2HVHA

Ddctp:o6meg pair in the polymerase active site (0 position)
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'
total genus 191
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hvhA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hvhA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hvhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hvhA01
2J6UA 4DL3A 4QZIA 9ICVA 3ZDBA 3HJFA 4GC7A 2ZUCA 3KJVA 5KFHA 2IC3A 2UVVA 3VQCA 1JLCA 3K5LA 4RPYA 2YHAA 2XC9A 5KFOA 3ALYA 3NF6A 3KHLA 3OY9A 4JV1A 4DF4A 4Q8EA 2RF2A 2YNGA 1CZBA 3BJYA 4O55A 3P5JA 4O5EA 1J5OA 5KT2A 4JLHA 4DSLA 4CJPA 4CERA 5KFKA 3SYZA 5DBAA 4C8LA 3HO1A 4YNQA 4LH4A 4JV0A 3THVA 4NYNA 2LYHA 3HP6A 1J54A 4JRQA 3B0XA 5KG4A 3HX0A 1RPLA 5KFBA 4KLTA 3L2RA 4YN4A 4YG2A 1XSNA 3OYEA 2FLNA 1X9WA 4F50A 4HTUA 3MBYA 4E7HA 3RRHA 1ZJNA 3S3MA 2VANA 4PUOA 3SQ2A 2P6RA 3KK2A 2GWSA 4NY8A 4F2SA 5FROA 4LVSA 3QNNA 8ICXA 1JX4A 2HMIA 3DOKA 4K8XA 7ICEA 4YMMA 1RBVA 2G8VA 4NM1A 4HVJA 3MAQA 4QAGA 2A1RA 4J9RA 3Q8KA 4F5RA 2ISOA 3M9MB 2KZZA 5DBBA 3DLBA 3SQ0A 3ZSQA 9ICQA 5DK5A 1Q9XA 3NTUA 2J6TA 5HMMA 7ICPA 3AA3A 4NLNA 1UAXA 3GDXA 5HRRA 5D49A 1QQCA 3TAEA 3OYFA 1RT5A 2P5GA 4XA5A 1EKEA 1ZQTA 9ICFA 3RBEA 1G15A 1NJYA 2KFZA 1KFSA 3MFIA 2P1JA 5KGWA 4FJLA 3TAQA 1BIUA 3FYHA 4NXZA 4GLXA 2P6UA 3U3YA 4CHPA 3B6PA 4FXDA 4EP5A 3TABA 4K4GA 4CHQA 2DY4A 2YNIA 4I2JA 3MGIA 5J2BA 4L8RB 3Q8MA 3OYBA 3DMJA 8ICHA 3KLEA 2ZQBA 4OGCA 3KHHA 1VSLA 3CFOA 4CEDA 2DPIA 1NK0A 4F4XA 3PO5A 3OS1A 4CEOA 2H5XA 5J0SA 5DLGA 4TUPA 4R64A 9ICGA 4LSLA 3QZ7A 2VG5A 4J9LA 4AHCA 5IIMA 4DMNA 3RAXA 1RT2A 5KRTA 1VSJA 1KVBA 1CLQA 3LDSA 5J0RA 3OJUA 1EXNA 1S10A 2GUIA 1SZPA 3BQ1A 5HRNA 5J0TA 4CJ4A 3AVFA 9ICOA 5I42A 2FBYA 2W8KA 1WAFA 1S77D 3RAQA 2OWOA 4Z6CA 4DFPA 1KSPA 2FBVA 4J2DA 3PV8A 1X9SA 4F3OA 4IFVA 3QO9A 4KLGA 1TL3A 1HNIA 3OYNA 3ZT0A 5KG7A 4KB1A 2YHBA 4M9GA 1XO1A 4YVZA 3ZD8A 8ICUA 2D0BA 3K58A 4ED8A 1BVSA 3G10A 1QS4A 8ICGA 2YKNA 4J2EA 1BQMA 1S1UA 2JZBB 5DMRA 5J0PA 1VSKA 1JLEA 1N5YA 3LAKA 2A1SA 1EXQA 4BXOA 4OKKA 3NDKA 4QZFA 2IHMA 1ZQQA 4ECRA 3JSMA 3QEWA 1U47A 2RDJA 5KFPA 4KV8A 1RZTA 4CECA 3N97B 2R7YA 3QEPA 1TVAA 3TI0A 1L3SA 2HW3A 1HYZA 5J2AA 4B8CA 1WSIA 4QZ9A 2GV9A 1ZQNA 1S0MA 3V7KA 3QIOA 1XS9D 1RT6A 2YKMA 3SPZA 4KN7A 2BANA 1S0OA 3O4QA 3NGYA 1VSMA 4ED6A 4AHTA 3DM2A 3MR2A 4KAZA 5CYMA 4EBDA 4QZGA 4M2YA 4F2RA 1S97A 5J2HA 4M3TA 2JGUA 4OKEA 5KFDA 2F1IA 3DLEA 3AVNA 4FJ7A 3H4BA 3LPUA 2BCRA 2P5OA 3ZSWA 4DTOA 2ATLA 5J2FA 1W9HA 3SI8A 4FZYA 3JPNA 8ICBA 1JLFA 1TK8A 5DDYA 1D9DA 3RJJA 4QZBA 2BDPA 1KLMA 4AHVA 5IILA 3H8SA 4ID1A 3ZDAA 5HNKA 2RN2A 5KFCA 1CXQA 1HQEA 3QINA 4KI6A 3HYFA 5CZ2A 1HPZA 2VA3A 4N76A 4R66A 4Z0UA 4CF9A 4E7JA 4FS2A 4DOBA 5EU7A 4M3ZA 5D4BA 4O5CA 4RQ8A 4IRKA 1IKXA 4FJMA 3ISNC 1DLOA 4NM2A 3T5HA 4O3NA 3GV7B 1SKWA 3NH2A 1GOAA 3MR3A 4UAZA 2I1QA 8ICTA 5J0UA 4QWDA 3KHRA 2Y1IA 1S9FA 1Z00B 3VN5A 5KG2A 3PW7A 3GV5B 2XY5A 5K14A 4M9JA 3NH0A 2AGQA 3M8RA 1FKPA 1TKXA 5EWEA 2ZJ5A 2WONA 2X78A 1U04A 5KFVA 1FXXA 2PFPA 4DO9A 2FMSA 4CJEA 4UB5A 4YMOA 3RB0A 3HP9A 3CG7A 4I2CA 3V6HA 5J29A 3V9WA 3C2KA 1C0TA 4PHAA 1SKRA 4Q0BA 4QZAA 1YTAA 3DI6A 2IAJA 2FPLA 3SQ4A 1T05A 3RH5A 2FBXA 4XQ8A 3RBDA 3V4IA 4FJGA 3E2EA 3ZT3A 1JL2A 4KHSA 2ZJAA 5DBCA 1ZQDA 4E3SA 4Q45A 4MEXA 4CGIA 4ECSA 3SV3A 4N47A 4M3XA 3TAMA 3EYZA 4CFBA 4Q44A 4P4MA 5CY4A 2F8SA 1KLNA 4CEAA 4E7KA 4KPYA 4HHTA 4O3RA 4H8KA 1HYVA 3P83D 4RUAA 3ZSVA 4RW8A 4CJ3A 4F5QA 4CK2A 2OPSA 3VQEA 1TKDA 3T5JA 1U45A 4B9MA 4RZRA 3M9NB 4BDYA 5DQIA 4AHSA 4LD0A 1W0HA 1JXEA 3RB3A 4Z4IA 3QEIA 2XY8A 3MR5A 1KFDA 1J9AA 1NK9A 3O3FA 1V9PA 5KFLA 1JLBA 4NYFA 1S6QA 3O3HA 3OHBA 5JUMA 1TAUA 9ICRA 1HJPA 2Y1JA 2QKKA 8ICRA 2ITGA 1MC8A 4PHEA 4FVMA 2IDOA 4JS5A 2BQ3A 5KFIA 1S1VA 4DL5A 4RW6A 1EX4A 3H40A 4JRPA 1ZQJA 3Q8SB 4LH5A 5BPCA 2HNZA 3DLKA 2MUTB 4IG3A 4YR0A 4FK4A 2E6LA 3F73A 4CEBA 5J0YA 4ID5A 3VQAA 4KTZA 2PI4A 4IG0A 1JXBA 2ASJA 3SUQA 4O5KA 3NF8A 3OHAA 3VQ7A 4P4PA 5L1IA 1ITGA 3PVXA 4ED0A 2HHTA 1ZQFA 7ICTA 4KTWA 1MU2A 5CWRA 4GXJA 3T3FA 1BQNA 1TV9A 1LW2A 5J2DA 4WE1A 1WCLA 3EPGA 5KG5A 8ICYA 1LWFA 4KLDA 1Z3EB 3MECA 3QZ8A 3JPPA 3PW5A 2AJQA 4KLEA 2KW4A 4IDKA 2W9BA 3T5KA 2F96A 1MQ2A 1WCNA 7ICMA 1AROP 1Y88A 4MF8A 1ZQUA 5J2IA 9ICKA 1FK9A 4YFKA 3DLGA 4IR9A 1EETA 1TFRA 2BR0A 5CZ1A 2BCUA 4PQUA 4MFAA 1RT3A 4KHWA 3G6VA 3TFSA 4GMJB 5L1JA 3CFRA 3VQ5A 4UBBA 4K4IA 4CCHA 2HNYA 4EYIB 3VQPA 2YV0X 1ZQZA 3KHGA 3CM5A 1S0VA 2DFHA 2V4QA 2Z1IA 4RQ2A 4PWDA 1T4GA 2QXFA 1NKBA 3TAGA 4RQ0A 1QLNA 1C7YA 1BI4A 1YT3A 5IIJA 4I2PA 3NF9A 5DG9A 3AVKA 4DTRA 1KVAA 1PZNA 5KFJA 3RJGA 3UXPA 5KI6A 5HLFA 4MF2A 3H8WA 4DOAA 1C1AA 4ECUA 3Q8QB 3TARA 2G8IA 4CHOA 1VSEA 4QZDA 1YVUA 4FK2A 3ZDDA 1ZQMA 3E01A 4RUCA 3TAFA 4Z4HA 2F1HA 1Z25A 4DG1A 4ECVA 3C5FA 4J9OA 3GFKB 2ZJ8A 1C0UA 3KKRA 3PMNA 3HL8A 3G6XA 4GC6A 1RILA 3ZDEA 4M3UA 1ZETA 3AVJA 4KLMA 3LP1A 2G8UA 3ZT1A 1L5UA 1N6QA 4QCLA 3OYMA 1NK7A 2XHBA 4MEYA 4I2GA 1ASWA 3VQBA 2W9BB 4RQ6A 1BPDA 3OJSA 2X6SA 4B08A 4RG8A 3V72A 3O4NA 4CJQA 3K57A 2DFFA 2W9CB 3RJKA 4JS4A 3CYMA 1ZBHA 2C28A 4FJXA 4M04A 5KFNA 2W9AA 2HB5A 4ECZA 3RJFA 2NRZA 4O0IA 4W5NA 4KN4A 4HCCA 5CYQA 4QZCA 3ZCMA 3A2FA 4QZ8A 4DU3A 4C8OA 3V7LA 2FBTA 2PYLA 2BHNA 1T7PA 3JYTA 2KZMA 2IA6A 1BL3A 1BPBA 5IIOA 1J53A 1S6PA 1JN3A 7ICLA 3NFAA 5F9NA 3MEEA 4HUEA 4M45A 3DRRA 3AVGA 4ED1A 4RPZA 4F92B 5DG8A 8ICIA 4Q5VA 2ZTEA 4NLGA 1A5XA 2JEJA 2B5JA 4CIEA 3C2MA 2PFQA 4M47A 4EBCA 4DSFA 3P1GA 5KFEA 4FJIA 5J2MA 2DPJA 4YR2A 5CA7A 4DTMA 2QK9A 1JIHA 3NE6A 4RT3A 4FLTA 1YTUA 3VA0A 1NJZA 4IFYA 3MEDA 4I7FA 4PGQA 4BDZA 2DFEA 1KFTA 1XU4A 4CGHA 2BGWA 2V9WA 5HP4A 3ZDCA 2NRXA 4PY5A 5SWMA 1HNVA 1WN7A 2B4JA 2OPRA 2VWJA 4FZXC 5C5JA 3WNGA 4IRCA 3RWUA 2KQ2A 1SL0A 4DSIA 1H38A 9ICWA 1BGXT 3HPOA 9ICHA 4PH5A 1ZQBA 2HVIA 4OVLA 4DL2A 3C1YA 1HYSA 2GBZA 5EWGA 5CP2A 4CIFA 5J0QA 4CHZA 3D45A 2BCVA 4QWAA 2PYJA 5DB9A 4YD1A 2R8GA 1DTQA 1UA1A 3OYGA 8ICFA 4FJ5A 2VA2A 3K5NA 1BPYA 4CJTA 4M0AA 1XC9A 4I27A 3L2QA 3ZSZA 1K6YA 4DSJA 4IQUA 4O0JA 4DS5A 1RYSA 5HBMA 4F8RA 4ZTJA 1NOYA 2ZE2A 4I2EA 3L3VA 2ZTDA 3T19A 1RTDA 3B0YA 1UOCA 3MXIA 1ZBUA 1X2IA 4J9QA 3PX6A 4J9MA 1HJRA 1UA0A 1I3AA 4FBUA 7ICKA 1TKTA 4CJKA 4TQSA 4RNMA 3QIPA 1MQ3A 4BE2A 3DRPA 5IINA 4BACA 4F91B 3KD1E 2XO7A 2AQ4A 8ICNA 1DTTA 3OYDA 1UT8A 1ZQKA 1WSFA 9ICTA 3CM6A 4CF0A 4MFFA 1RDAA 1A76A 3IG1A 3ORYA 4I2DA 2R8KA 1RBSA 1ZQEA 1RXVA 2HHVA 1UWBA 3D0PA 1IKVA 3LZIA 2G8FA 3V1RA 1RTIA 4RT2A 3O3GA 4O3PA 5DKWA 5FRNA 1QE1A 3TAPA 1B92A 5IIIA 4B9SA 3VQ4A 2MUTA 4KITB 2D5RA 3RR7A 4RQ4A 3VQDA 3DOLA 3AVIA 3PX0A 3FDSA 4FW1A 4Z4CA 7ICFA 9ICUA 1BPZA 5E41A 5JS2A 3KK3A 1ZQHA 4OPKA 4DLGA 2HHSA 3PW2A 5KFSA 4M9LA 4RW4A 1XSPA 3S3OA 3GIMA 2UVUA 2AGPA 4QZEA 7ICNA 4CEEA 4O4GA 4CESA 4YFUA 4NCBA 4G3IA 4EP4A 1JMSA 4NCAA 4DL4A 5J2EA 3NF7A 3V6KA 1CXUA 1LWEA 3RB6A 4DQPA 5KFXA 4F93B 2NRWA 4F4WA 2OPQA 1LAWA 4PGYA 2XRIA 3UIQA 5KFTA 5KG0A 1GOBA 1LW0A 2C2EA 2BQUA 5L1LA 5DQHA 5J1EA 4AH9A 3G6YA 4UAWA 4KLSA 4DTNA 4ICLA 3WNEA 1XHZA 3LP0A 4O44A 1S5JA 1IG9A 1QSLA 4FM0A 3ZD9A 3IM1A 2ETJA 4YXMA 1UT5A 3AVLA 2JLEA 1Z26A 3M8SA 1TAQA 3PY8A 3LDAA 5J2KA 2BPCA 8ICZA 8ICSA 3IAYA 3DYAA 5I3UA 4F5OA 9ICLA 3RMCA 3PR5B 4I2FA 4KLLA 2WOMA 1CZ9A 7ICOA 4DTXA 2XGPA 4FJHA 4MQ3A 1RBRA 3AO1A 5DLFA 5L1KA 4C8NA 3SZ2A 1HUOA 4K8ZA 1HRHA 3N4MB 3SPYA 4M3YA 4LZGA 4Z4EA 1XSLA 2NRVA 1RXWA 3L3UA 3PO4A 3U3GA 4KREA 4FJNA 2W42A 3NCIA 2F1JA 3MXJA 3UXNA 4C8KA 3RH6A 3AU2A 4KLUA 3KLGA 4CJ5A 3ULDA 8ICMA 3AA5X 3TR8A 9ICBA 3ITHA 1BIZA 3C2LA 3S9HA 1D8YA 3ASMA 1JLQA 3KKSA 5KFMA 4ZTFA 2D0CA 1NJWA 3M8QA 4KFBA 4CF2A 4RQ1A 3MFHA 3WNHA 3V7JA 2W8LA 2A1JA 3G0ZA 3JPTA 2ZTCA 3AVAA 4QOZB 3LWLA 1RYRA 8ICEA 3OYKA 4J2AA 5BOLA 1QTMA 3OYHA 1KTQA 4AHUA 4I9LA 3JPQA 3OSNA 3MR6A 1L3TA 4FLWA 4O9MA 4N5SA 4KLFA 3SUPA 4PGXA 1WSEA 3C6UA 4F4YA 3VQQA 3K5MA 1RTJA 5J2NA 3VQ8A 2AQ0A 1NJXA 4K4HA 2JEGA 1ZBFA 4KHNA 3NGDA 4IBNA 1ZQRA 2FMQA 5C25A 2E6MA 4ZH4A 3BDPA 2FPKA 2NUBA 4CJRA 3H8JA 5DGAA 4FJ9A 4P2HA 4YXJA 3NGZA 2PI5A 3LWMA 4ED2A 1NK8A 3AA2A 3L2VA 5HROA 4B9TA 2OZSA 3Q8PB 4CJLA 4E7LA 5EOZA 1BCMA 4E19A 4IKFA 4FS1A 3AVHA 3RJHA 1X1PA 3MDCA 4QW8A 4TQRA 5KFZA 4DFKA 1JL1A 3ZSRA 4CJSA 4KHYA 4FO6A 4ELTA 4KLJA 3QERA 2HHUA 3QLHA 4DLEA 3V1QA 5C24A 4KB0A 1ZQOA 3MGHA 3C94A 5HMLA 4CJFA 3K75D 4CFAA 4PPXA 3ZT4A 4HUGA 3LK9A 3NAEA 4HUFA 3T5LA 4XRHA 1C1BA 3ZSOA 9ICNA 4QWCA 3VA3A 2LSNA 4UQGA 1ASUA 1S1WA 3SCXA 4GW6A 4UB3A 2ASLA 4AHRA 3KLIA 3GILA 3K59A 4IQTA 3H08A 4CIGA 1ZQGA 2R8JA 3RH4A 2KFNA 4OJRA 4CEQA 5KT6A 4DU1A 4CFCA 3L2WA 4M42A 1ZQSA 2OYQA 3QEAZ 3EWAA 3IS9A 4RW9A 4B9NA 1BI4B 4PA1A 2XGQA 9ICAA 8ICWA 1TK0A 1D9FA 4TUQA 2J6SA 2ALZA 3PW0A 3OYCA 5DB7A 4PHDA 3HK2A 1HUZA 1REVA 4KHUA 4CGDA 3SQ1A 2BPGA 1K1SA 3HPHA 2XCPA 1ASVA 3C23A 2BQRA 8ICKA 5HRSA 1VSIA 3HVRA 4YR3A 4FLUA 4RQ5A 4M9NA 4CGJA 1T03A 4ED3A 3BQ2A 2ATQA 3I8DA 3H7IA 2YNHA 7ICJA 2OA8A 4Z6DA 3QEBZ 3OYAA 4UB1A 4KHQA 3ZSXA 1VRUA 1KCFA 1A5WA 1TVRA 1BPXA 3SJJA 2IMWP 3GQCA 3HT3A 3V6DA 1IXRA 4EZ6A 2VG6A 4J2BA 2OZMA 3U6FA 2HNDA 3V9SA 4E7IA 3V9XA 1ZQIA 5J2JA 1KDHA 4J9PA 2R8HA 3SV4A 4BE1A 4M41A 5CHGA 3LAMA 2Z1HA 1ZBLA 1CEZA 5D3GA 3VQ9A 4ECXA 1L3VA 4RNOA 3NBPA 4RW7A 4R8UB 1TV6A 2P51A 1U49A 2F8TA 4LSNA 1A77A 4R65A 1VSHA 7ICRA 5DGBA 3KTQA 2B6AA 4M6WB 4FZZA 1WNSA 4CGGA 1JXLA 4H4MA 1FKOA 4TURA 4W5QA 3RRGA 4F5NA 4ECQA 3V81A 1SL2A 1RDDA 1RT7A 2ZUDA 4YMNA 4EBEA 4O3QA 2C2DA 1N56A 3V1OA 4I2AA 5HRPA 1L3UA 1KEJA 3OVNA 3GIIA 4DFJA 1WLJA 3QETA 3LZJA 1Y97A 4OPJA 2XY6A 4JV2A 1WAJA 3MEGA 4X5VA 1RNHA 1TL1A 3LANA 3UPQA 4BE0A 3AA4A 4YQWA 4KLQA 8ICPA 3NH1A 3AO5A 1ZJMA 4E0DA 4ECYA 4I2BA 4DS4A 4O3SA 1LB2B 9ICEA 4KI4A 4H4OA 1WSHA 4EZ9A 4IRDA 3GIJA 1K1QA 2I5JA 1JKHA 4NLZA 4E1MA 4CFDA 1B43A 4KLIA 4Z6FA 4LY7A 2EX3A 5KTQA 1U4BA 3K4GA 3C21A 3Q8RB 1T8EA 4Q43A 5KFRA 3JPOA 1SL1A 1NK5A 1T3NA 1EP4A 1TK5A 2FPMA 4YD2A 2D0AA 4QW9A 4M9HA 2FC0A 4J9KA 1KVCA 4CK1A 1VK0A 1NKCA 4GVMA 2HHQA 4FJ8A 4DQSA 4F3TA 4CE9A 5FDLA 3OYIA 3C5GA 3EZ5A 3B6OA 2UVWA 3QEXA 1I39A 2ISPA 1WSGA 1U48A 4KRFA 4MFCA 3ISBA 9ICXA 4KLHA 4CF8A 4W5OA 4E89A 3SI6A 2I9GA 3HSTB 1IKYA 3AO4A 1ZBIA 4DL7A 5DQGA 3ISCA 2NRTA 1IO2A 4RNNA 4FYDA 2AU0A 2PXIA 3RB4A 4JUZA 4ELVA 5KT3A 5KT4A 1NKEA 3OYJA 3EY1A 3KK1A 9ICPA 3ZT2A 1QHTA 4KKOA 3ETLA 4M6WA 1XWLA 3KLHA 7ICQA 3HW8A 4P4OA 4CGFA 3PMLA 4EEYA 2X6NA 4R8UA 4KTQA 3RTVA 8ICQA 1B9DA 3FFIA 4DF8A 8ICLA 1RT4A 1XHXA 2AGOA 2R8IA 4DQIA 4BGDA 1A5VA 3LP2A 3MXMA 3C6TA 1TKZA 2Z1JA 4J9SA 8ICJA 2G8HA 3L2UA 3MABA 4C8MA 3V6JA 1S1TA 3AO2A 4DTPA 2PY5A 5KT5A 4DQRA 5KG1A 1GOCA 3RMBA 4IQWA 5HHIA 3EPIA 4Z4GA 4EYHB 2XY7A 5KT7A 1QSYA 9ICSA 3PUFA 4OLAA 7ICGA 3C1ZA 1RDCA 5F9LA 5BOMA 5KFAA 4CEZA 1LWCA 3SUOA 2JEIA 2E4LA 4NLKA 4ZHRA 1X9MA 2BGGA 1RBUA 3I0RA 1ZQLA 4Z4FA 4DFMA 4OKJA 1S0NA 3AUOA 1Z00A 1F21A 4FJJA 3VQ6A 1IKWA 5KFUA 1D5AA 1RDBA 9ICIA 5KG3A 2A1JB 2BCQA 8ICVA 3V9UA 4DSKA 4BXOB 1HQUA 3SNNA 2BCSA 1NK6A 3KIOA 3K5OA 3PR4A 3C95A 4PHPA 5T7BA 2RDIA 4RPXA 3UXOA 1N48A 3F9KA 3QNOA 2ASDA 2QKBA 2G8WA 4GXKA 4B8AB 5DDMA 5KRSA 4ELUA 3DLRA 1Q8IA 2KZ3A 3BQ0A 4NCGA 4UAYA 1DGSA 5TZVA 4FBTA 5KFWA 8ICAA 3OGUA 4TSXA 4I9QA 1ZQYA 4UB4A 2IOCA 4I28A 1B9FA 4B3OA 1C1CA 2HHXA 2KN7A 1RTHA 1D8LA 4CK3A 4J9NA 4DQQA 3DLHA 2VG7A 3UQ2A 4RU9A 3TQ1A 2ZD1A 3ISDA 5HP1A 2X74A 3NGIA 3LPTA 3MDAA 4QZHA 3QE9Y 4FW2A 4R63A 5CR0A 4YCXA 3HXMA 4JWMA 4I2HA 3TANA 5J0OA 5J2GA 2UVRA 4TUSA 5SZTA 3RMDA 3TFRA 3AO3A 3RJEA 9ICJA 1RCHA 3LALA 1ZQPA 3RJIA 2DFLA 3UQ0A 3OS0A 3AVBA 4CJWA 4RQ7A 4XIUA 2RKIA 2IS3A 3DRSA 2MAXA 4DOCA 4I2IA 4Z6EA 4HCBA 2W9CA 9ICMA 1RBTA 3BGRA 5J0WA 5KFGA 1SV5A 2FLLA 2O4IA 4B9LA 3HWTA 8ICOA 1COOA 2O4GA 2JZBA 1C0MA 2BPFA 3L8BA 4FLXA 1BHLA 1NK4A 2JEFA 4B9VA 1CUKA 3KD5E 4UB2A 4CEFA 2KTQA 7ICHA 3PNCA 4I29A 1S9GA 4BDPA 1VRTA 3V9ZA 1IM4A 1VSDA 3WNFA 4Q8FA 9ICCA 4JK1A 1QSSA 2PZSA 1BCOA 3H4DA 4OGEA 8ICCA 3T1AA 5KFQA 4CF1A 4KMUA 4M3RA 4YP3A 4OLBA 3RR8A 1XI1A 3KLFA 5CB1A 1S76D 1NOMA 1JLGA 3S3NA 1ZQVA 4DWIA 4M3WA 1LAVA 4LZDA 2V4RA 1R0AA 4F4ZA 2OPPA 3HPGA 1S9EA 2ZUBA 1ZQXA 4FLZA 4ECWA 1C6VA 2RPIA 1RT1A 5EWFA 4DL6A 1ZYQA 3JPSA 3GV8B 3RMAA 2P66A 1NOZA 2DTUA 1VSFA 1LV5A 4E1NA 5KGXA 1O1WA 4MFBA 4FLVA 4FK0A 3CQ8A 4DTUA 1B22A 4F5PA 4IR1A 1BISA 2M9NA 4W5RA 3LP3A 4W5TA 5DG7A 1WSJA 4BWMA 2FMPA 4FLYA 4O5BA 4FJKA 2HHWA 2IBKA 4DTSA 3IHQB 3PX4A 1DOQA 2IHNA 3QEVA 1ZQCA 4FM1A 2VA8A 7ICSA 3K2PA 1S1XA 3AV9A 5HHHA 5KFYA 3AVCA 4FCYA 5KFFA 5FRMA 5J2PA 3OYLA 2IGIA 2BKEA 5J2CA 1IH7A 3AU6A 4DTJA 3M8PA 4CJVA 1MSWD 5IIKA 2G8KA 4O3OA 3PW4A 2VWKA 4KO0A 2BE2A 5DB6A 2C22A 1JLAA 2EHGA 3HVTA 3TWHA 5KG6A 1U9LA 5JS1A 2PFNA 4Y1DA 4KLOA 4G1QA 5J0XA 3JPRA 4QWEA 2Q0ZX 7ICUA 1TGOA 4CHNA 3NHGA 4FM2A 3HM9A 1ZQAA 7ICVA 3QESA 1SKSA 5DB8A 2B21A 4QWBA 2Q3SA 3M9OB 2YNFA 4R5PA 2WTFA 4ED7A 1SUQA 4N56A 4XUSA 2HVHA 4N41A 3BQTA 4BWJA 2PFOA 1ZQWA 4RQ3A 5J2QA 4F4KA 3IRXA 4I2QA 4Y1CA 3EW9A 2FLPA 1HMVA 4DEZA 7ICIA 4DU4A 4ECTA 3SUNA 3CFPA 4CHYA 2W9MA 4UBCA 4GXIA 3AVMA 3GIKA 4B9UA 2Z1GA 3OS2A 1KRPA 4IQVA 3I0SA 3Q8LA 3ZSYA 1Q9YA 5CJ7A 2C2RA 2XCAA 4JWNA 4HYKA 5C42A 5L9XA 4DSEA 5D46A 4AILC 4CJUA 3OSPA 1BPEA
chains in the Genus database with same CATH superfamily
2C3UA 4IFYB 4DL3A 3HJFA 3N79A 5B0BA 2BV3A 1ED1A 3I8BA 4RWTA 3VQCA 4BC3A 2VPZB 5JU5A 3VOVA 1R3NA 4H4KC 1C1BB 3KHLA 3EX7B 1HW9A 4CTAA 3VGMA 1CZBA 3BJYA 4JLHA 2GC8A 4A8EA 2W04A 1RABB 3C8YA 1FE0A 4WU3A 2WTUA 1P8ZA 5DBAA 2VGMA 4YNQA 5BRHA 3THVA 2E2QA 3HP6A 2QWOA 4JRQA 5KG4A 4PXDA 1RPLA 1T6CA 3KJFB 1O51A 4PG6A 2NXUA 1HBNB 2ODGA 4MT1A 4F50A 3MBYA 5E7OB 3UKRB 2IFXA 2WVCA 2VANA 2M88A 2FY1A 1VQPN 3KK2A 4FF4A 5GAHI 1KQGB 4EAHD 4YMMA 3N6MA 3H2LA 3MAQA 2A1RA 2VBZA 5EE1A 3FCWA 1RHUB 5DBBA 2P9PA 3DLBA 4H03B 3ZSQA 5A2QO 1VIXA 4MK9A 7ICPA 1EKSA 5D0GA 2Y0SF 5JVGL 4WF9L 1UPMB 1Z4NA 1EKEA 2P9KA 1DLOB 2OAUA 3RBEA 5E5NA 3M1VA 3GSIA 3OTOJ 1NU0A 5B0CA 5KGWA 3G87A 1FDDA 4FJLA 4WFBL 4HVZA 3IXQA 4I69A 1MMLA 3EZOA 3MM6A 4H5RA 4OX9K 4NL5A 2ZGYA 1FRKA 3TABA 3ETOA 4CHQA 4I2JA 4CLKA 4LF7K 3Q8MA 1T3OA 3NVYA 2ZQBA 4OGCA 3KHHA 2DPIA 1WG4A 2A41A 3THWA 3BBBA 4F04B 2ZH4A 3WQUA 5D0RA 4CEOA 1OH8A 4UT4A 4R64A 4LSLA 4IG3B 2VG5A 4DL0C 3M32B 3BZCA 4MH8A 3EN9A 4MIWA 4LR8A 1KVBA 1S6QB 3LDSA 1B99A 5J0RA 2MLXA 1SZPA 2RRAA 3ILJA 1N52B 3AD7C 4C0OC 3UN2A 1P1LA 1PIEA 3R97A 3AVFA 4CJ4A 1HNZJ 9ICOA 3OW2R 4BCAA 2NLWA 2FBYA 5AKEA 1W7WA 2GHPA 4JI2J 2L08A 2FBVA 1ELOA 4J2DA 3PV8A 1X9SA 2CQ4A 1GLCG 4IFVA 4CT9A 1KVIA 2MYFA 2V34A 2HF3A 1F1BB 4KLGA 1OH6A 4MIBA 2PFFB 1RDRA 3ZT0A 3I4HX 1OXJA 3ZTRA 2VIXA 2YHBA 4DUYJ 1IVZA 1TMJA 1XO1A 3ZD8A 8ICUA 4CZLA 3GZFA 2D0BA 4BQZA 2ZNZA 1BVSA 3G10A 1QS4A 2K1RB 2OELA 2E5JA 4KHMA 4USIA 1FEEA 3QT7A 2JZBB 3VENA 2M8DB 1JLEA 4CLUA 3KUEA 4LF8J 4NL9C 5LJWA 1L7OA 4OPAA 3QMQA 1HQUB 1EXQA 1N8RT 2VICA 3QEWA 2BM1A 2CJKA 4CECA 1N5SA 4HR2A 3TEGA 4ES2A 2GVDA 4A8WA 4Q0BB 4I2QB 5IWAJ 3CCEN 2K4EA 1JJ2R 3M3ZA 4FL9A 4B8CA 4QZ9A 2GV9A 1ZQNA 4BRFA 3I0RB 4FN5A 2YKMA 4OJ6A 4N8NA 3O4QA 1YKWA 1RXOB 2DCUB 1JCFA 5J2NB 4XH1A 3K8WA 2CPJA 3NGYA 3M30A 2YJEA 1MMNA 3NS7B 4AHTA 4Y2UA 1XMQK 1L8LA 3UCGA 4KAZA 3SSQA 4F2RA 1S97A 3FBEA 2ABYA 2QE5A 2HQGA 2F1IA 3M8PB 4X4VA 3AVNA 4M63C 3VALA 1YJ7A 1Q95G 3CO9A 1N34J 4LF8F 1PVPA 2Q6BA 4DCPB 4OJ5A 1WBDA 1SAZA 1C0UB 1RAAB 4RO0A 8ICBA 1JLFA 2F9TA 3QGPA 3BS5B 5BREA 5DDYA 1D9DA 2Z2MA 2IY5B 3NGSA 3HD1A 3NRBA 3MM5B 4B3RF 2QLXA 4ID1A 1R8PA 2HFVA 2HURA 2Z8QA 3BSOA 2E8PA 2LEPA 2KG0A 3CJ1A 1WWVA 2KKZA 3QICA 1CXQA 3HYFA 1VIOA 3UN3A 4ZP7A 1X7VA 5CZ2A 1OY9A 4R66A 3L09A 1TE2A 1M6YA 4M3ZA 2DD8S 5D0HA 5RUBA 1FFGB 3BP8A 4YDUA 4I56A 4IRKA 1HEKA 4M5HA 4A8YA 3M8YA 1Q1KA 1E6VB 4AE5A 3T5HA 2WSCC 1YBAA 2QLTA 1SKWA 1GOAA 1XNQK 1TVRB 3MR3A 3SAGA 4UAZA 3ID6A 2Y1IA 2XEXA 3LM2A 1Z00B 3G6ES 5ALUA 3VN5A 5KG2A 2KI2A 2AGQA 4X4OA 1FKPA 1TKXA 2ZJ5A 2I1RA 1RAOA 2X78A 1U04A 5KFVA 3L3FX 1LWCB 1C0TB 4ZVSB 2FMSA 3SCIE 3CQYA 3QQCD 2B7BB 4YMOA 3RB0A 5DETA 3GWCA 3NAHA 1NPRA 1CS4A 1T0TV 4J9VA 1SKRA 4Q0BA 1S1TB 4I0WA 3SQ4A 4O44B 1RBLA 4NB4A 5C12A 5E3QA 4FJGA 3E2EA 5T41A 3ZT3A 5DBCA 1ROFA 1MWYA 2HK3A 4ECSA 2BW2A 3VAKA 1FO1A 1AB8A 3DOMB 2KIWA 1RGVA 3EYZA 4DX7A 1AA1B 4IQMA 1ATRA 3VV2B 5ALZA 1VOMA 4DCJB 2UUCF 3VGVA 2ZIWB 1X6IA 4Y2AA 4KH1B 4MYUA 4HHTA 5K8MA 4OQJA 3P83D 3MR7A 1LKYA 1UQVA 4OZJA 4DR4K 1P8GA 1SV5B 2E5SA 4CLYA 3G8SA 4B9MA 1IQTA 4LUBA 1SH0A 4RZRA 1GTEA 4K4XA 3MEDB 5IV4A 2BYCA 4LD0A 2VGNA 2YI1A 4DMZA 5G5HA 1L8OA 1NK9A 2GHVC 4A8MP 3W60A 4USKA 1NB2A 5F41A 2YMMA 1S6QA 1JJCB 2O8DA 4CZKA 3W2WA 1TAUA 5FDLB 9ICRA 1EZZB 4F36A 4WQ4C 4PG7A 3NXZA 2VG5B 5M1OA 1Q78A 3IRXB 2CVIA 1VQLN 3HHLC 1DT9A 4JS5A 2BQ3A 2DGTA 2AT1B 1WF0A 2HGLA 5C24B 3GE1A 4DI6A 3BQ7A 4JBCA 5G4DA 4LH5A 4RWWA 3CCVN 2MUTB 4K4YA 5H1SQ 2CJXB 2LMRA 1RU2A 1N36F 4CEBA 5J0YA 4ID5A 4OHVA 2PI4A 4DR5J 1JXBA 3K9JA 2P9KB 2L41A 4QR2A 3I5AA 2Q66A 1NH7A 4DV1J 1RCXB 4P4PA 5L1IA 4ED0A 4I1TA 2OMLA 5FP0A 4CD1A 1MU2A 1N5TA 1WOOA 5CWRA 1JB0C 1T9XA 2UUCJ 3T7ZA 4UZBA 2DISA 2P9PB 1S6UA 1TV9A 1LW2A 1UEVA 1Q81O 1U0HB 3TZYA 8ICYA 4FPBA 3PW5A 5AT1B 1NPPA 4IDKA 2ZH5A 3D6JA 1WCNA 7ICMA 2MZRA 1AROP 5J2IA 4YFKA 1EETA 3ILOA 1WACA 1NGGA 4GMJB 1I94K 3BB5A 1Q79A 1NGAA 3X3UA 3UCZP 4CBWA 2HBQB 3WK8A 5A6WA 1TP7A 3WK9A 1ZH5A 2GA7A 1N32J 2DFHA 2KT3A 4IOAL 2L9WA 2JHDA 5KAFU 2W1BA 4PWDA 1NKBA 2UUBJ 2V51B 4RUHA 1R7IA 5AQQA 5LJ5Y 3AVKA 1YJWS 3FBBA 2QWQA 3IWNC 3KWMA 5G5GA 2Z57B 4MF2A 3EEQA 3QYYA 1H6KX 1C1AA 4KGXB 2G8IA 2QLBB 1MN8A 1VSEA 1P7DA 3FE1A 1VJQA 3C15B 4FK2A 2EBEA 1O03A 3TAFA 2F1HA 1Z25A 3WX4A 2DRDA 3C5FA 2VQEJ 1VRQC 3BN7A 4DV1F 2F5GA 3KFWX 2R9LA 5ALQA 4EX7A 1R8HA 1NGIA 1KKHA 1U0HA 1RJJA 4LFBF 1L5UA 1N6QA 3UB5A 4QCLA 2XHBA 5ELZA 4I2GA 1S6OA 1ASWA 3O9QA 2UU9K 3D3CJ 3R1HA 4JI5K 4TN2A 1S6PB 3OHRA 2X6SA 1MNEA 1K5OA 4OZ3A 4L3QA 2RDDA 3RJKA 4WE1B 3AB2B 4RU2A 1ZBHA 1V3ZA 3FUYA 4H4KA 4GVBA 2HB5A 2BKPA 2NRZA 4NRUA 4HCCA 2ILYA 2ZC3A 2CPEA 5CYQA 3P31A 4QZCA 3B82A 3ZCMA 2LPEA 1OS5A 2FBTA 4R5PB 2BHNA 3JYTA 2KZMA 2FYXA 3BY5A 1QAJA 4NLCA 3VPZA 2JL9A 1X60A 2RKIB 1BPBA 1HL6A 3NFAA 5F9NA 3QFWA 3KKAC 4DN9A 2IVFB 3MDQA 4M45A 3KMQA 4FF3A 4DR4J 1IIPA 2FJEB 3R6LB 3ULEB 5AE3A 2AMCB 4ED1A 4F92B 1M1HA 1F0XA 8ICIA 1U1MA 5KPZA 3V4MA 1IV8A 2ZTEA 3A8KA 1WC4A 4CIEA 5HATA 3C2MA 3MK6A 2E5LJ 4WFAQ 4FWOA 3TZXA 4M47A 4DSFA 2MKHA 1UPPA 2E1PA 4OYOA 2DPJA 3A8EA 1JIHA 1RI7A 3CDAA 2BZFA 4RT3A 4IZ9A 3VA0A 1X5PA 3PSTA 1B4FA 2GH1A 3CD7A 3MEDA 4YOVA 2XSJB 1JLBB 3C3LA 4NO7A 4CLLA 4OYXA 1GLFO 4AD6A 3HOSA 1WN7A 2DR8A 3EICA 4IRCA 3OR1B 2AP1A 1SL0A 1VHXA 3AXKA 4ZJQA 9ICWA 1BGXT 5BYQA 3CCVS 9ICHA 1DTTB 4C7YA 3R2CJ 3D2QA 1OVYA 3E9PA 2JLFA 5EWGA 5AJ3K 4CIFA 3O8WA 2CN1A 1HNXF 2JRSA 4QWAA 2PYJA 5DB9A 3D6MB 2EC0A 1FWLA 4X4UA 1FRLA 2MSSA 2B4PA 3EZWA 3H5UA 2ZIUA 2A6AA 3FMBA 3T9ZA 3WXMB 5AM3A 2CNKB 1ZAXA 3OYGA 4ILRA 2HHHJ 3NOGA 8ICFA 4JD2B 3IWLA 1FNMA 4K4SA 4FWSA 4CM2A 2DGVA 1VBXA 3K5NA 3CCJS 2GMLA 1NMNA 1OSDA 1VRTB 2ROGA 3L2QA 2HWTA 2VUGA 2XMUA 3LVVA 2UXBJ 4DSJA 2MEWA 4ZVRB 4O0JA 4DS5A 3IBFB 4F8RA 4ZTJA 4UOCA 4I2EA 3JQJA 2GIFA 3UMGA 3NWRA 4EU0A 1FF2A 4BS2A 4UB8U 3FKBA 4RPFA 4U96A 1ZBUA 1X2IA 2YX7A 4CM0A 1B70B 3PX6A 1HJRA 2P9UB 3SSRA 1YBTA 2OI2A 4BRGA 2ZIUB 4K7QA 3A8JA 2LA4A 2GWJA 4CF5A 1RAFB 1H98A 3EL2A 4FPAA 2DRAA 3WDOA 4P0PB 3OW2M 4BACA 4F91B 3WIUA 2W6LA 1HBUB 4IS7A 2KYZA 1DTTA 1OVQA 1ZQKA 2RU9A 2ZUGA 2W6KA 4PZOA 2GNKA 1RDAA 1P9QC 4DDFA 2HHVA 2Z2YB 1M1GA 2GMJA 3GJSB 4WFBQ 4Y2VA 4RT2A 1YJ9S 2FXUA 3CJCA 5DKWA 1QE1A 2AX1A 4KE5A 5IIIA 1Z2LA 1UJ4A 3NL0A 2D69A 3VQDA 3IR5B 4ETZA 4XK8C 3PX0A 3FDSA 5LMNF 2DT9A 1CZAN 5AFUH 5CCMA 3ILLA 1JI7A 4OZ2A 3J7ZO 5HP1B 4CVNE 3BO3A 3JB9k 4DX5A 4K4ZA 1B64A 3CD0A 4J03A 2RHKA 4JMUA 4DLGA 3DWLA 1CJUA 4M9LA 1Q8LA 3GIMA 5GIPA 1HIWA 1HHTP 1YK9A 3BBFA 2Z7JA 2QL7B 2BJ1A 4NCAA 4DL4A 3W66A 5EHHA 5C10A 3TNVA 1LWEA 5KFXA 3K1RB 2OPQA 2KYXA 2O01C 4FWNA 3G25A 4YEAA 1HJOA 2FHJD 1LW0A 3IBPA 4L72B 3U1MA 4YOUA 1HHSA 3O5TB 1ZM4A 1Z6RA 4X62K 1VQ6S 3WXKA 1BNOA 3GFXA 1BA1A 1WWUA 1S5JA 2XYHB 4LJMA 5IT9O 1KHWA 3IM1A 2ETJA 1UT5A 3H0LB 2AEJA 2JLEA 1XNSA 5AE1A 2VH7A 3BSNA 3MMVA 3PY8A 3OTQA 1BWFO 4ISFA 1VDVA 1KOHA 3T1YK 2WSFC 4RW4B 4C80A 2MQOA 1Q3UA 1ATSA 4LBHA 4MLEA 3PRVA 2JFKA 1U25A 3P45B 1NSPA 3SIPB 3ZEUB 1PJ5A 1W97L 4CO4A 4B3RJ 2WONB 3FLCO 1VAZA 1Q7LB 1ZD5A 2O66A 3ZX3A 2E5LF 4BLGA 1WOSA 3SZ2A 3O8MA 5AQSA 4M3YA 2E2OA 1CC8A 1RXWA 2XQCA 1YSJA 3PO4A 1CULA 1P6TA 3U3GA 2ZNYA 2W2NP 4KREA 1SJ1A 1SQEA 2VG6B 4F0MA 4JKHA 3RH6A 3H59A 2E5HA 2OPRB 4CJ5A 2K7KA 4KC5A 3N0VA 3AA5X 1H3DA 3F2DA 3LGNA 4FNIA 2QB0A 2JLGA 3FGUA 3ASMA 1T11A 3RW6A 4B3TK 2YH1A 4DXLA 4MDBA 4KFBA 3M8QA 3VVUA 3MFHA 1BD6A 3V7JA 1FEHA 2A1JA 4LRBA 2V8PA 3LM9A 3G0ZA 1NGCA 2XHCA 3AVAA 3FC9A 4ISGA 3SLCA 1RYRA 3CCQN 2ASYA 4J2AA 5BOLA 1TFWA 1VRUB 4I9LA 2R7QA 5IT9Y 4DV4J 1QDUB 4IDKB 3NMUA 4W90B 1TL5A 1SJ4P 1L3TA 1FEZA 5JRTA 3VCBA 2VPWB 3K8VA 4N5SA 2DNZA 3PYEA 4F4YA 4CJ7A 3VQ8A 4F26A 3HRGA 1DQAA 2AQ0A 5I9EB 3CW2C 2JEGA 2ZBQA 2MB0B 4DV2K 1ZQRA 2YHYA 5GAGP 4DV5K 1Z19A 3BDPA 2NUBA 4ZP9A 4ICAA 3MURP 1KC8T 3ONNA 2DNQA 2FZGB 2J7KA 4ED2A 4OZ5A 2O5DA 4UASA 1CG2A 5HROA 4A8KA 3AGKA 4ICLB 2KXFA 4BC5A 4CJLA 4E7LA 3RJHA 1RP5A 3QSIA 1HNXK 3DLLQ 3CI5A 3E0FA 4KHYA 3WC0A 1VHFA 4FO6A 3QERA 2DQNB 2X51A 3Q89A 5C24A 5ETLA 3BO2A 4M5GA 2LDYA 4ANCA 3L4BC 1R59O 4HUGA 1Q16B 3BH6B 3WEEA 4PZNA 2AX0A 1YIJS 3QRPA 3D6HB 1X0FA 1RT7B 3CCSN 4QWCA 3MOJB 5DRKA 3QXGA 3SCXA 4UB3A 2ASLA 3W8GA 1NZ8A 4USJC 3M6XA 1Q86T 1RWPB 3H08A 3J7YU 5EX5A 5ALLA 2R8JA 4AQYK 3RH4A 1L7MA 2OKQA 3FRZA 2H3IA 6FDRA 4USWA 1EKRA 1YJWN 3U1LA 3QEAZ 2HBJA 4KH0B 4QQBA 2J9DA 3EWAA 3IS9A 1BI4B 2ZIWA 4FWLA 1A6SA 3QBXA 4DV7K 3MUMP 4JK7A 4TUQA 1UW4A 2E66A 3CJ5A 3BREA 3GZ7A 1IG8A 2CQHA 2ALZA 2OCEA 1EB0A 1MA7A 1OKJA 3OYCA 4HEA9 5DB7A 3C65A 1QVGM 3CMQA 1HUZA 4USUA 2P9IA 4ZLNA 3SQ1A 3I32A 4MK7A 3AGRA 1FCAA 3C23A 2BQRA 2Z30B 4OZLA 3H42A 2F4VF 3ENHA 3MN6A 4CLWA 4BROA 5SUHA 3F9MA 2E1CA 2A6MA 2CPDA 1T03A 1FKPB 3HVTB 3H7IA 3O2IA 1S8OA 7ICJA 2OA8A 3OYAA 1AUDA 4WBFA 4UB1A 3HKWA 3ZSXA 1VQNS 1TVRA 1J5EK 4WP9A 1J5EF 2DKZA 1LQ9A 3HT3A 1IXRA 4M5NA 2VHGA 2VG6A 3V9SA 1GLBG 3V9XA 5HLFB 2Z56B 3PKMA 1KDHA 3SV4A 1CULB 2DNGA 2GGPB 2Z4PA 3D2EA 2A19A 3W9JA 5CA5A 4QU7A 2DVIA 3ENWA 1FRIA 2F8TA 1KN5A 2IRXA 1NWKA 2B6AA 4M6WB 4FZZA 2AZ1A 2EK1A 1HYSB 2ADBA 4NLQA 4TURA 2K06A 4ECQA 2H51B 3EGVA 4CD3A 4HTJA 2OPPB 1SL2A 2ZUDA 3QU9A 3BF1A 4AM6A 1GAOA 1H2UX 2NS1B 4H0YB 5K4LA 4TXSA 3RW7A 4UOFA 2GQQA 2JV3A 3MM8A 1KEJA 3GIIA 3WXIA 2MKJA 3PHEA 4B3MF 3BYPA 5AFUA 3EVWA 3CCRS 2IVOA 2YX8A 1WKKA 3NGKA 2JH3A 4LF2A 4F72A 3NKYA 4NWBA 1BQXA 3UPQA 2P9NA 8ICPA 3G71N 2DNRA 5AHXA 2R2TA 4LR9A 4DS4A 4O3SA 1LB2B 4G6VB 4AYBD 4OJHA 3ISND 2RS2A 3J81j 1VQ5S 2GIRA 1K1QA 1JKHA 3H5SA 1W26A 3R3LA 2C3MA 2ASOA 4KLIA 1CI4A 4LY7A 3UD4P 4B3SJ 2VBXA 1VQ7N 3Q8RB 2MKSA 3TU5A 1TZ0A 4XO0A 1RAEB 3CJ7A 2XNQA 1NK5A 4B3MJ 3LOUA 2W03A 4YD2A 4QIGA 1CJUB 4DX6A 2EW9A 3QWUA 1SV0C 4M9HA 1B0VA 3CERA 1FX4A 1FX2A 1WTBA 2E7XA 5C25B 1NKCA 3U9DA 4M5DA 5HJYA 5EE0A 4IFVB 1FIQA 4IC9A 4XH4A 2M0NA 2H3VA 4H5NA 4Y2IA 2DHAA 1W2BR 2JSXA 1NPKA 5A6PA 3KK3B 3HFKA 1G4CA 3T1YJ 4WK3A 2A2DA 4X4NA 4HDHA 1BXNA 3G6EN 3FRYA 4MFCA 3ISBA 4AXIA 1N33K 3F2CA 4W5OA 4E89A 3IRWP 3SI6A 1XO0A 4TY9A 1ZBIA 2B9YA 2DR6A 3BKTA 4QIEA 2KK0A 1IO2A 3CGIA 2EQYA 3CCMN 4ILMA 4PG5A 2R2SA 3RB4A 2Q1LA 2IM1A 2XULA 4PG4A 3T1HK 2BMBA 3HHLA 4IO8A 3OYJA 3EY1A 1UWBB 5C0YA 3KK1A 3ZT2A 4DQ8A 1WKLA 3ETLA 5IWAK 3HW8A 2HMXA 4P4OA 2RRNA 4R8UA 1URRA 3RGIA 4C8YA 3FFIA 2ASMA 3D66A 1E6YA 1I5OB 4JI4J 4K2XA 1C4CA 5A0YB 2DGWA 2Z1JA 5IXUA 3L2UA 3MABA 1FRXA 4CO2A 5ETKA 4DTPA 3TVZA 4JHDA 5KG1A 2VYPA 3QUQA 4Z4GA 4EYHB 3TAMB 4K4WA 5AI9A 3EDRB 5KT7A 4I4BA 3OA9A 5CRXA 2SXLA 4KQZA 3HKZF 5DO2A 1RDCA 2OEJA 5BOMA 3KMSA 5KFAA 2DGQA 4HKQA 3SUOA 2XNRA 2Q0RA 2RSQA 1JMTA 2LM4A 4D3HA 4LF9J 3GG4A 2BXJA 4OHYA 2F7TA 4JAXA 1F21A 4QS8A 4IXCA 2MQMA 3CCES 4CGZA 1VHIA 3QRRA 5C2FA 1BWEA 2QXLA 4IOCL 2HFUA 2DHGA 5A0LA 4DV0F 3R6GB 4FO0A 4ZPVR 3AD9C 4AM7A 1AW0A 1QAYA 3KIOA 4HH1A 3KD3A 3K5OA 5M1NA 5ALWA 2H3FA 4E1JA 1SZHA 3F9KA 3QNOA 3P4UB 2ZHAA 1IKXB 3CB4A 2G8WA 2H54B 4B8AB 3VR1A 5DDMA 3QDKA 4MKBA 5KL8B 4FKXA 2EVZA 3RU0A 2F8KA 1VCTA 3HKZC 1WG1A 3TOQA 5TZVA 4I9QA 5KFWA 1XK8A 3OGUA 5EN1A 2J0SD 1YVFA 5B08A 4B3OA 5TKYA 1Y9OA 4B1ZA 1D8LA 4CK3A 1X5TA 1GLJO 1FDNA 2VCPA 4P9SA 3ISDA 3HX9A 1WORA 3MDAA 4FW2A 3QE9Y 4R63A 5LM7E 3TANA 5J2GA 1DHMA 2E1MC 4TUSA 3WKDA 1RAIB 3UVJB 3RJEA 3C29A 9ICJA 3HTVA 2COLA 3RJIA 5J2QB 1WHVA 1UMJA 1XNRF 3OS0A 2DRBA 2KKPA 3M2VA 3AVBA 3D2FB 2HEKA 3CVKA 2IS3A 3GE9A 4DOCA 5FD1A 5J0WA 1DAXA 3PIPL 2AKWB 2O4IA 4FOIA 2U1AA 4B9LA 4L6V3 3MF5A 3KJQB 1WDDA 2FVQA 3GOIA 1C0MA 1NCLA 4DUYK 4FLXA 5AKJA 2QX0A 2BDUA 2BRKA 4WFXA 3KD5E 4CEFA 4NLXA 5HBMB 3P4IA 3L0QA 4ZVGA 1OQ3A 4FP9A 1S9GA 3MEGB 1IBLF 1IM4A 1VLYA 4Q8FA 2JMGA 4JK1A 9ICCA 2KVSA 1BCOA 3H4DA 4OGEA 3LP1B 3M05A 2G08A 2AXTU 3T1AA 2BH1A 2MHNA 1YQHA 2W43A 3IDWA 5ETNA 4YP3A 2HMIB 4E8UA 3KLFA 5CB1A 5H9FJ 1X4CA 3S3NA 1ZQVA 1R0AA 3EWGA 1S9EA 2QL5B 2XYGB 1ZQXA 5H1SV 3MDFA 4WQ5C 1A0PA 2P9SA 3BPDA 4ZLLA 4CH1A 2EZYA 3K0SA 3MAHA 4LF5F 4PWUA 4IDHA 2DNOA 4DL6A 2KJ5A 5KPTA 3J7YP 3GV8B 1V9OA 1RLCL 2GAGC 3EE9A 3A3OB 2GX8A 3V81B 2P66A 3WQTA 5F8JA 2JWLA 1WI8A 4LFAF 3KG1A 2LXUA 4MFBA 4FK0A 2YB4A 3LH2S 4IR1A 4W5RA 2EFGA 2H1YA 2CWXA 5LMUF 5CAAA 1WSJA 2VOOA 2W11A 4DR1K 4O5FA 3IP4B 3R5GA 3PIOQ 3PSFA 4QJFB 2FMPA 2FJAB 1EETB 3A0HU 4O5BA 2HHWA 2W41A 2YWKA 1KLMB 3Q8VA 3PX4A 4Z37A 5AM0A 1CJVB 3BGOP 7ICSA 3DRPB 2E8NA 1S1XA 2HOFA 2H5EA 3WHIA 4DR7K 2VFRA 1CJKA 5KFFA 2FGOA 2L9NA 5FIIA 1FK9B 2IGIA 2AA4A 2BKEA 4IEEA 5AI8A 2W4CA 4K5RA 4BRMA 5ALKA 3KJNB 1MSWD 4CJVA 1ICEB 4UF4A 4KO0A 1O8BA 2FB0A 1U9LA 4TY8B 2D3ZA 1FJGJ 5JS1A 4C0ZA 5FLXY 3OVBA 5J0XA 2DXEA 1A9NB 4WF9Q 4Y3CA 1N34K 3DRYA 4RUBA 4WFNL 2HFZA 2J76E 3QJLA 4HHJA 4A4JA 5GVQA 3HM9A 4DR6K 2LEAA 2XVTA 1ZQAA 1JROA 3QESA 2QT7A 4U7BA 2XTJP 1SUQA 4N56A 4LBPA 2AYEA 1KAYA 1XNQF 3D28A 3CXCM 3BQTA 1DURA 5BN8A 2XMTA 3TP2A 3LPYA 2PA8D 3IRXA 3L3CA 1U24A 4EO8A 2DK2A 4C3MA 3WU2U 4DEZA 3OVSA 2B9EA 3NS5A 4CHYA 4UBCA 1VDHA 3IWXA 1U2CA 3ZC4A 3B8HA 2NYIA 1S1VB 1XC3A 1VQKN 3I0SA 5ITHA 3G82A 3ZSYA 2CDQA 2MLZA 2C2RA 2KD1A 4JWNA 5D46A 4BR9A 4O4GB 2KDOA 3LA0A 2ERRA 1YF5L 3O1BA 5LSLA 4LC9B 3THXB 3ZDBA 1BWVA 2ZUCA 1F3VA 1NNLA 3ISZA 2E1EA 5KFHA 1IWAA 4I64A 4O0NA 3R6MA 1KQFB 1QQOA 2DTJA 1F5AA 4RPYA 5FLXO 2Q0UA 2RD5C 3CPWR 3NF6A 3OY9A 4JV1A 4DF4A 4Q8EA 2RF2A 1A0OB 2F7VA 2NZ4A 5F2RA 4O55A 1OO0B 4O5EA 4NV0A 2DY1A 3U1NA 2V50A 3IFRA 4CERA 5KFKA 1LOUA 3H8MA 1DZ5A 3GLJA 2RE2A 3NBPB 3SYZA 4RW7B 1NGJA 5TKWA 1UTAA 5I42B 1WOQA 3W1YC 4LH4A 4LF4F 3UNGC 4YY3J 1N36K 1W2BM 3CIMA 2R3VA 4NX9A 2C3YA 2OHFA 1R8BA 3H1QA 1XSNA 1RT3B 2FLNA 3OYEA 3M6GA 2KSOA 1ZJNA 4LF9F 3S3MA 3VAFA 4PUOA 2FZKB 3B8AX 4JI1J 3PEJA 2AW0A 4WJBA 3FFKB 4NY8A 4FYXB 4F2SA 4GKJF 2J0XA 3DOKA 1QM9A 4K8XA 7ICEA 2G8VA 4C4RA 3ED5A 4QS9A 1TKXB 4JOUA 3D3BJ 2YKOA 2CRLA 4AQYJ 3H98A 2KZZA 3SQ0A 2PBDA 1KL9A 2Q4TA 9ICQA 1K9MO 5HR6A 1Q9XA 3NTUA 3AA3A 1AT1B 3U02A 4NLNA 3Q86A 1UAXA 5HRRA 3TAEA 1RT5A 4OYAA 5H9FK 1KVJA 1E6VA 9ICFA 3FVYA 1G15A 1NJYA 1KFSA 4ZCMA 3P8BB 1S49A 2NCKL 2ZITA 2P1JA 1SXLA 2FC8A 3ITHB 3TAQA 4USTA 1BIUA 2QGFB 5K8OA 4GLXA 5J2PB 3I56N 2PMZC 2DH9A 3A3PB 4WP3A 4CHPA 3B6PA 4OX7A 2R7XA 4K4GA 3N7RC 3I1YA 2YNIA 3MGIA 2ZC4A 3PFOA 3MMAA 3OYBA 4AL5A 1VQ4N 1WF2A 8ICHA 3KLEA 1NK0A 4EK2A 4DOZA 2PKEA 3VZIA 3VGLA 3HJVA 2AJ2A 3KLGB 1MROB 5F1XA 9ICGA 4DCOB 1VQ9N 2NRRA 2LQJA 4J9LA 1EAYC 2VFUA 5IIMA 1HARA 5AQIA 3B4MA 3RAXA 1WDTA 5CXTA 4K41A 5KRTA 3JS9A 4RBVA 3OJUA 2G13A 2HBZB 3D2SA 4CT8A 4KT0C 3QGIA 2ZH3A 3BQ1A 4ZVTB 1MMDA 3M1FA 5I42A 1OH7A 2W8KA 2OEMA 3HFVA 3TWZA 3QFUA 2FLOA 2LEBA 4OI0A 1M1KT 1U26A 3QO9A 2O8CB 1HR0J 4WFYA 3OUYB 5C42B 4CBXA 3SFUA 1I3OB 1TL3A 2VKQA 4FZLA 2BW7A 2LCWA 3MN9A 4OI1A 2I7PA 2XIDA 1S12A 4MK8A 3A1YG 4DR5F 1T6DA 4YVZA 1N62A 2KG5A 3K58A 5A8RA 4YHHK 4J2EA 3PRBA 2EAOA 3FEZA 4B6JA 5IC6B 5J0PA 3LAKA 5K20B 2W7OA 3HLUA 2A1SA 3H3NO 4A46A 4BXOA 4X84A 4UOHA 3JSMA 4ECRA 2QEXS 2CQIA 3I6PA 1U47A 2M5YA 3F41A 5H9EK 3BF3A 2JNJA 1EX8A 1WSIA 1HX1A 3MOZA 1RDWX 3DC2A 1S0MA 3V7KA 3P5TL 2ZBPA 2XB2D 4KN7A 1NRKA 1RA7A 1SS6A 1U0SA 2I2YA 2EZXA 3QWPA 2R42A 3DM2A 1DEJA 3MR2A 4RWXA 4QZGA 3AOCA 2W2PP 3A12A 4TLQA 3CJKB 3TVYA 4OKEA 4BG9A 3G8QA 3JXOA 1XMQJ 4C7ZA 3S01A 3ZSWA 3UI3A 3G2XA 2ATLA 5J2FA 2UXDF 1TKZB 4U7UK 4H0PA 3OTOF 5M1QA 3SBGA 1TK8A 4Y2YA 2IM2A 1X4HA 2EK6A 2J5AA 4Y2XA 4AHVA 4NLWA 3H8SA 3D54A 3F53A 5HNKA 1G99A 3CXCR 4QIVA 4JKGA 4OJ1A 5KFCA 4KI6A 3R8YA 2XMWA 1LFWA 2KHCA 1XNQJ 4HACA 4OCZA 2VA3A 1KP6A 2K3IA 2YY3A 4GRSA 4E7JA 3RYLA 1KW4A 3CCUN 5EU7A 5BN9A 4ES1A 5D4BA 2G5HB 1ZTTA 4V19J 4RQ8A 2DXDA 4FJMA 1DLOA 1NGDA 1UCVA 3EE3A 2QL9B 4O3NA 4PY5A 4B1VA 4MFBB 2IOFA 2XG8A 4EEKA 5B8HA 1SGGA 1V4TA 3PW7A 5AQRA 1UFWA 3GV5B 2XY5A 5K14A 4M9JA 3SMSA 5IT0A 4DV6F 3NH0A 1OWXA 2HNYB 4OYWA 4CH7A 3O80A 5HSPA 2W3RA 2AJ4A 2IAJB 1ZBTA 1N2XA 4J7CA 2EFQA 2P9LA 4UB5A 1R31A 4CJEA 3A5OC 1R0AB 4ZVQB 3MM9A 2PN6A 1AZSB 1REVB 2WRMA 3DI6A 4PKDB 1QJHA 2FJDB 2KICA 3RH5A 5M2RA 3KZXA 4FNHA 5GAGI 4XQ8A 2XO6A 1NZAA 5KQDA 2QIFA 1JL2A 4IOBA 3TUIC 2GUPA 4E3SA 4MEXA 2GJFA 5EOYA 4XTTA 3HRDD 4M3XA 4N47A 1PC4A 3OL7A 4CFBA 3THPA 4OX8A 5IQ6A 1DTQB 3T1HJ 2VKZG 2FSKA 4IH5A 3TEHB 2HQ3A 4KPYA 1RWNB 4H8KA 2E1RA 4K2JA 1NDPA 3ZSVA 3OL8A 2HS3A 5AR0A 4F5QA 4UQTA 4GKJJ 4CK2A 1MDUB 3T5JA 4AL7A 1U45A 2KEYA 5DQIA 4UZCA 3RB3A 1S72N 4H0TB 1FERA 1NZPA 1KFDA 1J9AA 3PTWA 1V9PA 5KFLA 4MTPA 3KJVB 1DRZA 2D1KA 5FJ4A 1JALA 3L7OA 4NYFA 2VG7B 2RE1A 4Q7AA 3ICXA 3N4WA 5JUMA 1N5XA 2XI9A 1HJPA 4YB6A 1JRPA 3RSEB 2QKKA 4MHVA 3SEIA 2ITGA 4H5VA 4DHVA 2IDOA 3CP8A 5KFIA 3AFGA 3CQXA 3HVAA 1KONA 1EX4A 2VL1A 4JRPA 1ZQJA 4I6MA 3Q8SB 1UETA 3GPAA 3KBBA 2HNZA 4KY3A 4RBUA 3DLKA 3Q22A 2ZJRL 1Y10A 4YR0A 4JI3J 1ATNA 4FK4A 3DRRB 2E6LA 2OH2A 3F73A 3T69A 1WC5A 2VQEK 4RQNA 2ZG6A 1DKGD 3F56A 2MZJA 3S6EA 2DF4B 4AF1A 2F4FA 4O5KA 1URJA 5HMYA 5AJ3J 1COKA 3NF8A 2WBRA 4HI1A 4XPEA 3VQ7A 1ITGA 4NA2A 2CQ1A 2HHTA 3EKUA 3O5BA 5J1PA 2RILA 3AJ1A 4KTWA 3JSYA 1WD6A 4QOTA 2HVDA 3O44A 3T3FA 1TUGB 1BQNA 2MZQA 5J2DA 3DRXA 2C1EB 1LWFA 3Q2SC 4ZCKA 4ZVPB 1QQ7A 2M70A 3ENVA 3T6BA 1Z3EB 1GXUA 3IAS9 3MECA 4US8A 3LDPA 2HOIA 1T94A 2AJQA 2HAIA 4KLEA 3QNWB 2IMOA 2F96A 1MQ2A 3PEHA 4UTGA 2BVZA 5M2PA 1Y88A 2JC1A 4MF8A 1RB0A 1BC6A 9ATCB 4C0HA 2IA0A 4NYPA 2FJXA 4FWQA 5CZ1A 3VGUA 2BCUA 4HHHA 3W9HA 2O8FB 4JI0K 3G6VA 3HULA 1WYGA 2PEHA 3VQ5A 3R3TA 2HNYA 4O23A 2YV0X 1T9VA 1VI7A 4OL8A 1S0VA 4HTIA 3WKBA 3WXLA 2V4QA 3WQPA 4RQ2A 2BZ2A 1T4GA 1QLNA 1C7YA 3DFEA 2ZH1A 1PAUB 4RW9B 4YB1P 5IIJA 4I2PA 4YHHF 3O6WA 1RG6A 4U7CA 4AXJA 5DG9A 1KVAA 5KFJA 3ALRA 3DHXA 3UXPA 5KI6A 4XAKA 5ALOA 1OW5A 4DOAA 3THTA 3J7Z5 1K47A 3Q8QB 4P2MA 3CULA 1T02A 2DCLA 4CHOA 2GO8A 3BGFA 3HSDA 1RUSA 1ZQMA 3E01A 4RUCA 4Z4HA 3BGLA 4DG1A 3NNAA 4ECVA 4J9OA 3GCWP 4GY2B 4I6YA 2YMPA 4LRDA 3BN4A 3UWTA 2F8HA 4B3SF 3G6XA 4QR1A 1F2HA 4LFBK 1ZETA 2DR5A 3AVJA 5T7LB 3FC4A 4YOWA 2W9BB 3D1OA 5F8MA 5E79U 1MW7A 5IM0A 1BPDA 5CE3A 3I87A 3V72A 3O4NA 4JN4A 4CJQA 3O9UA 4BRLA 4B9QA 1NU4A 2RUGA 1C4AA 1N63A 4M04A 1N8RO 3RJFA 2G2OA 5IT9U 1WUAA 4KN4A 3NCRA 2KOBA 2DNNA 4QZ8A 2VPYB 4DU3A 2Q43A 3GFHA 2IA6A 2FD2A 3AOBA 1I94J 3U4LA 4KAIA 7ICLA 3MEEA 2Q3PA 2WFBA 2E2PA 2XI2A 4QR0A 4PKIA 2LYBA 4RPZA 1C2PA 4URQU 4QBUA 3C16A 1UJ6A 1Y64A 4Q5VA 4NLGA 2B5JA 3AAQA 1M5PC 1TYQA 6AT1B 4F02A 4EBCA 1N88A 3QIDA 2XMJA 1GO3F 3P1GA 4FJIA 3LPEA 5J2MA 1TL3B 4YR2A 3ZI4A 2HZAA 2LMIA 4DZDA 3OUYA 2E1FA 3I55N 4GNIA 5MAOA 4GV3A 4I7FA 4OJPA 4Y2QA 1JCEA 1XU4A 2BGWA 4FFDA 2NO4A 2NRXA 2GLEA 2FJVA 3E01B 3BEGB 4C97A 3QB0A 5C5JA 3SCLE 4BRAA 3RWUA 4R79A 1WJ9A 2ZBCA 2UUBF 4YY3F 2N3OA 1JNZB 1H38A 2UUCK 2ZWHA 3UN5A 4NJ8A 2W24A 5AQMA 4OIXA 1ZQBA 4QZVB 1MROA 5GMDA 2HVIA 1HYSA 2GBZA 3MI7X 4QYRA 4YD1A 1U6ZA 2WAQD 4YUDA 2ZGZA 3OFEA 5JJBA 2GEMA 1NXIA 2WOMB 2QSWA 2BM0A 5K5MA 2QJ3A 3CJ3A 3KFUF 5F3TA 1Y0HA 4DV3K 4M0AA 2XI3A 3NP5A 3BS9A 3ZSZA 1K6YA 4FE3A 4IQUA 3EVOA 3OXLA 1D0EA 5T14A 4M5IA 3F5TA 4JKBA 1NOYA 3VEXA 2ZE2A 2GVZB 2LBOA 1S57A 2MQQA 2ZTDA 4JI6K 1RTDA 3MXIA 2KL8A 2RIJA 1WC1A 2C2NA 4J9QA 1UA0A 4FBUA 1HBMB 3VWSA 1TKTA 3C6UB 3THYB 3ET6A 3AARA 3QIPA 2IIHA 3E51A 3NVKA 3BZKA 1S72S 2G0AA 3KD1E 2YKQA 2DR9A 8ICNA 1U1LA 2VQEF 3OYDA 5B0GA 1UVJA 4A8OA 5JVGQ 4CO1A 3WKCA 2FY8A 4Y2JA 4OD0A 1R27B 3OQ2A 4CF0A 4MFFA 4L3NA 4I2DA 2R8KA 1ZQEA 1RXVA 3D0PA 3HVWA 3DRSB 3L4IA 4P52A 1IKVA 2V2QA 3LZIA 2G8FA 1GXTA 1RTIA 1FD2A 2B0CA 1D4XA 1Z4UA 1YI2N 3TAPA 1NMEB 4LIWA 1B92A 4B9SA 1H72C 3VQ4A 1SJ3P 9RUBA 1HLUA 2D5RA 4C4SA 2V6AA 5H2FU 3AVIA 1RTHB 3J7AP 3CD6S 4K4UA 4OYMA 3RUBL 3DXBA 1AUSL 3SSSA 2JWNA 3DXSX 1FFWB 3CCTA 5JS2A 5H9EJ 2NUHA 4ZVOB 4GVEA 1Q82O 4NRTA 2H9ZA 3H5YA 2ZM6J 3TADA 2HHSA 3PW2A 5LJ3Y 2E1YA 1XSPA 4DR5K 2UVUA 1C1CB 4CEEA 4O4GA 4CESA 1Q86O 1GMUA 4G3IA 5CYMB 1ZM2A 3G96A 4WYBA 2VWBA 3E3XA 2PMZD 4DQPA 4L73A 2NRWA 3N28A 2I0XA 4WZMA 3R9LA 3BDEA 3HHKA 4WKRA 3ZTOA 1LAWA 3DXMA 5KG0A 2IM3A 3JTPA 5L1LA 4AH9A 3CC2N 4UAWA 4KLSA 3WNEA 1XHZA 4KV8B 3NS6A 4ZHRB 3N5FA 5ALXA 5DDRC 1IG9A 2QTWA 4H5WA 2IJNA 1QSLA 4FM0A 2WF7A 3ZD9A 2IRYA 3SFGA 2EWSA 3QYPA 4WXWA 1BQMB 4FKYA 1Z26A 3C0BA 3ICLA 7FD1A 5AZIA 2HBLA 4A57A 1NM2A 2BPCA 2ZWOA 8ICSA 2VJ5A 4J5OA 3DYAA 1EWQA 5BJRA 5I3UA 3RMCA 2KMDA 3TX0A 4Y0FA 3EUNA 4NLYA 1RHRB 4J37A 7ICOA 5DM7L 4DTXA 3DKDA 3HSZA 3GTYX 4MQ3A 4QIWC 4QJVA 2MA1A 1YG0A 5KL1B 1CJVA 3TACB 4OJLA 1S3XA 4Z7CA 3HF5A 1XSLA 3K7RA 3FQKA 3TKAA 4FJNA 2W42A 2F1JA 3MXJA 2XSFA 1YAGA 3TSQA 1IKYB 3AU2A 4BRQA 3TUZC 1DQ8A 1L7NA 3C2LA 2FF6A 1D8YA 3S9HA 1JLQA 4HACB 4JB8B 4CF2A 4NMXA 2EFVA 3OR2B 4DR7F 3WNHA 1L6NA 3SAFA 1J2MA 5AQYA 4IJNA 3OYKA 4P7TA 3JPQA 1SWWA 1RK8A 1S9EB 3ADAC 3IMQJ 4BRKA 4BRPA 3SUPA 3SQGB 3ZTPA 4PGXA 1X31C 3C6UA 5HO4A 3K5MA 1RTJA 4FYVB 4K4HA 2LI6A 2P9CA 4KHNA 3BSAA 3NGDA 2FMQA 4DPYA 2ACYA 3FZLA 3VQSA 1NB7A 3PJXA 4P2HA 4LIRA 1K8AO 2HMPA 4YXJA 4O4RA 5HMXA 3D6FB 4DR3K 1FFSB 4WCEL 1UP1A 4QPTA 3Q8PB 3BBCA 2K2PA 5EOZA 2UUWA 3T1HF 1N5YB 3G86A 4QW8A 4TQRA 1DY3A 2VIHA 3ETRA 5KFZA 4DFKA 3WK5A 2A5XA 2I5JB 4ENOA 2ZOGA 1FFVA 3JSMB 3MCAB 3V1QA 1ZPVA 4KB0A 1DK3A 1O6XA 3C94A 1HNVB 1QQMA 4DV3F 3ZT4A 1UW9A 3MM7B 2OYYA 4OX9J 3M5RA 5AQTA 1GEHA 1GK8A 3NGUA 3US5A 1OY8A 1Q82T 3T5LA 3NNCA 3ZSOA 9ICNA 2RNEA 4BGAA 3VA3A 4IFEA 5BR8K 1ASUA 3IR7B 3ZX2A 4JYAJ 1SV4A 4AHRA 3DU5A 4IQTA 2MJNA 2QZ8A 5BXIA 3IAM9 4NLSA 3QAUA 3R5JB 3D4JA 1ZQGA 2V8VA 2R7WA 4CEQA 5KT6A 3GU0A 5D15A 3EO3A 1RU1A 2P9EA 4US9A 2D3DA 1Q46A 1LK7A 4B9NA 2PMZF 4PA1A 2VJUA 2CQCA 4K50A 1PCAA 3ZFVA 1TK0A 4JB3A 1HMVB 3PSIA 3FAHA 4NOHA 3UKUA 4ZIVA 2Q97A 2P9GA 5AJ3F 1D09B 3PW0A 3VAGA 1RQNA 3FNNA 2X1AA 3L6QA 3V4IB 1HNWF 2VODA 4ZCIA 1SQFA 2YNHB 2GTDA 1IBLJ 2KN4A 1Z4OA 1NLVA 2F2AB 3CJTA 4CGDA 1BDGA 1HBMA 3CCLN 5HRSA 2BRLA 4GKJK 4YR3A 3E66A 2GCFA 4FLUA 3G71S 4RQ5A 4M9NA 4CGJA 1YJVA 3KZIU 2NLXA 2A0FB 3BQ2A 1BUPA 2ATQA 3I8DA 2QO3A 1I1GA 3MTKA 4Z6DA 3PFEA 3QEBZ 2HZCA 4KH5A 3LGHA 3QAEA 2POKA 4KHQA 1B0XA 3B6BA 2VJVA 1KCFA 1UL3A 5EX3A 2BJDA 2M2BA 4FZMA 2KT5A 4JHDB 4ZJOA 4JNEA 4J2BA 1B0TA 1T9WA 4UOGA 2HNDA 4E7IA 1ZQIA 4BE1A 4J9PA 2R8HA 2GV1A 4M41A 3VAMA 5CHGA 4PUOB 1ZBLA 4ITSA 4C1NI 4K25A 1SC4B 4OI3A 4RNOA 4OHWA 4R8UB 2P51A 1XBWA 1IG6A 3KLIB 2QYCA 4H5TA 1JXLA 2ZBRA 1MWQA 2E1ZA 2WB4A 1U1QA 4W5QA 3D0HE 3JS6A 1HFEL 4B17A 4Y6IA 3NVMA 2IJRA 4EBEA 1WHWA 3V1OA 4IL6U 4I2AA 1Z2ZA 1M90T 3OBWA 4A47A 1HHQA 3OR1A 2VFSA 3OVNA 2K4PA 3DDKA 1WLJA 1LXJA 2MXYA 1VQNN 2XY6A 5J2MB 4JV2A 1WAJA 3PXGa 2I9SA 1PK3A 2F8MA 3R5AA 2HSEB 1FXLA 1TL1A 3CO0P 4H0XB 1GTHA 2E2NA 1DXSA 2GW8A 2V9KA 4KLQA 4WFNQ 5ALNA 3DGPA 1KTVA 3LUYA 1NGHA 2IVNA 2JH7A 4B1WB 3P3DA 4ZDNA 4PQAA 1FWKA 1W7AA 4KI4A 4H4OA 1WSHA 3PNIA 3MECB 5ALDA 4LF5K 1V38A 1LWFB 3GIJA 1VJWA 2LECA 4LR7A 2I5JA 4NLZA 1Q5YA 2CADA 4BGBA 4E1MA 4IKAA 4CFDA 1X5SA 1ZA2B 1B43A 5D4OA 4GMKA 3FZKA 2H3QA 4LJXA 1FT8A 2YKNB 2J4RA 3UMCA 1T8EA 1N5WA 3PRDA 1T3NA 2RP5A 4OLOA 3VEOA 1MWZA 4QW9A 2CG4A 5IM0B 4J9KA 3HFZB 5ETTA 4CK1A 1VK0A 3FCHA 3O1WA 2ZD1B 1YJUA 1ESVA 2KVIA 3OYIA 1VLBA 4MKYA 1X4EA 1ZQ1C 1KAXA 5G0RB 4KGMA 1U48A 3R8EA 4DG1B 2XS5A 4ZCLA 3RSEA 4CF8A 4FVUA 4QPXA 2O1PA 1MWMA 1EHWA 3ZZTA 4PWWA 4CI6A 5GAEI 3HSTB 5D4NA 5HMZA 1RGIA 3IG1B 3AO4A 4FOEA 4F67A 1ECWA 5DQGA 2DBYA 3F44A 3QUBA 2KM8B 3ZXWA 2NRTA 2GJIA 4DR3F 4PEOA 4RNNA 3H0MB 2ZH2A 4FYDA 3CMAN 2PXIA 4AUKA 5A2QU 3N5BA 1IBCB 2GWKA 5KT3A 5GADI 4X62J 2V67A 4P0QB 3O9TA 4LRFA 4C4TA 2WW8A 4M6WA 1X4AA 2R7SA 2GZOA 5GIOA 2G07A 3KKAA 1F60B 2Z2LA 4CGFA 3PMLA 4EEYA 2M52A 4KTQA 5GAEU 3TVKA 1U8WA 1RT4A 3PIOL 3SEOA 1VGYA 1VBZA 4IO1A 3MXMA 1RSCA 3C6TA 3D2NA 3CCUS 2FVCA 1B3TA 4UY8T 3CJAA 3L5KA 1RKIA 2CPIA 3R1LA 3V6JA 2UXCK 3AO2A 3GIRA 2PY5A 2MJUA 4UARA 2RJZA 1GOCA 5HHIA 2R2UA 4ZN3A 2D3OR 2ROEA 9ICSA 3PUFA 2E8OA 2CZVC 2A3JA 4OLAA 3C1ZA 3EM1A 3FJ2A 2RB7A 4FYWB 4CBUA 1RWMB 2YVSA 1X3MA 2W7PA 3SBTA 2CQPA 4YOEA 2HBRB 2OGUA 2Q2RA 1ZQLA 2DL0A 1S0NA 1WEXA 3AUOA 3DJCA 4KSEB 1BHNA 4Y2MA 2OM6A 2N4CA 3S6JA 3PDNA 2WK4A 2BOPA 1EWRA 4RLEA 1D5AA 4C1NK 3CCQS 4ZLJA 4UY8O 3BGRB 5BR8J 5KG3A 2DPNA 3LDQA 2BCQA 2P9IB 8ICVA 2QRRA 3V9UA 4DSKA 5ALTA 1T9YA 2FJ6A 3SNNA 1MWKA 3M2UB 5ALSA 2B7CB 5JXSA 6FD1A 1VQMS 2ALYB 1FJEB 2FQQB 2HDOA 4PHPA 3SDEB 1ZM3A 5I3PA 4OYIA 4Q2LA 1PILA 1UVKA 1NNDA 3ZNJ1 3OXGA 3MWBA 2PFDA 4PZVA 3QU2A 3R7BB 4LVOP 5HVGA 4NCGA 8ICAA 4TSXA 2OMOA 3JAMO 1KKXA 1B9FA 1YRUA 1C1CA 2MSTA 3UVJA 4IJAA 5F3ZA 3IV6A 4DQQA 3PYFA 4U6PA 5J8YC 3DLHA 2VG7A 5LOQA 4RU9A 3V2UC 1LCUA 2EPIA 5AXMA 2UXBK 5BR8F 1WC6A 3NGIA 4UAVA 4QZHA 4RX6A 2OFHX 1HPMA 1NO8A 4JWMA 3J7ZT 5J0OA 2OFGX 5B0FA 3UR3C 1HBOB 2F77X 3ATVA 3OL6A 2ZXHA 4DU8A 3TFRA 1F5SA 1RCHA 1ZQPA 3EE8A 2V4JA 1FI4A 1SWVA 3OD2A 3UQ0A 4A8QA 1ZPWX 2J9CA 3CDBA 5HR7A 4RQ7A 5LXYA 2Q6CA 5TISU 3DRSA 2MAXA 4DR6J 4PRFA 2NNWA 2CZ4A 5DDOC 4HCBA 2W9CA 9ICMA 5FPDA 3LVWA 3BGRA 1HI8A 1EQMA 4CE6A 1NBWA 2B6GA 1SV5A 2FLLA 3W8PA 2V7ZA 2O4GA 3EXCX 1ILYA 2JVRA 3VQTA 2BPFA 3L8BA 4WTYA 1NK4A 4LF6K 3QIPB 2E44A 4B9VA 5AIBA 3UM9A 1HWUA 2GFFA 3PNCA 4YN3B 3R5CA 4BDPA 4M5MA 3T6JA 5BRFA 2HBYB 4MJKA 3CC7S 3TADC 4BJQA 1PJ7A 3POTB 4OPHA 4RL1A 2G09A 4P71A 4D3GA 4OLBA 2LXFA 4ISEA 5GMKa 1NI3A 2XS7A 1XI1A 4XPCA 1NOMA 1CS4B 1JLGA 4DWIA 4M3WA 2LKYA 4WFZA 4ZVUB 4EHUA 4ZJLA 4H4MB 5HVFA 5BYSA 3SMZA 2OTLN 2HQCA 1UHUA 2OANA 2CNOB 1XR6A 3D7EO 2RPIA 1T9TA 4BC4A 1HIYA 1NZBA 2R7RA 1ZYQA 3JPSA 1HWIA 1E6YB 1NOZA 1VSFA 3FFIB 1YJ9N 5KGXA 2J9EA 5GTIU 3N4PA 2J8AA 4GVLA 2BOAA 5DG7A 1JUDA 3FM9A 3V6DB 3KK1B 1WHXA 3HHLB 1CJTB 4FLYA 3F5AA 4DR7J 2XLKA 2IBKA 2OSQA 3IHQB 2KH9A 3IM9A 2BKOA 3PJ9A 2VA8A 3K2PA 5AI0A 5KPRA 2D9PA 5KFYA 4FCYA 5FRMA 5J2PA 4IEIA 2GAHC 5J2CA 2ZKTA 1WHYA 3NY0A 4F3MA 3H2UB 3C7NA 4JV5K 4B3TJ 1YRTA 2G8KA 5GAGU 1U09A 4M5JA 4O3OA 2PA3A 3TZWA 3VF2A 1VLOA 4NLRA 1HKCA 2C22A 2HQFA 3TWHA 3NAIA 4CF3A 1K8AT 2ES6A 2PFNA 3G8TA 3CCRN 2H3ZA 3SCJE 3M6ZA 3JPRA 2M4MA 2ZJPQ 3K9KA 4DFDA 4YB7A 2Q0ZX 5MLCV 4DV2F 1CLFA 1YJNN 2H3GX 2JRZA 1TGOA 4CHNA 2D6FC 5AKLA 4FM2A 3MN7A 4OHZA 2OIHA 2JH1A 7ICVA 4TKTA 1NGFA 2QFJA 3OBYA 4ED7A 1GXLA 1OH5A 1FNXH 2CH6A 2HVHA 2UUBK 2IYIA 3N6NA 2ATCB 2WSEC 1ZQWA 2HCFA 1LW0B 1Q53A 4I2QA 2FLPA 1SC1B 1HMVA 7ICIA 2AEFA 2KRRA 3WZ0A 3MC1A 1TL1B 1ZZNA 3AVMA 4DU7A 2GMHA 4B9UA 3VVTA 3J80Y 1JLEB 3DXKA 3KOOA 4YOYA 1K8KA 2XCAA 3NLCA 1YVNA 4HYKA 5C42A 2L3MA 4AILC 4CJUA 3AXMA 1BPEA 1P1TA 2Z2ZA 3UD3P 2V7YA 3O0FA 3A5MC 2UVVA 2ZIVA 4I6AA 4P6QA 2MDAA 3SQOP 2FTRA 1CJTA 4Y2TA 3PJWA 3ALYA 4KHPF 2YNGA 4LQ3A 1UZDA 4K5SA 3P5JA 1J5OA 1N36J 4YY3K 3SJHA 1T9UA 4X4QA 2XZTB 4CNQA 1VC6A 4YOTA 4NEZA 4C8LA 3HO1A 5KQ8A 3IR6B 4TU9A 3A8YA 2LYHA 1J54A 1TELA 3JAMY 3VESA 2ZZNA 2KLAA 3B0XA 3HX0A 5KFBA 2B6AB 3L2RA 3GYNA 4YG2A 2EDUA 1D9AA 1X9WA 4PQUB 3SAHA 4HTUA 2BJ9A 4LF9K 1V97A 1REGX 2UV8G 3SQ2A 3THWB 4ANDA 4Y2PA 3BZQA 3HDSA 4PPZA 4UUWA 3D9BA 2B8PA 5IQQA 5FROA 3WK7A 4LVSA 8ICXA 1IM6A 4DUTA 1Y00A 3F5EA 4NM1A 3A0IX 2KFYA 2ISOA 3M9MB 4NE9C 3UMBA 3DLLL 2MQPA 4IO9Q 5I3QA 3C7NB 2YMQA 2N1RA 5HMMA 3ID8A 5AKZA 1SIZA 2BE9B 2KHVA 5D49A 4CO3A 4TY8A 1QQCA 2L9DA 2P5GA 3EJMA 4XA5A 4DR2K 2V94A 4N7TA 3MX2A 3TJ8A 2VQFJ 2KFZA 1OJ4A 1NHKL 1OYEA 2YMLA 3MFIA 1LXNA 2DH7A 2K4HA 1E3MA 3P96A 2XYPB 3QT5A 1QZ6A 5M1KA 4EP5A 5GMEA 5CZXA 3TR5A 4KKOB 2DY4A 5J2BA 2LVWA 4DPUA 2ZM6F 3WBZA 3IC1A 3LDNA 1JLQB 2FDRA 3HI9A 4F4XA 4J90A 3QNMA 4DV7J 2H5XA 2CJBA 5J0SA 5ETOA 5DLGA 4TUPA 2A18A 3CT9A 4LF6F 3QZ7A 4AHCA 2UZAA 1RKJA 1HBNA 2HNZB 4I6MB 1RT2A 1VSJA 1CLQA 3CMES 2RHQB 3R7NB 3LDLA 1EXNA 2GUIA 2V69A 1IBLK 2G0CA 4U8VA 5HRNA 4OO1J 4USMA 3GJRB 1DGJA 3D6TB 2KG1A 1WAFA 4DV4K 1GQEA 3I96A 5AQWA 2OWOA 2HPUA 4Z6CA 4DFPA 2KIVA 3QU7A 2OPSB 2AEMA 1Q7YT 1DGKN 4RW8B 1J2NA 1HNIA 3OYNA 3G82B 3MUVP 1NGBA 3FQLA 1ZTWA 4KB1A 4KPCA 3SCKE 1AFIA 3O1LA 2WFAA 3J81Y 5GINA 3CEDA 4ED8A 1VISA 3CIPA 2MY8A 2QWLA 4PL8A 1HA1A 4C3KA 1BQMA 2NREA 4H0VB 1S1UA 4M63A 5DMRA 2VJ4A 4AYBC 2MRLA 3M2UA 1N5YA 3E9LA 4LRCA 1VQOS 5AQLA 3NDKA 4QZFA 2IHMA 3R9KA 1ZQQA 4YMEA 2RDJA 5KFPA 4KV8A 7FDRA 3CHWA 1RZTA 2R7YA 3QEPA 1TVAA 3TI0A 1L3SA 4PYDA 2RQMA 2HW3A 1HYZA 2XWYA 4MDAA 3SXLA 5E3AA 1RWWB 4CQ1A 5L1MA