2HVHA

Ddctp:o6meg pair in the polymerase active site (0 position)
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 191
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hvhA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hvhA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hvhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hvhA01
5J0YA 3ZSZA 3D45A 4XIUA 3KLEA 4LH4A 4OKKA 3V9UA 3VQ6A 5DLGA 2G8KA 1Z3EB 5EOZA 3GIIA 4BACA 4RQ3A 1ASVA 1QE1A 2IHNA 3N4MB 2BCSA 8ICKA 3AVHA 4B9TA 3ULDA 1T8EA 5J2KA 2HHVA 3SUQA 5EU7A 3ZSQA 3M8RA 3ZT0A 4F4WA 4ECZA 3PO5A 3OJSA 5KFIA 4JRQA 4PGQA 1ZQQA 5J2NA 2FPLA 4ECQA 1BI4A 4RQ8A 1CXUA 3QIPA 7ICLA 3D0PA 2D0AA 2DPIA 3SPYA 1WLJA 5I3UA 4DTSA 3VQDA 4B8AB 1X9WA 4AHVA 1YTAA 2BCQA 3JPPA 2BPGA 4KN7A 1H38A 4YXJA 4F5RA 4I9QA 2GBZA 1UA1A 4XUSA 4M0AA 2P5OA 2JGUA 4O5KA 4PHAA 1W9HA 4MFFA 1GOBA 4CF9A 1HJRA 3DLEA 4OJRA 5HNKA 1TAQA 3OGUA 5J2PA 1RT2A 1ZQUA 5KG2A 1VSIA 1VSKA 4LZDA 3NH1A 1TL1A 4IRDA 4HYKA 1VSHA 3Q8QB 1K6YA 1SL0A 2UVWA 1RBSA 4KI4A 4E19A 1UT8A 1KFDA 5KFSA 4M9JA 3HYFA 4KLIA 5DG9A 3L2VA 2BR0A 1ITGA 4CJ4A 1LW2A 4QWDA 1QSYA 4N47A 9ICGA 8ICUA 3QEXA 5IINA 2ISOA 4MEYA 2J6SA 4NYNA 4DU3A 2ZJAA 4ZTFA 2BCRA 4I2PA 4DL5A 4KTZA 2F8TA 3AO3A 1MQ3A 4KLSA 4RU9A 4KI6A 5KT3A 3ITHA 5KFEA 3LP1A 1TL3A 3WNFA 4QZ9A 4PGYA 4DL4A 4HTUA 3KHRA 1N6QA 4FXDA 1ZQAA 2UVRA 5KG1A 1XHXA 3DM2A 2OA8A 3MBYA 3HXMA 2R8IA 3FFIA 4CIGA 4DFPA 2BE2A 4B9VA 4CGGA 4QZAA 1IO2A 3OSNA 4DSIA 2OZSA 3U3GA 4FLTA 2J6UA 3H8SA 4RQ0A 2BQRA 5BPCA 2R8HA 3MDCA 2ATLA 3F73A 4M3RA 3RJJA 1L3TA 3NGZA 2HHUA 3V7KA 5IIJA 3GIJA 9ICCA 4GW6A 4GXJA 4UAWA 1NJXA 7ICTA 1GOCA 1NK8A 4FLUA 4PY5A 4HUGA 4CESA 3HP9A 1Y88A 1KFSA 3HO1A 2P51A 4IFVA 4CHQA 4FLZA 4GC7A 3LDAA 2DFEA 3IG1A 1JLCA 1RT7A 3SJJA 3RJEA 4I29A 3SUPA 4CF2A 3OYIA 9ICJA 3FYHA 2HB5A 4CF0A 3K2PA 3WNEA 5DMRA 4RPXA 4DF8A 4CHPA 5KFOA 2AGOA 2ETJA 1S0MA 3ZSOA 2BGWA 3QEWA 2XY6A 4R65A 4RNOA 8ICAA 1S0OA 2IAJA 2HVIA 3QNNA 4Z0UA 2XY7A 3G10A 3MEDA 3AA2A 4QCLA 3AUOA 1Q8IA 2XCAA 3OYJA 3TFSA 4QWBA 3Q8LA 3QESA 4ELTA 1U9LA 4CJ5A 1XSPA 1O1WA 3EPGA 4IDKA 3C5GA 4DQRA 2OPPA 4Z6CA 5HMLA 4FS2A 4O3RA 1WSEA 1RPLA 3DOKA 3CFPA 4ED6A 1A5XA 2JEFA 1Z00A 9ICHA 1G15A 5HBMA 4DTUA 1KVCA 3MFIA 4BWJA 3ALYA 3QZ7A 3E2EA 3V7JA 2HNDA 2B4JA 1U04A 2IBKA 4F92B 3MABA 4EZ6A 7ICUA 1ZQWA 9ICSA 4JUZA 1HPZA 4NM2A 1U49A 4J9LA 2E6MA 3K5NA 2GWSA 4P4MA 3G6YA 7ICEA 4AHTA 3PMLA 8ICFA 3S3MA 3HX0A 4KHYA 4DOBA 4B9UA 3LZJA 5J2QA 4KLTA 2VG7A 1QS4A 1HRHA 4F50A 1SKRA 1ZQBA 1ZQSA 5D46A 1CEZA 1BIZA 4YG2A 1ZQMA 3M9OB 4FJ7A 4DQPA 3EYZA 9ICNA 3BQ2A 1C6VA 1UAXA 3MECA 4PHDA 3TR8A 5HMMA 4E0DA 4IQVA 4CGFA 3PX0A 3PW0A 4DFKA 1C1BA 7ICMA 2OPQA 3RH5A 4Z4CA 2G8UA 2X74A 3SYZA 4JV1A 2MUTB 1BPXA 4RNMA 3NHGA 2X6NA 4C8KA 2X6SA 2G8IA 5J2CA 4O3PA 1MC8A 3OHAA 3OSPA 3O3HA 1CZ9A 7ICPA 2Q0ZX 2DFLA 4FW2A 3BJYA 1S77D 3IHQB 3ZT3A 4O5CA 3RJGA 5SZTA 4JS4A 4OGCA 4F4KA 4YNQA 1JXEA 4OVLA 4EP5A 3H4BA 3LAMA 4M3ZA 3SQ1A 1LWCA 1XU4A 2Z1IA 3M8PA 3NF9A 1WAFA 5KI6A 3OS2A 4O55A 4GXKA 4CGJA 3CFRA 3KD1E 3QNOA 4G3IA 3ISCA 1RXWA 2NRZA 4CK2A 1JKHA 5L9XA 4R63A 5CYMA 2IDOA 1SL1A 4J9PA 2ISPA 3VQ4A 1SZPA 2ATQA 5J1EA 3KD5E 3MDAA 1QQCA 4CE9A 1YVUA 4HUEA 2YNGA 3RAQA 2AGQA 3B6OA 1QHTA 2AJQA 4I2JA 1JLBA 4QZCA 4EBEA 2XGQA 3VQAA 4QWEA 2RN2A 4J9NA 3K5LA 2V4QA 1BPEA 3OYBA 4UBBA 4DL2A 3FDSA 1T05A 4M9GA 3L2UA 3G6XA 4ZH4A 3TAPA 4CHYA 1VSFA 5DB8A 4CGHA 1I39A 1JIHA 2E4LA 3HW8A 3CM5A 3JPOA 2VA3A 3V9ZA 1VSMA 2F1JA 1RT4A 2BGGA 1RILA 2ZJ8A 4UB4A 4DG1A 2O4GA 2YNHA 4KKOA 4PA1A 3MR6A 1C0TA 4KLEA 3QLHA 5F9NA 4CF1A 2PI5A 3NCIA 4J2EA 1TAUA 1HMVA 3PX6A 3LWLA 4F4YA 2OWOA 3AA5X 5IIOA 3V9WA 4CJUA 1JX4A 4DFMA 3VQQA 4TQSA 3K5MA 4CEZA 4M3UA 4F2SA 2FMPA 4FZZA 3HJFA 3SQ0A 1EXQA 3T1AA 4C8NA 2Z1GA 3C2KA 4Y1DA 2HMIA 2IGIA 3PR4A 5DGBA 4KMUA 3TANA 9ICRA 1BISA 4Z4HA 4Z4FA 2JEIA 4LSLA 1RTJA 2G8VA 4I2BA 5KGXA 2FBTA 4K8ZA 1BIUA 4RUCA 1S97A 2UVVA 1XO1A 9ICXA 4R8UB 4P2HA 4NLZA 1HYVA 3MXIA 1S6PA 3MAQA 4O3NA 4RPZA 3L2RA 1RBUA 3ZSXA 5KT5A 1BGXT 1KDHA 4FLXA 1J54A 3EWAA 3U6FA 1TK0A 1BQNA 2W42A 4B3OA 4CHZA 4YD1A 1D5AA 2LYHA 3KKSA 3VA0A 4FJLA 2QKBA 5J2HA 5J2AA 4DQSA 3P1GA 3RJFA 1IH7A 4ECTA 4DFJA 4DEZA 3TARA 3Q8SB 2QKKA 3C94A 1PZNA 4PGXA 3AO5A 3LPTA 3LP0A 4GXIA 3DLGA 2G8FA 1NJYA 1DTQA 3V6DA 3AVAA 4I9LA 3QERA 2DFHA 4O9MA 4TSXA 1RYSA 1TK8A 4AH9A 1EX4A 3GIKA 3TABA 4O5BA 4FLVA 4M41A 2IOCA 4HCBA 4YVZA 1D9DA 2YNFA 5DG8A 4QAGA 3LDSA 3V72A 1NK0A 4ECWA 4XRHA 8ICNA 4CJKA 4ECSA 4KAZA 1B43A 4FLWA 4ECUA 1N5YA 1NOZA 2AQ4A 4LD0A 3F9KA 4YFKA 2ZTDA 4O5EA 4I2QA 3PUFA 2W9BA 7ICKA 2DY4A 4KREA 5CR0A 4DWIA 4BDZA 4FZYA 5KFAA 4OPJA 1BI4B 4CJPA 2P5GA 1QTMA 3RMDA 3SV3A 4CEDA 4YR3A 4FJ9A 4AHSA 3ZDCA 4CJSA 4ID5A 5DG7A 4QWCA 4RW6A 3RTVA 7ICHA 5DK5A 3E01A 4YD2A 1KVAA 3SQ4A 3K58A 1NOYA 2A1JA 8ICRA 4NCBA 4BXOA 5J0XA 4TUSA 8ICCA 5KFXA 4I2HA 4CEEA 5D49A 4HVJA 4Q45A 4L8RB 3DLKA 4F91B 2KZZA 5KFVA 1BPBA 4XQ8A 5EWFA 5KT2A 8ICLA 4W5NA 4DTPA 2E6LA 9ICLA 3GV5B 4F8RA 5KT4A 1ZQGA 3HK2A 4BE1A 2KW4A 4KHWA 1TV9A 3RMCA 3OYAA 4BDYA 5KFBA 5DBCA 3NE6A 5J0PA 2ZUDA 1ZQJA 4F2RA 5KFDA 3O4NA 4FJJA 3IM1A 1FKOA 2YV0X 4KLFA 4M9HA 1JLAA 4I7FA 1TKXA 3OYGA 3CFOA 1T3NA 4JRPA 1RCHA 3T5HA 2HNZA 5J2MA 4CFBA 5KT6A 3H8WA 3NF7A 3C5FA 1JLGA 2OPSA 3MR5A 2V9WA 1B9FA 1RYRA 3JSMA 4RG8A 3KKRA 5HHIA 5CA7A 8ICIA 4DL7A 1S1UA 4CJQA 2B6AA 1SKSA 1A5VA 3N97B 4JV2A 2BHNA 3KJVA 3G0ZA 4W5RA 2QK9A 1ZQXA 3KK2A 1NKBA 1D8LA 2FLLA 4CK1A 2O4IA 3CYMA 3JPQA 1SKWA 1ASUA 2D0CA 3KLGA 5KFWA 4C8MA 3AVMA 2BQUA 4FK0A 4ELVA 1MSWD 1UWBA 3NFAA 3RBEA 2JEGA 5DQGA 2KN7A 4W5TA 4TURA 4B9SA 4CJWA 1T7PA 4DQIA 4DU4A 3HPOA 4ECRA 4M3WA 5IILA 2PZSA 5EWGA 4K4IA 4FJKA 4B08A 2R8JA 9ICIA 3PX4A 4C8OA 4DTRA 4FJIA 5JS2A 1S9GA 5D4BA 4UQGA 3TI0A 4KTQA 7ICRA 2A1RA 4E7LA 4DSFA 2HHSA 3V81A 4IG0A 9ICFA 3LZIA 4CGIA 5T7BA 4M3TA 3DLBA 2ASDA 3WNGA 5DQHA 1QSSA 4E7KA 1VSDA 4J2BA 5K14A 2NRWA 4ZTJA 3ZDAA 3OYLA 1S9EA 4XA5A 1ASWA 3UQ2A 4FBUA 2DTUA 4C8LA 2JEJA 3OYNA 3I0SA 3ETLA 3BQTA 3OYKA 1HYZA 2HVHA 3AO2A 2ZTEA 3RR7A 4RQ2A 7ICFA 4QOZB 3HVRA 1VSEA 1X9SA 3DI6A 3RJHA 5DDMA 1UT5A 3OYHA 3RJIA 4AILC 3ZT4A 5CYQA 5J2BA 5J2IA 1RBTA 1DTTA 9ICWA 4O3QA 4O0IA 5J29A 1XS9D 1A76A 4O4GA 2JZBB 4M47A 8ICJA 2A1SA 2ZUCA 4ED8A 2EX3A 1BPDA 4Z6EA 3ZSWA 1KLNA 4J2DA 4FK4A 4KPYA 4EZ9A 2HHTA 4YQWA 8ICSA 4UB1A 4CEFA 1Q9YA 9ICTA 4FJMA 7ICIA 4H4OA 3JPNA 4HCCA 5IIMA 5HRPA 2G8HA 1YT3A 4B9LA 1IM4A 5KFNA 4RNNA 5E41A 2HHXA 2OYQA 2G8WA 4Z4EA 2FC0A 2RDJA 1KRPA 2GUIA 1A5WA 2F1IA 4NCGA 2DPJA 1CXQA 2PXIA 1ZBHA 3KLFA 4F3OA 5SWMA 3C6TA 4KLQA 4EYHB 4KLLA 2KQ2A 4I2EA 4J9QA 2UVUA 3Q8PB 4DF4A 1S1TA 3PW7A 2NUBA 2R7YA 1ZQVA 3OY9A 1ZQEA 4E1MA 3QEIA 3T5JA 2PYJA 1WSIA 2PFPA 1BCOA 2D0BA 1L3UA 4F5QA 5DGAA 3AVKA 3H7IA 4NLKA 4N5SA 3VQCA 3VQ5A 4KV8A 2XHBA 4BDPA 4FM0A 4DSKA 2ZQBA 3SCXA 4CJ3A 3ASMA 3AVBA 3LAKA 3H4DA 2Z1JA 3OS1A 9ICUA 1TKTA 4DTOA 3S3OA 5HLFA 3RRHA 3RH6A 1ZJNA 4W5QA 4FM1A 3QE9Y 5DDYA 2OZMA 4IQUA 8ICEA 2FLPA 3K75D 1J53A 2VWKA 5CWRA 3RB4A 1S0NA 5JS1A 1MQ2A 3ORYA 3DMJA 4M6WA 1EKEA 3ZSVA 3QIOA 1EXNA 1J5OA 4PH5A 5J2EA 1BL3A 4J2AA 5J2DA 4UAZA 4CIFA 1W0HA 4FLYA 3DRPA 4H4MA 4B8CA 4I2CA 9ICKA 1TKDA 4GMJB 1QSLA 4CJVA 2YHBA 3P5JA 4FJNA 1VRTA 4QZ8A 2NRTA 3QZ8A 3L3UA 1MU2A 3UPQA 1IKXA 2PFQA 4DTJA 3K5OA 3LK9A 4K4GA 4FJHA 4TUQA 1VK0A 4K4HA 2FBVA 4KB0A 2KZMA 1WAJA 1Y97A 1B9DA 4EEYA 8ICBA 1TV6A 4X5VA 4J9KA 4DOCA 7ICJA 3M9MB 3QEBZ 3ZT2A 1RXVA 3KTQA 9ICOA 3OYEA 4KRFA 4JWMA 4I2FA 4PWDA 8ICQA 4FJ8A 1REVA 1CUKA 1KEJA 5HRNA 1ZYQA 4DS4A 4KFBA 5KGWA 4MQ3A 2C22A 1RNHA 5J0RA 1HJPA 1JMSA 5KFUA 4MEXA 4PHEA 1Q9XA 4Q43A 5DB6A 3TAQA 2FLNA 1RT6A 1LB2B 4KLOA 1RBRA 5F9LA 3KLHA 2ALZA 4KHNA 1JXLA 4ELUA 1ZQPA 4GC6A 1KFTA 1ZQIA 4IRCA 4HHTA 3DOLA 2VG6A 3KK1A 1KSPA 2C2EA 1ZQYA 3RBDA 3SQ2A 9ICAA 5FROA 3SNNA 5DBBA 1WSJA 1LAVA 2F1HA 3PO4A 4BGDA 5KFTA 3P83D 1RDCA 5C25A 4TQRA 5KG6A 3KHGA 2XRIA 3CQ8A 4H8KA 3VQ7A 3SPZA 2W9CA 4CGDA 1KCFA 3OYDA 3THVA 1XWLA 4RPYA 4CFCA 1U45A 1D9FA 5IIIA 3C2MA 8ICGA 4QZEA 3CM6A 4K8XA 3BGRA 7ICQA 2PY5A 3SUNA 3UQ0A 5I42A 4RQ7A 4UB5A 1N48A 1LWEA 3V1RA 3M8QA 3TAGA 3U3YA 5FDLA 2ZTCA 4GVMA 2ZJ5A 3AVGA 2AGPA 1RTIA 4AHCA 1FXXA 4ICLA 3RWUA 5L1IA 2HHQA 3PVXA 1WNSA 1EETA 1ZQRA 4FJ5A 4LH5A 2ASLA 3QEVA 1UOCA 7ICOA 5C24A 1UA0A 1U47A 4M04A 5KFCA 4YMMA 3UIQA 4O0JA 3VQ8A 2W9BB 3QINA 3PW5A 4CHOA 1BPZA 4F4XA 1RTHA 4PPXA 3SUOA 5DLFA 5EWEA 2HNYA 2WTFA 4RW4A 4DU1A 2EHGA 4NY8A 4Z6FA 3RRGA 1VRUA 4EBDA 4QZDA 2GV9A 4ED0A 3V6KA 3MXMA 4B9NA 3TWHA 3S9HA 2FPMA 2P6RA 1JLFA 5KFQA 7ICGA 3GILA 1NK5A 2YKMA 4ECVA 1XSNA 4QZFA 4IQTA 4QWAA 1K1SA 2A1JB 4PHPA 3BQ0A 4LZGA 2KTQA 3ZDDA 1I3AA 3ZD9A 2XCPA 4MFBA 4BXOB 9ICMA 3QEPA 3M9NB 3C21A 4R5PA 4I28A 5HHHA 1C0UA 2Q3SA 4AHRA 5J0TA 4UBCA 4DS5A 3DYAA 3H40A 3OHBA 3ISBA 1GOAA 2X78A 3MXJA 3MR3A 4M9NA 3G6VA 3ZDBA 4O44A 3C2LA 3AO4A 2BPFA 4FW1A 1HQUA 4IKFA 4IG3A 4R66A 2ZUBA 5J2GA 1CZBA 4RQ6A 3AV9A 9ICPA 5KT7A 4CJEA 1VSLA 4FYDA 1ZQDA 1SV5A 2BPCA 4M2YA 4IRKA 3T19A 3B0XA 2YKNA 4IQWA 3RB6A 3RJKA 8ICHA 5KG0A 2HW3A 4Z6DA 2KFZA 4FS1A 5KG5A 3JYTA 3MFHA 4MFCA 1TVRA 4KN4A 3V6JA 3LPUA 4CK3A 2V4RA 1IKYA 4WE1A 1JXBA 5HRSA 3LANA 2BDPA 4BWMA 3LALA 4KITB 4CIEA 3EY1A 3QO9A 9ICVA 1WCLA 4LSNA 3AVFA 3JPTA 4ID1A 2Y1IA 3C1YA 5HROA 2XC9A 1C1AA 1ZBIA 3I8DA 4JV0A 1ZQTA 2FMSA 1NK7A 3BDPA 7ICVA 3AU2A 3L2QA 3L8BA 4CJRA 4E3SA 3QEAZ 3C95A 4J9MA 2YHAA 1ZQHA 2XY8A 1BCMA 1WCNA 4FVMA 3Q8KA 5J0SA 3V9XA 1HNIA 4FCYA 1WSGA 3OS0A 4RQ4A 9ICBA 3S3NA 5KFZA 5FRMA 3VQBA 2W9MA 4FBTA 1BHLA 1S76D 4F4ZA 2F96A 1A77A 4Q5VA 4ED1A 4KLHA 1ZBUA 5TZVA 1S10A 4RQ1A 1L3SA 4F5OA 4CF8A 3ZT1A 3EZ5A 1AROP 3UXOA 3GQCA 4DMNA 3HPGA 3RH4A 4G1QA 5C42A 1RT3A 3TFRA 1HUZA 4NLNA 4P4PA 4ED2A 4YR0A 3NGYA 2Y1JA 5FRNA 3PMNA 2ASJA 1R0AA 3RB0A 2HHWA 4OKJA 3RR8A 1X2IA 5J0QA 5KFLA 4CCHA 2PYLA 5L1KA 4E7JA 4RT3A 1S1WA 5J0WA 3ZSYA 1T03A 1JL2A 2B5JA 1RDAA 5L1LA 4N56A 1S6QA 4OLAA 3NTUA 8ICWA 3VN5A 3HL8A 4F5PA 4CJLA 2MAXA 1ZQNA 3PY8A 3LWMA 2H5XA 3JPSA 4E1NA 4I2IA 3AVCA 4I2DA 3NF6A 2B21A 4KHQA 4CERA 3UXPA 5JUMA 4FZXC 2RPIA 1NKCA 2IC3A 1L5UA 1TGOA 2IA6A 1C1CA 4I2GA 1S0VA 3V9SA 3GDXA 1D8YA 2KFNA 3VQ9A 4QZHA 1Z00B 2M9NA 2XY5A 2YNIA 2AU0A 5IIKA 1U48A 1HNVA 3RB3A 3LP3A 4DTNA 3VQEA 4YMNA 3SZ2A 4MFAA 4TUPA 1BPYA 9ICEA 4RW7A 9ICQA 8ICZA 3K59A 5BOMA 5CJ7A 1COOA 4HUFA 4DSLA 1YTUA 2IHMA 4Q8FA 4O3SA 4J9RA 3PW4A 4DTMA 1NK4A 4ED7A 4M42A 3HM9A 3DRSA 3NDKA 1N56A 3L3VA 4R64A 1NK9A 4Y1CA 4YP3A 3M8SA 4DL3A 3A2FA 2KZ3A 5J0UA 4JK1A 4CFDA 4Q44A 2C28A 4N76A 4EYIB 7ICSA 3HWTA 1JL1A 2VA8A 5J2FA 1TFRA 3SV4A 2ITGA 1TK5A 5HRRA 2F8SA 4KTWA 1KTQA 5KFJA 5HP4A 5KFRA 3VQPA 3EW9A 2BKEA 4E7IA 2FBXA 1ZQZA 1JLQA 4F3TA 3AVIA 4CEQA 1F21A 3ISNC 1WSFA 3Q8RB 4DSJA 4EBCA 4JWNA 3GFKB 4J9SA 1T4GA 2W8KA 3PNCA 3NAEA 5CP2A 4M45A 3OYCA 2BCUA 4CECA 1SL2A 1S5JA 2C2RA 4RZRA 1ZQOA 4UAYA 4Q8EA 2ZE2A 3NH0A 3V4IA 1NKEA 2RDIA 3B6PA 2JZBA 1ZQCA 2BANA 2QXFA 4NYFA 3NH2A 4DTXA 1WN7A 3AU6A 8ICPA 2BCVA 1WSHA 2I1QA 2JLEA 4M6WB 3JPRA 3RMAA 3H08A 4JLHA 3H8JA 2PI4A 3DRRA 1VSJA 2AQ0A 3RMBA 1BQMA 3B0YA 1L3VA 2WOMA 4BE0A 4E7HA 1FKPA 2VANA 4YN4A 3C6UA 1TVAA 5KFKA 2LSNA 2VG5A 4IR9A 2P1JA 4M3YA 2P66A 5J0OA 4F93B 1DLOA 3MR2A 1IXRA 1KLMA 3KIOA 3K57A 2XGPA 3PV8A 3MEEA 4P4OA 1IKVA 4B9MA 3O4QA 3TAEA 1TKZA 5BOLA 3MGIA 3C23A 4KB1A 2P6UA 3L2WA 4KLGA 5KFPA 5CHGA 4CJTA 4OPKA 1DGSA 3KHLA 3HVTA 4AHUA 3K4GA 2J6TA 1ZJMA 2R8KA 3ZD8A 2MUTA 3DLRA 3I0RA 4QZIA 1XI1A 3T5KA 4IBNA 4IFYA 1LWFA 4MF2A 4ECXA 8ICOA 4KO0A 5KFGA 4KLUA 2W9AA 1RDBA 2WONA 3VA3A 2BQ3A 4UB3A 3PR5B 3HP6A 4ZHRA 1J9AA 4F5NA 1EP4A 3V1OA 5KG4A 4DQQA 1HQEA 4BE2A 3ZSRA 1NK6A 4KLMA 4CJFA 4QZGA 2FMQA 4O3OA 4YCXA 3ZDEA 1RT5A 4RW8A 8ICYA 4LY7A 3EPIA 5DKWA 1FK9A 4ECYA 1BVSA 4YFUA 4I2AA 3T5LA 5KFFA 3TAFA 3Q8MA 5CB1A 1C0MA 3ISDA 1QLNA 7ICNA 2FBYA 4KLJA 4J9OA 4DSEA 3KHHA 5L1JA 3HT3A 1B22A 3V1QA 1ZBLA 5DBAA 5CY4A 1U4BA 3AA3A 1S1VA 4CEBA 2W9CB 1ZQKA 4FJGA 4DLGA 4Z4GA 4GLXA 3HPHA 3TQ1A 2I5JA 2NRXA 4DL6A 1XHZA 3IAYA 4LVSA 1CLQA 1IG9A 4RQ5A 3V6HA 1RT1A 4PQUA 3NGIA 2W8LA 3GIMA 4UB2A 4RT2A 3SI8A 5KFHA 3NGDA 2Z1HA 4DO9A 3GV8B 3C1ZA 2I9GA 4M9LA 4M3XA 3UXNA 4FJXA 4N41A 3O3FA 5CZ2A 1ZETA 1RDDA 1SUQA 3OYMA 2IS3A 1Z25A 1X9MA 1K1QA 1KVBA 3HSTB 4IR1A 2RKIA 8ICXA 5C5JA 2R8GA 2PFOA 4FK2A 3T3FA 3BQ1A 1XC9A 4KLDA 2RF2A 1RBVA 4Q0BA 8ICTA 4Z4IA 1LW0A 4OLBA 1S1XA 3MEGA 5DB7A 1C7YA 4RW9A 3OVNA 1NJWA 4DLEA 2PFNA 3AVJA 4CHNA 8ICMA 1X1PA 5DB9A 1NJZA 1JN3A 5KG7A 2OPRA 1ZQLA 3IRXA 4NXZA 4MF8A 3TAMA 3DLHA 3NBPA 4JS5A 4KHSA 5KG3A 5D3GA 4W5OA 4KHUA 4CFAA 2XO7A 5KFMA 5KFYA 1HUOA 3AVLA 3IS9A 1ZBFA 2DFFA 3CG7A 2FPKA 1ZQFA 1S9FA 4NLGA 2VWJA 1Z26A 4R8UA 3V7LA 3AVNA 4QW9A 4RUAA 1DOQA 3SI6A 4NCAA 1HYSA 3OYFA 1IKWA 4FM2A 4EP4A 4OKEA 1RTDA 2ZD1A 4DOAA 4I27A 5KTQA 5DQIA 5KRSA 4YMOA 3AA4A 4CEAA 3QETA 3OJUA 3MGHA 2NRVA 3KLIA 4PUOA 2IMWP 4YXMA 1XSLA 4E89A 2D5RA 3LP2A 1RZTA 8ICVA 1V9PA 4QZBA 1JLEA 3RAXA 3GV7B 4OGEA 3ZCMA 4ED3A 5KRTA 4NM1A 3WNHA 1LV5A 5J2JA 4QW8A 2C2DA 4YR2A 3PW2A 3KK3A 1B92A 5HP1A 3NF8A 1LAWA 2VA2A 4CEOA 3O3GA 4FO6A 1NOMA 5CZ1A 3AO1A
chains in the Genus database with same CATH superfamily
3ZSZA 2XMAA 3L4PA 4LH4A 2HBYB 1F5CA 5DDRC 5DLGA 2G0CA 2UU9K 2BE7D 4LJXA 1JXVA 2GIQA 1FESA 3C15B 3OXFA 4LFCF 4BVOA 3J80O 2WF8A 2BCSA 8ICKA 3ULDA 2EH9A 3SUQA 5EU7A 4HVZA 3PO5A 4H5VA 1ZQQA 5IFMA 2P9SA 4O0NA 4RNFA 3D6TB 2DBBA 2FPLA 5D0HA 4KGVB 1J2VA 4A62A 4RQ8A 2DPIA 3MGVA 2KJ9A 1U8WA 1N32J 4DTSA 4P0QB 4YUDA 3KK2B 2ZHBA 3D2FA 4B8AB 1X9WA 5C42B 5KQDA 3JPPA 3U8XA 2WSFC 4KN7A 1H38A 3J7ZT 4XUSA 3E3XA 2P5OA 2O6KA 2JGUA 2KT2A 1ITPA 5AI4A 4OJRA 1R0AB 1Z4UA 4LZDA 3BV8A 3NH1A 1VSHA 4JK8A 2R3VA 1Q8BA 1UPHA 4X66J 5HK4A 2J0QD 3Q2TC 3FR0A 3HYFA 2YB4A 1T03B 3H2VE 2C3YA 2NQPA 4KLIA 5AZIA 3L2VA 2BR0A 1ITGA 2K4IA 2WFAA 1CULA 3NEKA 1URRA 1QSYA 2A18A 2D4WA 4JYAJ 4NLSA 5BR8F 4LFAJ 2R7VA 4DU3A 2ZZNA 4DL5A 3EGWB 1MQ3A 3FRZA 3NUQA 2GELA 3NVZA 2W2PP 4CZJA 1BD6A 4F0HA 4FZNA 1JUDA 2IC3B 3D5MA 4QIWF 4QNLA 4DL4A 3R7NB 1N6QA 3D3BJ 2YNIB 4LF2A 1VHXA 2DNNA 3PZPA 3FFIA 3SAHA 1X0FA 3VAGA 2BJ1A 1RACB 3AODA 4L3QA 2Q66A 3P5TL 4FF1A 3NL0A 4LC9B 3OSNA 3VAJA 2YXLA 4FLTA 3TX8A 3HD2A 4ALZA 4RQ0A 5BPNA 2BQRA 3C0BA 4N77A 2GWJA 3QBCA 5HVHA 1C20A 1L3TA 3I56S 4DV7J 3GIJA 4GW6A 2CKWA 1GOCA 3G96A 4QYZJ 4BVPA 3R5BA 3DLLL 1Y88A 1KFSA 1F9HA 4GC7A 1JLCA 2E5SA 2I5HA 4I29A 3NGKA 3FYHA 2HB5A 3WNEA 3MHYA 3BH7B 1GMUA 5DMRA 4QU6A 3UKRB 2AGOA 1S0MA 4BR7A 3R5GA 2XY6A 3QT5A 3KJNB 1K0VA 3D6FB 3WZ0A 3QNNA 1I5OB 4K4VA 3HKZD 3GJQB 4KX5A 3OYJA 4ZPAA 3TFSA 3QESA 2HS0A 4Y34A 2OHFA 4CJ5A 1XSPA 4CM2A 3IM8A 2WVDA 3PNIA 3KLFB 2ZIVA 1B0VA 5HMLA 4FS2A 1E6VB 4KPCA 4DV0J 1RPLA 1BWEA 1Z00A 4C11B 3V4IB 2ZIWB 4YY3J 3D6MB 3PYFA 3E2EA 2K2PA 1X5TA 1QJHA 2D0PA 4ZVOB 4NB4A 2B4JA 2IBKA 7ICUA 1ZQWA 5E3QA 4JUZA 3ET6A 4AE5A 1YG0A 4CLWA 3AQFA 1AZSB 3G6YA 3BN7A 3TA0A 8ICFA 4B3RJ 2HQFA 2CXYA 1N5VA 4KLTA 2FUG9 3DNCA 4DR2F 1ZQBA 1ZQSA 5D46A 1CEZA 4BC9A 2IRUA 1BIZA 3GTYX 4YG2A 2ASOA 1SQEA 2VJVA 1GT8A 4NLXA 3TUPA 4NV0A 1JK9B 2HDOA 1SC1B 1ZQMA 5EN1A 2UUWA 4DQPA 3EYZA 1HR0J 4IH6A 1TKZB 3IG8A 1GK8A 3WX4A 2UXDJ 2WVFA 3TR8A 1PC5A 5HMMA 3R1LA 3MPUB 4O8KA 4LF6K 1N8RO 1FCAA 2AW0A 4CGFA 3PX0A 3THPA 5GAGI 4DFKA 3HLUA 3CD5A 4OJGA 3EGZA 3RH5A 4Z4CA 1T11A 1UW9A 1FRLA 4JV1A 2MUTB 4RNMA 1SJ1A 4C8KA 4IFYB 2AP1A 2K8CB 1Q3UA 1QZ5A 2EDUA 4BRNA 4OV1A 2IM0A 1XQSC 3POTB 3WQUA 2Q97A 2E88A 3OHAA 4KH5A 1EP4B 5IT4A 7ICPA 3LF0A 1GLBG 3IHQB 2OANA 2A3VA 4X4RA 4EUVA 2H5EA 3KKFA 2GX8A 2WHOA 3ZZYA 1JXEA 1FK9B 1KC8O 3H4BA 3LAMA 2B4UA 4Y2XA 1KKXA 3JTOA 4H5TA 1VQ4N 2Z1IA 3NF9A 3D1OA 1RAJA 2GUPA 4M94A 1EAYC 1DGKN 1VQMN 4G3IA 3ISCA 4AF1A 1SKUB 1RFQA 1QY7A 4YOXA 5L9XA 4R63A 1WORA 1SJ4P 4IYQA 3PRDA 1JJHA 1SL1A 2P6TA 3CDWA 3MCSA 5E2QA 1VQPN 4PABA 1CJTA 4FKXA 1ELOA 3MDAA 1QQCA 3ULEB 2DJWA 1FRKA 2BUPA 4HT7A 3EMTA 4I2JA 4QZCA 2HQIA 4A8XA 4EK2A 2UUBJ 3HRDD 2Z4PA 3A4TA 1QQOA 2M3DA 1KVJA 3HHDA 4TYAA 2UUAF 5AFUA 2VC1A 1SWWA 4LBHA 3QWUA 1ICEB 4M9GA 2RHSB 2ZH2A 1X4HA 5B7WA 4URQU 1BC6A 4CHYA 3JAMY 5DZ6A 1WBDA 5DB8A 4CGHA 4FXWA 5AE1A 3BZKA 3M2VA 3OR1B 4B3SJ 3IGNA 4JAXA 3F2DA 1U0HB 2YHYA 4M5KA 3TW0A 3MR6A 1I3OB 2VBZA 4CF1A 1X7VA 5I42B 2WRMA 2PI5A 4CO3A 4OL8A 5ALGA 1L3KA 1HMVA 4K2JA 3PX6A 2OWOA 1S1XB 3AA5X 1NB2A 1S8OA 4TQSA 3BO3A 1VLYA 2MKSA 2FMPA 1RTIB 3FRYA 3VEOA 1VQ5S 1PYOB 1EXQA 4F9OA 4Y2PA 1YX2A 4OYZA 4YS2A 1X31C 2Z1GA 3C2KA 4Y1DA 4NO7A 2IGIA 2FSNA 3LVVA 2ZH9A 3TANA 1CJVB 2C1EB 3RW7A 4Z4HA 3QNWB 2JEIA 4CP5A 4CZCA 4USWA 1RTJA 1VBXA 2FBTA 2J7WA 4RUCA 1VRQC 1KAZA 3Q8UA 2DXDA 4P2HA 2HCFA 1WF1A 1X3MA 3LGNA 1UFWA 3GYXB 2VICA 4JI4K 2KN4A 1JLFB 1HYSB 1IKWB 1UMJA 5KT5A 2A40A 1BGXT 2EFOA 1HIWA 2ZD1B 1HQ2A 4DHVA 2C2ZB 4BJQA 2OD4A 2W42A 1ESVA 5M1QA 1IBKJ 3ZX0A 4KT0C 4YD1A 4Y2AA 2UUCF 2LYHA 3M6XA 1QAIA 4DQSA 2R7TA 4R5PB 2VKRA 2Y0SD 2H54B 3F41A 4ZPDA 3OFGA 1IH7A 3Q24A 1FWLA 4DFJA 2N82B 4DEZA 4FL9A 3CCMN 3Q8SB 2CJAA 1PZNA 4PGXA 3LPTA 2IPOB 1DTQA 2OIHA 3PTWA 3DU6A 3V6DA 3VAFA 3AVAA 1TL5A 5ALYA 2B9WA 2GW8A 2ZM6J 2DL0A 4NXNF 5G5HA 1TK8A 4A5AA 5GIOA 5AQFA 3TABA 5GIPA 5ALOA 4Y2RA 1WOPA 4OHVA 3WEEA 2MTLA 5CXTA 5DG8A 1M5VC 3LDSA 2NRHA 4CJKA 2VOPA 2VD3A 1U25A 4ECUA 2YWHA 2LCWA 2DGOA 4LFBK 4LD0A 4JYAK 4LFAK 1O08A 3FEZA 4HWIA 7ICKA 2YCHA 2DY4A 1U26A 2F4FA 2VJUA 5KL1B 5ADZA 2P9SB 5KFAA 5AKZA 3SAFA 3CT9A 1RB0A 2MGZA 1P27B 4B6JA 2DXFA 4CEDA 4YR3A 1VK8A 4A48A 5HQLA 1HHSA 4CJSA 3JS9A 4QWCA 4LF8J 1B7YB 7ICHA 3E01A 5A76A 4YD2A 2W4DA 3D2FB 4ZVQB 4ZLJA 3K58A 2A1JA 4H5WA 8ICRA 4Z7CA 5BR9A 4FWRA 9ATCB 4M95A 4DV7K 5ALUA 2YKQA 4GNIA 4WXOA 4ILLA 4FVUA 2A10A 4QYZK 1F44A 4L8RB 1UETA 1S6UA 2RH3A 1OPIA 4HHHA 3D68A 5AZIB 5EHHA 5EWFA 3EKUA 2HGMA 2B8PA 2AJ1A 4A5BA 2KMDA 1CULB 4P6QA 9ICLA 7FD1A 1ZQGA 3AQEA 2KW4A 5D6GA 2VCPA 2G06A 2E5HA 2ZUDA 1I94J 2KJ5A 4RU2A 2HOFA 3P4IA 5C2FA 2YMLA 2YV0X 3EO3A 5GTHU 4I68A 2FY1A 1JLAA 1N6QB 2E1ZA 3TUIC 3OYGA 5AJ3F 1T3NA 3FFIB 1RCHA 4MHVA 2JNJA 5J2MA 1K8KB 4JRPA 2QYGA 1U2CA 3H8WA 3NF7A 2OPSA 2V9WA 1V3SA 4B1XB 1RYRA 3JSMA 2COLA 3KWMA 4L72B 4DV0K 4KIAA 8ICIA 3MF5A 4DL7A 3NLCA 4CJQA 5A8KA 3N97B 4JV2A 4HACA 4D3GA 4WTYA 3O1BA 4GO5X 1NRKA 5H1SQ 1NAQA 5D4OA 1TFWA 2FLLA 2O4IA 3CYMA 1U09A 1JLCB 1H2VZ 3D1QA 1V85A 2D0CA 2F9DA 1R27B 2I38A 4B3RK 3K9JA 3SCJE 1UWBA 4ZLNA 3RBEA 3O1WA 2CNNB 2KN7A 4MAKA 3H1QA 3GYGA 1T7PA 4DQIA 2C3OA 3P45B 1R8HA 2XHCA 3MPYA 4DPUA 1FF2A 3VVTA 3PX4A 1HR0K 2F7TA 1NGDA 3NVKA 4CBUA 1DARA 2Z30B 3SQOP 5JS2A 1S9GA 2EC2A 4GV9A 1R43A 1QH9A 2UXDK 2WAQF 2KO1A 3BEXA 3BGLA 3V81A 3EL2A 2LM1A 2OELA 5AQVA 3TUJC 4E7KA 1VSDA 2W4PA 3F0NA 2X1AA 4IO8A 5AQPA 3AJ1A 3CC2S 5SUHA 3OYLA 3HFKA 3MMJA 2L08A 3GPAA 5HMYA 4UATA 1YJ7A 4C8LA 1N34F 3I0SA 3ETLA 3ET6B 2DR6A 4BCAA 1HYZA 2HVHA 1K0TA 2MQLA 2ZTEA 2Q4TA 3RR7A 3IKMA 3L3CA 3JAMU 3VTIA 4M5NA 2G0IA 1YJNS 7ICFA 4QOZB 1PJ7A 3DI6A 1QAXA 1M5SA 5AI9A 3OYHA 2FJEB 4O3QA 5J1PA 3GBTA 1DURA 3NRWA 5IT9Y 1G1XA 3EE8A 2ITMA 4ED8A 5ALNA 3VHQA 4PZVA 1BPDA 2MQ8A 4EGLA 2KJWA 2YX1A 2PGCA 4EZ9A 4YQWA 2M70A 4OZNA 4UB1A 1B64A 9ICTA 1AUSL 4BC3A 5EY4A 3HMJG 4EX6A 4H5RA 2Q6BA 1FKPB 1PIEA 4GO7X 4MJKA 4RNNA 2M0GB 2HHXA 3GZFA 2DNMA 2GUIA 5ADXA 1B0TA 2ZH5A 1A5WA 2DPJA 1CXQA 1FRMA 2FVCA 2PXIA 1ZBHA 4CRJA 1HLWA 3BF3A 4WFNL 1FRJA 3C6TA 1KBUA 2KQ2A 3G9CA 4U95A 4NL5A 4OYAA 2XWYA 4A8OA 2V0NA 2DCUB 3FKBA 2WB1F 4JI2K 3QEIA 2H3VA 2PFDA 3PG9A 3QUBA 4BRPA 5AKEA 4NLKA 3VQCA 4KO0B 3VQ5A 4KV8A 1UFLA 9ICUA 2AZ1A 5HLFA 2QLXA 5I9EB 3ZTPA 3SQIA 4FPRA 4LR8A 2OZMA 1CJTB 4IQUA 1J97A 3F2CA 5EX3A 3SLCA 1D3WA 3ATUA 3UE2A 1CS4A 1DT9A 3K75D 2OAUA 2E1FA 5CWRA 2YH0A 4M1KA 2QWLA 3CJSA 3JAMO 3QRQA 3DMJA 2RUGA 3OTOK 4M6WA 2UXCK 3ZSVA 2CDRB 2MPUA 5AQOA 3QJLA 5IXUA 3IBPA 3FQLA 4CIFA 4HTLA 2NXEA 1VC0A 4HH1A 4AD6A 3DRPA 3B78A 4H4MA 4B8CA 4I2CA 1CC8A 1T6CA 3UE5A 1TKDA 3M1YA 4RWXA 3T6JA 2FY8A 1FDBA 3M2VB 2OTLS 3QB0A 1FE0A 3CMES 5TKYA 2QWRA 2Z2ZA 3K5OA 1WUUA 5CHIA 1QD1A 3CUNA 4K4GA 1NNLA 4NLQA 4FJHA 2GIFA 3HILA 2A2DA 1HMVB 2FBVA 1DKGD 3ZYYX 4KB0A 2KZMA 1WAJA 1B9DA 4EEYA 8ICBA 3O08A 4DUTA 3H5XA 3CQYA 4X5VA 7ICJA 3QEBZ 3VEYA 5F8GA 9ICOA 3DC2A 5CEHA 3OYEA 4JWMA 2IY5B 8ICQA 4V1Ak 2ZM6K 5LSRA 1H73A 1FFVA 4ES3A 4AUKA 3DWLA 4ZCLA 4DS4A 4KFBA 4JI5F 5LJVA 1P9QC 2EG1A 2HBQB 1FO4A 1RTJB 4Q43A 4W90B 4ANEA 5DB6A 3CD6S 4MO4A 1RT6A 1PKUA 2VQEF 4KLOA 1RBRA 3VEXA 4BRLA 1RHUB 4FXVA 1TYQA 3BF1A 4OJLA 1J2NA 1KFTA 1CPZA 3AOCA 2OH2A 2RU9A 1Q8KA 5LSLA 3VR1A 2DR8A 3DOLA 1RP5A 4ZP6A 2KVIA 1ZQYA 1MWZA 3CWJA 2RE1A 4WYLA 3SQ2A 5RUBA 4BRKA 5I4MA 2VODA 3S01A 3CJAA 3OL9A 1LAVA 2ZWHA 4CLPA 5JMVA 2X7IA 3T9NA 3CPEA 1LFPA 2R7SA 4KHPF 1RDCA 1Z1VA 4FF4A 5ALLA 1RLDA 2VBXA 3VQ7A 3SPZA 2ZNZA 4CGDA 1KCFA 1LK7A 1YRUA 3THXA 5LY3A 5HOOA 2R2SA 2ZNYA 3V6DB 1D4XA 5FPNA 3BGRA 4P7TA 4DV6J 2E5LF 2PMWA 1IWAA 3AAWB 1ZAVA 5EX0A 3WEEB 2CIMA 1R8AA 3L6QA 1K9MO 3QBXA 5IT0A 4OI6A 4AHCA 2GV1A 2QL9B 3H42A 1EB0A 1NU4A 2HHQA 4FJ5A 1EETA 2ZXHA 5AIBA 2Z2MA 3QEVA 1VQKN 1UA0A 4M04A 2V2ZA 2LBOA 3VAKA 3UIQA 4C1NI 3KHYA 4O0JA 1N36J 3PW5A 4CHOA 4CZEA 1I94K 5AM2A 5DLFA 1M1HA 1WDTA 2HNYA 2EHGA 2EI5A 4Z6FA 3QYPA 1VRUA 2MGZB 2HYIB 4DUYK 2GV9A 3UMCA 3MXMA 2QWOA 1HBMA 1YBUA 3IV6A 2RUSA 3GILA 2RT3A 1VQLS 3E01B 5T7LA 1UW4A 5DDQC 5KAIU 2KIVA 4DR3J 4QWAA 1K1SA 2A1JB 4PHPA 2XCPA 2G0AA 2AX1A 3SEOA 3CMQA 2H9ZA 9ICMA 1M1KT 3QEPA 2Y9TA 2PIIA 5K20B 2V4JA 2QI2A 4CZKA 3N6MA 1WYGA 3DXKA 2M5YA 1BUPA 1TMJA 2Q3SA 3TTDA 5J0TA 3HT0A 4CQ1A 3DYAA 5C2CA 3ZI4A 3VEVA 3MR3A 4MYTA 4XH5A 2K8AA 3WX8A 1HNWF 4IKFA 1HWIA 1WWHA 3NVMA 5J2GA 2JC1A 1WHYA 1CZBA 3N5FA 1ZQDA 5A8WA 3DDNA 3FSXA 4DL0C 2VPXB 1KQGB 5BYRA 4IRKA 2NXUA 4J7CA 2YKNA 3T1YF 4IQWA 4X2BA 3RJKA 3TOQA 4E1JA 4DR5F 2QEXS 4IO9L 2XG8A 1JLAB 1RJJA 2Q1NA 5IT9U 4CK3A 2BKOA 1JXBA 1JROA 5J2MB 3CCLS 2WSEC 4BWMA 1NH7A 2AH5A 2WHEA 4GKKJ 1S7IA 2OPSB 2QG9B 3JSMB 4ID1A 3C1YA 2XC9A 3I8DA 1RHMB 2Z7JA 1JCEA 5A8KB 1NPRA 3E8OA 4HACB 3QEAZ 3C95A 4J9MA 3MPWA 3MN6A 1ZQHA 2KKPA 2DVIA 3V9XA 1HNIA 2JOQA 3OS0A 4RKUC 4DX6A 4FBTA 1BHLA 1XNQK 3GG4A 1HPMA 2HZAA 2W41A 1Y3JA 2P9EA 3GSDA 3MGJA 4RBVA 2H3IA 4F5OA 4CF8A 3EZ5A 2NCKL 2KHCA 1BUXA 3P39A 3RH4A 4OIXA 1NZPA 4G1QA 1S9GB 2P8IA 2LMIA 1RT3A 4QYRA 5MAOA 3THYB 4JKFA 1T3QA 3IG1B 4X4PA 2FJBB 4YORA 2CUYA 1PG5B 1SC4B 2FJWA 3V81B 2G9OA 1Q5VA 2B0CA 1XJWB 4ISEA 2OSQA 3I1YA 4UY8T 2J9DA 5KFLA 3AARA 3K89A 2PYLA 1S72N 4EWTA 1S1WA 3FFKB 1OH8A 2RHQB 5K9FA 1JL2A 2BEFA 2B5JA 2RQCA 5C2DA 1S6QA 1JB0C 2PMZF 4QR2A 4CJLA 4PL8A 3PY8A 1N0VC 3BZCA 2JZ5A 4KH4A 5IT9O 4NLRA 3BSAA 2LFVA 4I2DA 3CJ5A 1XNRJ 1HWLA 3MXHP 4KHQA 4WPAA 4DZDA 1GNKA 3DI6B 2ILYA 2D9PA 2E20A 2MU2A 3DOKB 1S0VA 2KFNA 2P9PA 4QZHA 1HD1A 5AKLA 2RVJA 1U48A 2Q1LA 1BG3A 2BZ2A 4DTNA 4FWSA 1B70B 2HBRB 2HEKA 4Y0FA 5CZVA 4DV5F 1BPYA 4RW7A 5HO4A 2KK0A 1N5SA 3VQSA 4X65J 3G8TA 3CCZA 4C9DA 5CJ7A 1KOHA 3QGHA 1L7PA 2W3SA 3RJMB 2P9IA 5HJXA 4DTMA 1BO5O 3ONQA 2LVWA 4WCEQ 3DRSA 4R64A 3QRRA 1NK9A 4Y1CA 5K4LA 3M8SA 4DL3A 2HMXA 3O6QA 3NGSA 4P75A 3P6YC 4USKA 3J7ZO 4OX6A 3FCHA 2GAGC 1LCUA 3C6TB 3DLJA 3H90A 7ICSA 2Y8WA 2YPZA 1U6BA 3TVYA 2ITGA 1TK5A 5HRRA 2F8SA 5KFJA 2QTWA 4LBPA 3D2NA 2BKEA 4P2FA 1UJ4A 2J7UA 2FBXA 3L4IA 2MLZA 3SK3A 4X4TA 3ZX2A 2CH6A 1BA1A 3BGFA 5J8YC 2WW4A 4L74A 3ISNC 4KV8B 3Q8RB 3KUGA 1FXRA 4JWNA 3LYSA 4J9SA 2N3OA 5CHCB 3BBFA 4F36A 5CP2A 3OYCA 5HLFB 2M8DB 3PRVA 3QSYB 1PYTA 1VQNN 1GMWA 2LXIA 1IBLJ 5AK4A 2UP1A 1RWWB 1IVZA 3E51A 1CS4B 2VQFK 4I6YA 4UZBA 5A6WA 2CRXA 1DQ9A 5CCMA 2Q36A 1FNXH 3F56A 3DMJB 4A2BA 3JB9k 4TKTA 2I1QA 4M6WB 5CH7B 3H08A 2MKIA 4LF7K 4LF4J 2CNOB 1VBZA 1SIZA 3B0YA 2JWNA 1FTRA 1L3VA 5D4NA 2C2OB 3DRPB 1Q95G 4H4MB 3C6UA 5DRKA 5F3XB 2IA0A 2D3UA 5KFKA 1OJ4A 2XZTB 1XR6A 3PSTA 4KYZA 3ZNUA 1DLOA 1LWXA 4LMZA 1KN6A 3QNMA 5A0YA 3RSEA 3MEEA 1Y5NB 4BY9C 3O4QA 3UCZP 3TAEA 1DK2A 3TEHB 2QW9A 4HAIA 3C23A 1AQ6A 2QRRA 4KB1A 2HFVA 3L2WA 3ETOA 2GCFA 5CHGA 2FZGB 1DGSA 1VOMA 3KHLA 4LF9J 2DH9A 2I8EA 1KL9A 3DLRA 4MF2A 3CJQA 4DV6K 5KFGA 2W9AA 4X4OA 4KFBB 1KVKA 4F0KA 4E2FB 3IAS9 3LM9A 5ALQA 3KKAC 4BE2A 1NK6A 4CJFA 1YI2N 2GOLA 2WZ1A 2DBYA 1RT6B 2FVPA 2QA4N 1TYQB 4MKYA 1ZM4A 4F72A 1WKKA 1BVSA 2F44A 3KD3A 1AA1B 3T5LA 1ZZNA 5KFFA 2A1BA 3PIPQ 5CB1A 1N36K 3DOLB 1FJ7A 3AHPA 3HSGA 4EMDA 5C12A 4A8MP 3ZZUA 7ICNA 2FTRA 4KLJA 3I87A 3MN5A 4HEA9 4J9OA 1CLFA 3HT3A 1UPMB 3V1QA 1U02A 3I5BA 5DBAA 4C3LA 2XNRA 3UDVA 1EJ7L 1S1VA 4HI2A 2HBZB 1R8PA 2OHDA 4A47A 3S41A 3THXB 3LL3A 3CCJN 2JLFA 1ZM9A 1JCFA 2C2NA 4DR3K 4RQ5A 3BS5A 4PQUA 1WC1A 3BGRB 4RT2A 3SI8A 4CNZA 3P8BB 3AEVA 2DEIA 4DO9A 4ZVUB 4M3XA 3UXNA 1ZC6A 4N41A 3C14A 2E3TA 1RDDA 1SUQA 1NGAA 3Q86A 8ATCB 5GAEI 1G2EA 2VBYA 2IS3A 3TQEA 1Z25A 2BACA 5ALWA 2BBEA 1KVBA 4QPXA 2RKIA 1RHKB 4BC4A 2G2OA 1HW8A 1SWVA 2KB2A 8ICTA 2VYPA 4BC5A 1UVNA 1LW0A 2HNYB 1KVIA 1VRUB 4BRFA 5L39A 3MEGA 4RW9A 1NJWA 1HBMB 3BZQA 4OMFG 4YHHK 2LQ9A 4EAHD 3C6HA 4IDHA 1NJZA 4ZS6A 3P3DA 1W7WA 3IRXA 4X64F 2Z58B 3DLHA 4GKKK 5T7LB 5D3GA 1NI3A 5M1FA 5ETTA 4CFAA 3MMCA 5KFMA 2K8GA 5L46A 2EWHA 4F04B 2V4JB 4R25A 1AFJA 2NXJA 3DXKB 3CETA 2HQ3A 4ZPTR 1ZQFA 4NLGA 2VWJA 1Z26A 3V7LA 3DYAB 4D3HA 4A59A 2CJXB 1O0PA 2YQ1A 4QW9A 1IBMJ 2VFVA 1VK3A 3IDHA 2NYVA 2F4VJ 1RTDA 4I27A 2ROEA 5KTQA 5DQIA 5FD1A 2YWGA 5K8OA 4IJNA 2IOFK 5AQNA 1JJ4A 3MGHA 1X9JA 3KLIA 4JI0F 2R9LA 1A0OB 5A8WB 1RE1B 3CTRA 4WFXA 2VGNA 3VTHA 2ZBRA 2QC3A 1RCXB 2YKNB 1TU0B 4DZ6A 2HRUA 3ENBA 4JHDA 2K1RA 4DU8A 3LP2A 2KDOA 4H4KC 3GV7B 3QGIA 1X0PA 4OGEA 3MI7X 3WNHA 4KH0B 1FJGJ 1LV5A 2MKJA 4KH1B 5E79U 3HRGA 3NF8A 4CEOA 4V19J 4B3MF 3EZUA 2DEJA 4I6MA 1FRIA 5CZ1A 3AO1A 3D45A 4XIUA 4H0PA 4LJMA 3CC7N 1DXSA 5J1NA 3UW1A 2WSCC 2HURA 3VQ6A 1N2XA 2XIDA 3QJPA 2G8KA 4TYBA 3GIIA 5LL6d 4C97A 1KP6A 1QE1A 3RBZA 2IHNA 3N4MB 3AVHA 3T1HF 2NPFA 2V52B 3WXMB 2W2NP 2RQMA 4Y2TA 1HNIB 3NNAA 2VJ4A 2I0XA 1QM9A 2FF6A 3OJSA 5KFIA 4JRQA 1LK5A 5FPDA 2APOA 3D3CJ 1HARA 1WEYA 3GMGA 5J2NA 3I96A 1H0HB 3M32A 3OTQA 5AQGA 1YIJS 1BI4A 3CJ4A 4L75A 3HM8A 2QX0A 2F8EX 3AB2B 1VQSA 1VQYA 3SPYA 4UUWA 1WLJA 5I3UA 4O4RA 5LXRA 1S6OA 2ZF5O 4B3TF 4AHVA 1RT3B 1XMQJ 2E8OA 1CRXA 2BPGA 4YXJA 2DH8A 1UA1A 4M0AA 2NUHA 4X65K 4O5KA 1W9HA 3E9PA 1WHVA 5F0WA 4CF9A 2AT1B 1NGFA 3DLEA 4PG7A 5HNKA 1TAQA 2QA2A 1ZQUA 4AL6A 1VSIA 1F0XA 3HZGA 3K0SA 1K6YA 4LF5F 2UVWA 3H7HB 4G65A 4M9JA 1RUSA 3W5ZA 5DM6Q 2B5JB 1RHJB 2CGKA 1S6QB 1FFSB 2MRLA 4ZP8A 4CJ4A 4QWDA 2KI2A 4AXJA 5ALIA 1D09B 2CJQA 3KNAA 2ZJAA 1GAOA 3QWPA 2BJDA 3I55S 1YRTA 4A8KA 4KLSA 5KT3A 3LP1A 2JRSA 4YOEA 4WWSA 1VQ7N 4Y2VA 1JNZB 1HNZJ 2P9PB 3KHRA 2GZOA 2KRBA 1XMOJ 4CZIA 3U1NA 2V9KA 4KGZB 3HXMA 2R8IA 2ZFHA 1G4CA 3LDLA 1HA1A 2E1RA 4LIWA 1TELA 5BR8K 4CGGA 3FMWA 3C46A 1IBLK 4CLKA 2ZJRL 3BY5A 2ZGZA 5BPCA 2XSFA 2R8HA 3HD1A 3K7RA 4Y65A 2HHHJ 4M3RA 3IWNC 3V7KA 2P9IB 1W2BR 4GXJA 1C4AA 4K43A 2GIRA 7ICTA 1B4SA 3DRSB 5GADI 3AM9A 2XMMA 4IFVA 3QATA 4FLZA 2DFEA 3A1YG 2IFXA 1RT7A 3HSDA 3MN7A 5B0AA 3N7SC 3RJEA 5K8NA 3A5MC 4FWKA 1EQ0A 2R2RA 1HHQA 2B51A 3K2PA 2O8DA 4ZVSB 4NA2A 5KFOA 3VAMA 3ZZRA 1GLJO 4ED5A 3GL1A 3ZSOA 3QEWA 1KWMA 4R0JA 3FSIA 1GMVA 2IAJA 2ADCA 4PKGA 4Z0UA 2XY7A 3ENOA 2YHWA 4Y2YA 3MEDA 2Y1LB 2KHOA 3AUOA 2I1RA 1XIQA 4QWBA 4QJVA 1HWJA 1N54B 5G4DA 4QIWC 3PIOL 2LYAA 3D2SA 3KDOA 2CZ4A 2IYGA 1S22A 2OPPA 3JQJA 1J5EF 4LF9K 1VQON 2CQPA 4MYUA 2U2FA 1WSEA 3QUTA 3CFPA 3PKMA 3NCQA 1G15A 3FZLA 4HKQA 3QZ7A 3V7JA 1WBBA 1HBNA 1U04A 5GAHI 4BX9C 3MABA 5AI6A 3J7YP 4EZ6A 1OH7A 4PR6A 1HPZA 4NM2A 1R89A 2CPYA 1FFGB 4U67L 2W43A 2GWSA 4H0YB 3OT9A 3PSFA 1X9XA 1WF0A 3V2UC 3P31A 4AHTA 3MUVP 2W03A 1T9YA 3HX0A 4ED4A 4KHYA 3FEYB 3LZJA 3C6UB 5C7PA 4F50A 5AKJA 1GLLO 3RYLA 2XLJA 1JJCB 5B0FA 1DLOB 3KNGA 4QQBA 3NCRA 2HFNA 4CO2A 1ZBTA 1HNXJ 2RB7A 3M9OB 4DR7J 3UDLA 5A0YB 3RSEB 3MEEB 3I28A 4JOUA 3DHXA 3MECA 5CAAA 3VGMA 3MPVA 1NUEA 2OXOA 2VPZB 4NEYA 4F26A 4ICAA 3PW0A 1C1BA 2G8UA 3SYZA 4U7UK 1NGCA 2DWQA 1R7IA 1BPXA 3AB4B 2BUNA 4QBUA 4LF1A 3IWLA 3DDKA 2X6SA 2E29A 3A12A 4LQ9A 3WUHA 1MC8A 2HFOA 2E7WA 1S3XA 3O3HA 5AQSA 5B0EA 2DFLA 2K60A 4B9QA 1S77D 3OUYA 2MHEA 4EEKA 2BX6A 3RJGA 2A6OA 8RUCA 4CH0S 2IVPA 4JS4A 2DR7A 4OVLA 4EP5A 4RX6A 2KKZA 3FGUA 3SQ1A 1LWCA 1XU4A 4Y6IA 1S79A 1WAFA 5KI6A 2HIQA 3CFRA 2IIRA 4C2MA 1RWXB 3KD1E 3QNOA 4DV2J 3EUNA 1T9TA 2QXLA 2NRZA 4ILMA 1JKHA 3L7PA 2R7WA 9RUBA 4GKJF 2FHMA 2WF5A 2BRLA 2IDOA 2B7BB 2JFKA 4J9PA 2F77X 3H20A 2ISPA 1ZQ1C 2YB1A 3C16A 3CJCA 3VQ4A 1SZPA 2ACMA 3H5YA 2ATQA 2AV5A 3W61A 3OV7A 4CE9A 1YVUA 2XSJB 4HUEA 2IVFB 4KC5A 2C3UA 3RAQA 2AGQA 2YNGA 3B6OA 2VUGA 2ZJRQ 3G25A 2XGQA 3JTPA 3VQAA 3EZOA 2RN2A 3BS5B 4J9NA 3K5LA 3QUQA 4LUBA 2IVMA 5J8YA 2BW7A 2E2PA 3PEJA 4DL2A 3H3NO 4EHUA 1SV0C 1T05A 4FKYA 4PWWA 4NA1A 4JI8K 3TAPA 2NLWA 4TN2A 4RWTA 3GJTB 3C14B 1IBMK 1SUQB 1CG2A 3QSIA 3SDEA 1TE2A 3HF5A 1I51B 5I3QA 4UAVA 2F4VK 1JIHA 1ECWA 3CC4N 3HW8A 2CPFA 2J0XA 1DY3A 2VA3A 2RKIB 3BDEA 3H0MB 2BGGA 2ZJ8A 3VALA 2GHWA 5BRHA 3NCIA 2G0JA 3LWLA 1LW0B 3GP9A 3I5CA 5IIOA 4G6VB 4WF9Q 4CJUA 4DFMA 3MEGB 4RW9B 4F02A 1WEXA 3N7PD 4CEZA 3QU7A 2PFUA 4F2SA 1SI9A 2HWIA 7FDRA 1FJGK 1T9UA 4UW2A 2EEYA 3MC1A 3IRXB 2GC8A 2IJRA 1KR4A 4WJBA 3WC0A 2HMIA 3PR4A 5D3GB 5L9NA 4NLBA 1X3NA 4KMUA 3HHEA 1NGEA 2WVBA 3F5AA 3MMCB 4LSLA 3CJ7A 2L48A 4ZVFA 3IR6B 4C23A 5KGXA 1BIUA 3B82A 1S97A 4JKHA 2UVVA 5AXMA 3UD4P 2M52A 1F5AA 9ICXA 2NREA 1GXUA 1HYVA 2MZ1A 6AT1B 3HKZF 3L2RA 2V8PA 5KPZA 2E1MC 2J9CA 3W3DA 4JI3J 2HSZA 1RTDB 3NWGA 2DIUA 4KGKA 4L3NA 1TK0A 1BQNA 1P8ZA 4B3OA 4IQXA 2EZXA 3KFUF 3KLIB 4CHZA 2V6AA 4FZMA 4QIFA 3KKAA 2QKBA 1IG6A 3U4LA 4ZP7A 1VQMS 2LEBA 4U96A 2OLWA 4ILHA 1NMEB 4JHDB 2K1RB 1C0UB 4FF2A 4UW9A 4C3KA 3LP2B 4LRAA 2C3MA 2QKKA 3C94A 4PL2A 2BABA 2YPYA 3DN9A 4USUA 4AH9A 1OQ6A 1V5VA 3GIKA 4UF4A 4K5SA 4M41A 4YB7A 2LKZA 4YVZA 4K0KJ 2MDAA 2YNFA 1O6XA 3CPWR 4DR4F 3ILIA 5JXSA 4A8YA 2HBKA 2AYMA 2OGUA 4PG4A 3M6KA 4PPZA 4BRIA 4IH5A 4H0TB 1M90T 4ZVHA 1B43A 3GR1A 1QE1B 2ZIXA 3O80A 3NMUA 1SQKA 1N5YA 1VFJA 1NOZA 4FYXB 3D7SB 4DR1F 4YB6A 1OUQA 4NXNK 4OX8A 4YFKA 4I2QA 3PUFA 3Q7CA 4KB7A 2MKKA 3I56N 2MYFA 5J2NB 3M32B 1PILA 2E66A 1BI4B 2H5JB 1QTMA 1HNZK 3SAGA 3RMDA 3SV3A 5L38A 1LEOA 2KSOB 3ZDCA 2CWXA 5I3UB 2MY8A 2FZKB 2KKHA 4RW6A 4CO5A 1YJRA 5DK5A 1TUYA 4YOVA 3BBBA 1NOYA 4OZLA 4NCBA 4U6PA 4ZIVA 2L9DA 4ZLLA 2QMUB 1Y5LB 2G2ZA 2DNYA 3EX7B 3DLEB 1ZA2B 2HHHK 1YZ7A 1HUXA 4CI6A 4C4RA 4OZ3A 4WYWA 1OQ3A 3PJWA 2K4EA 1WC0A 3WQPA 3OLBA 4CDGA 3WBZA 2FDNA 2BYCA 4F91B 1WJ9A 2XMUA 2KZZA 1BPBA 1XEZA 3OBIA 3WK9A 8ICLA 3Q0AA 2E6LA 4F8RA 2DHGA 3T9ZA 2E2QA 1Q81O 1A7GE 1TV9A 5DBCA 5J0PA 1ZQJA 1Y11A 5KFDA 3DGPB 3OTCA 2GVDA 4X62J 2HGLA 1WSVA 3LP1B 1FKOA 2Z56B 3D9BA 4M9HA 2XMVA 3BGOP 5C15A 2G1HA 5ALHA 4M5JA 2HNZA 3TJ8A 2Q2RA 4CFBA 5KT6A 4TLQA 4EU0A 3CCMS 1YJWN 1SXLA 1L8OA 1VQ9N 5ETKA 2AEJA 5EE3A 2BDUA 4CO1A 4RG8A 2CQGA 3ULHA 3Q23A 4NPOA 5CA7A 3H5SA 1NMDA 2BHNA 4UARA 1XO0A 1UQVA 4CLFA 2G4BA 3BKUA 3KJVA 4W5RA 2X51A 5AJ3K 2QK9A 1ILYA 3KK2A 4YN3B 3VCDA 4CK1A 4IFVB 4DV3J 3SSSA 2NZTA 1RT7B 1SZHA 3EM1A 5B0CA 4GIBA 4C8MA 2O8DB 2BQUA 3AN1A 2DF4B 1NHKL 2ZITA 3PXGa 4B9SA 2N1RA 4CJWA 3CJ2A 1F2GA 3HPOA 3C7NB 5ETVA 4JKDA 4HR2A 2UU9J 3J7A1 2IAJB 1UCNA 4ZIWA 2IOFA 4K4IA 3C65A 4DR7K 3MEDB 1B3TA 4DTRA 5F2RA 4A4JA 4DR6J 4FJIA 3ETRA 4WP3A 7ICRA 2AYEA 2A1RA 2PSZA 2FC8A 4E7LA 4KRWA 5JRTA 1X4FA 1DFDA 2HHSA 4F0MA 4CGIA 5T7BA 2OPPB 2ASDA 1WSRA 1UZHA 2DQNB 5DQHA 1QSSA 3MEKA 4J2BA 4TU8A 2DUYA 2NRWA 4ZTJA 1R8BA 2MA1A 1XK8A 1S9EA 3ZEUA 2J7KA 1H98A 1BDGA 4XA5A 3R1XA 1HBNB 4IO1A 1JLQB 1R6YA 2AZ3A 4CLZA 3G8QA 1VQ8N 4LRBA 1HPZB 1ZZFA 4IEIA 4URGA 2JHEA 1Y10A 3OYKA 3CCVN 2VWBA 1NBWA 1N61A 1RGVA 3E66A 2ZVIA 3BP8A 2B43A 4V19X 4I6AA 4RQ2A 2WBMA 2Y0SF 1WI8A 1VSEA 3MM5A 3RJHA 1V6HA 5DDMA 3IAM9 4YDDB 2A2CA 3RJIA 5EDWA 3ZT4A 4AILC 2J4RA 1RBTA 5J2IA 5LOQA 5J29A 2MKCA 1XS9D 1A76A 3F2BA 1QDUB 4DV2K 4PYAA 2P2CB 2CWKA 1RWUA 1N34K 2WK4A 3Q22A 1RAIB 4Z6EA 2D1CA 1R3NA 3ZSWA 2J8SA 3M2UA 2HHTA 1DK3A 4DUZJ 2HK3A 1Q9YA 3M30A 1URNA 2P9UA 3BB5A 2CJ9A 7ICIA 1V4TA 4H4OA 1YITS 2Q0UA 1HI0P 3D7EO 2WAQC 1N4LA 1C1BB 5IIMA 2GWKA 2G8HA 4LF6F 5KFNA 3LO3A 5M2RA 3CEDA 1V38A 1TL4A 1OO0B 1HBUA 4ZP9A 2CJYB 1MN9A 3KLFA 4F3OA 4KLQA 4AXIA 4CWBA 4EYHB 1WHWA 4KLLA 1E6VA 2MKHA 4I2EA 5GTIU 4JP8A 3FUYA 3MD1A 4UY8O 3VGVA 4ZK7M 3RG6A 2GQQA 3KMQA 3PW7A 4BR9A 2ZIWA 2NUBA 2R7YA 1W2BM 1ZQVA 5GMDA 1LWCB 4E1MA 2RMLA 3T5JA 2PYJA 2PFPA 1BCOA 3SMSA 2BXJA 3HTVA 4F5QA 5DGAA 2XMJA 3H7IA 4N5SA 2HOEA 3DXBA 2XHBA 4FM0A 2ILZA 2JMGA 4CJ3A 3AVBA 3LAKA 2Z1JA 1TKTA 1PAUB 1ZJNA 4JK9A 4W5QA 2NS1B 3C16B 2Q3PA 3FZMA 3QE9Y 2ZBQA 3O5TB 5DDYA 1Q5YA 2ZWPA 3BGUA 8ICEA 2FLPA 2LYBA 2QGFB 3VF0B 1J53A 2YNGB 1DRZA 2IHR1 2RNEA 1VC6A 4AYBD 2YKOA 3FM9A 2N7YA 1J5OA 1CQMA 1BL3A 5J2EA 4UAZA 2NLXA 1N0UA 1FEZA 1VR6A 2AKWB 4DXLA 9ICKA 4GMJB 2A6AA 3SDEB 4NRTA 2D7SA 2MZSA 1CJKA 1FDDA 3BQ7A 4K4TA 3FVYA 3KZIU 2I5JB 2ZH6A 2D1KA 3L3UA 4K41A 3CJKA 2RRNA 5KPRA 4USAA 3UPQA 2PFQA 4DTJA 3CCSS 1RT1B 4WK3A 1FA0A 3BPDA 4Y2IA 3QICA 3M5RA 3HI0A 4TUQA 2A3JA 2ZGYA 3RAMA 4DOCA 3GOIA 1N5QA 4MKBA 1RXVA 3KTQA 2A5XA 5A2QO 3I32A 4NJ8A 1DRGA 1G99A 1REVA 4CD3A 4ZPVR 1KEJA 5HRNA 3NS7B 3U7JA 1RQNA 2HMIB 5KGWA 4MQ3A 2C22A 3RU0A 4K0KK 4LRFA 4F25A 4GVBA 4LSLB 3I8BA 2DD8S 1Q9XA 2D41A 2HLUA 2FLNA 1LB2B 2VDIA 3ULEA 2QV6A 3R3LA 4ZA1A 4CLUA 3LW5C 4ZMMA 2ALZA 2OMLA 4KAIA 4GC6A 2L9WA 2VF3A 2X3GA 1O51A 2O8BB 3OTBA 2BMBA 5BPLA 1KN5A 4IRCA 2B3TB 4JI5K 4JI1K 3RBDA 1BQNB 4QOTA 2CA9A 4B3OB 2CPDA 4USJC 5DBBA 1WSJA 1H2UX 2F1HA 5ETRA 2VQEK 4BGDA 5C25A 4NXMJ 5KG6A 3KHGA 2XRIA 4H8KA 3NRZA 3MWPA 2CADA 4NMLA 3OYDA 1SC3B 5AKKA 2HQGA 3TO8A 2VOOA 4CTAA 1N32F 3I5AA 3W65A 3MMBA 3PCOB 3VQTA 3J81j 4P2MA 3VWSA 3C2MA 2LQBA 2Y3YA 3CM6A 4K8XA 3FC9A 7ICQA 2KJVA 3SUNA 4U8YA 2HFUA 5I42A 4RQ7A 2X3DA 2XNQA 3O4WA 1N48A 3V1RA 3WXKA 2YNFB 4KHPK 2K7JA 4DN0A 1RTIA 2FQQB 2W2OP 3KWIA 5L1IA 1WC3A 4X66F 1ZQRA 1JLEB 1NGIA 4RL1A 3US5A 1M5HA 1N5YB 3KUEA 2YBVA 1NMNA 1UOCA 4JI6J 1PC4A 4I2QB 2DXEA 2HF3A 5KFCA 2ZZTA 4YMMA 4FE3A 3VQ8A 2V8DA 4JYAF 5HP1B 4LFAF 3G71N 1RTHA 4PPXA 1SV0A 2AJ4A 4DFDA 4W4MA 2NPIA 3UNGC 4RW4A 3OVSA 2WTFA 3TACB 5F8IA 2QSWA 2KXHA 1NPPA 3PJXA 4EBDA 3V6KA 3IWXA 2OSRA 2V8GA 1J6ZA 3TWHA 1WOSA 5DM7Q 1JALA 2P6RA 1JLFA 3NP5A 3ILJA 3OLAA 5GAGP 7ICGA 3R7SB 4Y28C 4RW6B 1NK5A 1XSNA 3L7OA 5E84A 1O13A 4OYMA 2W6LA 2BKPA 4R0EA 4IL6U 3BN4A 2VPWB 2CJBA 3BQ0A 4MFBA 3D66A 5L1MA 4M5LA 1DQ8A 1E4FT 3C21A 3RFAA 4R5PA 3G2XA 4JBCA 1KXPA 3RRKA 5F8LA 4JV5J 4UBCA 4DS5A 1SJRA 1FTCA 4DV7F 3QIPB 1NZAA 1GOAA 1BNPA 1VS3A 4DV3K 4M9NA 4O44A 3C2LA 3BYRA 5LJ5Y 2Q43A 1KKHA 3AL0B 1U1KA 4OJHA 4RQ6A 9ICPA 5KT7A 4CJEA 4FYDA 1SV5A 4M2YA 1B99A 5DDOC 3OTEA 2DNOA 2GVDB 8ICHA 3NGTA 4Z6DA 5H9EJ 1FKOB 4KQZA 2KFZA 1IXKA 1YF5L 3HHLC 3LTOA 4LR9A 4PWUA 4MK9A 2D9OA 4DV1K 2KG1A 1NGGA 4MFCA 1MWQA 4DR6K 4KN4A 4JI4J 1LQ9A 2NSCA 4Q2MA 1IKYA 1L7OA 3UWTA 2HNZB 1NZ8A 3DAWA 1CI4A 3MUTP 3EVWA 4I69A 3EY1A 4OO1J 1TUVA 3W1YC 1YJNN 3GB0A 3QO9A 4NLPA 9ICVA 1WCLA 1RAOA 1NJIT 4JV0A 1ZQTA 4NYPA 2MB0B 3NOCA 3A8YA 1KW4A 4I2PB 4DV0F 4DR5K 4CJRA 1RQ0A 1WG8A 3KJVB 4YY3F 1TL7A 2YHAA 2PFFB 4WZMA 2O01C 1WCNA 1MN7A 3BO4A 3R9PA 2GTDA 2P5VA 3FE1A 3IP0A 4JKBA 4OQJA 2F96A 3CPWM 3I9V9 4B3RF 3OHRA 4ED1A 2ZC3A 4KLHA 4DJBA 2LEPA 1S10A 1T9WA 4YDUC 2LEAA 3WHIA 3MZIA 1QVFR 4JEPA 3C6AA 3UXOA 3GQCA 1A6LA 5KQ8A 2BKNA 4IOXA 2V8VA 4LFBJ 2L9NA 1HUZA 2N3LA 1HR0F 3VERA 1L7NA 1VGYA 2BOPA 4DUZK 3K2YA 4OLPA 4YR0A 2UXDF 3GFHA 1M0SA 5FRNA 2ASJA 2OI2A 1PK1A 3RR8A 3TU5A 5J0QA 1QQ5A 1L7MA 1IUJA 2LLZA 3L95X 2FSJA 4P2XA 1S9EB 3N4QA 3ZEUB 1K8KA 3WK8A 4U7CA 2UZAA 1O03A 3NTUA 5HL7Q 1Q3VA 2JJ4D 4UB6U 2MQPA 1WB9A 2KG5A 5AQKA 3HJEA 5KAKA 3CHWA 3NF6A 2C42A 4CERA 3MM5B 1PK3A 1EQMA 2CPIA 2RPIA 1L5UA 1C1CA 3HJVA 1WWUA 3V9SA 3GDXA 3VQ9A 3ICLA 2M9NA 1KAYA 2AU0A 2V7ZA 2O5DA 2EK6A 4ES2A 5IIKA 3VGTA 1PBUA 3M7VA 3TZXA 3VQEA 4YMNA 3OFFA 1HWKA 4NLVA 3M2UB 2XYGB 2LMRA 4MFAA 1BE4A 3K59A 3M30B 2K06A 2P9UB 1COOA 4DCOB 4DSLA 4H4OB 2E9RX 3CJRA 1E6YA 3GZ7A 2IHMA 4Q8FA 6FD1A 4J9RA 5J2QB 2YY3A 3B8HA 4M7YA 4M7XA 1NK4A 3PJ9A 3NDKA 2HSEB 2LDYA 1S12A 3I9ZA 1O5JA 2FI1A 2UUBF 1FFWB 1HBUB 5DDPC 3A2FA 4USVA 2KZ3A 1W97L 5J0UA 4JK1A 4CFDA 3MCOA 2ZBIA 3D54A 3IFEA 4DV5K 1HBOA 4DPTA 3ONNA 2CNLB 2E5JA 2PMZC 1TFRA 3SV4A 1KTQA 5HP4A 2FHJA 4ILGB 4ISFA 5KFRA 2CQIA 3TYTA 3TTFA 4E7IA 2L3MA 3MWTA 1CVJA 4Z2XA 1DEJA 2O8FA 4B3SF 1SJ3P 1Q46A 4CEQA 3GFKB 3AD8C 2FLOA 3PNCA 1TKTB 1N88A 2ZOMA 3VGUA 2BCUA 1IR1A 1GX6A 3R9LA 3O9QA 5AQWA 4WZQA 4RZRA 3P96A 3CXCR 2DGUA 3NH0A 4Y2UA 1LKYA 3B6PA 1ZQCA 2QXFA 4NYFA 4EENA 5ITHA 4DTXA 2VHGA 8ICPA 2BCVA 1X6IA 1S72S 3SEIA 4PKIA 2M8HA 3QIDA 3PRBA 1VSJA 5HR6A 3HI9A 1J5OB 3RMBA 1BQMA 2WOMA 3PSPA 2HF4A 2EQYA 4I6WA 4FWPA 3AOBA 3HX9A 4ISGA 1FKPA 4EIAA 4YN4A 4XTTA 1P7DA 1WTFA 4GMKA 4RUHA 2LSNA 3W5YA 3KFWX 3TADC 4XPCA 2DYAA 1O8BA 7AT1B 4Y2KA 1CJKB 1KLMA 2VFTA 3CJKB 2O66A 4P74A 1IJFB 2XGPA 3PV8A 1FKAF 1IKVA 3CCUN 1IBKF 4NXMK 1T3VA 2VPYB 2P6UA 4JKGA 1CC7A 2HK2A 2CPZA 2CPEA 5AM0A 2R8KA 4TU7A 4IBNA 1F0MA 3RUBL 2CQ3A 4ECXA 4KO0A 1REVB 5IOLA 2E7VA 5FP0A 2WONA 1RDBA 1IG8A 2ZM6F 1J9AA 4F5NA 3V1OA 4EFAC 1X5OA 4DG1B 3LPEA 4GVBB 4WQ4A 3QBWA 1FFUA 1FDNA 2K4PA 3M8WA 2FMQA 3VF2A 1RT5A 5JTIA 4C0BA 8ICYA 1BWVA 2ZJPL 3EPIA 4QS7A 1K8AT 3FGVA 4ECYA 2LU1A 2XMTA 3Q7BA 2CRLA 3W66A 4O3MA 4I2AA 4JI6K 3TAFA 3Q8MA 2F8KA 1F5BA 3IMQJ 4U8VA 4JN4A 3S1TA 4N8NA 1VMBA 5E26A 4CVNE 4MIBA 4ZN1A 3M7DA 1ACMB 4WK1A 5H2FU 2E1YA 2WBNA 1VISA 2A42A 4JI7J 1B22A 3BF4A 2MSTA 5C25B 1HIYA 1U4BA 3U9DA 4CJ7A 3A0IX 1UAWA 4XH1A 5AQIA 4DLGA 4Z4GA 2KU7A 4LBIA 2NRXA 4CT8A 4CTAB 4LF8F 1GEHA 4JI2J 3MMBB 1U7LA 4LVSA 3CCEN 3V6HA 5CQGA 3JXUA 1F3FA 2YMQA 2W8LA 4UB2A 3TZWA 3CJ8A 1RDUA 2XZWA 4JV5K 1NWKA 2QLBB 3GV8B 1SQFA 3NWRA 3VGLA 1PAEX 3O3FA 4JD2A 1WWVA 1ZETA 1M6YA 2YMPA 3TVKA 3OYMA 2FJ6A 2XHWA 5F41A 3CJ3A 2O67A 3AAPA 1K1QA 4IR1A 3VVUA 3IDWA 1RK8A 4B17A 4FK2A 3OTOJ 3T3FA 3ENVA 1F1BB 3BQ1A 2WCXA 2UXCJ 2RF2A 2IRYA 4BGAA 1RTHB 4Q0BA 4Z4IA 4RW4B 3K5PA 5H9EK 1ZTWA 1I94F 2RE2A 4CLLA 1X1PA 3O9TA 4F3QA 2QN6B 5AK3A 1JN3A 5KG7A 2IVNA 2OPRA 2XWXA 4QZVB 4NXZA 4P72A 3NBPA 5BYQA 3SSQA 4BRHA 2HFZA 3AT1B 5KG3A 4KHSA 2K7KA 4W5OA 3H1VX 2XO6A 3MM8A 1P8GA 4MFBB 2XO7A 2VB6A 1HUOA 3AVLA 2HPUA 1ZBFA 3GLJA 4R8UA 5AKXA 1FXDA 5T41A 3MM9A 2BJ7A 5HMWA 2OEHA 1YI2S 2R2UA 4NCAA 3JS6A 4O44B 4DOAA 2BRKA 2Q79A 4YMOA 4E98A 5CD4A 2QA4S 4CEAA 2KJ8A 3HVWA 2E1EA 3QU5A 2NRVA 3H98A 2WC9A 2IMWP 3PKYA 5IWAK 1SV5B 2PA8D 3QGPA 2FIUA 4NLOA 1VDHA 2F8HA 3HFZB 3AGKA 5AM5A 2D74B 3IM9A 4E89A 2D5RA 1DGJA 4IJAA 1WHXA 2F76X 3LUYA 1U6ZA 3RAXA 4RUBA 5HVFA 2R7RA 4C8YA 2JHDA 4G9BA 2JV3A 4ED3A 3N79A 1H7WA 1IKYB 4N7TA 3OFHA 5JVHQ 2CG8A 2DTJA 2GO9A 2AD9A 3CCJS 4OZ2A 3O3GA 4JI0K 4FO6A 1WC4A 3QO9B 2BH1A 1NOMA 2FZCB 1H74A 3UFCX 2CDQA 4CE6A 2KVQE 4RNHA 2NUUG 3DKDA 5HVGA 3ZZTA 3V9UA 2QB0B 1FEHA 1Z3EB 5EOZA 1IM6A 2LXFA 3J7AN 4BACA 1TL7B 3QU2A 3UM9A 1GQEA 3ALRA 4BC2A 2M88A 3FNNA 4B9TA 1T8EA 1EWQA 1YK9A 3ZSQA 2ZJPQ 3ZT0A 4F4WA 2VH7A 3C3LA 5ALPA 1QTNB 3PDNA 4PGQA 4BQLA 1NU0A 2J9EA 1B7FA 1QCKA 1WD6A 2CG4A 1NDKA 1H7XA 7ICLA 3AJDA 3QAUA 3VESA 3D0PA 2D0AA 3FBBA 4OZJA 5E3PA 1GTEA 2F5GA 1RBAA 3VQDA 1W26A 3MMVA 4DPWA 2ERRA 1LXNA 1YTAA 4M5MA 4K7QA 4Y2CA 5CE3A 4F5RA 4OI0A 3D1HA 2AWZA 4PHAA 3TZZA 1PUZA 1YZ6A 1RAGB 1PK1B 3W64A 5KG2A 2XULA 2YWWA 1VSKA 1SIWB 2WMMA 4HYKA 4DUYJ 1RBSA 4KI4A 1KFDA 1RKIA 5DG9A 2WUSA 3WT0A 3TA1A 4K4WA 3M1FA 4TNOA 1LW2A 5AR0A 2OM6A 4OHWA 3QGGA 3QEXA 4IOAQ 5IINA 3OPKA 2ISOA 1OSDA 4MEYA 3IRWP 5JVGL 2M4MA 4Y00A 1FVSA 3AO3A 2F8TA 4IG0B 1PBAA 3I4HX 4RU9A 3WNFA 4BHQA 2DB1A 2ZOFA 4QZ9A 1S7HA 1RM6C 1C1CB 4I64A 1M90O 3N4WA 4FSVA 4HTUA 4FXDA 4FPAA 1ZQAA 2UVRA 5KG1A 1XHXA 1ZA1B 3MBYA 3D28A 4Q2LA 4HH0A 3TR5A 4GVLA 1SPBP 3AH6A 2FF3B 4IOCL 2VKQA 4C48A 4Z37A 2ASPA 1IO2A 2OZSA 2J6UA 3FEXB 2MLYA 4A8FA 3H8SA 2EAOA 2B4PA 3B9JA 1RTZA 1E6YB 3RJJA 5FPEA 3NGZA 1NCLA 5IIJA 3AA9A 3AJ2A 3NGUA 3CCQN 4UAWA 3HHLA 1DTTB 1XR5A 5HSPA 5ETLA 4K42A 3CC7S 4PY5A 4HUGA 4CESA 1F9EB 3THYA 4CHQA 3IG1A 5M1PA 2KYZA 3SUPA 4CF2A 1YRXA 1KQFB 1HBOB 5D4LA 3J7Z5 1GLDG 3C66A 3KWGA 4RPXA 4DF8A 4CHPA 2EWSA 3M3ZA 3THWA 2D3DA 2ETJA 2BGWA 3K0JA 4RNOA 1ZD2P 3I4PA 3R27A 2VBWA 2O8FB 3B6BA 1Y4ZB 1P1LA 4OPAA 2YMMA 3VMFB 2ZG6A 3N5BA 3BS7A 2ZOGA 1O1WA 1BXNA 4QS9A 3ZTQA 3EPGA 1N52B 2QLTA 3U9ZA 3C5GA 4Z6CA 2FXUA 4O3RA 5D4PA 3BSOA 1XNQJ 4WQ5C 3DOKA 3HSCA 1A5XA 4MTPA 1QVFM 4S0MA 1LKYB 4YDUA 5BN8A 3H8MA 2VV5A 5HBMA 5BYSA 3MFIA 2B9XA 2B4VA 4BWJA 3NS5A 5G0RB 4JMUA 2HNDA 5AFUH 5LMNK 3R5DA 4PHTX 1U49A 3NMAA 4J9LA 3K5NA 2E6MA 1BQMB 4ES1A 3P4UB 4P4MA 2B4OA 2D3O1 2WOMB 4B1WB 2C2KB 3PMLA 3ILOA 4PXDA 3S3MA 3MCMA 4MKVA 4UOFA 4B9UA 1QQ7A 1IWGA 2VG7A 4NLCA 2AX0A 4PKHA 5F1XA 1KLMB 5E3AA 2OEKA 2BW2A 3VAIA 1ATNA 5CA5A 4ZCIA 4FJ7A 2Q0RA 3BS9A 3TSQA 5ALFA 1VQ7S 3BQ2A 1NG9A 2W2QP 1IKVB 4BRMA 1C6VA 1UAXA 1UHUA 5LMUJ 4JI7K 4PHDA 3SMVA 4PJ0U 4C80A 2D6FC 2AJ2A 4JKGB 1NLVA 3FZBA 3DXSX 1MA7A 5IC6B 7ICMA 2OPQA 5IV4A 1T02A 2X74A 4NLWA 3QX7A 3HDSA 4NE9C 2G8IA 2G13A 2F3JA 5J2CA 2WONB 3GFYA 5AI8A 4DV6F 3OSPA 5AQRA 1WKJA 1RWNB 2Q0ZX 3U1LA 1SJFA 4FW2A 2GO8A 2Y1RI 3ZT3A 3CCRN 5D0RA 2PKEA 5LXYA 2OD6A 1APSA 3D4JA 3ZXWA 5SZTA 1RT5B 3Q89A