2HVHA

Ddctp:o6meg pair in the polymerase active site (0 position)
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
580
structure length
580
Chain Sequence
b'KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 191
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hvhA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hvhA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hvhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hvhA01
4G3IA 2BCSA 4UB1A 4FW1A 4FJ9A 1S9FA 5BOMA 2LSNA 3P1GA 8ICCA 1NKBA 3SUQA 4KLEA 5KTQA 1GOBA 4UAYA 4JV1A 3SQ1A 1HYZA 1LAWA 4M42A 4NLNA 3HO1A 2AQ4A 3U3GA 3QNOA 3V4IA 4OJRA 2F8TA 9ICOA 3MGHA 2YHAA 5J1EA 4Q43A 5HRPA 1S1UA 5HHHA 4KHNA 1I39A 3RAXA 3Q8SB 2EX3A 4DTUA 2AGPA 7ICNA 2VWKA 4B8AB 3C95A 3T5LA 4RU9A 4ZTJA 4EP5A 4MFFA 2VA3A 2O4GA 3BQ2A 5KFYA 8ICVA 4W5NA 4KFBA 3C21A 1RDAA 5J0QA 3HP9A 4P4OA 3MR6A 3ZT1A 4BGDA 3SJJA 4Z6FA 3OS2A 4B9NA 4RT3A 2W9CB 3DRPA 2P6UA 4PUOA 2HB5A 5J0XA 4EYIB 3AVCA 4CJQA 3QNNA 3TR8A 4FJIA 4FJKA 1BCMA 3HPOA 4KLFA 4TURA 3V6HA 4DTSA 4DSIA 1JLEA 3QE9Y 4NM2A 4YN4A 4Y1DA 1WNSA 3MEDA 4OGEA 1GOAA 1MQ2A 4KI6A 4IR1A 2A1JA 4M3XA 3ZDEA 4QZ9A 3RMBA 1XHZA 1UWBA 3HP6A 3QO9A 2ASLA 4F50A 3C5GA 3ORYA 3OYIA 3QEVA 4CEZA 3AO4A 1UAXA 2Q3SA 4XRHA 2G8KA 2R8KA 2B6AA 4E0DA 3S3OA 4CHQA 3CG7A 3TWHA 5KFPA 3UXPA 5KFCA 4FJHA 8ICGA 3ISCA 4DSEA 4KMUA 3O3FA 1L3UA 4LH5A 2VANA 3KD1E 2XGQA 3OVNA 5KG5A 4ICLA 3TAPA 4NLZA 1VK0A 1T4GA 2FBTA 4H4MA 1LW0A 1S0OA 4ZH4A 4QZFA 3PV8A 3P83D 3OYLA 1UT8A 4AHVA 4CE9A 4RQ7A 3RRGA 1KRPA 2BCUA 1KVAA 2I9GA 3HJFA 4QZ8A 4EZ9A 3H8JA 4CIGA 1RT6A 1WSHA 1VSIA 4DU1A 4KB1A 5J0UA 2J6TA 4CHNA 5HRSA 4I2JA 4M2YA 3RB0A 2G8HA 1D5AA 1UA1A 3KK3A 9ICCA 4AHCA 2BGGA 5CYMA 5DG9A 1ITGA 3MR3A 3DLEA 1Z00A 4DFMA 4OVLA 1DOQA 2A1JB 3DYAA 4I2EA 3MECA 5J2BA 1HMVA 5J2NA 3QZ7A 5J2EA 2DFHA 4KN7A 4ZTFA 4ECWA 3JSMA 2RPIA 1Q9XA 2IOCA 2P5GA 4FW2A 4MFAA 1B9DA 1TGOA 3ZSRA 3DRSA 4FZYA 1ZQTA 4DOBA 2FMSA 2IHNA 4DQRA 4BDYA 2BPGA 4DQPA 2D0CA 4O4GA 4QWDA 2HVHA 3C2KA 3L2QA 2V4RA 7ICJA 1YT3A 3BDPA 3QLHA 4F8RA 3ZCMA 7ICUA 1VSKA 5J29A 3HVTA 5CA7A 2AJQA 7ICGA 8ICAA 3AVBA 2XY5A 5KT7A 3ZSOA 5C25A 4FJJA 4E3SA 1NK9A 1LWCA 3ULDA 1ZQDA 3EPIA 2DPIA 3RB4A 3HWTA 3RR7A 4KB0A 4UB5A 3VA0A 4KITB 5DGAA 1D8YA 7ICOA 2NRZA 4R66A 2HHUA 3LPUA 4RQ8A 1S97A 3PW0A 3SV3A 5DBCA 1S77D 3K5OA 4W5OA 1SKRA 4AHUA 1XWLA 1BPZA 3MXJA 5CB1A 1Z26A 3LANA 2E6MA 1KLNA 7ICRA 1BCOA 3OYFA 3LZIA 4E1NA 5KFRA 4FJMA 3MGIA 1JLGA 3Q8MA 4CFAA 3MDAA 3U6FA 5KFQA 4MF2A 1IG9A 1JLFA 2G8VA 3JPSA 4KREA 1ZYQA 1IKXA 4F4ZA 2JLEA 3WNGA 4M3YA 3NDKA 3PY8A 1SL1A 4CJFA 1S10A 3M8QA 5KI6A 4YMNA 4DOAA 1NKCA 5J2MA 1F21A 4F5NA 1LWFA 3OJUA 4M41A 2R8IA 7ICTA 4KLTA 1TKXA 2KZ3A 2Y1JA 3AVKA 5J2QA 2BPCA 4F4YA 4DS5A 1N6QA 2I1QA 1S1VA 4IG0A 1EETA 3C94A 3ZSYA 1QSYA 1JMSA 1BPYA 2OPRA 4CGHA 2Z1HA 3LP2A 4IQUA 4YR2A 5KFHA 2BCQA 3V9ZA 1COOA 4JS5A 2FLPA 5KFUA 3EW9A 3AV9A 4B3OA 3DMJA 3D0PA 5F9NA 4LVSA 5HNKA 4ED1A 1NK4A 2PY5A 3LZJA 3C23A 3OYGA 4K4IA 4QWCA 4CK3A 5J0YA 4QW8A 4F91B 4O3QA 4EEYA 2YHBA 3G6VA 5J0OA 9ICAA 4LH4A 1VSJA 4R5PA 1JIHA 3PW4A 3MFIA 4GXJA 4DEZA 5KFIA 3SYZA 8ICUA 4IQTA 4M04A 1KFSA 2PYLA 3QIPA 3T5HA 3V1OA 5DB9A 2AQ0A 4ED6A 1HNVA 4I9QA 4E89A 3MFHA 1SL0A 4PHDA 4I2GA 1KFTA 2ZUDA 4AHTA 2VWJA 3OHBA 1TKDA 4UB3A 2P66A 3TAMA 4DFJA 4Z6EA 2JEGA 3HXMA 3VN5A 3HW8A 3KK2A 2ZTEA 4JWNA 4AH9A 1WSEA 2BANA 4CJSA 4EBDA 9ICRA 3EY1A 4C8OA 5JS2A 5IIIA 4FYDA 5HROA 4CIFA 1ASWA 5KT2A 1BHLA 3NF6A 3JPPA 8ICXA 1ZQVA 2BPFA 3MEGA 4R64A 2FLLA 4ED0A 2GBZA 4ID1A 5KT3A 4O9MA 4RPYA 5D49A 4JRPA 3PO5A 9ICSA 2HVIA 2J6SA 1MC8A 4FJGA 3QZ8A 5SZTA 7ICLA 3IRXA 5L1JA 3LP0A 2OZSA 4O5EA 2JEJA 3LAMA 2DFLA 4O5KA 4F5OA 3AVGA 3NF9A 2ITGA 4J9QA 2D0BA 4CGIA 3MBYA 3PX6A 9ICNA 3TFRA 2X78A 3VA3A 1AROP 9ICQA 3VQAA 4OGCA 9ICIA 2KZZA 3CM5A 4TSXA 5KG0A 3SI6A 1D9FA 2H5XA 2YNIA 4XIUA 2YNFA 4E7HA 2BDPA 9ICEA 4EYHB 3OYJA 3C2MA 5J2HA 2BGWA 1U48A 1TV9A 4IDKA 3DLHA 4M6WB 5KGXA 4FS1A 3C2LA 4RUAA 4M3RA 4O44A 3FDSA 3TI0A 2IAJA 1KCFA 3WNHA 4RPZA 3QETA 1BIZA 1N56A 1KSPA 4DL6A 1X2IA 3RH4A 8ICHA 2PZSA 4OKEA 2VA8A 4I2BA 2C2EA 2HNYA 1HQUA 3MABA 4HUEA 1REVA 2EHGA 1IH7A 3QESA 1U45A 9ICXA 3V7LA 4KO0A 1J5OA 4RW6A 2BHNA 4JK1A 4NCAA 4EBEA 2BR0A 2WONA 5CZ1A 4CFCA 3QEBZ 3LP1A 5KG3A 7ICHA 3NFAA 3M8RA 4Q8FA 4B08A 4RQ4A 2PYJA 3G0ZA 4Z4IA 4KRFA 8ICLA 4LD0A 4F2RA 1IM4A 1D9DA 3UXNA 1HPZA 4CHPA 3HX0A 1TL3A 3OYAA 3T1AA 4CJ3A 1ZQEA 2BCVA 4O5BA 3S9HA 4FLZA 1BI4A 5KFGA 3SUOA 4M3ZA 4CK1A 3H7IA 4CJ4A 5KFTA 4ELVA 5CJ7A 2ZTCA 4DO9A 1RZTA 1KDHA 3GILA 1NK7A 5KRTA 5KG4A 4IQVA 1I3AA 2R8HA 1TFRA 4QAGA 4RW8A 2QXFA 4IRDA 3RTVA 2M9NA 4BDZA 4KHYA 3BQTA 3T3FA 3AVIA 4DMNA 4PWDA 1LW2A 4W5QA 4DLEA 1WAFA 4ECUA 4F5RA 3ZDDA 3Q8PB 4M9JA 4LZDA 1JKHA 3VQ7A 3LDSA 3NF7A 5C42A 1ZQAA 3SPZA 3H4BA 5I42A 3SQ4A 2IHMA 4CF9A 1ASUA 4RQ1A 4YP3A 3PW5A 1ZQLA 2KFNA 1RBTA 3DLKA 2F8SA 4CJUA 1LAVA 5IIMA 5DMRA 1RBVA 4O3NA 1ZQPA 2XCAA 1RDCA 2IS3A 5J2JA 4K4HA 4KKOA 7ICEA 3SUNA 3LPTA 2PFPA 2G8FA 3RAQA 1C0UA 4BXOA 5L1IA 2HW3A 1DLOA 5D4BA 2ATLA 1X9MA 1CXQA 3RH5A 3OSNA 4J2EA 2DFEA 2W9BA 3JPRA 4FZZA 4E7LA 3M9MB 3ZD8A 1ZBIA 1U49A 4I2FA 3OS1A 3VQ8A 4TUPA 2D0AA 3TAGA 4FCYA 1RXWA 4NLKA 5DBBA 1L5UA 1XO1A 3HSTB 1SV5A 3EWAA 3PO4A 3VQEA 4DL2A 2FC0A 2IC3A 4J2DA 3HL8A 5T7BA 2VG5A 3O3HA 9ICKA 4E1MA 4CF8A 4HTUA 2XY8A 1UOCA 2F96A 3T5JA 3AVFA 1ZQXA 3H40A 4F5PA 4KLJA 1RTIA 1ZQQA 3ZD9A 4YXJA 3RMDA 3AA4A 3HVRA 1FKPA 1Q8IA 4FM1A 4NXZA 5DG7A 5I3UA 3NCIA 3NBPA 4FBTA 3HYFA 4QZBA 1IKYA 3AVAA 1EX4A 4I27A 3ITHA 5KFLA 3B6OA 1GOCA 3SNNA 1ZQKA 2HHTA 3VQQA 1ZQIA 5TZVA 2Z1IA 4FXDA 3I0SA 1RDDA 5KG6A 4J2BA 4ED2A 1SZPA 3VQ4A 2QKKA 1R0AA 3Q8RB 8ICQA 2B4JA 2ZQBA 4NM1A 1KEJA 4W5RA 1B22A 4MEXA 5DG8A 1MU2A 2DY4A 4N76A 2KZMA 3Q8QB 4BXOB 1BPEA 1D8LA 1U9LA 1ZQSA 3GIIA 8ICTA 1CEZA 1B43A 3UQ2A 1ZQRA 5J2GA 3C6UA 4KLDA 3KLGA 5J0SA 1RTDA 3BQ0A 2Z1JA 2HMIA 4FLXA 4QWAA 4CJLA 7ICKA 3RBDA 5KFOA 4UB4A 2G8IA 3TQ1A 1ZBUA 3KJVA 4CJEA 4ECZA 4YG2A 4LSLA 4KLIA 3AA2A 3K5MA 1CZBA 4O0JA 2XY7A 5KFMA 4FBUA 4Q0BA 4FJ7A 4B9TA 3NGIA 3V6JA 4E7JA 1J9AA 4F2SA 8ICNA 1W9HA 1QQCA 3F9KA 1ZJNA 4Y1CA 1TKTA 5KFBA 1K1QA 3ZT0A 1ZQCA 4YFKA 4IBNA 3FYHA 4GW6A 3WNEA 4O0IA 1ZQWA 4KHQA 4KTQA 3ZSVA 2HNZA 4CJTA 1RBUA 4GMJB 3UIQA 2Z1GA 3GFKB 4PHAA 4YMOA 3FFIA 4LSNA 8ICYA 1KVCA 2FPKA 1HQEA 2VA2A 3NF8A 1VRTA 3V9XA 4CEFA 4CHYA 4C8NA 4RQ0A 3A2FA 1Z00B 3DM2A 3GIKA 3C1ZA 9ICJA 3L3VA 4AILC 2FLNA 2GV9A 4M45A 1U4BA 4FLUA 1U47A 4CJPA 4PQUA 4Z4HA 2HHVA 3EYZA 3QEXA 4Z4FA 3EZ5A 2LYHA 2B5JA 4PGQA 5IIOA 3QINA 2XY6A 3RMCA 5KFDA 2UVWA 1JLAA 3K57A 3MR5A 3C5FA 3DI6A 3L2WA 4RT2A 4J9LA 1NJZA 4FM0A 1S6QA 8ICJA 4M9GA 4KN4A 3KKRA 4GXIA 3E2EA 1HYSA 4DL4A 5KFVA 1IKWA 3VQ6A 1YVUA 3V9UA 3BQ1A 2YV0X 1XS9D 2RDJA 3AA3A 3OYHA 1LWEA 4K8XA 5CZ2A 5KRSA 4YMMA 4M9HA 1RTJA 3QERA 4Z6CA 5KFXA 1C1AA 1ZBHA 4CGGA 2C2DA 4CIEA 3AO1A 9ICWA 3LK9A 2NUBA 1RT4A 2ATQA 4DTMA 3K59A 4DU4A 4FJNA 1WLJA 4JV2A 1ZQMA 4OLBA 3HPHA 3THVA 4P4PA 2XHBA 1VSDA 5J0PA 5FRMA 3GDXA 2FBXA 4FZXC 3GV5B 1IO2A 5KFSA 3V9SA 1X9WA 5E41A 4DL3A 4FJLA 2ETJA 4KAZA 2RF2A 1XU4A 5J0RA 2AGQA 2V4QA 3V81A 2ZTDA 1O1WA 3T19A 4UQGA 1T03A 5CYQA 4RQ6A 4B9LA 4WE1A 4ELUA 4HVJA 4KHWA 5BPCA 5DGBA 3PX0A 4GC6A 4KLGA 1JXLA 4CJKA 2R8JA 2WTFA 3CFRA 3AVNA 3U3YA 2IGIA 3EPGA 1NJXA 1XSLA 1X9SA 1Y88A 1NK8A 2PI4A 3BJYA 4DSKA 4I2AA 4NLGA 4CJVA 3T5KA 3VQBA 2X74A 4KLMA 3GV8B 5J2FA 4B9VA 1RDBA 1Z3EB 2O4IA 4YR0A 3V72A 3KHHA 5DLFA 1Q9YA 4ECSA 2IA6A 4CF1A 3QEPA 5EOZA 2AGOA 1K1SA 2ALZA 2R8GA 1W0HA 1WCNA 8ICSA 3B0YA 1S1WA 4BWMA 3NHGA 3RH6A 4RNOA 4DSLA 1HJPA 4ED3A 2IDOA 1RPLA 2NRVA 3H08A 3ZT3A 3IG1A 1RTHA 3VQPA 2C28A 1XSPA 4H4OA 8ICFA 4IG3A 8ICWA 1X1PA 3CYMA 1TVRA 2ISOA 4DWIA 1BQNA 4QZCA 1EP4A 3NAEA 5KFKA 1T7PA 3OY9A 3RB3A 5DB6A 4O3PA 2A1SA 1ZQZA 4RPXA 4QZGA 3TFSA 3TAFA 4W5TA 4YNQA 2W42A 3PUFA 4I28A 3SI8A 3V6KA 4FK4A 2VG7A 4BACA 4I2QA 3BGRA 1JLQA 5J2PA 1S1XA 3B6PA 4JV0A 2G8WA 4GLXA 3GIJA 3ZSQA 4DTOA 3M8PA 2KFZA 4KLLA 1DTTA 9ICBA 4RW7A 4C8MA 1SKSA 4Z0UA 3RR8A 5DQIA 4XA5A 1QSLA 4FK0A 3HPGA 2RKIA 3OYKA 4C8LA 5HP1A 4O3OA 2Y1IA 4OPJA 5HLFA 3SUPA 2MAXA 3DOLA 2BKEA 1A5XA 4CESA 2X6NA 3P5JA 5KFFA 4EBCA 5FROA 1SUQA 2I5JA 1RCHA 3HT3A 1FK9A 2HHQA 2OPPA 4M3WA 3OYMA 4KTWA 4P4MA 1LB2B 3AVLA 3SCXA 2PI5A 4FS2A 3PMNA 3NGZA 1LV5A 4NYFA 4RQ3A 2HHSA 4QWBA 3OYBA 1NOZA 2XGPA 1CLQA 4RQ5A 1PZNA 5KFNA 4J9NA 3DLRA 3ZDCA 5KG2A 4CECA 2BE2A 5CHGA 3V1RA 5HMMA 4KHSA 5JUMA 5KG1A 3MAQA 4KHUA 4ECQA 1J53A 4XQ8A 1S9EA 3LP3A 3DRRA 1WSJA 4F4WA 4I7FA 3AU2A 9ICMA 1T05A 4MF8A 1T8EA 3PW2A 7ICQA 1RILA 4J9OA 7ICFA 2NRTA 1SL2A 1HUZA 2FBVA 4FM2A 3Q8LA 3GIMA 2E6LA 3AA5X 3N4MB 7ICPA 8ICRA 1WN7A 3AVMA 1WSFA 1RBRA 1T3NA 1VSFA 2QK9A 1KLMA 5KT4A 2W9CA 2PFQA 3VQ9A 2PFNA 4F3TA 4LZGA 1BIUA 5KT5A 4ECXA 2ZUCA 3B0XA 4E19A 1TK5A 4DOCA 4CJ5A 5HHIA 4XUSA 1DGSA 4R65A 3CM6A 1JXBA 5L1KA 1C6VA 1HYVA 3ZSZA 3HM9A 4NCBA 2YNGA 4RZRA 2BQRA 4GVMA 4RW4A 4YD2A 3ALYA 7ICVA 3ISBA 1XHXA 5EU7A 3RRHA 3QEAZ 4CHZA 4O3SA 3L2UA 3F73A 4B9SA 5DDYA 4O5CA 4DSJA 5DBAA 3RJEA 3KIOA 3KK1A 4UBCA 3MDCA 1ZBFA 2DFFA 5CR0A 4E7KA 3OYDA 1NJYA 3AO5A 3LALA 1J54A 4KLOA 4QZIA 1VSLA 1EKEA 2J6UA 3C1YA 4DQSA 4MFBA 3TARA 3OYCA 3KHGA 4IKFA 4DL5A 1UT5A 2ZJ5A 2ASDA 5DKWA 1EXQA 4ID5A 3OHAA 4RG8A 4IR9A 2D5RA 2JEFA 4QWEA 1NJWA 5KFJA 1TAUA 3RB6A 3DOKA 4TQRA 3H8SA 4YQWA 2FBYA 5IIKA 3AVJA 4JUZA 4F4KA 3QIOA 4M9LA 2HHXA 1BI4B 5D3GA 4QOZB 5IIJA 4DS4A 4FJ5A 1CZ9A 4K4GA 3K4GA 2W9AA 4Q44A 4FO6A 3O4QA 3K58A 2F1JA 4QZHA 4QCLA 4CJRA 4RW9A 4YCXA 4UBBA 1B92A 1S6PA 4FK2A 7ICSA 2A1RA 1MSWD 5DQHA 2YNHA 4OKJA 3Q8KA 4PHPA 8ICKA 1XI1A 9ICGA 2IBKA 4CJWA 5KGWA 3KKSA 5C5JA 1VSMA 4HYKA 4DG1A 3MXMA 1JX4A 3ISDA 3I0RA 4J9SA 4DTPA 4BDPA 4M0AA 3JYTA 5HP4A 2XRIA 9ICTA 3M9NB 2OA8A 3ZSWA 3CQ8A 3LWMA 4BE0A 4LY7A 4CGJA 1ZQHA 1VRUA 4DSFA 1S0VA 4F5QA 1RYSA 3GV7B 4KLUA 2OYQA 4Q5VA 5J0WA 1ZQNA 8ICMA 9ICLA 4ECTA 5IINA 1N48A 1RT7A 3JPNA 3G6YA 5C24A 5EWFA 2G8UA 5KFZA 5J2AA 2QKBA 2JZBA 4QW9A 4FJ8A 4RQ2A 3LDAA 2Q0ZX 4O55A 2W9BB 1BPBA 1JL2A 4KLQA 1S0NA 3M8SA 4HUFA 4B9UA 4KPYA 1C7YA 1QLNA 5F9LA 3H8WA 5FRNA 3RWUA 4KLSA 1H38A 5HBMA 4KLHA 4IFVA 4AHSA 4DTXA 1HUOA 4RNMA 4YD1A 3KTQA 2KN7A 1A5WA 4J2AA 3PVXA 1JLCA 1CUKA 2KQ2A 1KVBA 4M47A 4K8ZA 1IKVA 3E01A 4MEYA 3DLBA 4CFDA 4CFBA 4HUGA 1S5JA 5DQGA 3KHRA 4GXKA 3L8BA 1C0TA 2FPMA 4PPXA 1ASVA 4F92B 1RT1A 4J9KA 3NGDA 2WOMA 3ISNC 4ECYA 1C1BA 1RNHA 4J9MA 4ZHRA 2C2RA 1UA0A 3L2RA 3UQ0A 4NY8A 4Z6DA 4B9MA 1ZQOA 4DTRA 1Y97A 4OKKA 4E7IA 1V9PA 3NGYA 4JLHA 2F1IA 5HRRA 2DPJA 2PXIA 1S1TA 3AO3A 3SZ2A 1S9GA 4EP4A 4RNNA 4Z4CA 4KI4A 2JZBB 4Q8EA 3OYEA 5EWEA 4QZDA 4TUSA 4YFUA 5J2CA 3OS0A 1IXRA 4CEEA 3MEEA 4TUQA 2AU0A 3RJJA 3OYNA 3RBEA 2FMQA 3HK2A 4JWMA 4DFKA 3K2PA 3NH2A 2ASJA 4X5VA 3K5NA 1G15A 9ICPA 3NTUA 4BE1A 3AUOA 1XSNA 3JPOA 2BCRA 3O4NA 5HRNA 2FPLA 5CP2A 4AHRA 3KLFA 5KFWA 4DQIA 4I2CA 1JN3A 4ED8A 1DTQA 2RN2A 4M9NA 2X6SA 2E4LA 3L3UA 3L2VA 1NK0A 4TQSA 1FKOA 4BE2A 4C8KA 4DL7A 3H4DA 4HCBA 3V1QA 1TVAA 2B21A 2NRXA 4FLWA 1N5YA 1Z25A 1NOYA 3VQ5A 5DK5A 5J0TA 4N56A 7ICMA 4Z4EA 4N41A 4I29A 4F93B 5J2DA 3V7KA 5JS1A 3O3GA 3QEWA 1HNIA 2P1JA 4IQWA 1TK0A 1RT3A 8ICZA 1QE1A 3V6DA 1MQ3A 4QZAA 1A77A 3NE6A 3D45A 4N47A 4R8UA 3G6XA 9ICUA 1ZQUA 4CF0A 1WSGA 4HHTA 1TKZA 1RT2A 1BQMA 1U04A 3S3NA 3KLIA 1RYRA 1NK5A 1WSIA 5KG7A 3ETLA 3RJKA 3I8DA 2XO7A 1HJRA 5J2IA 2HHWA 4NYNA 3ZDBA 4F3OA 1BPDA 4DFPA 4UB2A 4CGDA 1ZJMA 3TAEA 4G1QA 1NK6A 2P51A 1S0MA 4KTZA 3V7JA 9ICVA 2ZE2A 8ICPA 5CWRA 4RUCA 4I9LA 3ZT4A 1VSEA 1L3VA 4DTNA 2XC9A 3SQ0A 1WAJA 3OSPA 5D46A 4P2HA 3IHQB 4CEQA 4Z4GA 4CEAA 5IILA 4PHEA 4CEDA 1TV6A 4HCCA 2NRWA 2P5OA 4PGYA 4FVMA 4YVZA 4DF4A 1BPXA 2C22A 1RXVA 4CERA 3CFOA 1S76D 3JPTA 4I2DA 4CGFA 1ZBLA 1ZQBA 3KD5E 4BWJA 3PNCA 3AVHA 1BGXT 4M3TA 2YKNA 4ECVA 1QSSA 1QS4A 3PR5B 3KHLA 2FMPA 3CFPA 1JL1A 4FJXA 3PMLA 4O3RA 1VSHA 4CEBA 4R8UB 3QEIA 1YTUA 1ZETA 3KLHA 3TANA 3V9WA 2R7YA 3RMAA 8ICBA 4N5SA 4CK2A 4M6WA 4IFYA 4Q45A 4ELTA 3RJGA 3IM1A 5DDMA 3IS9A 1JLBA 3RJFA 2KW4A 4I2HA 2ISPA 2YKMA 4FLTA 1KTQA 2BQ3A 4JS4A 2JEIA 3LWLA 4FLYA 1C1CA 5L1LA 2W9MA 2MUTA 3RJHA 1QTMA 4NCGA 3ASMA 4ECRA 2VG6A 3OGUA 3K75D 2V9WA 2RDIA 2DTUA 4M3UA 2BQUA 4UAZA 3NH0A 1L3TA 5CY4A 4DTJA 3OJSA 1ZQJA 5KT6A 2GWSA 4DLGA 4CEOA 4PH5A 1L3SA 4OPKA 3IAYA 8ICOA 4CHOA 1TAQA 4F4XA 3UXOA 2F1HA 5J2KA 5KFEA 1NKEA 4IRKA 1JXEA 4PY5A 2XCPA 1A76A 1TK8A 4QZEA 9ICFA 2P6RA 2KTQA 1BL3A 1WCLA 1ZQGA 7ICIA 3MR2A 1KFDA 4KV8A 3S3MA 1ZQYA 1ZQFA 2OPQA 1FXXA 2UVRA 5HMLA 1A5VA 4J9RA 1XC9A 1QHTA 3C6TA 3NH1A 3ZDAA 3MXIA 4R63A 5DLGA 3DLGA 4MQ3A 4MFCA 5DB7A 4PGXA 4CF2A 3KLEA 3SPYA 4JRQA 2JGUA 3VQDA 1EXNA 1SKWA 4UAWA 2W8LA 2UVUA 1K6YA 2OPSA 2OZMA 4H8KA 5K14A 3WNFA 2HNDA 3PR4A 3TAQA 2GUIA 3TABA 2ZJAA 2ZJ8A 2IMWP 4J9PA 1RBSA 3JPQA 8ICIA 4OLAA 4ED7A 5SWMA 2MUTB 2PFOA 4IRCA 9ICHA 3PW7A 1C0MA 4L8RB 2UVVA 2ZD1A 8ICEA 3GQCA 1RT5A 4FLVA 4DU3A 4PA1A 3AU6A 5EWGA 1HRHA 5BOLA 3N97B 1NOMA 4EZ6A 1B9FA 3ZSXA 3LAKA 5KFAA 3M9OB 5FDLA 3VQCA 4DQQA 1YTAA 1BISA 1BVSA 2OWOA 1TL1A 4YXMA 4I2IA 3ZT2A 3SQ2A 4GC7A 3SV4A 2ZUBA 5L9XA 3G10A 5DB8A 4CCHA 4YR3A 4I2PA 4DF8A 2W8KA 4B8CA 3RJIA 3AO2A 1CXUA 3UPQA 3PX4A 3K5LA
chains in the Genus database with same CATH superfamily
5ALOA 3OTOF 1FWKA 2UXBF 1SC1B 2CVEA 4ZKAA 2E5IA 3SUQA 1HBUA 3QUBA 4YDXA 5FP0A 2AD9A 5T41A 3W61A 5JRTA 2AQ4A 2BKNA 3U3GA 3V4IA 2AP6A 2MZSA 9ICOA 1E6YA 2YHAA 5BN9A 4OHYA 4J8FA 1IBMK 5HRPA 2XB2D 5HHHA 1I39A 2NYIA 3DRRB 3O9QA 4B8AB 2F5GA 3GZ7A 5DETA 3ETRA 4ZTJA 4GRSA 5AQWA 5FIIA 4MFFA 1KQKA 1I94K 1T6CA 2E8PA 4C8ZA 3MR6A 2O3DA 3CMAN 1FD8A 2F8MA 2MKJA 3NL0A 5B0CA 2XZTB 3NXZA 4B9NA 3FSYA 3OW2R 4HVZA 2WF6A 4FVCA 2K2PA 2P6UA 3DRPA 1Q0NA 2EAMA 3ULEB 3ZFVA 5J0XA 4EYIB 1X31C 2WVBA 1EB0A 1BUXA 1JLEA 4OZ3A 4NM2A 1R7IA 2B43A 4V19S 3OL6A 4FF1A 5CXTA 4ES2A 4M3XA 3RMBA 4QZ9A 1NNEA 2FSJA 3I96A 1UWBA 1FJEB 2NO5A 2DK2A 2ASLA 4C0BA 3C5GA 2XNRA 3GG1A 1HBUB 4LR9A 1C4CA 4HI2A 4OI3A 3AO4A 1UAXA 2YKQA 4M5IA 1U1QA 2FSKA 3CG7A 3V4IB 3NS5A 3UXPA 1RAAB 1XEZA 5KFCA 2W55A 4F36A 5M1OA 2YPYA 4KMUA 4K0KJ 4LH5A 1K8AO 3HKZC 4B3SK 4BC9A 3OBWA 2XGQA 2A6MA 2MKSA 1QHAA 5KG5A 3MM6B 1B7YB 4PXDA 4X2BA 3OYLA 5EUHA 2DNQA 1Y64A 1UT8A 4XO0A 5JVHQ 1KRPA 1HWUA 4DV0J 2N4DA 1KVAA 4G9ZA 2ZH3A 4MLHA 3BR9A 1Q8KA 2Z57B 2ZH7A 3EVMA 1HNXK 3PKYA 4LR7A 4DU1A 3L7PA 5J0UA 3AGKA 1UPHA 4ZP9A 4CHNA 1X0PA 2HZVA 3DRPB 3RB0A 4LFAJ 4KB7A 3T6BA 2E1PA 1P90A 5DM6Q 2DL0A 2O66A 5D3GB 5C2FA 3UR3C 1S7IA 1CJKA 2EBEA 4H54A 1R59O 4UY85 2DY1A 2JOQA 3SQOP 3ADAC 4I2EA 5BRDA 3MECA 1Q86T 5J2BA 1HMVA 1UWBB 3QZ7A 2N82B 2P35A 4FNIA 2DFHA 4KN7A 2IRXA 1T3OA 3NOCA 3JSMA 2XMWA 5ALIA 2XLIA 1Y3JA 3BH7B 2IOCA 2VFTA 3ZSRA 2DIUA 1ZQTA 2W01A 2AA4A 2IHNA 4YUDA 2QWMA 3VAFA 1FDNA 1N36K 1PJ6A 2B4VA 3UCGA 2D0CA 3FCWA 4QWDA 2HVHA 3MMBA 2OD6A 3C2KA 4P0QB 4F8RA 1AA1B 2FJAB 5AXKA 3MCNA 5J29A 3MTKA 2HIQA 5D77A 4XTTA 5CA7A 2F4VK 3OQ2A 2PT0A 4DPWA 1TYQA 7ICGA 5D0HA 5F1XA 8ICAA 4I64A 2MRLA 4M5MA 3ZSOA 4RQNA 4ENOA 4FJJA 1OH7A 4X62K 3PHTA 3K8VA 4GKKF 3EPIA 2DPIA 2DPNA 3VA0A 7ICOA 3UVJA 1Y5IB 4PG7A 3LPUA 4RQ8A 1YLXA 1S97A 1H2VZ 1W7WA 3H42A 4DCPB 1S77D 1BUPA 3NVZA 1SKRA 1FE4A 2RH3A 1HMVB 4UW9A 2A3ZA 2EKYA 2E6MA 1KLNA 2O8DA 1SBRA 3MCOA 2K4EA 3MGIA 3JSMB 4CFAA 1SV0C 1XUPO 5KQ8A 3U6FA 3NCQA 5GAGP 3J7ZT 4MF2A 3NAIA 3JPSA 2GVDA 1C0TB 3E9OA 1IKXA 3UN3A 1SC3B 1VJWA 4DZDA 2JLEA 2CQ3A 1ICEB 3MOJB 2X1BA 3FNNA 1C1BB 3PY8A 5H9FK 2C2NA 3M8QA 4WFYA 3RYLA 4XEIA 2UUWA 4C0OC 5J2MA 1F21A 3ZC4A 4ZCMA 2OEMA 2XMMA 2J9DE 3Q8YA 1KBUA 2BJ8A 2FHKA 4K4ZA 2KZ3A 2KHCA 2Y1JA 5A2QU 1TYQB 2W4DA 1MWKA 3OHRA 1S1VA 4KGZB 1XNSA 2YY3A 3HFKA 5C2GA 4TY8A 3K1ZA 2Z8QA 1JMSA 3HSJA 3CT9A 5F0WA 2DNYA 2ASYA 4IQUA 4OHXA 4EFAC 5A8RA 3VETA 2KHDA 2QWPA 5FLXY 3D0PA 3DU5A 1XR6A 4LVSA 3WQPA 5AJ3J 3MCAB 2PY5A 3LZJA 2MDAA 3G82B 4K4IA 1OKJA 3FZFA 1HBOB 5AQUA 4CK3A 1S6OA 2MSSA 3JSRA 1BC6A 1PYOB 3OV7A 2FJXA 3CCES 4O3QA 2MGZA 2YHBA 1VDVA 3CCSN 3C65A 4OX6A 4R5PA 2QJ3A 2KFYA 5AK4A 2K1RB 3PW4A 4YMEA 1IKXB 4OJ3A 5KFIA 3SYZA 8ICUA 1SV4A 3SJHA 4I56A 2CH5A 4DV5J 3ID8A 4QIGA 2VU5A 1YIJS 1SL0A 4ZLLA 1Q4RA 4CRJA 3KMSA 2KV2A 3OHBA 4OYAA 5BR8K 2H3ZA 1QUPA 3IN5A 3N0VA 4DV7J 4JWNA 1S1VB 2BANA 4EBDA 9ICRA 3EY1A 1RWPB 1KN5A 2FJ6A 5IIIA 1F9HA 5HROA 2ZBIA 5BYQA 8ICXA 5A8RB 4LUBA 4R64A 4PL8A 2DGWA 3O5TB 3IO1A 3T9NA 3LL3A 2DEIA 5KT3A 4FNHA 2W7AA 3FEXB 4ILLA 1DQ9A 2O5DA 1Z4NA 2WVFA 3K2YA 1PK3A 1L8OA 4ZP7A 3CXCM 3QZ8A 7ICLA 3IRXA 4KMOB 2G1DA 2DVIA 4CZMA 2DFLA 4F5OA 4R5PB 2R3VA 5LMUJ 4GY2B 2ITGA 1X60A 5C15A 1JJ2M 1YHQS 3DHWC 9ICNA 2W2OP 3VGUA 1G6BA 3RZAA 3VA3A 2HBKA 4Y2UA 1MLAA 1UVNA 3SI6A 1D9FA 3M6GA 5FPEA 2VYPA 1OXJA 4XPCA 3LH2S 2UXCK 3VAJA 2YNFA 1WBDA 3M6UA 9ICEA 5KPRA 2ZWOA 3EGNA 4JHDB 5LJWA 4EYHB 2EFPA 3KLHB 3FJ2A 2BGWA 5DO2A 4WP8A 3W60A 4LF5F 1VQMN 5KGXA 5TKYA 4C7QA 3VVTA 3C2LA 4RWWA 2KB2A 3WUHA 2FB0A 1J27A 4O44A 3RRKA 1JLBB 3TI0A 2R7UA 4OJHA 1CPZA 2IHR1 2RMLA 2R7SA 2IIRA 2HMPA 1YBAA 4DL6A 2VV5A 3L4BC 1X2IA 2QLXA 3C7NB 4OKEA 4I2BA 2C2EA 3N79A 1UW4A 2HNYA 2HBZB 4NLQA 3U4LA 2QFIA 1U1PA 1REVA 3QESA 4X84A 1N36F 3R3LA 3R6MA 3V7LA 4RW6A 1URNA 4NCAA 2MZQA 3A12A 2WONA 2XMKA 1MMNA 4HHUA 2A1BA 3KG4A 4L76A 3NFAA 2QFJA 4LRBA 1KW4A 1SJ1A 3W3DA 4KRFA 3ZETA 1UVLA 2QO3A 3M2RB 2E88A 4LD0A 1NGIA 2XSJA 4DU8A 1OVYA 4KV8B 4ZLPA 3HX0A 2RU3A 3H59A 2YJFA 2YNFB 1ZQEA 2ILYA 1QVGR 2V51B 4J90A 4UAUA 2CPDA 4O5BA 3D54A 3SMPA 1BI4A 4OO1J 4AQYJ 3QWUA 2ZKTA 4EGLA 4DUYF 1KOHA 2SXLA 2UUAJ 4FN5A 1RAIB 4M3ZA 3T9ZA 2LA4A 3LUYA 2IJNA 1KDHA 3W8GA 2Z58B 1NK7A 3CMEN 4DN0A 1J5EF 2M9NA 2D6FC 3ONQA 3WK7A 3AVIA 4K41A 4DMNA 5B0EA 2VGMA 2QGFB 3FKBA 3Q8PB 4G6VB 3KJNB 4LZDA 1OO0B 2YWFA 1ZBSA 4LF8K 4DV0F 3NF7A 1M90O 1ZQAA 2ZD1B 3G87A 2JC0A 1REVB 1ESVA 4QYRA 3FEYB 3HOTA 5I42A 3SQ4A 3G71S 1Q3UA 3HI9A 4RQ1A 4NYPA 4C3LA 2F7TA 2WONB 1X40A 1ZQLA 1RBTA 4C80A 4JMUA 2DH8A 1I5OB 1X8DA 3DC2A 5DMRA 2CQ0A 3O1WA 3SBGA 1U2FA 4O3NA 1RDCA 4U7BA 4K4HA 3SUNA 3C0BA 1FFGB 3AQOA 3ZETB 2G8FA 1C0UA 5LSLA 2HW3A 2BXJA 5D4BA 5D4NA 3IR7B 3OSNA 2VPWB 5JLHA 4CQ1A 2OFHX 4FZZA 4K4VA 3VEOA 4E7LA 2WBRA 1ZBIA 4I2FA 3N4QA 1XMOK 4C3KA 4ZP6A 2FVPA 4FCYA 2R42A 4NLKA 5DBBA 2WF5A 3BQ7A 2NV3A 1L5UA 3HHLC 1N32J 1QQOA 3HSTB 1SV5A 3EWAA 4CLSA 2VWBA 5CZXA 2VODA 3O9SA 1VQNS 5T7BA 2E5LJ 4E1MA 1HWKA 4K2XA 2XY8A 1UOCA 2F96A 2F77X 2DRBA 5J1EB 3NVWA 4KLJA 4DV1J 4EHUA 3A0HU 2B9XA 3RMDA 5AQGA 3CMQA 1R8AA 2YKPA 4BG9A 1YVFA 4NXZA 2MY8A 3NCIA 3NBPA 4BC4A 2WSEC 3MM8B 2XYHB 4AXJA 3HRGA 1IKYA 4I27A 4R25A 3U8XA 3O5BA 3JTOA 4KFBB 5CCLA 3VQQA 5DZ7A 1ZQIA 1U02A 5TZVA 2QC3A 5FLXU 1VQ7S 4NXNF 1C20A 1FJGK 2W1BA 3WIUA 1SZPA 2QKKA 3FLCO 3PIPQ 4JB8B 2GGPA 4CZHA 4PUOB 4CGZA 4HEA9 3AQPA 3F44A 2KD1A 3UWTA 3VAIA 1XQSC 3Q8QB 3MMJA 1RJJA 1BPEA 4CF4A 3GYNA 3A5NC 3MEDB 1D8LA 1U9LA 1VMBA 5AIBA 1GLDG 3WKCA 1CEZA 2CG4A 4PKHA 3IDWA 1AQ6A 5J2GA 4KLDA 5J0SA 2CPIA 1RTDA 3BQ0A 4P2SA 2V67A 2HMIA 3QO9B 3N9UC 5HANA 2JZ5A 4QWAA 2I9SA 3VGKA 4CJLA 5KFOA 3M7DA 2G8IA 1SV5B 2HQCA 1NGDA 1WYGA 4Y2AA 4KLIA 1IBLJ 2YWKA 2CQ4A 3E3XA 2UU9J 3PJWA 1KTVA 2V94A 4FBUA 4FJ7A 3BZKA 3UDVA 2P6SA 4WKYA 3M6VA 1LW0B 1J9AA 2UUTA 3VQTA 1S7HA 2FQQB 1EAYC 2YX6A 4Y1CA 3D2FA 4AYBC 5KFBA 4YFKA 5DM7Q 2BJ3A 2CWXA 1ZQWA 1QUVA 1L7NA 4DCJB 3BF3A 2MKCA 2DCLA 1JI7A 1YJ9S 4B17A 2MQ8A 2FPKA 3BR8A 3UN5A 4LR8A 3ONNA 2G1HA 1DK2A 4C8NA 2VC1A 4PZOA 5AJ3F 2CPRA 5AQKA 3SDEA 2BVZA 3L5KA 2NNWA 3DYAB 3L3VA 1U4BA 2HFVA 1U47A 2RQKA 4PQUA 2VZ9A 4OJGA 3EYZA 3EZ5A 5D0GA 2LYHA 2B5JA 2H9ZA 3GTYX 1WG5A 2XY6A 1ZOLA 5KFDA 3MR7A 5HL7Q 2UVWA 4IJAA 2R7TA 5CHCB 5E26A 4RT2A 3D5MA 5I4MA 2VQEK 1KKXA 2RNEA 1UCVA 1IIPA 2BJ7A 1HYSA 2WVCA 4NLPA 5CYJA 1ELOA 1T9UA 1L8LA 1WNEA 1YVUA 3V9UA 3M32B 4Y2MA 3AA3A 5U47A 5AQHA 2FTRA 4YMMA 5AQSA 1QZ6A 2NZCA 1RTJA 3JB9k 5AE3A 1VQ9S 3TA2A 3UD4P 4Z6CA 5KFXA 1C1AA 4CGGA 2I5HA 1ZPWX 1V97A 4CIEA 1RHJB 9ICWA 2UP1A 2MZRA 2ATQA 4DTMA 2V8DA 5C25B 4JV2A 1ZQMA 3F2CA 3THVA 5FPDA 5J0PA 3GDXA 4OZ2A 2OUGA 2HQFA 4BLGA 4H0TB 3MTJA 2WSCC 2ETJA 2RF2A 1FVSA 2ZITA 1LXNA 2YX1A 1QJHA 2CZ4A 3HRDD 1U2RA 2XHWA 1QM9A 4B9LA 3VTHA 4WE1A 2CKWA 4ILGB 3GYXB 4HVJA 2VF3A 3TX8A 3DNCA 4B3RF 5AQTA 4CJKA 1JXLA 3QBXA 3AVNA 4Y2PA 4HR2A 3B8AX 4BC2A 3SQIA 2IGIA 3EPGA 2QMXA 3C3LA 1ZOTA 4FZVA 3F5EA 3BJYA 2IRYA 2CGKA 2ZNYA 4E8UA 3VQBA 4KLMA 2GX8A 1MN8A 4L3NA 1FDDA 1RDBA 5ALEA 2GMJA 5AK3A 3V72A 3KHHA 4PR6A 1VDHA 4ECSA 4CF1A 1Z1VA 2YMMA 5EOZA 1RTJB 3QT8A 4A62A 4U95A 5LJVA 3ZT3A 1RPLA 1YJNN 3KK7A 1V38A 5LXYA 1T9VA 1VQLN 5K4LA 4F0HA 4LF9K 8ICWA 3ZTRA 4KGKA 4IOXA 3CYMA 1TVRA 1BOTO 1BQNA 3JSBA 2F7VA 4ES1A 4K4YA 2C3OA 1DURA 1EP4A 5GADP 1T7PA 1RP5A 2J0XA 3DMJB 2ZGZA 2DGSA 1ZQZA 3QGPA 1KP6A 3NOGA 1NDKA 2AJ0A 5AXLA 4JB3A 3TFSA 5AM5A 3BBCA 1LK5A 4BJQA 3W3SA 3OFGA 1NEEA 3NCRA 4FK4A 5B0GA 4OLPA 4BACA 4K2JA 5IC4B 4R79A 2DKOB 4HH0A 1PC4A 3BGRA 3CW2C 1JLQA 7FDRA 3B6PA 1COKA 2NQPA 3CD7A 4H4KA 3LGNA 1PO6A 4KX3A 1P6TA 4Y2SA 3D4JA 2KFZA 1Q18A 1DTTA 1FRLA 1RWMB 1SKSA 1GXUA 4H5VA 3AMZA 2MYFA 1U7LA 2AEFA 3HPGA 3MM5A 3AY0A 2RKIA 3OYKA 2AX0A 2Y9HA 3MAAA 1Z19A 3R8YA 4OPJA 4JI0J 3NGTA 4CLKA 5CQGA 1A5XA 2D7SA 4MKAA 2LMIA 1NJIO 2UUAF 2LI6A 1RXOB 2H4YB 3DN9A 1Z1ZA 5G5GA 3AT1B 4NLRA 3OBYA 4C0HA 4Y34A 1VQPS 3IR5B 3OYMA 3BB5A 2OYYA 4P4MA 2GWJA 1AXQA 3SCXA 3WZ0A 3BYPA 1UQVA 3PMNA 5ITHA 2MB0B 4UY8O 4ZPVR 3ZTQA 2O8FB 4K43A 4A4JA 4QWBA 1NOZA 1FJCA 4DXLA 2UUBK 2LFVA 5KFNA 4JI8K 5CZVA 3T7ZA 1U25A 3HKWA 4ANCA 3MAQA 4KHUA 5IQQA 1D9AA 1ZXOA 1J53A 3HVAA 4LF2A 4XQ8A 3VGMA 1S9EA 4JV5K 1R0CB 2IIHA 1CVJA 3B6BA 3F2DA 4ER8A 3U02A 4MF8A 5EOYA 1R89A 1HUZA 2FBVA 3U1LA 2RSQA 2VPXB 4AL6A 1R27B 4M8LA 3GIMA 1HD1A 4HT5A 3AA5X 1DTTB 2DR9A 1HWJA 1TP7A 1WEYA 3R97A 4UZBA 1RBRA 3MM5B 1KAYA 5IWAK 2PFNA 3I55N 4K7QA 1BIUA 4ECXA 2ZUCA 3CIZA 3B0XA 4Q2LA 4DOCA 4CJ5A 5GAEP 1U0HA 3JS9A 5HO4A 4OPAA 7FD1A 4ZCKA 2E5LF 2RHKA 2IVMA 1JXBA 2DGXA 3IM9A 1W2BR 2W2MP 2M3DA 4IFEA 1WWUA 2IAJB 4NCBA 4DV1F 2YNGA 4GVMA 3I9ZA 4WYWA 5M2UA 3ISBA 4I6YA 5B8HA 3RRHA 1HBNB 4BRDA 1H1VA 5F3ZA 1XMBA 3F73A 2AKWB 5AZJA 3LGMA 3CPWR 1HQUB 3GE9A 2ZJQQ 3NVKA 5DBAA 2HVZA 1DY3A 2PMWA 3NVVA 5CR0A 1I6JA 1FRJA 3OYDA 1RHMB 1S9EB 1MA7A 3NWGA 1VC0A 4C97A 4ZJOA 5M1PA 4QZIA 2K3KA 4BR9A 4MFBA 3TARA 3N5FA 2V2QA 3KHGA 5F3TA 4DL5A 1UT5A 3Q0AA 2D74B 2ZJ5A 1XNRJ 2ASDA 4H0OA 5DKWA 1EXQA 3OHAA 5CAAA 1XMQF 5AR0A 4RG8A 1NNLA 3H7HB 1HPZB 4RNHA 4BQLA 1TAUA 4GVBA 3EEQA 2F40A 4QOZB 3R1HA 2YBVA 3UMBA 4H5NA 4JI3J 1T3QA 5DDPC 3K4GA 1IBLF 3CMAS 4YCXA 4UBBA 1U26A 3CIMA 4DFDA 1HHTP 2N1RA 4BUGA 2ZZMA 4BCAA 5IT9Y 4PWDB 2YNHA 1KQQA 1O03A 3ENAA 3S1TA 3T1HK 2LXIA 1XI1A 9ICGA 1SS6A 1VQON 1JKHB 1PVPA 1LKZA 2CZ9A 3QAUA 3QWPA 3D6JA 4DG1A 3MXMA 3W7BA 1JX4A 3ISDA 4J9SA 2UUCK 2KVSA 3JYTA 1FXDA 1TFYA 1RWKB 4BE0A 4LY7A 2KMDA 1ZD3A 1HARA 3AQEA 3AQFA 1S0VA 1HW9A 4F5QA 2KE7A 4KLUA 5BRHA 1QVFR 1FEHA 2KI2A 1VK8A 2HS0A 1HWIA 9ICLA 4ECTA 1N48A 4N8NA 3O6QA 1XC3A 2R18A 3JPNA 2G09A 5EWFA 3J7YP 1R6YA 5J2AA 1EQ0A 2QKBA 2JZBA 1E6VA 2ZM6J 3HFVA 3C6AA 1OH5A 1WF1A 5HK4A 3U7JA 3UR0A 4GKJJ 2V7ZA 2Q0ZX 1CJTB 2W9BB 4ETZA 2N7YA 4M7XA 1BPBA 4U6PA 1VQ4N 2Y1LB 2ZH4A 3FUYA 4B9UA 3BS9A 4WTYA 4YB1P 4HUFA 3J80Y 1QLNA 4YOEA 3QUTA 4AHSA 2M0NA 3DDHA 4RNMA 4YD1A 5AI9A 1UMJA 3GG0A 3GU0A 3ISZA 1XIQA 1JLCA 2UXDJ 3OR2A 1FEEA 4P75A 3OTEA 2DRAA 3QICA 3DGPA 5HVHA 2P9EA 1XN9A 2DHHA 4K8RA 1MMLA 4CF3A 3D6HB 4KBIA 4DV4K 3KHRA 4DG1B 4GXKA 2YX8A 1PG5B 2AZ3A 3MM7A 3C66A 2FPMA 5LL6Z 1ASVA 3ISNC 4ECYA 2LXFA 2A42A 3VTIA 2VJ5A 3L2RA 4YHHJ 4P0PB 2K60A 4DR4J 2C3UA 3NGYA 2J5AA 2OAUA 2EDUA 2Y0SD 4EP4A 3VZIA 4RNNA 2JZBB 4Q8EA 1KNZA 1J2VA 3WDOA 2KRRA 3I5BA 5AQFA 2IYGA 4BR7A 1VYAA 5J2CA 1IXRA 2E1YA 1B3TA 3RJJA 2FMQA 2GIQA 5ALLA 3KLGB 3JXUA 4USIA 3N4WA 3ZNJ1 4JYAK 1S5ZA 1URRA 1G15A 4I6WA 4CLYA 2CPFA 4K0KK 2HS4A 2OIHA 4I6MA 1WD6A 4WPAA 5HRNA 2ABYA 4NA3A 2B7CB 4LSLB 3A3OB 3TUZC 1NU0A 4I2CA 4ED8A 1C4AA 3C15B 4BRPA 5EHHA 2W4CA 3SQGB 4ZJQA 1BA1A 2Y1RI 5FD1A 4P74A 1JLCB 4JKGB 4YS2A 2YJEA 2ZHOA 1HLUA 2E4LA 2XVTA 4BRMA 3HCXA 3ZI4A 4L73A 1NK0A 4BE2A 4C8KA 4HCBA 4GV6A 3EZOA 2B21A 2NRXA 1FF2A 1Z25A 4CLLA 1NOYA 9ATCB 2E1MC 4NLBA 5DK5A 2MJNA 5J0TA 4CO2A 4F93B 3RUBL 4LFAK 3NMUA 4B3MK 2VBYA 3Q86A 1XBWA 1ZPVA 5JS1A 3O3GA 1IV8A 3IXQA 4Y3CA 1GH8A 2DGTA 1QE1A 1I1GA 3KWMA 3AB2B 4QZAA 1RFQA 1WHWA 5EN1A 1NGFA 2LCWA 3MN7A 4WFAQ 1RWUA 2KU7A 1KD1O 5AI4A 1WSGA 1TKZA 2WVEA 1AUDA 3ILJA 4FZLA 2ZH8A 1PVQA 1N5SA 4JI4F 1NK5A 3ETLA 2V9KA 4P2XA 1IBKF 4P71A 4DR5J 2XO7A 2CFXA 1WBBA 5KAFU 2AV5A 1HJRA 2HHWA 1X7VA 5K8PA 2NR0A 5C2CA 6AT1B 4I6MB 5CEHA 3TPQA 2HVDA 3EUNA 1NSPA 1R43A 4JAXA 1K8AT 2KP7A 3M8ZA 2Q31A 4CO5A 3DI6B 4CH1A 1EQMA 4KX5A 3CC4N 1NGGA 4RUCA 4M5GA 4CLTA 1V4SA 2XLJA 1AW0A 5BJRA 1KQSR 3O1BA 4DTNA 4CI0B 4LIRA 2W25A 3AOAA 5K20B 2LVWA 4LF6J 1YJ7A 4PHEA 1LWEB 3HHDA 4TLQA 4CEDA 4U7CA 2ZEJA 5AQLA 3SLCA 4PGYA 3CQYA 4DF4A 4IH6A 4URGA 4FL9A 2HOFA 1S76D 2YVSA 4CZKA 4M3TA 1VHIA 1T9TA 1HJOA 3PR5B 3OTCA 4U9RA 4YY3J 1QE1B 2QB0B 4PG6A 3CCSS 4O3RA 2KT5A 5J8YA 2O01C 2VBWA 3HHLD 3QEIA 2Y0SF 1UFKA 5ALHA 4M6WA 4CZJA 3ET6B 4IH7A 2HHHK 1GQEA 3MI7X 4CBXA 4ZLNA 3IS9A 3O0FA 2D9PA 4I2HA 3ZEUA 3CO0P 1F60B 3D2WA 3LWLA 3VEZA 1UJ6A 3TX0A 5HQLA 1HNZF 4ECRA 2VG6A 1VI7A 1X6JA 1UVJA 2IJFA 1PGZA 2KL8A 4UAZA 3UDEA 1JRPA 5DDQC 5CY4A 2B8PA 2LDYA 4H5WA 2BX6A 2HSZA 3K1RB 2VD3A 4NEYA 1JALA 2RS8A 4A8OA 3IAYA 1XK8A 4J5OA 5IT9U 2F1HA 5J2KA 1NKEA 4QIVA 4NXMJ 3AY9A 2XO6A 4ISGA 3O2IA 1TK8A 3MMAB 1K8KA 2KTQA 4DR3J 1ZH5A 1WCLA 1MG7A 2W3RA 3VPZA 4KR0B 1O5JA 4LQ9A 1KFDA 1S1WB 1RKIA 3S3MA 1FXXA 2APOA 1ECWA 3FSXA 5AI8A 1YBTA 4R63A 1WC3A 5DLGA 2LYBA 1YITN 2J9DA 2ZHAA 3MHYA 3DLGA 2DBBA 3DLLQ 3KLEA 3UD3P 3ALRA 4LFCF 4Y6IA 3W8PA 1GAOA 2OZMA 2C3YA 2XZWA 4H8KA 3VEWA 1NB7A 4CE6A 3AAWB 3TABA 2ZJAA 2F1FA 1RBSA 1R3NA 2BBEA 4LF1A 3I76A 4ED7A 1RBOB 2BTFA 5AKHA 4DV5K 1MN9A 4AYBD 1RT5A 1XNRF 3KUHA 2KN4A 1NGBA 4PA1A 1HRHA 5BOLA 2OM6A 2VOPA 2DNRA 4CH0S 3OBIA 4E98A 3L0QA 3GSDA 3M9OB 5FDLA 3VQCA 2F3NA 4ZS6A 3BEGB 2R7XA 3TA0A 5HP1B 4DV7K 2OWOA 3MURP 4IOCL 4I2IA 2HF4A 2E1CA 3MF5A 3WKDA 5ALJA 2CZVC 4YR3A 2VASA 1CBKA 4DF8A 1SUQB 4JI3F 3OA9A 3RJIA 3AO2A 3UPQA 3PX4A 2AWZA 3GFXA 1FK9B 4TN2A 4CZFA 4F72A 4G3IA 2HFZA 2OHDA 2RVJA 4FJ9A 3QFHA 1S9FA 1N88A 2YPZA 3VZHA 2EZZA 1XO0A 8ICCA 4BROA 1GOBA 4JV1A 4RBTA 4M42A 4NLNA 2HQ3A 1Q53A 5LSOA 3QNOA 2QL5B 5EX3A 2V63A 5TKWA 4X4UA 1N5VA 4Y2TA 4UOGA 4K59A 2F8TA 3MGHA 1VQ8N 4ZA1A 2XSFA 3LDPA 3R7SB 2AX1A 5LMUK 1WOPA 2P9UB 4KHNA 3LM9A 4DTUA 1IN0A 4EI2A 2VWKA 1TL7B 2J9CA 1A9NB 1U6FA 3T5LA 4RU9A 3CMES 4YDUA 5KFYA 5EE1A 1HKAA 4W5NA 1VIXA 4W4MA 3C21A 4Y2RA 3CDEA 1GMWA 4AXIA 2F76X 4GKJF 1BG3A 4CO0A 4CO3A 3P5TL 4BGDA 4EHTA 3SJJA 4ZVRB 2JR5A 2IM3A 1KVJA 3TP2A 1BXNA 3QFPA 1B99A 2DQNB 3RSEA 2QTDA 5CE3A 3TR8A 1BCMA 4KLFA 4Y2YA 3CF5Q 3GFHA 4Y1DA 3SMZA 1WNSA 3EO3A 1N8RO 3WHIA 4QYZJ 4K4UA 5AHXA 5C12A 4IR1A 2A1JA 2XTJP 5GIOA 4LFBK 2XZDB 3SAHA 1XHZA 3HP6A 2BM0A 2UXDF 5C10A 2MEWA 2OMLA 4A8EA 4JKAA 4PQAA 4UZCA 3QEVA 5F3XB 4CEZA 4GIBA 3AFGA 1ZS6A 1OUQA 2CG8A 2G8KA 4F04B 1N5WA 2B6AA 2CQ2A 1UWAA 4WP3A 3JTNA 2V52B 8ICGA 1VCTA 1WSVA 4DSEA 3O3FA 3OD2A 2R7QA 2VANA 2ZXIA 3AA8A 1VQYA 2V8VA 2C2OB 3KWIA 3TAPA 4NLZA 2FVCA 1VK0A 2FHMA 4H4MA 2HLUA 1TELA 2PAVA 2CPZA 1S0OA 4DR4F 4CT8A 3CCWA 4KE5A 3RRGA 2GZOA 3RFAA 4AYBF 1VK3A 2DY9A 2BCUA 1QAYA 4LF7J 3HJFA 1V3ZA 2GQQA 3H8JA 4WQ4A 1RT6A 4QZVB 1WSHA 3HI0A 3WXMB 4AQYK 1K5OA 2P9SB 3S7RA 4CLWA 5HRSA 2C2MB 1FXRA 3R2CJ 5GADU 4I2JA 4M2YA 3X1LB 4OZ1A 3RSEB 2G8HA 4QJFB 1OSCA 9ICCA 4AHCA 3L7UA 4ZMMA 3A8KA 5CYMA 5DG9A 2BGGA 3MR3A 1ZM2A 2P5VA 3EDQB 1WELA 3QNMA 2KG5A 2VQFJ 4AUKA 2A1JB 4OYPA 4URSA 4RW9B 4CD3A 2G2ZA 5J2NA 3O9TA 1TR0A 3MM9A 2BMBA 1YKWA 1NDLA 2R7WA 1SCJB 5ALFA 2RPIA 2MXYA 3RW6A 4HL9A 3KJQB 2QRRA 3LDOA 2ZBPA 5HR7A 2VFUA 3GCWP 4FW2A 4CBWA 2MJUA 1V4TA 1HR0K 4FZYA 2XLKA 4DQRA 4OYZA 4PL7A 5RUBA 4K25A 2DHXA 3BS5B 1UFLA 3ZNUA 4DQPA 1T02A 1FO1A 3VMFB 4BC7A 3A8JA 2OP5A 3DXSX 1KQFB 2QA4N 3QLHA 4A8WA 1VSKA 4JOUA 1T3VA 1GTHA 2XWYA 1SJFA 2EPIA 2H4WB 4GV9A 1QAXA 2AJQA 1NLVA 3N7SC 2GX9A 2AW0A 3L09A 4TU7A 1YJUA 1N32K 4WP9A 2XY5A 2MKIA 3PRDA 3TYTA 1NK9A 2N3OA 2LEBA 4IO1A 5F8LA 3ULDA 1ZQDA 4XK8C 1FRIA 3HWTA 3H5XA 3RR7A 4UB5A 4WK1A 2WCXA 1KBRA 4HH1A 4IFVB 3ILIA 2F4FA 3SV3A 3K5OA 2FGOA 1XWLA 4ZVOB 3BGLA 1Z26A 4IL6U 3MM9B 4USUA 3OYFA 3NP5A 4C9DA 3QNWB 4ZOSA 4DV2J 5KFRA 4LQ3A 4FJMA 1JLGA 1M90T 4F02A 5ALTA 3L3FX 5KAIU 4ZDNA 3P4IA 5KFQA 4LF6F 3KUEA 1IG9A 3EUB2 2Z2MA 2D9OA 5AFUA 4P7TA 5HVGA 1FHTA 4F4ZA 4OX7A 4IDHA 3AJ1A 2B51A 2HK2A 3FC4A 4M5JA 4Y0WA 3PJ9A 3NDKA 4GVLA 1SL1A 1TUVA 3N28A 1S10A 5K8NA 3KZXA 1X9JA 3VEVA 4NASA 3CJBA 3D0GE 1YJVA 1N62A 1S59A 2V4JB 3QLHB 3TEHB 2R8IA 2KHOA 3O9UA 7ICTA 1S9GB 1MDUB 2NUHA 2WUSA 3VAKA 4OJ1A 2A40A 2I1QA 2ZWHA 1WACA 3C94A 4ZP8A 3CJKB 1YGYA 3NVMA 5ETVA 2OPRA 2VICA 3D2SA 5KFHA 2BCQA 2QIFA 3V9ZA 1COOA 1Y7PA 2FLPA 4CO4A 2W11A 4DJBA 4QIEA 4B3OA 2BZ2A 2DKZA 4CZGA 3KLFB 3MMCA 3CETA 4ED1A 2WW8A 4F4AA 2VIHA 4ZVEA 3CJ9A 4DQ8A 3MUTP 4CLUA 1BE4A 5B0BA 2N4CA 1FKOB 4QW8A 5SUHA 2EFQA 3W9IA 1YIJN 1HLWA 1S12A 5FPMA 3G6VA 5J0OA 4LH4A 4NXMF 1G4CA 3MFIA 2ZZTA 4DEZA 1XNQK 4IQTA 1KFSA 1VJ5A 2HLTA 4ANDA 5ADXH 3QIPA 5F0XA 1WJ9A 3V1OA 4CJ7A 4KHMA 4I9QA 4DV3J 2IFXA 2I6WA 1M5KC 2ZUDA 2VWJA 4UB3A 5A6WA 3RU0A 3TAMA 4DFJA 3QRRA 2JEGA 2HOQA 2J8AA 2OD4A 3HZGA 3OVAA 5F2RA 3KLIB 2LPEA 3THXA 1WSEA 4Y2CA 4CJSA 3O8WA 4KRWA 2WC9A 2X3GA 1WKKA 4IWVA 4WBFA 3FQLA 3QFWA 5KT2A 1CS4B 1BHLA 1ZAXA 1VQ6N 1WWVA 1ZQVA 2BPFA 2QLBB 1FJ7A 1UPMB 2FLLA 4ED0A 2GBZA 3Q7BA 1NXIA 2WF8A 1NZAA 1U6ZA 4G1QB 2V34A 1RHQB 5D49A 2OGUA 2DYAA 5B66U 1YJNS 4IO8A 4JRPA 1YHQN 5ALMA 3I82A 3WXKA 4OJLA 1VQLS 9ICSA 3LPEA 2JH7A 2KM8C 5SZTA 1CJVB 3U9ZA 2GJIA 2HPUA 2CQCA 2JEJA 1H7XA 4CLZA 3H0RB 3ZZ0A 1S6UA 5HVFA 2EFNA 2H1YA 3OW2M 4CGIA 3MBYA 3PX6A 3TFRA 3ZZUA 1ZBTA 3EWGA 4ZVTB 3HILA 2XEXA 1AB8A 1YJWN 5M2RA 2KZZA 4TSXA 2Q66A 4B1ZA 2YNIA 4BREA 2J8SA 4TU8A 1RAOA 4E7HA 2DUYA 3D68A 3SR6A 1ZD4A 2J7WA 1TV9A 1F1BB 4QS9A 3THXB 4FS1A 3OL7A 5LT5A 4RUAA 2RRNA 4QR2A 1Z6RA 3FDSA 1NM1A 4TYAA 3MDFA 2DB1A 3K8WA 2D8CA 1M0SA 4RPZA 3QETA 1C1CB 1KSPA 8ICHA 2ZIXA 3OXGA 4C11A 4BY9C 1YRUA 4HUEA 1HIWA 3DWLA 3VERA 3SCJE 4KO0A 4DUZJ 1F5AA 3ISND 4W92B 4EBEA 4CFCA 5MAOA 4KYZA 3UFCX 3S8SA 3QEBZ 1CSJA 2C2KB 3M8RA 3IP4B 4RQ4A 2PYJA 4LF4K 3J81O 2P8IA 1Q46A 3OTBA 3F56A 5GMKa 4KGXB 3LPYA 3SAGA 3IWLA 1SV0A 4F2RA 2LLZA 2IVFB 4DDFA 3UXNA 2OPQB 3OYAA 3T1AA 3QU4A 2YXLA 1UETA 4RKUC 1V5VA 2YNIB 1FA0A 1KKHA 1DGKN 3UCZP 1MWMA 3ZLJA 1Y5LB 4FLZA 2QM1A 4DN9A 2ZH2A 5D8HB 3AD8C 1VLBA 1EHWA 3TRGA 4CJ4A 4ELVA 1RZTA 2ZTCA 2R2SA 2PMZC 1H2UX 2WW4A 3GCXP 2ZBCA 4PXBA 2A3VA 4OZ5A 1I3AA 4DCOB 4YOYA 2HNDB 1ZD2P 1TFRA 1WG1A 3KKAC 4IRDA 4EX6A 3RTVA 4BDZA 3BQTA 3T3FA 3BN4A 3MGJA 1Z4OA 5AM0A 2JVOA 3I55S 2QARB 3D66A 2ESEA 4DLEA 3B4MA 2ZFHA 4ECUA 4M9JA 2LECA 3MX2A 2ZIXB 3R9KA 1JUDA 2FUG9 3NCPA 2EWHA 4LF7F 4WJBA 1BDGA 4CF9A 4JI0K 1ASUA 2M2BA 4RL1A 5LMNJ 2KFNA 3DLKA 3AD9C 1UEUA 1S49A 3PM9A 5IIMA 1W7AA 2DH7A 2XCAA 4CZEA 4L3QA 4JP8A 4TLRA 3W64A 3L95X 3UDLA 4KKOA 3J80O 3FAHA 1NU4A 4U67L 4NX9A 2VKZG 4USJC 2C3MA 5IM0B 3OUYA 3PYGA 1WI8A 1DKGD 1BU6O 2VQFF 2LEAA 2EZYA 4J2EA 1U49A 3R5CA 3VQ8A 5IV4A 1RXWA 1Q95G 1YF5L 2MSTA 2W24A 3PO4A 3VQEA 3ENBA 2PDAA 4DL2A 1BWEA 1RACB 5E3RA 3O3HA 4C6AA 1RCOB 3BSAA 1H73A 4HTUA 3OTOJ 2CQGA 1VQ7N 1OIAA 3H40A 2UXBJ 1MA9B 1RTIA 4KGMA 5AKKA 2BE9B 4FOEA 3Q2TC 3H0MB 3W2WA 4KY3A 3AA4A 3HVRA 1FKPA 4FM1A 1ZA2B 4GO7X 5DG7A 5I3UA 4MK9A 4W90B 3B4DA 4QZBA 1EX4A 5HQ8A 3NG8A 3QU7A 3MXHP 2PBDA 1GOCA 3N6LA 3B6OA 3CJCA 3THYA 3KNGA 2PMHA 3O08A 2DJWA 2B4PA 4ACOA 4FXDA 2F8KA 4DR7J 1RDDA 2ZNZA 1S99A 2BJ9A 1VQOS 1GLJO 1NJIT 5EE9A 8ICQA 1VRQC 1Z4UA 3UMGA 5HJYA 1PILA 1M1GA 2BJEA 4N76A 1RM6C 3KOOA 2O1PA 3D28A 2O8EB 3EKSA 2VOOA 1B43A 4FDFA 2G0IA 3C6UA 4UY8T 2O8CB 2HWTA 4FLXA 4DV2F 3PIOL 3O3LA 7ICKA 3RBDA 4BG8A 4YOTA 4ZPAA 3GIRA 1VFJA 4J9VA 4L3KA 3KJVA 4CJEA 1ITPA 2F8LA 4ECZA 4YG2A 2EK1A 3K5MA 3R2DJ 5D0RA 4KHPJ 1CZBA 1N5XA 2R2RA 4O0JA 1VQ4S 2E8MA 5JICA 4Q0BA 1RTIB 2DH9A 3PXGa 4AL5A 2NLXA 4QIFA 1YJ9N 1A6LA 4F2SA 1W9HA 4CD1A 3BDEA 3F9KA 2XIDA 1TKTA 1DGJA 1VBYA 2G08A 3J8AA 1ZQCA 4IBNA 2FLOA 4O0IA 5D6GA 2P9IA 2HNZA 4C7ZA 3KWGA 4O3MA 1PSDA 5TISU 4GMJB 3I6PA 1Y11A 2BDUA 1HBMA 2KJ5A 4PHAA 4YMOA 1KVCA 2LQBA 2OEJA 4NO7A 2YQ3A 4YOVA 2P9PB 3KK3B 4NMLA 4X66J 3H8MA 4CHYA 3IG8A 2CRLA 3DLEB 3N6MA 1Z00B 4LBHA 3CI5A 3M6WA 4JKHA 3GIKA 9ICJA 3C6UB 2GV9A 2YY6A 1U8SA 4CJPA 1RQ0A 4Z4HA 4PYDA 2J7UA 3QEXA 1NHUA 2H3VA 4PGQA 4X64J 3RMCA 4O23A 4ZIWA 4WFBL 2VFVA 3C5FA 2N7CA 3DXKA 4J9LA 2KIVA 5BRFA 2HQIA 1S6QA 2KH9A 4M9GA 1PAUB 2AJFE 4V1Ak 1ZZNA 4GXIA 3DRSB 1SB3C 3E2EA 4Q0BB 2HSEB 3H5SA 3MZIA 4C4RA 3MAHA 2HEKA 3R9PA 2JRSA 1A7GE 1WDDA 2ZM6K 2Z30B 1DK3A 1XS9D 3B9JA 2RDJA 3OYHA 2QLWA 2J0WA 1RKJA 2Y8WA 2NXUA 4MJKA 4DR6F 2RAQA 4OLOA 2P9IB 1RHUB 3CCTA 3AO1A 4DR2J 1FVQA 1H74A 3LK9A 1RT4A 1HX1A 2ZUAA 1Q3VA 1HBMB 1FD2A 3K59A 2AYBA 1LWCB 2YH0A 2LXUA 4KSEB 4DV6F 2XHBA 3AAQA 2LQJA 3ZZZA 2KOBA 1HW8A 5KFSA 2AH5A 5B09A 2V8GA 4KHRA 2I2YA 2KVQE 3TUIC 3G96A 4TNOA 4H0PA 1XU4A 2F9JA 2AGQA 3K9JA 2OJ3A 5BXIA 4B3TF 1HUXA 4JI2K 1NLKL 4UQGA 2F2AB 2I7PA 3M4XA 3E51A 1WHVA 5BPCA 1DZ5A 4GC6A 5ETQA 1JLFB 1FE0A 4DR1J 4YHHK 1IM6A 4PWUA 5GMDA 1NJXA 1XSLA 3W0LA 3HHLA 1Y88A 3R1XA 2X7IA 3QPIA 1GLEG 3GR1A 1Z2LA 4ILJA 5IQ6A 3GV8B 1Z3EB 3CD6N 4YR0A 4WU3A 3WKBA 2P9CA 2IA6A 4M5NA 4ZVFA 2M88A 2R8GA 3FRYA 4PL2A 1FNXH 5E3PA 1W0HA 1QVGM 1WCNA 3UKUB 1N6QB 3AJDA 2KHQA 4IG0B 3H08A 4OFZA 2VUGA 1RTHA 2QLTA 3LP2B 2LKYA 3MPVA 1U1LA 4H4OA 8ICFA 4A47A 3ZZOA 2HQGA 4NZ0A 2JL9A 3KFWX 3T1YF 3D0HE 4JI5F 1T95A 3DOMA 2ZOFA 3OVBA 1T9XA 2HZCA 2A1SA 3QAEA 4U7UD 4DUZF 2XS5A 2W7OA 4X4QA 6FDRA 2HBJA 1F5BA 1RWWB 3AAPA 1BY9A 3TAFA 4YNQA 2FC8A 3FZHA 3SI8A 3H2VE 4JI6F 1GLFO 2KJ8A 2GCFA 2VG7A 1GXTA 4I2QA 1WB9A 4JK8A 2PN6A 4BRCA 2AYGA 1S1XA 4BRNA 4JV0A 1AZSB 2M8HA 3PACA 2G8WA 3ENHA 3UKRA 4GLXA 4DTOA 3HHLB 3PSIA 4KLLA 4PCQA 9ICBA 3RR8A 4X4OA 5DQIA 1HNVB 2CNNB 1VQPN 4FK0A 4C8LA 1I94J 4O3OA 3UDCA 2VDIA 2RQ4A 5HLFA 3C16B 3SUPA 2MAXA 2X6NA 4DR5K 5KFFA 5FROA 2I5JA 1R8HA 3IAM9 4OJ5A 2NLWA 4ERDA 3IFRA 4KTWA 4LRFA 3W5YA 2A5XA 4LC9B 4X65K 4B1WB 2Z2YB 3FZLA 1LB2B 1HHQA 1NSAA 3IG5A 2PI5A 2CPHA 3MN6A 3J81j 3VHQA 3MEGB 2WF9A 3ZTSA 3OYBA 1VIOA 2BA9A 2HIYA 1B70B 1DAXA 5D15A 3P49B 2OLWA 3D6TB 5CHGA 3RF9A 1H2TZ 5HMMA 4FWLA 1LVHA 5JUMA 4JI1F 1FIQA 2PA3A 4IOBA 5LMNF 1N34K 2C2ZB 1YITS 2EAOA 3NAHA 4A8QA 2GHVC 4KPCA 1NMDA 3DRRA 4ISEA 4I7FA 4UAVA 3VEYA 1QQMA 3C8YA 4XAKA 4ZVSB 1RILA 4RTFD 8ATCB 4FM2A 1S8OA 2OO4A 4YY3K 1G99A 3HJEA 1RTZA 5M1NA 7ICPA 3M1VB 4FYVB 3W1YC 3CIPA 3AJ2A 1T3NA 1VSFA 2QK9A 2E1RA 3A3PB 3IGVA 4OHVA 1KD1T 5KT4A 4OX9F 3ULEA 1SQGA 4F9OA 2W4PA 3TZWA 2GS8A 4F3TA 4LZGA 2OMOA 4ILMA 1BNPA 1HNXJ 3S41A 4P2MA 1TK5A 1VBZA 5JVGL 4IDKB 3TVZA 2B0GA 2YHYA 2G4BA 3A3NB 1ACMB 4M95A 4Y2KA 1RGVA 2HFNA 4RCHA 1NDPA 4X4TA 3QJPA 1HYVA 2FD2A 3QMLA 2HRYA 4RZRA 2BQRA 1SZ2A 1L7PA 5EU7A 1RABB 1AT1B 4O3SA 4UATA 4LF5J 2UV8G 3RJEA 2EG1A 2O8BB 4HAIA 1M5OC 5B0AA 4NA2A 5AKIA 2MY7A 4DR7F 1GLLO 3MM6A 2YQ1A 2R7VA 5ETMA 1NJYA 4OQJA 3LP1B 2DNHA 4DR3K 2ACMA 3LALA 1YI2S 4KLOA 4I7FB 2VH7A 4FO0A 2HKEA 4FPAA 4O4RA 4U8VA 3PKMA 3TADA 2HAFA 1VQ8S 3VCBA 1N36J 4ID5A 4RUBA 1WC1A 4IR9A 3NGSA 2D5RA 2LU2A 5KFJA 4FYWB 4C48A 4IS7A 5E0OA 3H8SA 2J0QD 4YQWA 1REGX 2FBYA 2EAPA 5IIKA 1KQGB 4MH8A 4OI6A 4JUZA 2AZ1A 4M9LA 5D3GA 2P2CB 3SENA 5LJ5Y 3CJ5A 4FJ5A 3T6JA 3NGUA 4MKBA 4YB7A 5AFUH 4X62J 2W9AA 3BZQA 5IXUA 4KHPF 3O4QA 4QCLA 4EFHA 3QBWA 1RWXB 4QJVA 2E1AA 4RW8B 3Q7CA 2ZC4A 3QGHA 3CSKA 7ICSA 1X4AA 5ETTA 2MHNA 1TZ0A 2WFAA 2IOHA 3QYPA 4PHPA 3H0PA 3O4WA 2G5IB 4DUYJ 1X4DA 4CJWA 2I0XA 3VF0B 1VSMA 2GWKA 1C0GA 2IM2A 4OZNA 5C42B 2ZF5O 1SWWA 4EAHD 1BNOA 1J5EJ 4RJVA 2DNZA 2XRIA 2OA8A 3ZSWA 2DIVA 3ID6A 3QUQA 1F2GA 4C7YA 3Q8UA 1ZQNA 3SFGA 4P0QA 8ICMA 2DNPA 5IINA 4X66F 2EKNA 3G6YA 3L9ZA 4ID5B 4PXEA 2L3MA 4MKVA 1IR0A 4OHWA 2BKPA 1X66A 4MIWA 1Q8LA 5AM3A 1S0NA 3M8SA 3HZ6A 4MYTA 4PKGA 4H4KC 1WC5A 1C7YA 4X64F 5F9LA 3ILOA 5HBMA 2DISA 3W9HA 3M8WA 2IC3B 2W2QP 2LQ5A 4J2AA 3PVXA 3GJQB 2IA0A 4QU7A 4MKYA 2WHEA 2KQ2A 3KG1A 3BS7A 4M47A 1SB6A 4NV0A 4NWIA 1N52B 3LF0A 2GIRA 2F65A 1S5JA 2KKVA 4A8SA 3ITHB 4AD6A 3CCUN 1C0TA 5AM1A 4AL7A 2EC0A 4DR2F 1R8CA 4B9QA 1C1BA 2MLXA 4KC5A 3I0SB 4J9MA 1VQKN 3UQ0A 1NGCA 4B9MA 1Y97A 4OKKA 2YMQA 2GNKA 2DR8A 1P27B 1SQEA 2DPJA 2GVZB 2V2VA 3RJMB 4MT1A 3H45C 4KI4A 3OYEA 5EWEA 3EE3A 2MLZA 3SMVA 2A3JA 4USKA 4NXNJ 1GX6A 2E8NA 1U09A 3MEEA 3MPUB 2FJVA 1OYEA 3OYNA 2H3EB 3V4MA 4LREA 4M63C 3AOCA 2ASJA 4X5VA 4CVNE 2QA4S 4BE1A 3AUOA 1VQSA 3JPOA 2BCRA 3FK4A 1MMDA 5HBMB 2Q6CA 3O4NA 3AHPA 2ZDPA 4KT0C 1JNRB 4UW2A 4Z94A 4YDDB 3CD5A 4DR1F 4M5KA 2CJKA 3TACB 3KLVA 1JN3A 2KIWA 2DRDA 3G82A 3SAFA 3QQCD 4IEIA 1HBOA 3L3UA 3BM7A 2XMJA 2XICA 4TQSA 2ZKUA 2RUGA 4DL7A 3MCPA 2U1AA 1IWAA 2CGJA 3EN9A 1J97A 3THTA 1N5YA 2H48B 4NLYA 2YWGA 2K1RA 2P9LA 4N41A 5J2DA 3V7KA 2GUPA 1LKYA 3AH6A 3EL2A 1KN6A 4A8MP 2QMUB 5AQJA 1TK0A 8ICZA 1NZPA 4LSNB 2ROPA 2GFFA 2PE8A 3TSQA 1N8RT 1FCAA 4MAKA 3GB0A 4N47A 1VRTB 2W6LA 1NI3A 4HHTA 3EDRB 2AIRB 3CJAA 1U04A 2PMZD 3DM2B 3MEEB 5KG7A 3O9RA 1YVNA 1NSKL 1O0PA 4G65A 1HKGA 2ZHBA 4F3OA 1DT9A 4OYOA 2NUUG 4DFPA 4DKWA 1SQKA 1ZJMA 1JLAB 3DDKA 1NK6A 2P51A 2AYMA 4EU0A 1YBUA 5D78A 1IBMF 4NL9A 4KTZA 9ICVA 1H0HB 3CJ7A 8ICPA 5CWRA 1VHFA 4LRDA 1VSEA 4A8KA 1LCUA 1NGEA 2Z0GA 2XC9A 1NPPA 1S57A 3VVUA 4CEQA 2EC2A 1I94F 4OI1A 5HN0A 1ILYA 5ALQA 1PK1B 2BW2A 2RRAA 1N5YB 5AQVA 3LA0A 1WG8A 1FX2A 1H7WA 4HCCA 1HA1A 1B64A 2NRWA 2P9LB 2P5OA 2N3LA 4FVMA 2ZH1A 1SJ4P 4YVZA 1OS5A 8RUCA 1BPXA 2HHPA 3PZPA 3CFOA 1V9OA 4NE9C 4CGFA 2CJQA 1ZQBA 2JVRA 1LKYB 3I31A 5KL1B 1PUZA 3EXCX 3F53A 4X4SA 2YHXA 3C6HA 4EUVA 2YKNA 4ECVA 3B82A 1QSSA 2FMPA 1SGGA 1T94A 3PMLA 4PKDB 4H03B 4EO8A 4IO9L 3G9CA 2LM4A 2MLYA 4JHDA 1W2BM 1ZETA 1IJJA 3KLHA 3V9WA 4TXSA 2R7YA 4N77A 3RMAA 8ICBA 3R5AA 3GMGA 4Q45A 3IM1A 4AM7A 2MHEA 3IRWP 1JLBA 3RJFA 3CPWM 3FM9A 1SC6A 2BQ3A 1YSJA 3HLUA 4H0XB 3KOAA 3JAMO 2D69A 4ILRA 2W9MA 2QL9B 3RJHA 3C7NA 1QTMA 2I7NA 3ASMA 3IMXA 4B3SF 2FHOB 3OGUA 3K75D 2RDIA 5BPMA 1Q81O 2E8OA 3GDQA 4A2BA 1VQ6S 3D0IE 1W25A 5KT6A 2GWSA 2VDHA 4LF8J 3KDNA 1V85A 3CWJA 4CHOA 2V50A 1HNWK 1TAQA 4B3RJ 4OYMA 1LOUA 4IRKA 1HNXF 4QZEA 5GAHI 5JMVA 5F8NA 1BL3A 3M2RA 2V5HG 4HDHA 4KV8A 5EGYA 1ZQYA 3L4PA 2YHWA 4DHVA 5HMLA 3F2BA 2YKNB 4J9RA 3O6WA 4P52A 3K7RA 3IG1B 5C7PA 2ZIWB 1JQGA 4MQ3A 4MFCA 4CF2A 2Y0SC 3N4PA 2JGUA 3QSYB 1EXNA 4DPOA 2PMZF 2HBLA 1XMOJ 2BOPA 3WNFA 1YJWS 2PFDA 1U8WA 3G4SS 3H20A 3GU3A 4A57A 3PR4A 2BUPA 2IMWP 2LEPA 3JPQA 4PL1A 3BP8A 1FTRA 4ZPTR 2VHGA 3LGHA 4OLAA 4PRFA 5ALWA 2PFOA 1FERA 3THWA 5E3QA 9ICHA 4NI2B 5ELZA 3R8EA 3PW7A 4ZOHC 5J2PB 4DV3K 2CIMA 2ZD1A 5LXRA 3MPWA 1QVFM 2YMPA 1OJ4A 3AU6A 2HG4A 3N97B 4EZ6A 2DGOA 4RW7B 4UASA 2QSWA 2IYIA 4L6V3 3ZSXA 4WZQA 4TY9A 7AT1B 4JI7K 5CD4H 2V2ZA 2P9NA 4MN4C 2ZH9A 1RI7A 3BYRA 1BVSA 4OJPA 2KYXA 2KDOA 2B4OA 1TL1A 2F4VF 2HWIA 2OEHA 3GE1A 1NRKA 3SQ2A 4Y2JA 3KNAA 4GC7A 2ZUBA 1SJ3P 2W8KA 3G6EN 4B8CA 4X62F 3EVOA 1E4FT 2CPJA 3PYEA 2WBMA 1Z2ZA 2GHPA 2BCSA 5ALKA 4FW1A 5BOMA 2LSNA 3EGZA 3M8YA 3P5BP 1NKBA 5KTQA 2GMLA 2PFUA 2L48A 1HYZA 3SQ1A 5LJ3Y 2Q0UA 2M7SA 2G13A 5ADZA 3HO1A 2OTJN 3OXLA 2VC0A 3PG9A 3QJJA 5J1EA 4FYXB 4Q43A 1S1UA 2QA2A 3D2NA 3RAXA 3MD1A 4NLSA 2DR6A 2EX3A 4OYWA 2AGPA 2BJDA 4M7YA 3NUQA 4CT9A 3C95A 1WSRA 3THWB 1T05B 3CC7S 5FJ4A 3CQXA 3MM8A 3CB4A 3HX9A 2M9KA 3CNHA 2O4GA 1J2MA 8ICVA 5ETSA 4KFBA 3VGSA 2JHDA 1RDAA 3U1NA 3RAMA 4TU9A 4X4RA 3HP9A 2P9NB 3ZT1A 2K7JA 4MO4A 1SH2A 4Z6FA 1KLMB 4CM0A 1XR5A 3OS2A 1N33K 4RT3A 3CCJN 2W9CB 1TL1B 2OXOA 4PUOA 3SSRA 3AVCA 4CJQA 4FJIA 4FJKA 3HPOA 2ZWPA 3V6HA 3QT7A 3ZTOA 3QE9Y 4KAIA 1IWGA 3MEDA 4OGEA 1GOAA 3GSIA 1MQ2A 1RLDA 3FSIA 4KI6A 2CYYA 4IOCQ 5HR6A 2EZXA 1RDRA 4HI1A 1Y9OA 1JJ4A 3QO9A 4F50A 2LKZA 4QPXA 3G86A 4RW4B 3OYIA 2HURA 1F3VA 2Q3SA 1S48A 2F8HA 4ALZA 3S3OA 4MIBA 1E3MA 2F3JA 4CHQA 3TWHA 3T79A 5KFPA 4PHTX 2WHOA 2QV6A 4FJHA 3ISCA 3WK5A 4D3HA 1L3UA 4YB6A 4KQZA 2LP4A 5DZ6A 1S1UB 4ICLA 2A18A 1T4GA 2BZFA 2FBTA 3W2VB 1LW0A 3BGUA 5A76A 3P83D 3P96A 1ZAVA 4CE9A 4RQ7A 3BO2A 4DPXA 2VL1A 4OCZA 4EZ9A 2RU9A 3K0SA 4MIAA 1KAXA 3I5AA 3RBZA 5AKEA 2E20A 5BR8F 3DOKB 2DXDA 3BO3A 1RDWX 3MK6A 1RA6A 2MQMA 3M05A 2E2OA 3FE1A 5D4LA 2QA4G 3A5LC 4DFMA 2JLFA 4UQTA 4OVLA 1XMQJ 1ZD5A 2GJ2A 3BPDA 3DYAA 1U0SA 4QQBA 1S6PB 4I68A 1WC6A 1NCLA 2RHFA 4ZTFA 1LXJA 1KQSM 3K17A 1Q9XA 1B4FA 1BO5O 2ALYB 4MFAA 2JXJA 3I0RB 3EGVA 3UE5A 1SC4B 1KAZA 4ANEA 2R2UA 2IJRA 4ICLB 4BDYA 2NZTA 1U2VA 2FI1A 2BPGA 1VRUB 4X4VA 2HSTA 3VF6A 1UP1A 4NLCA 3M32A 2QKQA 5DRKA 2MQNA 2CA9A 2QA1A 1MROA 2G0AA 2V4RA 3BDPA 3MOZA 3IDHA 3ZCMA 5C24B 2RHSB 4GFJA 2Z2ZA 5AE2A 3P39A 2IMOA 4N7TA 3K0JA 3LVWA 2UXCF 5IT0A 3AVBA 1GO3F 5C25A 2W3SA 4E3SA 3FBEA 3RB4A 3ZZTA 3GL1A 4KB0A 3OTOK 4KITB 2YTCA 1D8YA 2PKEA 1YXQA 2NRZA 2UXBK 4EX7A 2A41A 3H5UA 3DFEA 4W5OA 4AHUA 3MXJA 3K89A 1K44A 1P7DA 5ALZA 3LANA 7ICRA 4E1NA 4JKCA 1IKVB 3KG0A 4F3QA 4U7UK 4CO1A 3MDAA 2HGNA 2AYEA 2YKOA 1M1HA 4N8OA 2V69A 3SCLE 2G8VA 2E29A 4KREA 1U1KA 1CJUB 2ZIUB 2CRXA 1D4XA 3QFUA 2RQCA 2W7PA 2WOMB 2FJWA