 3THXA 2GJFA 4CRXA 2ITGA 3TABA 3IC1A 4DV5F 4F67A 4CD1A 5D6GA 3AJDA 3E1YA 4FXDA 1PVRA 2CJYB 1FVSA 1HNZJ 3V1RA 2G2YA 1V3SA 2W9CB 3I96A 3ZO7A 4C8NA 4WQ5A 3QU2A 2KJ9A 2A2CA 2CNKB 4G1QB 2W9BB 5D78A 1RTHB 2PFNA 2FHOB 3HMJG 3KKRA 4OLPA 5J1EA 3ZDDA 4M3TA 1FERA 2C3PA 3ZDBA 1OPZA 1YKWA 1Q81T 3A8EA 4EI2A 4EZ6A 4A8XA 4ECYA 4B1VA 1ZQCA 4NLDA 2CZ4A 3DRXA 2EH9A 3Q86A 2FXUA 4EEKA 4MF8A 1XO0A 2XS5A 2J9CA 2EDUA 2WONA 4OD0A 1FKPA 2Y0SF 4PABA 5DRKA 3J7AN 2UUCF 1C4CA 4M95A 3ZCMA 1SXDA 3W5ZA 2VJUA 1VQPN 4JI3F 4KKOB 4NWBA 3H20A 3F9KA 3WQTA 2D69A 3KWIA 3QT5A 3MAAA 3KD3A 2B0GA 5IM0B 5JJBA 5ELZA 3D0GE 3QB0A 1B3TA 4XAKA 3R9LA 9ICHA 3GG1A 3RAXA 2YMQA 4IUFA 4MO5A 1JMTA 5KFAA 1JNRB 2QZ8A 2X3DA 4DU1A 3F53A 1S6PA 3SQ2A 5TISU 5GTIU 5DM6L 2ZH4A 4H0XB 4BACA 2L3MA 3R6LB 1FJGK 2PE8A 4CJ7A 2NYVA 4IOXA 1S1XA 4K5SA 3LVWA 3THYA 1N36F 5RUBA 3J81Y 3JAMY 4I68A 2KDOA 3VPZA 3C23A 3H2LA 4UB2A 1PO6A 2ZG6A 2F3JA 4OJPA 1P9QC 2EFOA 3WK8A 2F8LA 1ZQYA 4DR4F 1NXIA 1RTJB 2VIHA 3TJ8A 3CCRS 1BXNA 1TKXA 2B6AA 2ZIWA 2QT7A 5DGAA 4JYAK 3SQ4A 3UDEA 2YQEA 1I94K 1U8WA 7ICVA 3PACA 2MQNA 4FJGA 4NA3A 4EBDA 4CFCA 4CJTA 1I94J 2YKPA 1BPDA 1ZPVA 5AQVA 2VBZA 2JZ5A 4UOFA 3NOCA 4S0MA 3ZZZA 2NZTA 1ZETA 3WIUA 2ZZNA 1KOOA 1NGHA 2HK2A 3BS7A 5KFLA 4PG4A 3J81O 5J2KA 2FJBB 2PD1A 3BH7B 3JB9k 2FBYA 1ZPWX 2ZBCA 1X0FA 4J9UE 1PAEX 5A8RA 3O9SA 4P7VA 5T7LB 4PL2A 2Q2RA 5KPRA 1NK9A 3HD1A 4KH1B 4CEBA 2HFSA 2UVRA 8ICCA 2KKVA 2DTJA 4XPCA 3VESA 2YCHA 4M63C 1J5OA 4OX9K 4FVUA 3HULA 3OL6A 4JKFA 1U1NA 3MPVA 1ZBUA 3SMPA 2BE2B 3AA3A 3Q8PB 4CIOA 2KG5A 3S3MA 1ZQLA 4HVJA 3SBTA 1K8AT 2R7QA 3PO5A 2BTFA 3BBCA 2VA3A 1JLBA 1OH8A 1HR0K 4CO0A 1R8BA 3AD9C 2OHDA 3WNFA 2GC8A 3CJ5A 3VV2B 1MA9B 2V7YA 3CC2N 1WJ9A 2DNGA 4PQUA 4ECXA 3RFAA 1ZQHA 3CG7A 2M0NA 4DLGA 1C0TB 7ICGA 5KG4A 2KHQA 3E3XA 3A5LC 1UEKA 2WRMA 3I4PA 1V5IB 2IYGA 1W2BR 5AFUH 2H5EA 1XN9A 4WFZA 5KT7A 4C4TA 1D8ZA 4J91A 3BUZB 3PX4A 3UWTA 1SB6A 1PC4A 4Y6IA 1YBTA 3QERA 4P0QA 3L09A 3CM5A 4CO1A 1D9AA 3VF4A 3NGIA 1R7IA 2P6TA 2YNHB 3SCLE 3KJVB 2WHEA 3EGZA 5DQHA 2UU9F 1RHMB 4OI3A 4JKGB 3N4QA 2NRWA 5KFEA 3FBEA 3TOQA 1RBSA 4PQAA 4WIQA 3ZT0A 1D9FA 3C95A 1AZSA 2FMPA 3MN6A 4JI6F 2DHAA 4YHHF 4A5AA 5I3PA 2WONB 5CD4A 5BR8J 3FEXB 2UXDK 4P2SA 1TL1B 4C23A 4OV1A 2JNJA 4JKAA 2VFSA 4BG8A 4DV6K 3F5EA 2LEPA 2WB1F 4PHEA 4CJVA 3AQEA 4O0IA 1VQ9S 3TAMB 2G8WA 5FIIA 2Z2LA 4JI8F 5I3QA 2EZXA 2O8FA 3I1YA 5ALEA 2HK3A 2W9BA 2ZOMA 2G9OA 3NASA 2FJXA 1OQ6A 2K4HA 2NSBA 2BR0A 1M5KC 1MWKA 4J7CA 2QWPA 4A8OA 4WYWA 3HD2A 1IKWB 2VONA 2FI1A 4F72A 4KITB 3MN5A 2P5VA 4URGA 3GSDA 1X6IA 2RUGA 1Z4OA 1KTQA 3MEEA 5ADXH 2YX1A 2MKKA 4TU7A 3HOTA 1JLCA 2BUPA 5HRSA 4MKBA 4B3TK 1T03A 1RT6B 4B3TJ 3KK2A 1SI9A 4XA5A 2G2OA 1BCMA 3GZFA 2ZUCA 4ZVEA 2ZXIA 5EU7A 3SV3A 1PIEA 3L2RA 1QE1A 3D0IE 2AP1A 1NGDA 1RCHA 1WHYA 3OYCA 4PGYA 2XMAA 2WF8A 5D4BA 4NXNK 3DM2B 4ED8A 4JB8B 4M3YA 3D67A 1VQ5S 5FDLA 3I31A 1RWKB 1RQLA 2N4CA 3ZSRA 1QQCA 3K2YA 6AT1B 2LEAA 4NA1A 3R3LA 4YN3B 1YX2A 2RHSB 3V4IA 3D1HA 2DR5A 4I2GA 2WB1D 3CMES 1XNSA 1B70B 3FBFA 1S99A 1N32J 4ECZA 3MHYA 1ESVA 2P9PB 4CJ3A 4A48A 4OGEA 2O66A 3PW7A 4UASA 3OTOF 3TKAA 4TUSA 1NK4A 1GMVA 1U2RA 3FFKB 3K59A 5CQGA 3TO8A 1F6TA 2M8DB 3DHXA 2P9NB 4DHVA 1ZQZA 1YHQS 2Y1JA 4X64F 1HR0F 4QWBA 3QUTA 3H0MB 5EY4A 1BPYA 4IYQA 5IT9Y 5DQIA 1MWZA 3MDFA 3HDSA 4ZJLA 2HVEA 3B0XA 2GV1A 3W1YC 2GHPA 3ZD8A 1VQSA 2PMWA 1XR5A 2LSNA 2VFUA 3I0SB 4HLBA 4CZCA 4I2IA 4MK8A 1CJTB 3ZT4A 3MAAB 5DM7L 2V8PA 1W7AA 4FWLA 1LK5A 3CDEA 4MF2A 3SCIE 3O44A 3HPHA 3A8JA 3C16A 4PXCA 3UD4P 1SWVA 2UU9K 1N88A 2DR7A 1NH7A 2UVUA 3IBFB 2YXLA 3Q8UA 5D46A 3HZ6A 3BB5A 2B5JB 2X1AA 2VODA 1BG3A 3RR7A 1JLGA 3TA1A 3WNGA 2RT3A 4JK7A 2O4IA 3HFVA 4IQXA 3O8MA 5B8HA 2XHWA 4Y3CA 2Z1JA 4Y2YA 4FDFA 5HR7A 2V9WA 1S1TB 5HMXA 2UUBJ 4M5LA 1CJVB 4CZMA 4DPXA 1H2TZ 2KB2A 1I94F 3TUJC 4FJNA 1Q79A 3SCJE 3W3SA 1SB3C 3GFHA 4YOXA 5LL6d 2A3ZA 3R7BB 4I2FA 1KNZA 1U8SA 3MCNA 3BR9A 2D3DA 3SSRA 3VQAA 3NXZA 2CN1A 3A5MC 2P9SB 2W3RA 3AU2A 4DUZF 1NGJA 2ISOA 2VUGA 4M41A 2KSOB 5HN0A 4YQWA 3ZT3A 3QT8A 1FXDA 5E0OA 3SMVA 7ICOA 4ZK7M 4GKJK 3NDKA 1S22A 1L8LA 2P35A 2C3MA 3F2CA 1TTHB 2V7ZA 4P10A 4GKJF 1Q0NA 9ICPA 4LFAF 1RBTA 3V4IB 4DL0C 1L8OA 1RYUA 4PPXA 3VQ8A 2E1PA 1IKXB 1VQLN 3IG1B 2V4JB 4P4PA 1HWJA 1GLJO 2FJEB 1BVSA 2P9UA 2CJAA 4WE1B 4LIRA 2E66A 4CJFA 4DCPB 4U7BA 2J9DA 1LW2A 1S12A 2P9KB 1IO2A 1QM9A 4DMNA 1D09B 4CLYA 1R6YA 4CO3A 4DPUA 3NH1A 1VOMA 2XZWA 7ICUA 3OFHA 3X1LB 3SEOA 3SPZA 4C97A 2IIRA 3O1LA 1XI1A 4C7ZA 4DTXA 4QYRA 4KLIA 2XYGB 3PJ9A 3KK1B 2W6LA 5K4LA 4PXDA 3PCOB 3VENA 2AYGA 3L4QA 3KK1A 4UB3A 3FJ2A 4NMXA 1HRHA 4L73A 3PRBA 2V52B 3VQBA 4IO9L 1UT5A 5LXRA 2CXYA 3ILJA 1Z2ZA 3P1GA 1X9MA 4RBUA 1TL5A 1BD6A 2BE9B 4ZA1A 5AQNA 4HDHA 4RZRA 4DR2K 3DLLQ 3FC4A 3VF2A 1L7OA 4LSNA 5AQUA 1HX1A 1I5OB 3FQLA 3DI6B 3W7BA 4NL9C 4YMNA 2Z1IA 3O1BA 3BGRB 2GH1A 1VQPS 1VISA 2MKHA 2DPJA 1RT1B 4C2MA 2A1BA 3IS9B 1QZ5A 4X64K 2DXDA 4BVOA 4C0HA 5AQOA 4XH5A 3OTDA 2ZVSA 3BYPA 4M5HA 1NOYA 2Q3SA 3MECA 1W97L 1B4FA 3CO0P 1Q82O 4A46A 5J29A 4ZVOB 4WKRA 2P9SA 3ENOA 1C0UB 4HUEA 4YR0A 2ZFHA 1LCUA 2XEXA 2A1JB 4P0QB 4DSFA 2HBKA 4M45A 1JLFA 3EICA 1KLMA 1RA6A 2CG8A 1RBRA 1NNLA 3PIOL 2J7KA 2AWZA 4DS4A 1TK5A 1PYSB 1RKJA 3M6VA 1X42A 5D0RA 2MPUA 1ZQGA 1NGAA 1Z05A 4FJIA 5L46A 3OVNA 1ZQBA 4LSLA 1XS9D 3AA8A 5EWFA 2ZE2B 4JI6K 4NOHA 3D68A 2GGPA 1Z1ZA 1NK0A 4H4KA 1HI8A 2GGPB 4F92B 1HPZB 5M1NA 3QU9A 4TXSA 3SEIA 1QS4A 3WUHA 4TQRA 4DL5A 1QAIA 5C10A 1FNOA 5T41A 4MK7A 3N01A 1DKGD 3ZTSA 1OQ3A 3H4DA 3T1AA 5F8MA 1S1UB 3GV8B 2R7WA 2JRZA 1IVZA 1B99A 1YK9A 3PDNA 3MM8A 5HJYA 9ICJA 3HCXA 5AQXA 1F5BA 1FRXA 1WACA 3KFUF 4J90A 4OV6A 5D4LA 3TNVA 4WFBL 1UFKA 3M6WA 1Q5VA 2SXLA 1WHWA 4KJIA 2CZVC 1MROA 1N5YA 3UW1A 3QU4A 2DO0A 4OKKA 4BRDA 1AZSB 2DKOB 3LH2S 9ICKA 3RJKA 3WEEA 2KN4A 2C3YA 3KLIA 4H8KA 3T1HF 2HAIA 4OPKA 4B1ZA 4DV0K 2HPUA 3OA9A 2ZTCA 3SSSA 4CLWA 3CDAA 4JI5F 5EX5A 3MXIA 2G8VA 1RB0A 4DR5F 3GYXB 2WVFA 3GBTA 4JKEA 1UKUA 2NCKL 1OWXA 3HLUA 1MLAA 2FYXA 1QVGR 5HAOA 1XNQJ 1RSCA 4AXJA 3S6JA 1BHNA 2PIIA 5JVGQ 5JVHQ 4CIGA 2FMSA 3KNAA 5J2MA 5KOXA 1Z6RA 2H65B 3R7SB 4CBXA 3UDLA 2Z4PA 1HL6A 4FWKA 4LF5K 3NGRA 2BJ1A 2BA9A 5AJ3K 1N63A 2ACYA 1BUXA 2D6FC 4TY8A 1LWEA 3OR2B 2QO3A 2DNOA 3CI5A 3OY9A 1WF0A 2DR6A 3MTJA 2ZJ8A 1RTZA 1HJOA 3A8KA 1B9FA 3U7JA 3KMQA 4RQ8A 3VGMA 4CVNE 1C1AA 2VGNA 4E7IA 5GAHI 3AO3A 3ITHB 1XHZA 4ILRA 2ATQA 4DPWA 4F04B 5K8PA 2VG6A 3NRZA 1R0CB 3H40A 4IQTA 9ICMA 4O3QA 3ZNUA 1SJ1A 4A8EA 4AHCA 4OLAA 2A6OA 2GFFA 1CBKA 1S57A 3T6BA 2MXYA 2VJ5A 4ZLLA 3AA4A 5ALHA 3QPIA 1T44A 4X4RA 3MFIA 2FY1A 2HSZA 2B9YA 3ZSWA 3GFZA 3ZLJA 4W98A 4FOIA 3E9PA 1N5QA 1W7WA 3O5BA 1C0FA 1U1PA 2ZJQQ 3BQ2A 1VR6A 4EMDA 2LLZA 4DUYK 1RYRA 1KQSR 4OZNA 3W66A 3WK7A 1RHRB 3T3FA 1KC8T 2R8HA 1VBXA 4P2HA 4JB3A 3H2VE 1W2IA 5K8MA 4AL5A 4EFHA 2HGMA 2XHCA 1CULB 4FYDA 1R3NA 3FNNA 7AT1B 4DKWA 4UB8U 1TQLA 5I42A 3QGGA 4IOAL 5DETA 4JHDB 4PWDA 3SQGB 3LW5C 1FO4A 1KWMA 5A0LA 1IBCB 4DG1B 1ZOLA 1TV9A 4JI5K 3NVKA 3MMAA 2HOFA 4FJ8A 2U1AA 4GV9A 5AKIA 3H59A 2ZVIA 1Z4NA 5IC6B 3V9SA 1KD1O 3KOAA 1KRPA 1LKYB 2K4PA 1DLOA 1S9FA 3JSRA 1SC6A 3D2FA 4R25A 1IJJA 2F44A 4CF8A 1EARA 5AM3A 4F0HA 4I2EA 1MC8A 1GOBA 4US8A 3KUGA 5IZHA 1VJ5A 2PYJA 1YITS 1UJ4A 3M8WA 5KL1B 1SV4A 4CCHA 1OY8A 2D5RA 4E98A 3H8WA 2CQ3A 2QB0A 2J76E 8ICVA 1YZ6A 2RRBA 5EX3A 1UVJA 3MPYA 3MC1A 2IFXA 2Z2ZA 1IWAA 1QVFM 1H1VA 2HQIA 3G8TA 2RQ5A 5KFKA 2EW9A 1AYEA 3OL9A 4CJRA 4DFPA 4Z7YA 2HHWA 2GJIA 2Y9TA 4H03B 2ZH7A 4DV7K 2KRRA 4CGDA 4DR2F 1ZM9A 3C19A 4FZYA 3DWLA 4BQZA 1EKEA 4Q0BA 2GO7A 2KL8A 2XLJA 1B9DA 5AM5A 4PHAA 3V72A 1NM1A 1QUPA 1YIJN 4OI1A 1H7XA 2PXIA 3QU7A 5AZIB 1YGYA 3C6UB 3R2DJ 3QZ8A 4CNZA 3M6KA 2HI0A 1T95A 3WT0A 1HWLA 4P6QA 3E66A 5C7PA 5ALDA 3KHGA 2E1YA 1G7CB 3SBGA 4CDIA 4CIFA 4RLEA 4UBBA 3GFKB 1C6VA 5B0DA 4BRHA 2FPKA 1A5VA 3QT7A 3ALRA 2ERRA 5CB1A 4KHPJ 3C7NA 1KQQA 1JLFB 1WORA 1SJFA 5EN1A 2V34A 2R7UA 3MWBA 3VVUA 1VSFA 3R6MA 3CEDA 1BWFO 5GAGI 4DB3A 5LT5A 4DV5K 3HHLA 1S6QB 1HNXJ 1F3VA 2CJ9A 5KFRA 3J7YU 2PA3A 2ESEA 1GXUA 3A8YA 1S7HA 4YFKA 3V81B 5EOYA 1CQNA 2IHMA 1UFLA 3N7RC 2XY7A 2HRUA 3EE9A 2C1EB 2IVPA 1T9XA 3BSCA 5E2QA 3D1OA 4C8LA 2OTJS 4PJ0U 2ZH1A 3KLEA 1WF1A 5L38A 2YWWA 1L6NA 2EFVA 3EZUA 3GWCA 3S3OA 1EWQA 3T7ZA 3V5RA 3SNNA 1PILA 2E8MA 3G71S 1FDDA 3TZZA 9ICGA 3X3UA 5L8RC 4KH6A 1R6VA 2DNPA 1RDCA 4AILC 1HFEL 1I6JA 3R5BA 4DOZA 2IVYA 4A2AA 5C0YA 2NUHA 1XMQF 2DWQA 3RTVA 2M4MA 3JTOA 1B22A 4C48A 4JV1A 2ASJA 2Q6BA 5F2RA 2F9DA 2Y3YA 4YB1P 2DNRA 4KV8A 4PHTX 2P2CB 4DOCA 4ECUA 3BGLA 3GG0A 3AA9A 3V1OA 5E5NA 5DQGA 4W5NA 2W2OP 4OJ1A 1N34F 2KKZA 3AGKA 1SQFA 2K06A 2HHUA 5DO2A 5ALMA 2CH6A 1ZQ1C 3S1TA 3LTOA 3AJ2A 1F0MA 1TAUA 4IJNA 4RW4A 4OZ5A 2JH7A 3N5BA 3TX0A 5KQ8A 5GMEA 4I2QA 3TARA 4X4NA 4ZVQB 2GO9A 3LQVA 2EBEA 3DLHA 2OSQA 1FJ7A 2G07A 3GJTB 1W0HA 3P39A 3LDSA 2ZIXB 2DBBA 1NWKA 2B4UA 5SZTA 1KOHA 5F9NA 3L6QA 1GLCG 4DN0A 1K73O 4K43A 1TAMA 3VEXA 2NRHA 1V5VA 3QGHA 1NSAA 2G0JA 3ZSXA 3CTRA 1PVQA 3BDEA 4HCBA 4M1KA 4LRBA 4CBUA 4J2AA 3EPIA 3WHIA 2LI6A 9ICSA 4EK2A 3TJAA 3MABA 1MG7A 1CG2A 3K5LA 5AKJA 1QSSA 2ZIVB 4UBCA 2YKNA 2NZ4A 2W41A 4CZJA 5CE3A 4LZGA 2DFEA 4QWEA 3UKRB 1PCAA 2ILZA 2QA2A 4E7HA 4M42A 2F1IA 2CJQA 5HMMA 4CJUA 1ITPA 4H0TB 4WYLA 5KFHA 3J80O 1Q3UA 5JVHL 4FZLA 2C2NA 5LJ5Y 1WAFA 4MYTA 4RUBA 4MMOA 1NUEA 4PPZA 3ELHA 4DX7A 3UXPA 2HNDA 2LQJA 3QGIA 5LSOA 1BA0A 4K8XA 4YHHJ 2HVZA 5K8OA 3Q8SB 2UXBK 2UZAA 4NXNJ 1N52B 1V4TA 1FRKA 3CJCA 2Z0GA 1W26A 2AIRB 2QX0A 4CTAB 4M94A 2VQFF 2QFJA 3RJHA 2EBGA 2N1RA 1YUWA 4J9VA 4P7TA 2DHSA 2XRIA 4A8WA 1IKYA 3UO0A 3LDNA 8ICGA 2JEGA 4PGQA 1RLCL 3W60A 4A8MP 3OYHA 4CHPA 5IC4B 4Y2VA 2X1GA 2W7AA 2QB1A 3ULHA 4FM2A 3K1ZA 1VC0A 4KH5A 5ALSA 2QL5B 1H98A 3MCOA 3QNWB 5G0RB 2IJRA 4DV0J 3RBXA 1WLJA 3U8XA 3ISBA 2YMMA 9ICQA 3MOJB 5CZVA 1T3VA 4BVPA 4LD0A 3OW2M 5SWMA 4LMZA 1YLXA 1FRLA 2LMIA 3EZWA 3DM2A 2WAQF 1N0VC 5IWAK 2H51B 4W90B 1KBUA 3TX8A 3HP9A 4B9UA 3UN5A 5J0RA 4R8UB 3VEVA 1HJPA 4O5CA 1RWPB 2BOAA 1OSDA 4YCXA 3NE6A 1WBDA 3AVMA 4DQQA 4B3OB 3PKMA 2L9NA 3WIVA 2LQBA 3LP0B 2WFBA 2W9CA 3PJWA 4K4UA 4DR6K 3HHKA 3CFPA 4LFBK 1SKWA 4DR6J 4AHSA 4NLPA 3GR1A 4CNYA 2IDLA 1NZ8A 1QQ6A 5HP4A 4FWQA 1UVKA 3IFRA 2HHHF 1KFTA 2PZSA 3CJTA 1QQOA 2GWSA 1HNZK 2HHVA 3PIOQ 2WC9A 1YJNS 4Y2PA 2UXCF 2W9AA 3V4MA 5KFDA 4J2EA 3U6FA 1N2XA 2PFOA 1UEUA 4P72A 2QN6B 5K14B 3T41A 1VQMN 5HQMA 1CPZA 5GAEU 3VCDA 1DGSA 1J97A 4NPOA 4PYDA 3IXQA 2BABA 3QRPA 9ICAA 5HRPA 2V4JA 4JI4F 3ET6B 4BC7A 5BREA 1UT8A 4LJXA 1N34K 5E26A 2XMTA 3NMAA 3M2RB 1G6BA 5GAEP 3C2MA 3NY0A 5DDPC 3NAEA 2IMWP 2AKWB 3HKZC 4OL8A 1T02A 1XQIA 4ITSA 3VGUA 4UOCA 4FW1A 2IMOA 1S1UA 4CT8A 1N4LA 3R7NB 1ZQPA 5AICA 4LH5A 4E3SA 1CSJA 8ICKA 4QZAA 2YNFB 5M1KA 5E3AA 1WNEA 1UP1A 2CQPA 4FK0A 5ETSA 5KG2A 2BW7A 3CJ2A 3NEKA 1COKA 3KJVA 4J2BA 4C7QA 4QNLA 2BRKA 4YDDB 3QINA 1HWKA 4FJHA 3N7SC 2AJFE 3SQ1A 1UHUA 4RW9B 4CFDA 4FZVA 1JQGA 3MEEB 4J9LA 4TLQA 3ID8A 2E2NA 5ETTA 2RKIA 5KQDA 4C4WA 4P9SA 2DGXA 1Q86T 2AGQA 3VQ9A 1ASVA 1IKXA 4CLKA 2H3IA 5LJVA 3T1HJ 4ZVPB 2EZYA 2P9UB 2DNHA 4ZPDA 3HSCA 2R7SA 4MH8A 1IXRA 2LM1A 2KRBA 2NPIA 2XO6A 1TKXB 2B6AB 3TP2A 1U2VA 4JD2B 4F4WA 1EQYA 4I6MA 5FLXO 1U48A 3W65A 2GWKA 3U02A 5DB7A 2BQRA 3M2UB 1OUQA 4USVA 2CQ0A 3V6DA 3H0RB 2X78A 3IM8A 3MECB 3JYTB 4ISGA 3RH6A 5H9FK 4ZCMA 1K47A 2V2KA 1BDGA 1J9AA 2M7SA 4CTAA 3RJFA 4WPAA 4C7YA 5T7LA 4Y2CA 3M8QB 4ZVUB 5DGBA 1NZAA 4OI0A 2KK0A 2KP7A 9ICOA 1WC4A 2GWJA 3QIDA 1C0GA 2K7JA 5L39A 3J7ZT 3CDBA 2AX0A 1TMJA 4OZJA 2ZZMA 4YEAA 3WQPA 1XR6A 4LFAJ 1Q7YO 1NNDA 2HHTA 5BRHA 3FMWA 4LVOP 1SUQB 4IR1A 1X1PA 1BISA 2EC0A 2F4VF 2GQCA 3EKSA 2KU7A 4ANCA 4X66F 4E7KA 1I3OB 2GS8A 4Y2XA 1G99A 5ETKA 3UQ0A 1PK1A 4LF8K 4FWPA 2E5JA 1KEKA 3LPTA 3H0LB 5FRMA 5HMYA 2ZJ5A 5KFYA 4C4SA 3EXCX 1S6PB 1XMQK 1WEXA 5HJXA 3G86A 5A6WA 2V63A 5L9XA 1FTCA 4QYZK 4KPCA 2QMXA 3NVVA 4BDYA 4NY8A 1YJWS 3R5JB 2X51A 1Q9XA 3K5NA 5ALFA 1YQHA 1HYVA 2N3LA 4P73A 2ZH6A 1HBNB 2OPQB 1SC4B 2IM1A 2AGOA 4Y0WA 2AQ4A 4K0KF 4FVMA 8ICZA 4M8LA 2ZNZA 3P45B 3L4BC 5HQ8A 5EUHA 1IBKJ 4QPTA 3MD3A 1VLBA 1MA7A 1WSRA 4CI6A 3OYGA 3UMCA 4FPRA 1ZC6A 4AL6A 3MZIA 2QEXS 5F0XA 3MAQA 1VQ7S 5AK6A 4ZS6A 1NB2A 1ZOTA 4IO1A 3QESA 2XBPA 1AXQA 1XTZA 4PUOA 3AO1A 4NXZA 1K9MT 3VF6A 1S4EA 1XEZA 4DV1F 4WK3A 3RMCA 4OJHA 1IN0A 2ZHOA 1NPKA 5K8NA 1SBRA 3TAFA 3NNHA 3TTFA 1Z25A 4FZZA 4KGZB 3IMXA 1KTVA 1YT3A 1DAXA 1LWEB 3M8QA 3K2PA 4DPOA 4ZVSB 1X2IA 2FPLA 3AAQA 1IM6A 1YRTA 2HBMA 4O4RA 4KHNA 2XC9A 1CJUB 2DFFA 1GTHA 1GX6A 8ICSA 4J03A 3CCJN 4Q45A 4JK8A 1ZQXA 3M5RA 2LQ5A 2B8PA 4MDAA 4BR2A 2BM0A 3MX5A 1SUQA 2FGOA 3F0NA 4BE2A 3MM6A 3WNEA 3C1ZA 3NHGA 4NEYA 4RWTA 2Y9UA 1FFGB 2IRYA 3B78A 2M88A 3ISZA 5F0WA 2NNWA 4E1JA 3T9NA 4NLCA 3M2UA 3CNHA 4I6WA 5HOOA 4KO0B 2QA4S 3KDNA 4OVLA 4IEEA 4US9A 2E5LF 3EDRB 3JPQA 4I2DA 2MQMA 5D4NA 1X60A 2FZGB 4ZHRA 1D8YA 3WXMB 3CD5A 4JI7K 1U26A 4KLDA 2WAQD 4CE6A 5E84A 2XMMA 1ICEB 3MEDA 2I1QA 3IRWP 3BF4A 1HHTP 1W9HA 3H25A 2IS3A 3TANA 4ELTA 3VGVA 3HVRA 4BRPA 3FK4A 3DEEA 2J9EA 4KBOA 2ZBQA 3BM7A 5B0CA 1S49A 1NMEB 4OX7A 5JU5A 4NX9A 4BLGA 3BF1A 1GTEA 1XU4A 2UUWA 3NS7B 3PW5A 4XRHA 4JD2A 2OM6A 3N4MB 2QWMA 4KQZA 4H5TA 2MUTA 3CCJS 3DHWC 3M9MB 3RGIA 4BRGA 2LEBA 4L8RB 3O3LA 4NYFA 2NRVA 1GAOA 4E0DA 4ZITA 3RMDA 4BXOB 3F5AA 4DFMA 1TUUA 2GAGC 5MAOA 2ZTDA 4DSKA 1AA1B 4WFYA 1RTHA 1BNPA 2P9IB 4FKYA 4IDHA 1H0HB 4K0KJ 2JHDA 1NHKL 2P9IA 1XNRF 3LPYA 3TSPA 4WP8A 2GQ2A 1RGVA 3TA0A 5G0RA 3H1QA 1J5OB 4UAYA 3OYDA 3FM9A 2FE9A 1RU1A 5CABA 3QEXA 3WXIA 1NLKL 4CIEA 1C1BA 3CXCM 3HJFA 2DNKA 3F41A 3AVCA 3T5LA 4LF2A 3ETLA 5IQ6A 3OTOJ 4PZNA 4K4YA 3C6TB 2R7OA 4EUVA 3CMAN 1OXJA 3N4PA 3D6FB 1R8CA 3C6HA 1HPZA 1VYAA 3LF0A 1U1OA 5KG0A