2HVHA

Ddctp:o6meg pair in the polymerase active site (0 position)
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 191
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hvhA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hvhA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hvhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hvhA01
2W9MA 3JPQA 4DWIA 3GFKB 2HW3A 1EETA 1ZQLA 3ULDA 5FRNA 4O3OA 4JWNA 4KLSA 1ZQWA 3ZSZA 5CHGA 8ICGA 3DLBA 1KRPA 2W9CB 2KFZA 9ICKA 4QWCA 4CJEA 1BHLA 4TSXA 5KFCA 5KT4A 2Z1GA 4CJQA 1ZQKA 3QEIA 3Q8PB 4CGIA 4FJXA 3MGIA 2KZZA 4OLAA 4I7FA 4B8AB 2E4LA 4DLEA 2DTUA 4QZGA 2JEFA 4B8CA 1L3UA 4CHYA 1VSMA 5HHHA 5KT7A 3EWAA 3AUOA 5JS2A 3OSPA 5BOMA 3PMLA 1Z3EB 3WNHA 2AQ0A 3OYAA 1RDCA 4E7JA 1KFSA 5KFBA 1RBVA 2W9BA 2UVUA 4CJLA 4F5QA 1HQUA 5KFGA 1VSKA 3QEPA 4ED6A 4RT2A 4CFBA 5DBCA 1BCMA 1REVA 4JV2A 2F96A 4OPKA 4DTOA 5HNKA 3JPTA 1RNHA 4W5OA 1NK7A 4ED1A 4CF1A 3ZDEA 3ETLA 1SKWA 3IS9A 2YNFA 3AA3A 3MXJA 4CEFA 3L3VA 3K5MA 4E89A 9ICEA 5E41A 4N76A 1RBSA 3QO9A 4F5OA 1HUOA 5L9XA 1C1AA 4PY5A 3H4DA 3OYDA 4CJ3A 5DG7A 5CY4A 4DQSA 2OZSA 1VSIA 5J2CA 3KHRA 4J2AA 4DTSA 3L2VA 4Q0BA 4QZ8A 1XO1A 7ICOA 3IAYA 2W8KA 3K5OA 8ICVA 4KHWA 3OJUA 1EKEA 4DSEA 4E1MA 4CHZA 1KCFA 1ASVA 2PI4A 2ZTEA 4FW2A 5C24A 5J2HA 5DB6A 5KFJA 3GV7B 4M6WA 2A1SA 9ICNA 3OYLA 4DOAA 4Z4CA 1JLCA 3KIOA 4I27A 2XY6A 3RRHA 4NCAA 5KFDA 1XHXA 2JLEA 1D9DA 4DTMA 5CJ7A 3D0PA 3RJGA 4MQ3A 1WSFA 1F21A 1ZQSA 4Z4HA 3AVJA 2HHXA 2ATLA 3CFPA 4RQ0A 5EU7A 4ZTFA 4ECYA 3PR5B 4R63A 2A1JB 4F4ZA 2BCRA 3V6DA 4ED0A 1UA1A 4HCBA 3UXPA 4KHYA 1BPBA 3Q8KA 1VK0A 1NOMA 1ITGA 2DFLA 4FJGA 1X9WA 1Q9XA 1X1PA 3H7IA 3DM2A 5IILA 4CEOA 2XHBA 4KKOA 4KRFA 1B43A 4OPJA 4FJLA 3QLHA 1ZQDA 2HHTA 4CHOA 1T05A 1BISA 2NRVA 4I2AA 2VANA 3PW0A 5DB7A 7ICNA 4KI4A 2MAXA 2ZQBA 1BPXA 2Z1HA 7ICVA 1Z25A 3GQCA 3BQ1A 4FK0A 3RAQA 4K4IA 4I9LA 1Q8IA 3H4BA 1K6YA 3B0XA 2BGGA 5JUMA 1MC8A 4E0DA 4Z6CA 4P4PA 3HL8A 3C2MA 3E01A 4YCXA 2JEGA 3HW8A 2HHSA 8ICUA 3ISBA 2RN2A 3TANA 4KMUA 3WNEA 5KFUA 1HQEA 1WSHA 3KLFA 5L1KA 3PVXA 4J9SA 3VQQA 2YKMA 4JV1A 3OVNA 4KLTA 9ICTA 2Q3SA 1LW2A 2FC0A 4KHQA 4TUQA 1WCNA 4FJ5A 5KFEA 5F9NA 3RMDA 2J6UA 4CGHA 3NF9A 4RW8A 2JEJA 1QSSA 4DL3A 3C2KA 4M3TA 3C1YA 4MF8A 4IRKA 4CFAA 4KLDA 4E7IA 3ITHA 1IKWA 9ICMA 4F2SA 4DS5A 2HHUA 4JS4A 5CYQA 3GV8B 3BJYA 7ICEA 3WNFA 4FVMA 8ICEA 2QKBA 4YFUA 4NM1A 1U49A 4EBDA 4Q44A 4KTZA 2PYLA 4KITB 3VQ4A 2RDJA 9ICQA 1TK5A 4CJKA 3V4IA 3SPYA 1WCLA 2BQUA 2HVHA 2VA8A 4BE1A 5J2GA 3RJFA 5DQIA 1HJRA 4FM2A 3SQ1A 1H38A 4KI6A 4PHPA 2W9AA 4C8MA 4DTJA 4KLFA 5DK5A 3UPQA 4CHNA 4F3TA 1D9FA 5KT6A 3NF6A 4GLXA 4KLLA 1BI4A 3V9WA 5HMMA 3SUPA 4DS4A 4BACA 1WAFA 4DU1A 2HNDA 3V9UA 4CEAA 4DQPA 3EW9A 3K57A 4OJRA 1BQNA 4E7LA 5IIKA 4NXZA 4O0IA 5CA7A 4ECWA 2IDOA 4EEYA 4RUCA 2VG5A 4ZTJA 4ED8A 2NRWA 3VQ5A 3C94A 2YKNA 2FMPA 1BPDA 4CJPA 3T3FA 4UAYA 3T5HA 4PH5A 1D8YA 4K4GA 2BCVA 1L3VA 4Q8FA 1JXBA 1TK8A 3ZDBA 5KFOA 3RR7A 1TV6A 3TFRA 1T8EA 2M9NA 1HYZA 3OS2A 4O3QA 4RQ1A 1ZQYA 1ZQUA 1ZBIA 4DSFA 1K1QA 4CGFA 1RDDA 4NLNA 1R0AA 3KD1E 3OYCA 4YXMA 1JLBA 3DLRA 4I2DA 5DDYA 9ICBA 5HHIA 2IOCA 3TAFA 5IIJA 4JWMA 3SCXA 2HHWA 1G15A 1KFTA 4ICLA 4Y1DA 1WSJA 4Y1CA 1J5OA 1N56A 4KFBA 3G0ZA 4KV8A 3AVBA 1S6PA 3VN5A 3PW2A 4PA1A 4I9QA 4O5CA 4ECXA 1HYVA 3CQ8A 5DDMA 3KK2A 3C2LA 4IQVA 1YTUA 4NLGA 4QOZB 4BE2A 4CJFA 2WONA 4DSJA 1ZQRA 4DSKA 3Q8LA 4M45A 1TL1A 4DU4A 4UB2A 4TQRA 2BCSA 5J29A 1WSGA 1WN7A 2RDIA 3HK2A 4IRDA 5L1IA 2FBTA 4W5QA 4BXOA 5CYMA 3AU2A 2BGWA 1D8LA 9ICLA 3HWTA 1KLNA 2DY4A 1SL1A 2F8SA 4E19A 1NKEA 3V6KA 2O4GA 3M8RA 1EXNA 2C2DA 5CZ1A 3GILA 4BDPA 4YNQA 4QZEA 4PGYA 4M47A 1YTAA 3OYBA 3BQ0A 3AO4A 4RG8A 1SL0A 8ICIA 4IFVA 1ZJMA 1BIUA 4BWJA 4LH5A 2NRZA 1Y88A 3NCIA 4M3WA 8ICLA 1ZQMA 1DTQA 1TV9A 1U48A 7ICHA 3ZSYA 4HUGA 2VA3A 3AO1A 1VSEA 3QIPA 5I3UA 4FJIA 5HMLA 2R8JA 4RW6A 4DTUA 2JZBA 4FM1A 3UIQA 4O9MA 1BVSA 2NRTA 3T1AA 3MBYA 3NH0A 2ZJAA 2ISOA 1MQ2A 3G6YA 4M3XA 3N4MB 4B9UA 4DF4A 3OS0A 3QNOA 5KFTA 5KG5A 1BPEA 2OWOA 4XA5A 1S0OA 3H8WA 1U45A 1J54A 3NFAA 4J9PA 3H08A 1HMVA 2E6MA 2FLNA 5J2PA 3M8QA 4TURA 8ICCA 1A5WA 3K2PA 4R8UA 3HVRA 2ALZA 2XY7A 3H40A 3IHQB 2G8HA 3RH6A 9ICCA 4BGDA 3HXMA 3CM5A 5EWFA 3EPIA 1WAJA 5KI6A 4RQ5A 9ICJA 1IKVA 2G8VA 3AO3A 3QEAZ 3FFIA 1LB2B 1SUQA 3TWHA 3M8PA 4I2IA 1S9GA 3C95A 5HLFA 4RZRA 4FJHA 8ICAA 3RAXA 4KREA 1BPZA 3IG1A 4X5VA 3RMAA 4DQIA 4CF9A 2ZJ5A 2RKIA 1JLQA 3RJJA 4PHAA 3HPHA 5C42A 1C1CA 5KG6A 3RWUA 3N97B 1JLFA 4W5TA 3K5LA 4R66A 2PZSA 4YN4A 1S9FA 4ID1A 4YD1A 4UAWA 3MEDA 3RJHA 4J2EA 3V7JA 3B0YA 2W9BB 3LWMA 3VQ9A 4CGDA 3LWLA 5HP1A 1B9FA 4CIGA 3C6TA 4KHNA 3NF7A 2HVIA 4CJVA 3VQBA 4GVMA 2R8HA 3AVIA 3V7LA 4Z4EA 4MF2A 4YR3A 3NHGA 5KRTA 1HNIA 4GXJA 2BCQA 3G10A 7ICIA 1DTTA 3KLHA 4NLZA 4FBTA 3MECA 3L2RA 2DFFA 4CECA 3SUOA 4E1NA 3C5FA 1CXUA 1XI1A 4N47A 5HBMA 3KK1A 1S1XA 3TAGA 4FCYA 3T5LA 4KHUA 3PV8A 1NK5A 4B9LA 4C8KA 5KFVA 2NUBA 3RBDA 4YP3A 1RXVA 3LK9A 3PO5A 5HRRA 3V1RA 5KT2A 3SPZA 3B6PA 3C1ZA 1IKYA 1S1TA 3NBPA 4ECQA 3QZ8A 3TAPA 2PYJA 2R7YA 4J2BA 1N48A 1WLJA 3F73A 3I8DA 4CJ5A 4P4MA 3ZDDA 7ICGA 9ICIA 4IFYA 5L1LA 2R8IA 3MXIA 2XY8A 2P5GA 4M41A 4EP4A 1KVBA 5DLFA 2Y1IA 3KTQA 1QTMA 3QEVA 2OPPA 1ZQVA 1S77D 5J0PA 3KKSA 3V1OA 1JKHA 9ICRA 1RT7A 2BQ3A 3HP9A 4J9RA 2BCUA 3U3GA 7ICSA 1NOZA 1W9HA 3ZT4A 9ICPA 3PW7A 1ZQBA 3K5NA 3LALA 4MFFA 5FDLA 4QCLA 5DLGA 1ZQZA 4O55A 3GV5B 2DPIA 2PI5A 4PGQA 4DEZA 5KTQA 2O4IA 4FW1A 1UOCA 4OVLA 4QWAA 1WSIA 1IG9A 5HRPA 4F4XA 3M9NB 5TZVA 4DOBA 1RTDA 4F5NA 4J9QA 4F92B 3OYFA 3RB0A 4OGEA 1KVAA 1KLMA 3A2FA 2IS3A 1CEZA 3ZSRA 4F4KA 5CR0A 4IR1A 4HYKA 5D3GA 3NGZA 4KB0A 3BGRA 5J0QA 2A1RA 3MDCA 3C5GA 4DL2A 1B9DA 4DQRA 1S97A 4MEXA 4M2YA 1C0MA 1RDBA 4CHQA 3PX6A 2HHVA 3TAEA 4EYHB 3AO5A 1AROP 4O3SA 2B21A 1RTJA 4Q5VA 2F1JA 5KG1A 5EWGA 3QEBZ 4PQUA 7ICTA 4N5SA 2BKEA 1TAUA 1JXEA 4KPYA 3THVA 1C1BA 4W5RA 3AVNA 2B4JA 4FBUA 5FRMA 4KLHA 3SQ0A 5KFIA 4CJRA 9ICXA 3AA4A 5IIOA 3NH2A 1VSDA 1HNVA 4M3ZA 3C23A 4DL5A 1ZQPA 1SL2A 3AVFA 3HT3A 4N56A 1O1WA 3NE6A 3T5KA 1ZQCA 3CYMA 3SQ2A 5BOLA 3K59A 4KLOA 1SKSA 4KAZA 2PY5A 4JS5A 4F93B 2BPFA 4RUAA 4ED3A 1LWCA 5J0RA 2C28A 4F5RA 2XGQA 1KSPA 3Q8SB 2DFEA 1WNSA 1JMSA 2BQRA 2W8LA 4FJ8A 1NJYA 1KTQA 5FROA 4CJUA 3RRGA 1ZJNA 5J2DA 4GXIA 4ZH4A 5IIMA 4AILC 4RNMA 1EX4A 3AVLA 1ZBHA 4H4OA 3EPGA 5KFLA 2FPKA 4IQTA 2HB5A 2XRIA 4RT3A 2KW4A 2OPQA 3ZD9A 7ICQA 5J2MA 2E6LA 3SUQA 4PHEA 3JPNA 5HROA 1TL3A 4FJJA 4W5NA 1RBTA 3C6UA 4KLGA 3TQ1A 4DL6A 3OYJA 4FLWA 1VSHA 3MR5A 3V9ZA 1RPLA 4I2JA 5CWRA 7ICUA 4J2DA 1CUKA 4ZHRA 2C22A 1JX4A 2NRXA 8ICWA 1BI4B 2G8IA 8ICFA 5BPCA 3NGYA 4RNNA 1RILA 3RMCA 4H4MA 5KRSA 1FKPA 3LAKA 4KN7A 3CFOA 4CJWA 5DG9A 4F3OA 1HPZA 3DI6A 3ZSVA 5CB1A 1SV5A 2BDPA 3ZCMA 1ZYQA 4P4OA 5D46A 3MXMA 1IM4A 3E2EA 4I29A 5KFYA 3G6VA 1U04A 3DMJA 1GOBA 2VWKA 1JL2A 2I5JA 4HTUA 4LSLA 1WSEA 3CM6A 1DLOA 5HRNA 4F91B 5J0YA 8ICJA 3VQCA 4RQ3A 2MUTA 4FZZA 4IKFA 4ED7A 4ELUA 4DMNA 2Y1JA 1S1VA 4RPZA 2FLLA 1W0HA 4DQQA 1HJPA 4OKKA 3ZT0A 4RW4A 3RBEA 4DLGA 4M04A 4QZ9A 4PPXA 1LW0A 4CEQA 3MR6A 4F4YA 4RPXA 4KHSA 3KHHA 4HUFA 3SI6A 2F1HA 2ZTCA 5J0OA 4IQUA 2BR0A 2ZUCA 1EP4A 5DQHA 1RT6A 8ICHA 4NYNA 7ICKA 4E7KA 1B22A 1T3NA 1UT5A 4FO6A 3PY8A 3V81A 4UAZA 3T19A 2BPGA 4N41A 3Q8MA 2XGPA 2AGPA 1S6QA 4FLXA 4RPYA 3UQ2A 3RB3A 1XS9D 8ICQA 2ISPA 3DLKA 4J9MA 2PFPA 4EZ6A 3RR8A 2ASJA 3VQ7A 3QERA 2BANA 2R8GA 2EX3A 5J1EA 3TAQA 2GV9A 3V9XA 2FBXA 4I2BA 4Z4IA 2BHNA 2I9GA 2WTFA 4Q45A 4O5EA 2V4RA 4BXOB 1UWBA 4ELVA 3C21A 4WE1A 4FLZA 1HRHA 2DFHA 2QKKA 3B6OA 1NK4A 3OYMA 3RB6A 1C7YA 5KGWA 5KFAA 1LAVA 5DBBA 4O3RA 1RBRA 1N5YA 3OS1A 5KFHA 4DF8A 1S76D 1RTHA 9ICHA 3OHAA 3ZT2A 1A5VA 2FPLA 5CP2A 3KLGA 4FJ9A 5L1JA 1I3AA 4NY8A 3NDKA 5KFPA 3SUNA 3F9KA 3SQ4A 3Q8RB 4J9NA 4YR0A 4IG3A 1GOCA 3RB4A 1ZQIA 8ICSA 4IRCA 1TFRA 4IBNA 2AGQA 4Q43A 3LZJA 4ECUA 4M9NA 3IM1A 4DL4A 4UBCA 5CZ2A 4FJKA 4RNOA 4EYIB 8ICRA 4NCBA 3MR3A 2JZBB 1QSLA 4I2EA 4KTWA 4CFDA 3QESA 2P6RA 3QZ7A 3DLEA 3IRXA 3K4GA 1NK0A 1QHTA 2XCAA 3RJKA 2LYHA 4LZDA 3Q8QB 2IHMA 3EY1A 2QK9A 7ICJA 2H5XA 5C25A 5I42A 3P83D 2KZ3A 8ICXA 3D45A 1NJXA 4DSLA 3OSNA 1XSLA 9ICUA 4R8UB 9ICSA 4MFBA 1DOQA 3K58A 4OGCA 1Z00A 5D49A 3NGIA 1B92A 4DSIA 4F5PA 4KLEA 2XY5A 4I2PA 3ISDA 1ZETA 4FM0A 3M9OB 3GIKA 4JRPA 4CEZA 4M3YA 1X9MA 4GMJB 4FK4A 8ICMA 1SKRA 4OKEA 4JLHA 3T5JA 1ZQHA 5KT3A 4RQ8A 1K1SA 5J2NA 1NKBA 2AQ4A 3JSMA 4B9NA 1TGOA 4FXDA 3KKRA 4J9OA 4RQ4A 2KZMA 1BQMA 4PWDA 4M3RA 4L8RB 1A77A 2VWJA 2GWSA 3VQDA 4DFKA 1EXQA 4CK1A 3AV9A 3H8SA 2OA8A 1L3TA 1Q9YA 2BE2A 4ELTA 4FS2A 1VSLA 1BL3A 4I2QA 3KD5E 3PW5A 2OPSA 1V9PA 2IC3A 3U6FA 3V7KA 3PX0A 1GOAA 4ECVA 4FLYA 5EOZA 1ASWA 4M9JA 5KFZA 3HM9A 1YVUA 3AVMA 3OYGA 4TQSA 4P2HA 2YV0X 3DRRA 3RTVA 4AHCA 2G8WA 4M9GA 1KEJA 5J0SA 1JLEA 4ED2A 5EWEA 3V9SA 1UA0A 3I0RA 2VA2A 1J9AA 4K8XA 2HHQA 4Z4FA 4AH9A 5DGBA 3HPOA 3SV3A 3LPTA 4QAGA 3SNNA 4TUPA 4I2FA 2GBZA 4I2CA 5KFQA 4TUSA 4UB1A 3LP1A 2ZD1A 1LV5A 2XC9A 3VA0A 3RJIA 1TVAA 1YT3A 3LDSA 4M0AA 5KFWA 4BDYA 4O3NA 4GW6A 5KFXA 3QETA 2B5JA 4HUEA 4QZCA 4E7HA 1MU2A 4CJTA 4CEBA 5J2IA 4AHRA 2FLPA 2G8KA 4CGGA 3ZDCA 5KG4A 3NGDA 3NF8A 4M9LA 3VA3A 3AA5X 4R65A 2P66A 3RMBA 3HP6A 3GIJA 4KLIA 1ZBUA 3TI0A 3DOLA 3VQAA 4EZ9A 4XQ8A 9ICGA 5DQGA 2P1JA 4LH4A 2F1IA 3UXOA 5IIIA 3JYTA 3SZ2A 3SJJA 4LD0A 4KLUA 3VQPA 4IQWA 4QZHA 3ZSXA 5DMRA 3V72A 4PUOA 2ZJ8A 3V6JA 2UVVA 1RT2A 3HJFA 3MEGA 3PUFA 3AO2A 5HRSA 2V9WA 4YG2A 1RBUA 4AHSA 4E3SA 3ISNC 3L2WA 2P6UA 4Z4GA 3CFRA 4M6WB 3OYIA 7ICRA 1HYSA 2W9CA 5IINA 1RT3A 3KLEA 2OYQA 2HMIA 3GIIA 4KTQA 4J9LA 4KLQA 4LY7A 1RT1A 2B6AA 1C0UA 4QWBA 3ZD8A 2ITGA 3DRPA 3MGHA 1RXWA 3P5JA 2F8TA 2Q0ZX 3RH5A 1MQ3A 4I2HA 1LAWA 2D0CA 4ECRA 2J6TA 1S9EA 1MSWD 4CEEA 3EZ5A 3RH4A 3PX4A 4DTXA 1X2IA 1RCHA 3QIOA 4OKJA 3LDAA 2Z1IA 3DOKA 4G1QA 5DGAA 4CCHA 2X78A 1VRTA 2RF2A 8ICZA 3L8BA 2PXIA 2IGIA 4O5KA 4KN4A 8ICYA 1S1WA 1S5JA 4QZIA 5HP4A 3JPPA 3MEEA 3O3FA 1NJWA 1T03A 1LWEA 1JLGA 1QSYA 5DKWA 1COOA 2IHNA 2EHGA 4DG1A 3KJVA 1TKZA 2Z1JA 9ICAA 3S3OA 3QE9Y 2PFNA 4C8NA 3AA2A 1XHZA 3TAMA 4PHDA 4B3OA 2ZE2A 1BCOA 3SI8A 1NK8A 2KN7A 4M9HA 2D0AA 1TAQA 1TKDA 3U3YA 3AU6A 3LANA 1KVCA 4HHTA 2XCPA 4RW7A 4JUZA 4OLBA 2HNYA 4FLTA 1L5UA 5JS1A 2X6SA 4YMNA 4KB1A 4Z6EA 1S0MA 1UAXA 2RPIA 5KFFA 3ZDAA 4QW9A 4ECTA 1ZQTA 3QINA 1JIHA 4B08A 3O3HA 4FLUA 4YVZA 5SWMA 5J2JA 3NH1A 4QWEA 4AHVA 3DLHA 3OYKA 3BDPA 3OGUA 1U9LA 1IXRA 8ICPA 4JK1A 3O4QA 1ZQNA 3O4NA 4NYFA 1U47A 2X74A 3PW4A 1CZBA 2P5OA 1ASUA 2YHBA 4MFAA 1RZTA 4CK3A 4UQGA 4FZXC 1NKCA 4AHUA 5J2EA 4B9SA 3QEWA 4MEYA 2A1JA 5J2BA 4RQ6A 3KHGA 4M42A 3VQEA 1ZQQA 5KG2A 3JPOA 3I0SA 4F2RA 1ZQEA 5KG3A 5DG8A 3LP0A 2D5RA 3LZIA 3QEXA 4IDKA 1RYSA 3TR8A 3UQ0A 1ZQOA 2MUTB 4BE0A 4FYDA 4QZAA 2J6SA 3ZT1A 4RU9A 3OY9A 1RT4A 4QWDA 5C5JA 5K14A 4CESA 4CIEA 4O44A 2AU0A 3GIMA 1KFDA 2AGOA 3NTUA 1IKXA 1NJZA 1QE1A 3MR2A 2ZTDA 1RT5A 2KQ2A 1CXQA 1S10A 4HVJA 4MFCA 4KO0A 4B9VA 2C2EA 5KG0A 4Z6FA 1X9SA 5KGXA 3RJEA 4UBBA 1A76A 1U4BA 4YMMA 1UT8A 8ICBA 4QW8A 4DTNA 4RW9A 2FBYA 4LSNA 3VQ6A 4QZDA 5KFRA 1JXLA 3KHLA 2YNIA 1VSJA 1FK9A 4DTPA 2VG6A 3LP3A 3HYFA 4C8OA 2C2RA 2ZUBA 2R8KA 1TKTA 3MFHA 9ICWA 1T4GA 1NOYA 9ICFA 2KFNA 3HVTA 3OYNA 1RYRA 3WNGA 1S0VA 4DO9A 1VSFA 5D4BA 4GC7A 1C0TA 1RTIA 9ICOA 1Y97A 2ETJA 3TABA 2FMSA 7ICFA 2UVRA 3AVGA 2LSNA 1QQCA 4NCGA 2PFQA 8ICKA 3S3NA 3JPSA 3TARA 2YNGA 1ZQAA 4RQ2A 4Z0UA 3H8JA 3HO1A 3DYAA 3OJSA 2IBKA 2DPJA 4JV0A 1XC9A 1IH7A 1S1UA 1KDHA 4I2GA 1Z26A 4FJMA 5J0WA 1JL1A 3P1GA 8ICOA 3PR4A 4YR2A 5KFKA 5F9LA 3LP2A 3S3MA 2YHAA 4PGXA 3LPUA 3VQ8A 3AVCA 1IO2A 3S9HA 1SZPA 4GXKA 1QLNA 4GC6A 4CERA 3NAEA 8ICNA 1L3SA 4O3PA 5J0TA 4DTRA 5KFSA 5J2AA 4F4WA 4C8LA 3L3UA 1XWLA 8ICTA 2XO7A 1ZQXA 1RDAA 3QNNA 4J9KA 4K8ZA 4R5PA 2ASDA 4B9TA 1ZQGA 2D0BA 5J2FA 3O3GA 4NLKA 7ICLA 1I39A 4DOCA 2IA6A 5T7BA 9ICVA 1FKOA 2FMQA 2ASLA 3PO4A 2UVWA 3BQ2A 2JGUA 4YD2A 5SZTA 4CFCA 3M9MB 4LZGA 4KLJA 4JRQA 2QXFA 5KFNA 4YQWA 4CJ4A 2OZMA 5J0XA 4KLMA 1XSNA 5DBAA 2BPCA 3SYZA 4M3UA 4YXJA 3HPGA 3SV4A 1ZBLA 2V4QA 1Z00B 4UB3A 4XUSA 4EP5A 1FXXA 5DB9A 3CG7A 3AVAA 3V6HA 4ECSA 4QZBA 4F8RA 3KLIA 1NK6A 4CHPA 1TK0A 4NM2A 3AVHA 1TVRA 3AVKA 4FJ7A 4K4HA 3OHBA 4BWMA 3HX0A 2HNZA 1D5AA 4FZYA 3KK3A 1XU4A 4CK2A 4O4GA 2WOMA 4RQ7A 1LWFA 4Q8EA 3PNCA 1ZQFA 5J2QA 1VRUA 4DL7A 4UB5A 2P51A 1T7PA 2W42A 2G8FA 4CF8A 1JN3A 4O0JA 3ZSWA 3LAMA 7ICMA 3EYZA 4CIFA 1S0NA 4B9MA 4YFKA 3K75D 2I1QA 2AJQA 1DGSA 2IMWP 4CF2A 4FS1A 3V1QA 4CE9A 3L2UA 4CGJA 3FDSA 4DFPA 4FLVA 2FBVA 3G6XA 4DU3A 3ASMA 4IR9A 1A5XA 2KTQA 5J2KA 4FK2A 5KFMA 4R64A 1C6VA 3MAQA 2JEIA 1PZNA 4XIUA 7ICPA 1TKXA 4F50A 5KG7A 4ID5A 2YNHA 1N6QA 3MDAA 3HSTB 3UXNA 1NK9A 2IAJA 1ZBFA 2FPMA 4I28A 3TFSA 3GDXA 3OYHA 3ISCA 1ZQJA 4DFJA 4IG0A 1QS4A 4EBCA 4LVSA 4AHTA 5KT5A 3JPRA 3MFIA 1JLAA 4FJNA 3ZT3A 2OPRA 4CEDA 3ZSQA 4HCCA 5DB8A 4QZFA 3FYHA 3DRSA 4O5BA 4UB4A 1BPYA 3MABA 2PFOA 2ZUDA 3ORYA 2ATQA 4ECZA 4CJSA 4H8KA 4Z6DA 1HUZA 2GUIA 4YMOA 3ZSOA 5J0UA 3BQTA 4EBEA 3ALYA 1XSPA 2VG7A 1CZ9A 4DFMA 4G3IA 3M8SA 3DLGA 2X6NA 1BGXT 4CF0A 1J53A 3PMNA 4XRHA 1BIZA 2G8UA 3OYEA 3L2QA 4BDZA 1CLQA
chains in the Genus database with same CATH superfamily
2XMMA 5D77A 3HILA 1WOOA 3GR1A 2DGSA 2HW3A 3D6RA 4O3OA 1OVQA 2ASOA 3CDEA 1ZQWA 1T9YA 3M32A 5ALFA 3DLBA 3E8OA 1KRPA 1JB0C 2E2PA 4CJEA 2AD9A 1BHLA 2WW8A 2HMIB 5KFCA 2VBWA 2P6TA 2Z1GA 2UU9J 3Q8PB 1C0UB 2F8KA 1HBUB 2MYFA 3C6AA 1WUUA 1WACA 1HBOB 1F9FA 1PYTA 3OXGA 4X4NA 1RBOB 1ZBTA 5ETPA 1NSKL 4B8AB 2ZNZA 1S9EB 4DLEA 4KAIA 1ZM9A 3D1HA 3MTKA 2DB1A 3M7VA 3PZPA 1L6NA 4PKDB 3FVYA 3T79A 2V52B 4LFAK 2HBZB 3DOKB 4CRJA 4M94A 4Y34A 3WNHA 3N28A 1RDCA 3O9QA 3TWZA 2UUCJ 2RF2B 3JXOA 1X4GA 1EQMA 4A8YA 1MN9A 4DR6F 5KFGA 3VOVA 2ZXHA 3AB4B 4DZDA 3HF5A 4FWMA 3MEEB 1FDNA 2KSOB 4CH1A 3CQYA 4CFBA 1BCMA 2CQGA 1XN9A 2DY1A 2EKYA 4ISGA 4UY8T 2K4EA 4W5OA 4CF1A 4CLKA 3ETLA 1SKWA 4CEFA 4E89A 3DLJA 1CVJA 1XJWB 3QO9A 1RBSA 4F4AA 2LPEA 2VGMA 3OYDA 1Q46A 4PZVA 4PYAA 3W2WB 3TUIC 1KOOA 4RWXA 3SBMA 3D68A 1IIPA 3KHRA 4J2AA 3L2VA 4ENOA 5GAHI 2W8KA 8ICVA 1PO6A 2EK1A 1V3SA 4YB5A 4CHZA 2HIYA 3W62A 5AQUA 4KGXB 1P9QC 9ICNA 2Z2ZA 3F9MA 4YOTA 2B4UA 3OYLA 3OVBA 3D7EO 1TE2A 3KIOA 1MNEA 1RGVA 2F1FA 1RP5A 1KP6A 3G25A 3KUGA 1D9DA 5LJ3Y 3RJGA 3MDQA 2AJ1A 2CJAA 2F63A 3I5CA 1WSFA 4ZKAA 4G1IA 2E1ZA 1AZSA 4CM0A 2A2DA 2VQEJ 2AYEA 3PR5B 1Z1ZA 1X4EA 3V6DA 2F8EX 1K9MO 2H1YA 3GPAA 3T6BA 3IG8A 3I5AA 4JI0J 4LC9B 1X1PA 3H7IA 3M2VA 4PJ0U 3GLJA 4NXNJ 3O0FA 5IILA 2P9UB 2LEPA 2NXNA 2RILA 5ALEA 1B43A 4FJLA 3IBWA 4K4XA 2RH3A 3H2VE 3DOMB 1BISA 4USWA 4JK7A 4YB6A 1RAIB 4KI4A 5HMWA 1YKWA 1NU4A 1Z25A 3GQCA 3BQ1A 3RAQA 1N33J 2GO9A 4UW2A 3VGVA 1QM9A 1X4HA 1XR6A 4EO8A 4E0DA 3QWPA 4Z6CA 4P4PA 4ES2A 2W11A 3CJRA 3FZ2A 4YUDA 2VJ4A 5HVGA 3HW8A 2H3VA 4LFBK 1Q81T 2RN2A 2DR5A 4KMUA 4P74A 1FDBA 4JNEA 5AFUH 3KLFA 2QRRA 3P6YC 5L1KA 1R89A 2VG6B 3A1YG 4IOAL 4JV1A 2NV3A 1KHVA 2A3VA 4KLTA 1O5JA 2DGVA 2KJ5A 4TNOA 3KWIA 2CQ2A 3FC4A 1O51A 1C0TB 2J6UA 2UV8G 4CGHA 2D3OR 4RU2A 1RTIB 2ILZA 1QSSA 1ZAVA 3L7OA 2YX6A 3C1YA 3RW7A 1IKWA 2KHVA 2CNOB 4DS5A 2GJFA 3NL0A 5CYQA 3ISND 2W43A 3BJYA 7FDRA 3WNFA 8ICEA 2B9XA 2QKBA 2ZBRA 3KHYA 2DUYA 4QS8A 1KQSM 2MZ1A 3CD6N 1FX2A 1S1UB 2VV5A 4PAAA 2RDJA 3L4IA 4MDBA 4QJFB 4WYWA 1GTHA 4OI0A 5KOWA 4BE1A 1S57A 3WKEA 5DQIA 2BKPA 2OFGX 2XMTA 3GCWP 3UCZP 4PHPA 2W9AA 2FLOA 5DM6Q 4C8MA 2BANB 4DTJA 2I8EA 2F8HA 1DEJA 4CHNA 1FF2A 5KT6A 3JQMA 1SC4B 4FWSA 4KLLA 4JI4J 1BI4A 1U25A 2CPRA 1FESA 1I3OB 2CQBA 2HNDA 3NKYA 2Z58B 2CJKA 3EW9A 3UE5A 3I55S 3GFXA 3K57A 4OJRA 2GQ2A 2BX6A 1G1XA 3P49B 3TZWA 3CCQS 5FD1A 1N5XA 4US9A 3BGLA 3TNVA 3J7AP 4RUCA 2D4WA 4ZTJA 3CCLN 2HMPA 2UUAK 1F44A 1NHUA 2G08A 3KDNA 4UAYA 1A6LA 1SJQA 1D8YA 3JXUA 3CO0P 3P39A 4K4GA 4LJXA 3SEOA 5HR7A 2CRXA 1NNLA 1VQ7N 4DX5A 2O8EA 1Q8LA 1RWOB 4PXDA 4ZPAA 1WC0A 2V0NA 3OS2A 2D3UA 4ZLLA 1ECWA 4HL9A 2RJZA 1ZZNA 4BRGA 3PYFA 4CGFA 4LR8A 3KD1E 1JLBA 3DLRA 3KK3B 9ICBA 5AK5A 3WXKA 1LOUA 4O4GB 2IOCA 2A1BA 4JWMA 5AKLA 1Q8KA 1F0XA 2HOEA 2UYTA 5H1SV 1KFTA 4ICLA 2F7VA 2G2YA 3HOSA 1D9AA 1KQKA 3OR1B 7FD1A 4XH5A 2BKNA 2D9OA 4PG6A 3R2DJ 4QOZB 2YWKA 3AJ2A 3VV2B 1ZQRA 3SAHA 4DSKA 4FKYA 3R5BA 4DPWA 3HSCA 3R7BB 1TL1A 4DU4A 3IBFB 2BCSA 4OJ5A 2Q2RA 3JB9k 2P35A 4IRDA 3GFHA 5L1IA 1N54B 2FBTA 1NB2A 1OKJA 4WFBQ 1FNXH 4BLGA 1SI9A 5F3ZA 2F7TA 3AU2A 2BGWA 3VGKA 1D8LA 2QKQA 3R3TA 3VAKA 1TKXB 2V4JA 2HK2A 1RADB 2JH1A 1N6QB 2IJRA 3PSPA 4BC2A 4LR9A 2G9OA 2HHPA 3KKAC 4PGYA 3OYBA 3BQ0A 4RG8A 4IFVA 1BIUA 3NAHA 2NRZA 1VQ5S 8ICLA 1VFJA 3FBBA 4EFHA 1I94J 1U48A 3ZSYA 2OPRB 3OPKA 3QIPA 4AD6A 4QS7A 4DV3F 5AKZA 5M1PA 3F2KA 1J5EF 3DRSB 1E3MA 5H9EK 4P73A 2LYVA 1RHKB 1VQLS 3N4MB 4B9UA 2CQIA 5KFTA 2YMQA 4OJLA 1BWVA 1BPEA 2YY3A 1IQZA 2DO4A 3U02A 4B3MJ 3QBXA 1RWVB 4J8FA 1RKIA 3P38A 1U24A 4DBQA 2LBOA 1MU2B 3VALA 1HMVA 2E6MA 1L3KA 1RJJA 2XG8A 8ICCA 4R8UA 2WSFC 3P96A 1EETB 4OZ0A 4O8KA 2G8HA 3RH6A 3UKRB 4FNIA 4RR5A 4FKXA 3HXMA 1F1BB 2UUBF 3LDPA 5KAFU 3JYTB 2KRBA 2GCFA 2G8VA 2C2NA 1WEZA 1ICEB 2XB2D 1K9MT 2ZEJA 2MXYA 4JV5F 1X0PA 1TUUA 4I2IA 2OTLN 2QLBB 5HLFA 2KK0A 4FJHA 3RAXA 2Y0SC 2RT3A 1BOTO 4WFAL 4X5VA 3RMAA 5F41A 3N7PD 4CF9A 1WC4A 3AQPA 2RKIA 2UP1A 4DV7F 4PHAA 1C1CA 2KICA 4JYAJ 3H0MB 3GIRA 5BN9A 1MDUB 3MEDA 5MLCV 3V7JA 3B0YA 1FRMA 2J0WA 2D7SA 4EIAA 3VQ9A 1FTRA 2GNKA 3O1WA 2JRSA 2W2OP 3C6TA 3NF7A 1QVGM 5LT5A 1I6JA 1NZBA 4F3QA 4Z4EA 2KL8A 3NHGA 4GXJA 3V4MA 3G10A 2HURA 3A8KA 2K8AA 2PMZF 3NOCA 3VEYA 2O67A 3MGVA 3QJPA 2YNFB 3A8IA 1XI1A 1E4FT 4E2FB 3FEZA 4YOYA 1U2FA 2D3DA 2DNHA 1Q16B 4NRUA 3U1LA 3T5LA 4KHUA 3F0NA 3VGLA 5BR8K 4B9LA 3R8YA 1HQ2A 3TP2A 3F2BA 1FEHA 3C1ZA 1CC7A 3PIOQ 1N48A 3CJ2A 2EFGA 4CF4A 1PKUA 3M6XA 3PHEA 1FA0A 4HDGA 1VK8A 1HBNA 3FRZA 9ICIA 3AGRA 5AQKA 3PTWA 5L1LA 2XY8A 4M41A 2RVJA 1KVBA 2CJ9A 3HSDA 1E6YA 3QEVA 2DNQA 2HYIB 4OI1A 3PSTA 1S77D 3V1OA 4UZCA 1JKHA 3OTOF 4B3SF 4ED5A 3WU2U 4H5TA 5ALGA 2XMKA 5GAEI 3RVCA 4J9RA 4F0MA 4C3LA 1IBLJ 2J9CA 2YXLA 3T6JA 1MWMA 2XZWA 1NOZA 4WF9Q 1I1GA 3U3GA 1TUYA 2P9LB 1T94A 3ZT4A 5FDLA 1S6OA 2DNPA 4M5DB 1HNXJ 5DLGA 1FD2A 1SXEA 1G7CB 3FUYA 4RBUA 4DEZA 1IBKK 3C16B 1UOCA 3PIOL 2JV3A 3KNGA 5K8OA 4EUVA 2PMHA 3M9NB 4DOBA 4F92B 3DU5A 3W66A 4OGEA 4KGVB 5A8KA 1KVAA 3FQLA 5FLXO 2IS3A 2WB1C 2AX1A 3A4TA 3NGZA 4OZJA 4KB0A 2DR6A 3N5BA 3M6ZA 2BOPA 2BBEA 3NVYA 2PFFB 1KKHA 4X4OA 4DQRA 1S97A 4QR0A 4M2YA 4QU7A 4BR2A 1FHTA 4WCEQ 2MTLA 4RUHA 2HHVA 3TAEA 3AO5A 2FQQB 5CCMA 4O3SA 3KG4A 1KVJA 4HTIA 4DDFA 2KD1A 1M5PC 5EWGA 3EUB2 3QEBZ 3CCUS 2D1KA 2M0GB 2BKEA 1TAUA 1U09A 3AVNA 2B4JA 1IBMK 1GFWB 1PYSB 4OHVA 1P7DA 1N52B 2N1RA 4Z7YA 2P9NA 4PG7A 4O44B 4EI2A 3CPEA 4TXSA 2XMAA 2V8PA 2ASMA 3HT3A 4ILRA 1O1WA 4DR1F 3FBFA 3DRYA 1RT5B 2O8FA 1ZQCA 5G0RB 1QUVA 3GE9A 4QBUA 4X65K 4RW8B 4RQMA 4ILLA 4KAZA 1PUZA 4WJBA 2BPFA 4OFZA 4DV4J 3CMQA 2D6FC 3NY0A 1OH8A 4BY9C 1LWCA 3BYRA 4F5RA 2XGQA 3Q8SB 2DFEA 1JMSA 2BQRA 2B0GA 1NJYA 3Q83A 5FROA 4CE6A 2G0CA 1ZJNA 4GXIA 2QW9A 2YJFA 1UCVA 3AOAA 4KBIA 4BVOA 2P9SA 1YRUA 3V4IB 1WWHA 1F3FA 2OPQA 7ICQA 2PGCA 3M5RA 3MTJA 5J2MA 2E6LA 3SUQA 5AKKA 5HROA 2N7YA 2R7VA 1YRTA 1ATRA 2RRAA 1RBTA 4CZKA 4DL6A 4ETXA 1S48A 7ICUA 4DR2J 1YVNA 4PKGA 3ATUA 1OH6A 2C22A 1ZRNA 2HSZA 2G8IA 1RILA 3IG5A 3PFEA 1FKPA 1X9JA 4OJ3A 5BPMA 4IC9A 4F3OA 1O8BA 2FF3B 4Z7CA 2R7XA 2BDPA 3D6FB 1PIEA 2EBEA 3NGSA 1WUDA 5K8MA 3MXMA 3CCEN 2CYYA 1FT8A 2ZZTA 5KFYA 1AYEA 3G6VA 1GOBA 2P5VA 1BHNA 2I5JA 2VG5B 3F5AA 4LSLA 1JK9B 2MY8A 3NVZA 2LA6A 4IO9L 4B1YB 3THYB 1D4XA 3DV9A 4FZZA 4ED7A 1SJ4P 5G4DA 4DQQA 1HJPA 2DXEA 2G09A 4KMOB 2HRYA 4WJ3B 4QZ9A 1SB3C 2F44A 3MR6A 1UPMB 1R8CA 4JB3A 2N3LA 3CCJN 2R9LA 3EE8A 4LBPA 3R2CJ 1VQ7S 1R0AB 4I6AA 3F53A 1SKUB 2BR0A 2ZUCA 3QBCA 3N7SC 5DQHA 8ICHA 5AI5A 4C23A 2ZJQQ 1UFKA 4H0TB 1WKKA 1B22A 1WG5A 2WRMA 1T3NA 1UT5A 3PY8A 2Q4TA 1J5OB 4KFBB 3M2RA 4KV8B 3QAEA 2J0SD 3GZ7A 4BGAA 5AM0A 4IJNA 4DR4F 3DLKA 2JZ5A 2ZHAA 2ITMA 1YF5L 4Z2XA 2ASJA 1S12A 3QERA 4JHDB 1V4TA 1FJGK 2R7TA 2YQEA 3ZTRA 4CLWA 3N7RC 2AZ1A 2F4VK 5JLFA 2BJ1A 4C80A 3V9XA 2FBXA 4A8XA 4PXCA 2IY5B 4AUKA 3R5AA 1F2GA 1NPPA 4BXOB 3MM7A 4WE1A 4L72B 3OR2B 1HRHA 2QKKA 3TRGA 3B6OA 2CUYA 2B4VA 1QQ6A 3FZHA 2YX8A 1VQPS 1U1MA 2ZZMA 1RBRA 4DF8A 3BO2A 4CM2A 2MZQA 4B9QA 1NDLA 1A5VA 1X3NA 4ZLJA 2ZHOA 2D0OA 4HTLA 3WXIA 5CP2A 3KLGA 2HHHK 2LQ9A 4WWSA 1I3AA 3CJTA 3VAHA 3NDKA 2GGPB 4GVLA 3RSEA 3OVSA 2RE2A 2DBBA 1N32J 1DTQB 4IRCA 4KRWA 2AGQA 4P2XA 4UBCA 5CZ2A 4FJKA 2I0XA 3BH7B 4EYIB 1YJRA 2RUGA 4FVCA 8ICRA 4NL9A 3MMCB 4RW6B 3MR3A 3DRXA 5FIIA 4K42A 5IOLA 4CFDA 3QZ7A 4YEAA 1U2VA 1QHTA 1FFUA 3IMQJ 4DV2F 4OI6A 4H5NA 2OLWA 1NNEA 5C15A 2K7JA 2IAJB 4JI3F 3UW1A 3FZBA 3X1LB 3P83D 1V6HA 3MM6A 1S8OA 2CQ1A 1N5QA 3MPYA 8ICXA 3RBZA 1NHVA 4DZ6A 3D2FA 4JKEA 2HHHJ 4DR3K 9ICSA 4MFBA 4ZPTR 1PK1B 1JCGA 5LY3A 2F4FA 3K58A 3WEEA 3FSYA 2KVQE 2ZH9A 3SSSA 2KKZA 4EO6A 4ZVTB 3RF9A 2KDOA 1B92A 4DSIA 4KLEA 1V97A 4LVOP 2OXOA 4RQ8A 4N77A 5J2NA 1NKBA 2E8NA 4OZ3A 2ZGZA 4JI5F 2E7VA 1TGOA 2WSCC 3P3DA 1SUQB 5F0WA 3G82B 4JI2J 1S9GB 2GWSA 1SH3A 3AXKA 2QWLA 2CDRB 3IG1B 1L3TA 2BE2A 2QJ3A 3A12A 3UVJB 4A2AA 3OFEA 4UQTA 3VGUA 3W3SA 4FL9A 2VKQA 3RU0A 5C42B 1XNQK 2AZ3A 3LVWA 4C11A 2OTLS 2CPEA 3KZXA 4Y65A 3VVUA 1HWIA 4FLYA 2YI1A 4BHQA 5KFZA 2AJ4A 2WVDA 2KFYA 2KKPA 5JJBA 3H3OB 4JOUA 4AHCA 3S7RA 1OS5A 2G8WA 2AA4A 1IXKA 4WYLA 1YJNN 4YY3F 1JLEA 5CAAA 5A76A 3ULEA 2W54A 1QZ6A 2Z56B 1J9AA 3HHKA 2HHQA 4YOVA 5DGBA 3HPOA 1RAJA 2LQJA 1YITN 3HSJA 3N0VA 4HT7A 3KK1B 5LMUJ 3FCHA 3QFPA 3MPDA 3VCDA 2ZD1A 2N7CA 1LV5A 2AKWB 2PEHA 3VA0A 4JI6F 5GMKa 4BC3A 3TOQA 4BDYA 1PBAA 2EG2A 2H5EA 3SQOP 3I9V9 3L9ZA 3B9JA 1QHAA 4GW6A 5KFXA 1WB9A 4DU7A 3VGSA 3QETA 1VOMA 2D3O1 4HUEA 1IKYB 1S1TB 4MAKA 1JQGA 4CJTA 2AYBA 3JTNA 1FRKA 4UF4A 2G8KA 2DH8A 2O8CA 4TU8A 3R7SB 3NF8A 1ZAXA 2DY9A 4R65A 2EAMA 4IFYB 1IBCB 1ZH5A 5A0YA 4LH4A 1T9WA 4LRBA 3R9PA 4NEYA 3VCBA 3FMBA 2QARA 2RQCA 2VFUA 1H72C 4FPIA 2N3OA 4KLUA 1YJ7A 3LDOA 2F9JA 3NNCA 5HL7L 3UKUB 2HFSA 4QZHA 3ENBA 3ZSXA 5DMRA 1U1NA 2CPJA 2UVVA 1TZ0A 1K8AO 2LEBA 5HRSA 4NEZA 4YG2A 5THWA 5AQYA 1BLUA 2FC9A 5IWAF 4DUYJ 1SCJB 3SCKE 4A4JA 3OYIA 3ZETA 1N5TA 4NMXA 7ICRA 1ZA1B 4NLVA 1HYSA 1UW9A 5IINA 1YVFA 5KAKA 3MWPA 3O08A 2CA9A 1RT3A 2DGOA 2OYQA 3D2EA 1N60A 1Z2ZA 4J9LA 3EO3A 4KLQA 1FRJA 4NASA 1RT1A 2Y1LB 5LM7E 5K4LA 4QWBA 3TUZC 2ITGA 2IVNA 1U1LA 1RXWA 1HJOA 3L4BC 4ECRA 2JOQA 4CEEA 1KDNA 2P9KA 1WJ9A 4DTXA 1RCHA 5IC6B 1RTJB 4PQUB 4PCQA 3CJ4A 2X78A 1VRTA 2Q0RA 2UXBJ 3FM9A 4A47A 1KKXA 4PWUA 1HNVB 4O5KA 4Y2AA 2ZWPA 5HP4A 1NJWA 2GVZA 1T03A 3P5TL 5D4PA 3AEVA 4M95A 2V5HG 3MCMA 4IH7A 2IHNA 4GFJA 3ET6A 4X64F 2EHGA 1VAZA 2K8BB 4DG1A 1UVIA 2Z1JA 4NYPA 3RZAA 2PFNA 4C8NA 1REGX 1XHZA 1NSAA 3HULA 1IR0A 4B3OA 5B0AA 3NGRA 1RWPB 3QWUA 4KYZA 3EXYA 2VH7A 2M70A 2KN7A 2MLZA 2D0AA 4JI8K 3U3YA 3AU6A 5AM1A 4RW7A 5E7OB 3E9PA 5AQNA 3I87A 4K4SA 4AE5A 1WHVA 3UD5A 3IR6B 2PA3A 3VEWA 1UAXA 1Z4NA 4FZMA 2DHHA 5AHXA 1TL3B 1R43A 4B08A 4YVZA 3SSQA 1N34F 2RDDA 4USMA 2J9DA 2Y0SD 3BDPA 1IXRA 3SQIA 5B08A 4ZHRB 1H1VA 3D9BA 2HVZA 3ZNJ1 1IKWB 4NYFA 3WHIA 4NA1A 3PW4A 1CZBA 3W5ZA 3GJQB 1ASUA 2YHBA 4CK3A 3LDQA 2BEFA 4DV1J 2UV8A 1S4EA 4X66F 4N7TA 4Y0FA 4B9SA 4ZN3A 2OUGA 3CC4N 5J2BA 4RQ6A 3KHGA 1YGYA 1UVLA 2AYMA 3VQEA 4D3GA 2MMYA 3VAMA 1WF1A 2QLTA 3R1HA 1CJUA 5ALSA 2D5RA 2A42A 1QCKA 5D8HB 3TR8A 3MM8A 1RDUA 1EQ0A 3MXHP 2J6SA 3ZT1A 2NLWA 1S1VB 3F56A 5HMXA 1RT4A 2G06A 1WSRA 5K14A 1QQOA 1OPIA 3QT7A 3R9KA 4PR6A 1KFDA 2P9EA 6FD1A 4NE9C 1IKXA 2YB4A 4LF7J 4RX6A 3MCSA 4NZ7A 3C66A 2ZTDA 3VC8A 4B9VA 1RHMB 1HNZF 2GMLA 4AT1B 1VQSA 2EK6A 1RT6B 1WOPA 4PL8A 2VPWB 1GLEG 2BW2A 3F2CA 3RJEA 3WK9A 2APOA 1UT8A 5L1MA 4P0QB 3NGUA 4JI1K 1BWFO 1BNOA 4RBVA 1G99A 4QW8A 2OKQA 3FJ2A 4DTNA 3CCJS 3Q8UA 3WZ0A 3TJ9A 2O8DA 3ZZPA 3BREA 1NBWA 4CWBA 2YNIA 4DTPA 2P9GA 4Y2JA 1TKTA 3MFHA 9ICWA 3N6LA 3GSDA 4ZLNA 1NOYA 3CPWM 3T9NA 3QMQA 4UTGA 3QGGA 3WNGA 3RJMB 3BSOA 1SBRA 1VSFA 5D4BA 4R0JA 3FQKA 3D66A 4ZPWR 1Y97A 2ETJA 2FMSA 4KJIA 3AVGA 4TLQA 4CBWA 4ILHA 1NGAA 3MOJB 3BSAA 3JPSA 4RQ2A 2GOLA 4YB7A 3CRXA 4Z0UA 2A1AA 5C0YA 2H3ZA 3H8JA 1N5YB 4JI1J 3DYAA 1M5SA 1OJ4A 4A2BA 1NM1A 2RHQB 1MROA 4JMUA 4J90A 1IH7A 4C98A 1RHUB 3UR3C 2WB1D 4QQBA 1Z26A 2OO4A 1FDDA 3PR4A 1T44A 3J7YU 5F9LA 2ZKTA 2YHAA 2VJ5A 3J80U 1IO2A 2CQ0A 3M6KA 3J7Z5 3H2LA 2K89A 3JTOA 8ATCB 2W7PA 3GSIA 2RHKA 1XWLA 2GAHC 1ZQXA 4PHTX 5ALDA 4K8ZA 4C0BA 3DLEB 4R5PA 5J2FA 2UU9F 1I39A 1DRZA 3SLCA 3CCSN 4AP9A 3F5EA 5L39A 5AK3A 2O6KA 5GADI 3SMSA 1N8RO 2DR8A 2JGUA 2QA4S 1M5VC 2BABA 5F0XA 3QNMA 1WEXA 4IOCL 4JKGB 1TU0B 2V94A 3G6EN 4MK7A 2CN1A 1X4FA 1MLAA 2BPCA 2BM1A 2CZ9A 2FSJA 1EKRA 4FDFA 1EB0A 4BRFA 3HPGA 1ZBLA 2NYHA 1Z00B 1GLDG 4UAVA 3DHWC 3L3FX 4EP5A 1FXXA 5DB9A 4I6WA 3A3NB 1PAUB 2LXIA 3AVAA 2UUCF 1Q18A 4I2PB 3V6HA 2A5XA 3NVMA 2Y9HA 2DWQA 4QZBA 1NK6A 4U7UK 2XI9A 3HFZB 4K4HA 5AZJA 1RI7A 1K8AT 1SH2A 4BWMA 1BQMB 4URGA 4PWDB 1XQSC 2HNZA 3CD5A 3TO8A 4FF3A 2VIHA 1PSDA 4CK2A 4DCPB 2W3SA 4RQ7A 2I9SA 3PNCA 1ZQFA 3AA9A 4MIBA 3WK7A 5J2QA 4LMZA 4KT0C 5GIPA 2G5HB 4DV6J 2W42A 2G8FA 2DQNB 5KL8B 1EX8A 1JJ2R 5F2RA 2BJ3A 4CTAA 5IQ6A 4ISFA 1S0NA 4OI2A 2E9RX 2I1QA 3VF4A 2AJQA 4ICAA 3HSGA 2IMWP 2DF4B 2R2TA 1MN7A 3V1QA 4CE9A 3L2UA 2IM2A 1FRXA 3GJRB 2QWOA 4NXMJ 2IM1A 3BP8A 2HDOA 1FEZA 2FC8A 1DARA 3ASMA 1S5LU 2PEBA 1A5XA 1Y4ZB 2KTQA 4MKBA 3C14B 4XH1A 5KFMA 5F0UA 4LFCK 2ZVIA 5BJRA 2MKKA 1B3TA 2Q0UA 5ALVA 1C4CA 1YJNS 5H2FU 4PYDA 5AQFA 2YNHA 3OTQA 2IRYA 1NGHA 4CJ7A 1Z19A 3FNNA 3MDAA 1DGJA 1CI4A 1YITS 4YDUC 5JU5A 1QTNB 4URQU 2FPMA 2DGZA 1VQYA 4I28A 4QJVA 3NVWA 3MEKA 1U02A 3TW0A 4B3TK 4JI0F 4IG0A 1Y0HA 1T3QA 4JBCA 2ZJRQ 4EBCA 2GQCA 4NXNF 4AHTA 1AUSL 3I32A 5A8WB 1VC5A 2CVIA 1JLAA 3DOLB 3AMZA 5DB8A 2IOHA 1H73A 4MYUA 5KPZA 5IT9Y 2A6AA 2DRBA 4DR7K 1DQ9A 2HWHA 2ATQA 4ECZA 5C2CA 4WP9A 3EE3A 5ALIA 3THWA 1N33F 3X3UA 3FGUA 5AFUA 5J0UA 2CJBA 3VAFA 4EBEA 1XSPA 3O9SA 3DLGA 3OLBA 2KN4A 1Q4RA 2JWLA 5G5HA 3LGMA 3MEGB 2G8UA 3UMGA 3EJMA 4BDZA 1R7IA 3SCJE 4RWTA 1D1UA 3NNAA 3GFKB 3QBWA 1ZD4A 1ZQLA 3UQSA 5J8YA 5FRNA 4JWNA 3S41A 1TL7A 1IUJA 3ZSZA 1SC1B 1TL4A 8ICGA 2WW4A 9ICKA 1DQAA 1E6YB 4P0PA 2R2UA 5B09A 2KVIA 3KLEB 5B8HA 2B51A 2BA9A 5KT4A 1D3WA 2HAFA 2B6AB 5LL6Z 2AP1A 2EW9A 1Y64A 4CGIA 3PRDA 2HBJA 2DNGA 3VETA 3VVTA 4OLAA 1T6DA 4I7FA 5M1KA 4RQNA 3J81j 2DTUA 1Q3UA 2JEFA 4NA2A 4FPRA 3HVAA 4KQZA 4FYWB 1L3UA 4B8CA 4CHYA 2R7RA 3C3LA 1JUDA 5BOMA 2OEMA 4EAHD 4G1QB 2E5LK 1U0SA 2O01C 2AQ0A 3OYAA 1SV0A 1NH7A 1RDWX 4F7VA 1KFSA 3L5KA 3L95X 3O4WA 1RBVA 2W9BA 2FYXA 4Y2RA 3VZHA 4EU0A 4F5QA 1VSKA 4QIWF 4DJBA 1S1WB 1FE0A 4USAA 3MMAA 4YOUA 1LWEB 1YZ7A 2WAQF 1JLGB 5M1QA 4OPKA 1LEOA 4LF5J 1RNHA 1T95A 3W5XA 3O9RA 3ZDEA 1HKGA 3MXJA 3AA3A 4JI4F 3L3VA 1U2CA 2ZE2B 4CLPA 1B99A 5E41A 4F5OA 3SQGA 2LYAA 5L9XA 5AR0A 1FE4A 5DG7A 2OMOA 4DQSA 3IAS9 2E5LJ 3MURP 3THXA 5CCLA 2HNYB 1UFWA 5BN8A 5IS2A 7ICOA 3F5TA 1I51B 1U6ZA 2YQ1A 1XTZA 3ILJA 4KHWA 3OJUA 3EX7B 1X5PA 3M30B 4OHYA 4ZLPA 3KFUF 1RAGB 5DB6A 2FHJA 5KFJA 4M6WA 2A1SA 2IVFB 4Z4CA 1BD6A 1JLCA 4I27A 2XY6A 2X1BA 2QLXA 4YOEA 2JWKA 2VBXA 3D0PA 3Q2TC 5HQMA 4MQ3A 4W98A 2KXNB 1F21A 4LT6A 3N4PA 3AVJA 2NPFA 4F71A 5ETQA 4RQ0A 3E51A 4ZTFA 1OY6A 4P2FA 4R63A 2A1JB 4CF5A 4ED0A 3KG1A 4HCBA 3WUHA 3UXPA 3KUEA 3I0SB 1NOMA 2XYPB 3R6MA 2DFLA 5BPLA 2MPUA 1Q9XA 1VBXA 3DM2A 4BR5A 2CQPA 4IDKB 3NCRA 2Q79A 4CEOA 3T1YK 1AT1B 4Y2MA 4KRFA 5L9NA 4KH5A 4ZJOA 2HHTA 4CHOA 1T05A 2UXCJ 1V9OA 2B56A 3MMBA 4O0NA 1Q8BA 1PJ7A 5AIBA 4QPXA 3U9DA 1BPXA 1QE1B 4CH7A 2Z1HA 4CBXA 3GG4A 5BPNA 2FVRA 4GKJJ 4M5IA 4AYBC 2VHGA 1KTVA 2H3IA 3AQOA 3H4BA 4I9LA 1DY3A 3T69A 2GC8A 4HKQA 2BGGA 2CADA 3OFFA 2Y3YA 2IVPA 4XH4A 5JUMA 5ALQA 1MC8A 5F8MA 2J4RA 3B8AX 1FXDA 3HL8A 3C2MA 5CD4H 2P9IB 3E01A 4M8LA 1HWUA 2JEGA 2XSJA 3KFWX 4CLZA 4H0OA 1HBMA 4YN3B 3CULA 1VQNS 1NDPA 4UOCA 4CLTA 2RQ5A 1WSHA 4RW9B 1C20A 3MUMP 1CJTB 2HOQA 4LSNB 1K47A 1S5ZA 3OBIA 1O0PA 4ZA1A 3C19A 2NR0A 3CB4A 4J9SA 1HARA 3VQQA 4C9DA 1QJHA 1GMWD 1YIJN 2DVIA 1NU0A 2HQCA 2QMUB 2MZJA 4P2SA 1LW2A 4KHQA 1V4SA 4JN4A 3AJ1A 5KFEA 1EIYB 3HVTB 2LFVA 3TADA 3MWBA 3A5LC 4DL3A 3C2KA 1I94F 5HI7A 2ZOMA 3ITHA 2YB1A 9ICMA 4DUTA 1ZQ1C 3HI0A 2QSWA 1V5IB 3GV8B 2LDYA 5E3RA 3P8BB 2WFBA 5LXYA 4IEIA 1RWUA 1WG8A 4DKWA 1U49A 1HR0K 4Q44A 3CJSA 3MAAA 2B8PA 4B3MF 3ZEUA 2ZBCA 3DLKB 2DHSA 2OFHX 3RJFA 1HJRA 4OHXA 3SQ1A 1H38A 1UWAA 4KI6A 2Z0GA 2IJFA 4WP8A 1XERA 4HT5A 4KLFA 5DK5A 1X3MA 2DXFA 2YMPA 4F3TA 1D9FA 3NF6A 3FCWA 2QSFA 4FVUA 1Q7LB 1Q95G 3BBFA 3ONNA 4DS4A 1KAZA 3HBTA 5F8LA 2UUWA 2ZUGA 1VQ4S 2M7SA 1GO3F 3V9UA 1AW0A 3CJQA 4TY8A 3W61A 1UVJA 1BQNA 3IP4B 4HVZA 5IIKA 2BM0A 1K8KA 1T3OA 1FKOB 5AQZA 2KB2A 1B7YB 2E1PA 2CDQA 4EEYA 2RRNA 3GTYX 3LVVA 1ZTWA 2FMPA 1BPDA 4CJPA 4JK9A 1NMEB 3WXMB 4K0KK 1VIXA 3MCPA 2VQFJ 2CH5A 4JYAF 1FRIA 5MLCQ 1VQMN 5AICA 4W90B 2YWFA 1PAEX 3D28A 2X1AA 1BU6O 1TV6A 3W8GA 2G5IB 3KLIB 4ZVEA 1DRGA 4K4WA 2M9NA 5JMNA 3BN7A 4O3QA 4RQ1A 1TVRB 3UD4P 1ZQUA 4MYTA 1ZBIA 1HEKA 4K59A 2CZVC 5B66U 1K1QA 3KOAA 4HR2A 1ZA2B 3OYCA 4YXMA 2DGWA 2L08A 3FK4A 1XC3A 2YJEA 1WEYA 3TAFA 2WOMB 1LWFB 1FVQA 1QD1A 3AFGA 4Y1DA 1WSJA 4Y1CA 1VRUB 4MFBB 5J1PA 3J7YP 2ZDOA 1F2HA 1SQEA 1S6PA 4IFEA 3IN5A 3PW2A 4I9QA 3KK2A 3C2LA 2WVEA 4NLGA 4K2JA 1TYQA 4CJFA 1IG6A 2KIVA 2WONA 3TQEA 2VJVA 1I5OB 5AQLA 3Q8LA 2NXCA 1KBUA 5A2QO 4TQRA 3CCRN 2DNZA 1WSGA 4DMZA 5GADU 3IRWP 1C0FA 2HGMA 3HM8A 4X62K 3O6WA 1WF0A 4QYRA 1YUWA 3ZI4A 1K0TA 1RLCL 2JH7A 5E79U 2LMRA 1VC6A 3A8EA 3CF5Q 4PG4A 1FWPA 4CDIA 3IFEA 3GYGA 4M63C 3T9ZA 3ZTSA 4WP3A 1NKEA 1QVFM 1RCOB 1WD6A 3V6KA 1IBLF 2VBYA 3UN3A 1XO0A 2B7CB 4BDPA 4USKA 1DFDA 2WVBA 1U7LA 1HNXF 5A0LA 4M47A 2XZTB 2HS3A 1RKJA 2JX2A 3CJ8A 3AO4A 8ICIA 3B82A 1GXLA 1ZOLA 2YWHA 1ZQMA 4W4MA 2A3JA 3LDLA 2YQ0A 4HUGA 2VA3A 1VQON 2DO0A 3BDEA 3CHWA 3QU2A 5A6PA 3E0FA 2JZBA 4X62J 2AMCB 4IUFA 3QYYA 1UVKA 1BVSA 3BZKA 2NRHA 3NH0A 2ZJAA 5F8IA 1MQ2A 3OL7A 2VDHA 4CQ1A 3OS0A 3QNOA 5KG5A 4A61A 1A7GE 3HKZC 3CNQP 2H48B 4XA5A 2VG7B 1U45A 1XNRK 1J54A 3H08A 1JJHA 3ZTOA 3M8QA 3H90A 3D3CJ 2ALZA 2WF5A 2JWNA 2YWWA 2RUSA 1YJUA 4NL9C 2ASYA 3FZKA 4UATA 3CM5A 4DUZJ 3QJLA 3EPIA 4M7XA 3IM9A 4RQ5A 1WHYA 1FTCA 3OLAA 1P27B 3QEAZ 3FFIA 1LB2B 1FKAF 2I6XA 1DAXA 1UW4A 3J81U 4DV4F 8ICAA 2J7UA 3SENA 4OJHA 1H98A 3WXJA 3RJJA 4P2MA 3ZXWA 4D3HA 3SD7A 6AT1B 3ID6A 4M7YA 3AB2B 2XLJA 1KAXA 5KQDA 3RJHA 4J2EA 4LRFA 1BQXA 4DX6A 1RT3B 2BOAA 3WK4A 1HQUB 3IWXA 5HP1A 4ES3A 1IN0A 3TZZA 2R7QA 3VQBA 1RTZA 3AVIA 1REVB 2KM8C 2YWGA 5AKEA 4MIAA 7ICIA 2IOFK 2OCEA 3KLHA 1OO0B 4NLZA 3MECA 2YX7A 4DR2F 1NZAA 1PVRA 3IS9B 2MEWA 3SUOA 3C5FA 4N47A 4NB4A 3EGWB 1S1XA 1WI8A 1NGBA 3MN6A 4AQYK 3KOOA 2WHOA 3TAGA 2O1PA 1VQ8S 3QT5A 2IHR1 2FJVA 2EVZA 3PV8A 2H3QA 4C8KA 4GKKK 4YP3A 4ZVSB 1RXVA 3LK9A 5HRRA 5KT2A 1UVMA 3SPZA 2QT7A 4EELA 2JC0A 4Q0BB 4ECQA 4DPTA 1QVGR 3DXMA 3LYSA 1WLJA 3I8DA 3OXFA 3WC2A 4P4MA 1T03B 1K0VA 1MWZA 3I5BA 3SFGA 5C24B 2DGTA 3A8JA 3QUQA 3KBBA 2FHOB 3C15A 3LOUA 4DG1B 4EP4A 5DLFA 4NV0A 3KTQA 3RUBL 1B7FA 1QTMA 1Y5NB 2OEHA 2OPPA 5L46A 4HWIA 9ICRA 3CJ7A 2VUGA 4DV2J 2MQ8A 1SC6A 4U8YA 2BCUA 2GZOA 4ZVUB 7ICSA 4DV0J 3C46A 2GLEA 3RFAA 3EDRB 3PW7A 3LALA 2GS8A 4MFFA 4KHPJ 4QCLA 2L9WA 4ZIVA 4O55A 5ALMA 1GNKA 1QDUB 2UXDK 5AQSA 5E3QA 2O4IA 2QX0A 4OVLA 1WSIA 5JRTA 4F4XA 4B3RK 4ZVGA 5TZVA 4RBTA 1RTDA 4KKOB 4NLSA 2AYGA 1Y10A 3OYFA 1NDCA 3D0HE 3QLHB 4M1KA 4CLLA 1KLMA 2VYPA 3KVGA 5DM7L 3GBTA 3HZ6A 5CR0A 3UB5A 3E9LA 5D3GA 3A0IX 1M1HA 2ZJPQ 3BGRA 4ZITA 1HWKA 2A1RA 3C5GA 3E1YA 1VJQA 4DL2A 1EKSA 1RDBA 4CHQA 2DR9A 3SAFA 2RHFA 3LGHA 2HF3A 5T7LB 1AROP 1F60B 5AQWA 4Q5VA 4DR5J 4YOXA 1O13A 3O8WA 2YH0A 2F1JA 2UXDJ 1KQQA 5C12A 4N5SA 1HQEB 4A8EA 2CRLA 2M9KA 1JXEA 1OH5A 1C1BA 3NP5A 3UNGC 2E20A 4KLHA 3F2DA 4CJRA 3AA4A 4LF9J 4DL0C 3NH2A 2YKMB 5M1FA 1NH8A 1Q7YO 1RWMB 1ZQPA 3AVFA 3AN1A 2YCHA 4ZVRB 2EC0A 3IM8A 3NE6A 4FZLA 2EAOA 4OYWA 3CYMA 2FSKA 3K59A 3JS6A 4KLOA 3J7A1 1N32F 1ZPWX 4OZ1A 5D6GA 3S6JA 4RUAA 4H0PA 4WFXA 2E2NA 1KSPA 4FJ8A 3KJFB 1KTQA 1G6BA 1WDDA 4CJUA 4KSEB 3SDEB 3WIUA 2ACYA 4AILC 5GVQA 3DXBA 3D54A 2A6OA 1ZBHA 4EEKA 2O8DB 2OELA 4DR6K 1YBAA 2VU5A 3D6HB 5AI4A 2XRIA 5ALLA 4CZIA 2V2VA 2BUPA 3BSCA 4EWTA 4UB6U 4AXJA 2ZGYA 5ALUA 2HHHF 4KGKA 3C6UA 3OYJA 4EK2A 2GA7A 4FLWA 1OUQA 4L74A 3D2WA 1RPLA 5CWRA 3C7NB 5EE0A 3M1VA 2D8CA 3VGMA 5AT1B 3VWSA 4KN7A 1YK9A 1HPZA 1R8PA 3DI6A 5IV4A 5EX5A 3I1YA 5CB1A 4JKAA 3D2QA 4ZS6A 2QLJB 2RRBA 3PRVA 2DGUA 3DYAB 3KWGA 3GP9A 2DH9A 2CAJA 2OI2A 4BQLA 1J97A 4JI2F 3DMJA 2C2OB 5AKYA 1EJ7L 2FVCA 4UY8O 4HTUA 3MR7A 3GWCA 4HACB 4WFZA 3CM6A 5AZIB 2YKNB 3VQCA 4RQ3A 3BKTA 2E7XA 5HK4A 1Q0NA 3EVWA 3H25A 4DMNA 1CJKA 2Y1JA 1F3VA 4OKKA 2ZUAA 4QIVA 1WORA 3RBEA 4IQXA 3G96A 1XEZA 4K8RA 5D15A 5AM5A 1RBLA 2V2ZA 1W26A 2O8BB 4PPXA 1LW0A 1CJVA 4F4YA 2EI5A 2QL5B 1DZ5A 1GEHA 2EWHA 4HUFA 2ALYB 5J0OA 1XR5A 4OI3A 4IQUA 4FPAA 1EP4A 4H4KA 4CO2A 7ICKA 2HMXA 4E7KA 5CXTA 4CT9A 3THPA 1YAGA 1FIQA 1NM2A 5LMUF 3V81A 2VC1A 4ZVHA 3T19A 3C29A 1RYUA 3CJ9A 5JLHA 5K8PA 3Q8MA 1HUXA 3M1FA 1LKYB 5KNIA 2LKZA 2XBPA 5M1OA 4HAIA 4RPYA 1XS9D 8ICQA 2BACA 2ISPA 3QSIA 2ZIUB 4F72A 3OL8A 3RR8A 3VQ7A 1G3OA 2OSQA 4BG9A 2HS0A 1Q82T 1U1OA 5J1EA 3I55N 4FOIA 3TAQA 2DNMA 4Z4IA 3CJ0A 2LEAA 3CCQN 2P9PB 2V4RA 1UWBA 5CYMB 4FLZA 1C7YA 2DIUA 3HOTA 1AA1B 3B54A 3CCRS 3DEEA 4O3RA 3QDKA 5KFHA 4QYZK 3N4QA 2FJWA 4ZJLA 3SIPB 4A46A 2EG1A 3IR7B 2CXEA 2FPLA 5L1JA 4AYBD 5KFPA 3F9KA 4RNFA 5HN0A 1NZ8A 1V3RA 4J9NA 2PMWA 3HMJG 4DUYF 3RB4A 8ICSA 4CZMA 1TFRA 2DCLA 5EDWA 1RHQB 1RCXB 3IM1A 4DL4A 5I3UB 1EZZB 2VB6A 5GINA 2LCWA 4OZNA 4NCBA 4U67L 3WQPA 3T1HJ 1HWJA 5ALNA 1NK0A 4BRQA 2Y9TA 3NAIA 2C1EB 2DEJA 2QLWA 3FR0A 1N61A 4LZDA 2M3DA 3HTVA 5FJ4A 4KR0B 1XMQJ 3TR5A 4FWPA 3EE9A 3GJTB 3LPYA 5AQTA 5C25A 1VBYA 4LF4J 3M2UA 4EX6A 5A2QY 3D45A 3OSNA 9ICUA 5J2PB 1XBWA 1Y3KA 3BR8A 2H4YB 3M8ZA 4OGCA 2AWZA 5KOXA 3BF1A 3CJKB 3PIPL 2XSFA 4F5PA 5AXNA 2XY5A 4CI0B 2XO6A 4A57A 2UXBF 4M3YA 4FK4A 5GADP 4OX9K 3QFWA 4P71A 1SKRA 5C7PA 1YI2N 4JLHA 2NQPA 5KT3A 1K1SA 3VF0B 4Y2YA 1IKVB 2K1RA 2E8OA 4L3QA 2ES6A 4B9NA 3JSMA 2B4PA 4BC9A 1WBDA 2IRXA 2GJ2A 2WCXA 1SH0A 2E5JA 2Z2YB 2KZMA 4KH0B 3B4MA 5B0FA 2G07A 3M8PB 1XMOK 2E8MA 2RHSB 3SMPA 2P6SA 5ETKA 3VQDA 3D0IE 5IM0A 3H8SA 1VYAA 4MK8A 2VCPA 1JLQB 4I2QA 3KD5E 1JLFB 3QSYB 3R7NB 3FE1A 3QU9A 3V7KA 1F0MA 1WWVA 2E3TA 3QU7A 1WKLA 1YHQS 4M9JA 2MHNA 1YVUA 4K4ZA 4P2HA 4OX9J 3VTHA 4M9GA 1KQFB 1KEJA 2G1DA 5J0SA 1VQLN 4ED2A 5EWEA 3I96A 1K44A 3V9SA 1UA0A 3I0RA 4K8XA 2F9DA 1CS4A 1HNIB 2D9PA 1DTTB 1PILA 3SV3A 1UFLA 3LPTA 2P2CB 2XM3A 1HHSA 1FD8A 4QAGA 4I2FA 2GBZA 2RSQA 1XMOJ 3W5YA 4UB1A 5HBMB 3LP1A 2XC9A 1ILYA 1AQ6A 2YX4A 3KZBA 3CW2C 4DV1F 2QI2A 3L6QA 2LECA 4WFNL 3LDSA 3VESA 2L9NA 1U6BA 1Q7YT 3HX9A 1MMNA 2QFJA 2NUUG 4FO0A 1NNDA 2KI2A 2COLA 2B5JA 3NBPB 3O44A 1GX5A 4PZNA 1LOTB 3UPFA 3ZDCA 3NGDA 4I1TA 1SQFA 1RUSA 1NZPA 1CSJA 2HIQA 3TUPA 3W0LA 4EZ9A 9ICGA 4OCZA 3GCXP 1TP7A 3UXOA 1DURA 3WT0A 5DDOC 4P52A 1RT7B 4LF7F 3PJWA 3VEZA 5EHHA 3DGVA 3VQPA 4NO7A 5AQMA 1QAXA 1APSA 2QL9B 3V72A 2BVZA 4PUOA 3MOZA 4K25A 3FBCA 3BO3A 5CHCB 2M0NA 2ZIWB 3GMGA 2GX8A 1YDLA 4E3SA 3VAGA 2LHTA 2KT5A 1S3XA 3CERA 2P6UA 4Z4GA 3FFKB 4M6WB 2D74B 3D4JA 3OD2A 3UDVA 1ESVA 1ZD3A 4DV3K 1FNMA 1J5EK 4QNLA 4XAKA 4PQAA 2HMIA 3OTCA 3HSZA 2EFVA 3JTPA 1C0UA 2BRLA 2W4PA 3UI3A 1HBUA 1CC8A 3MM9A 3NWRA 5BXIA 2UZAA 1HBOA 5ETOA 1WSVA 2F8TA 1UPHA 4I2HA 2QC3A 2QXLA 2W01A 2D0CA 2KHDA 1NI3A 1A0OB 1MSWD 1S9EA 1N0UA 2GIQA 4CLYA 4X4VA 1B70B 3WKCA 4K7QA 2ZIXA 4OKJA 1S59A 2Z1IA 3DN9A 3DOKA 2J5AA 4LFAJ 1A0PA 4JI1F 1BUPA 2RF2A 4EGLA 2KHOA 2UUBK 4FWNA 1WTFA 3QPIA 5ADXH 4KN4A 3HKZD 1NLVA 1FDAA 3MEEA 2KSOA 2GWJA 3TSQA 2W04A 1RACB 9ICAA 5D0HA 3SJHA 4ANEA 1XUPO 2AHOB 4LF8K 4ER8A 3AA2A 3ENOA 3EMTA 3G4SS 2QLFB 3F41A 1TKDA 3LANA 5AE1A 3W2WA 3K9KA 4H4OB 5D4OA 5ETNA 2H3EB 4FLTA 1SJ1A 5JS1A 2XYHB 5F8GA 2LYBA 2HGNA 5HR6A 2DRDA 1ZQTA 3QINA 1CULB 4OYPA 4H5RA 5SWMA 3NH1A 4AHVA 5ADZA 3OGUA 2C3YA 4JK1A 1RWXB 2OMLA 4US8A 3TSPA 1UMJA 4CYUB 2FHKA 4H4MB 4LF8J 2XNQA 4QIEA 1URNA 2B0CA 2HAIA 2Q36A 1RZTA 2WF8A 4KIAA 3CCUN 1SV5B 1X7VA 3WQTA 4AHUA 1RDRA 3I9ZA 4OJ6A 3ELHA 4MEYA 1HKBA 5EXWA 4JAXA 3IWNC 5HMYA 3JPOA 4DFDA 4F2RA 2HGLA 2KO1A 4AM7A 2HPUA 5EOYA 4O8UA 1DLOB 3TTFA 3LL3A 1NMDA 2MUTB 4QZAA 4DV6F 4C3MA 4UT4A 4HH0A 1Q5VA 3BV8A 4DHYA 3DOMA 4QWDA 5C5JA 1QAYA 3WKDA 4OPAA 3OTOK 4RW4B 3CIZA 4B3SK 4M5GA 3SR6A 3IWLA 2AGOA 2GIRA 2AH5A 2J0XA 3Q0AA 4UUXA 2KQ2A 2QWPA 4TY8B 2V63A 4NXMF 2P9CA 3SXLA 4PKIA 1Q79A 3D5MA 3B8HA 2GHVC 2YPYA 4Z6FA 1F9HA 2MGZA 4UBBA 2OEJA 4DI6A 1A76A 1U4BA 1J2VA 1YXQA 3KNAA 4J37A 1FRHA 3KJNB 2CQ4A 4LFBJ 5BYRA 2FBYA 3VQ6A 1JXLA 5AJ3K 3H8MA 1S6QB 1FK9A 3MI7X 2VG6A 4BRMA 1B0TA 3LP3A 4C8OA 4F0HA 3AOBA 1T4GA 1UL3A 4C4RA 9ICFA 4I0WA 1IJEB 3KK7A 1RYRA 4DO9A 1U1QA 4H0YB 4GC7A 1C0TA 2A41A 1RTIA 9ICOA 5AK4A 5GMEA 3VHQA 4Y00A 7ICFA 4QOTA 5I3QA 3ATVA 4WKYA 2LSNA 4PL7A 3PSIA 2CGJA 1ATSA 2PFQA 2Q66A 3S3NA 5K8NA 4WK1A 3TARA 3NS1A 2LQBA 3GYNA 2VONA 2MDAA 1HHQA 4J9UE 2J7KA 4LFCF 4HH1A 4XPEA 3CI5A 2IBKA 5CR4A 2HOFA 3LPEA 1RTHB 4JV0A 1XC9A 1S1UA 5AJ3J 1Y9OA 4MJKA 4MDAA 3CPWR 4ATNA 1JL1A 2J76E 5JMVA 4DR1K 3QUTA 2MKIA 3KKAA 2WVCA 4NLOA 3VQ8A 1SZPA 4JK8A 4CERA 4NYZA 3NAEA 8ICNA 1ELOA 2FE9A 1L3SA 1JWWA 3QMLA 5DM6L 3OUYB 5J0TA 1GXTA 4DTRA 5KFSA 4C8LA 1ZM2A 3VERA 4NLUA 1VLBA 3IRXB 1ZQGA 5K5MA 2ZWOA 3O3GA 3IO1A 1KWMA 2IA6A 5T7BA 2K8GA 3E66A 4XTTA 1HI8A 2ASLA 4MH8A 3PO4A 3WC0A 1IVZA 2UVWA 4I68A 2W24A 4YD2A 3M9MB 5I42B 2RP5A 3M6WA 2VKRA 1P1TA 3OPXA 5KFNA 4YQWA 2ZDPA 4K50A 2YX1A 4KLMA 1NSQA 2CVEA 5C2GA 2UUAJ 3SYZA 1VISA 3Q86A 5D0EA 2J0QD 4IL6U 4UB3A 4XUSA 1DBDA 1MG7A 4W92B 3CG7A 5TISU 2GELA 4ZP9A 4FF4A 4CHPA 4IS7A 1RAEB 4NM2A 2QZ8A 3AVHA 3AVKA 1VQPN 3SK3A 3QAUA 1YJWS 4AFFA 2C2KB 4OHZA 3OA9A 1KBRA 4LF5F 3GOIA 1D5AA 3KK3A 3DGPB 3WIVA 2E1CA 4O4GA 3IKMA 3BM7A 1YI2S 5H9FK 5IFMA 4I56A 1N62A 3OR1A 4OYMA 2OPSB 3RW6A 4GIBA 4O0JA 1JNZB 3A5MC 1JCEA 2IC3B 3POTB 4MK9A 3LAMA 4KB7A 2E5LF 4YDDB 1FFWB 4PG8A 5ETTA 1DGSA 3DRRB 2MSSA 2WBNA 2E1RA 5F3XB 3G71N 2CPIA 1KR4A 3TTDA 4ZCLA 3ENHA 2FBVA 4B1VA 3HCXA 2RU9A 4YS2A 3CCVS 2VFTA 2DGXA 3MUVP 3ILIA 4EMDA 2RS2A 1LXJA 4WFBL 1MMDA 2FVPA 1TKXA 1JJCB 2MJUA 4Y2VA 3NCPA 1N6QA 4DR4K 1NGJA 1ZBFA 3CCTA 1YZ6A 5KQ8A 3W63A 2HRTA 1URRA 2KYXA 3OYHA 5HP1B 3KMQA 5LMNK 1LFPA 4DFJA 2IVOA 1QS4A 4BRLA 2DXDA 2R4FA 4GY2B 2WBMA 2OPRA 3LGNA 2Q97A 2KOBA 3KLHB 4CEDA 1R8AA 2UXCF 2XMUA 3QT6A 2M2BA 3FYHA 2NSBA 2QFIA 3DRSA 4O5BA 4UB4A 1BPYA 2KXHA 2PFOA 2ZUDA 1OSCA 5H9EJ 4GKJF 2GTDA 4Z6DA 2V2KA 1WG1A 3ENAA 4YMOA 5M2UA 3ZSOA 3DLLQ 4IWVA 3NASA 3ALYA 4DFMA 4G3IA 3M8SA 1RE1B 2BE9B 3HHLB 2X6NA 4B1XB 4CF0A 1J53A 1RT2B 4XRHA 3JQJA 3UNYA 4OPHA 3PM9A 4DU8A 3OYEA 5M2RA 5L8RC 3NVKA 1UQVA 3DXKA 1CLQA 3JPQA 3UM9A 2X3DA 2K3KA 1EETA 1UCNA 2X7IA 3HD2A 3KXDA 3ULDA 4MLHA 3UKRA 5CA5A 1FW6A 5CHGA 3C15B 2W9CB 2KFZA 2CNKB 3UO0A 1OY9A 4QWCA 1CG2A 1S72S 3ZYYX 2R7UA 4RPFA 1YWXA 3O9UA 1NMNA 2VIXA 1ZQKA 3CO9A 3QEIA 1UETA 3R5DA 1FXLA 4HI2A 3OXLA 5HO4A 4JI3K 3QYPA 3DRPB 2QA4G 4FJXA 1YBTA 3MGJA 2MU2A 2E4LA 8AT1B 5BRHA 1K5OA 4F9OA 3DLLL 2NS1B 2QB0B 1VSMA 3EWAA 2V50A 2IVYA 2YKAA 3WXLA 2CQDA 3PMLA 3BZCA 2HLTA 2MY7A 2VD3A 4E7JA 2KIWA 1NUEA 2J8SA 5KFBA 2NRRA 1W7AA 4CJLA 2KEYA 3NG8A 4H0VB 4JI5K 2HZCA 3QEPA 4RT2A 5DBCA 4JV2A 4BUGA 4DTOA 2G0JA 2AW0A 3KJVB 1TKZB 4JD2B 3Q7BA 1NK7A 4ED1A 3BZQA 3QRQA 4PPDA 2YNFA 5HAOA 3RAMA 3TAMB 3K5MA 9ICEA 5HANA 4N76A 2VODA 5SUHA 1HUOA 5AXKA 2MJNA 1C1AA 4CJ3A 5CY4A 3QU4A 5BR8J 4BROA 3AJDA 2OZSA 1VSIA 2KKHA 1X6IA 2E44A 3GG0A 4QZ8A 1COKA 1XO1A 1R31A 1Y00A 2PFDA 4NI2B 3IAYA 3K5OA 1X60A 4YY3K 1EKEA 4CNZA 3M6GA 4DSEA 5AI9A 4E1MA 1KCFA 2U2FA 2PI4A 3HHDA 2ZTEA 5J2HA 1J2MA 2IM3A 3GV7B 5K20B 2W40A 2VQFF 4DOAA 3PSFA 2ZF5O 5JVGQ 2ZH7A 4U7UD 3RRHA 5AQJA 4G65A 4WQ5C 4DB3A 2MKCA 2JLEA 2OD6A 3MPVA 4DTMA 4JI6K 5CJ7A 5ETRA 2RS8A 1X4BA 2W6KA 4Z4HA 3DKDA 3FZMA 3HHLC 2HHXA 3CJCA 3CFPA 2W41A 5EU7A 4ECYA 2V67A 4X4TA 2JL9A 1PK3A 1WC1A 4CVNE 4B1ZA 1UA1A 5GAHU 4WF9L 5A8RB 3Q8KA 3FCVA 1VK0A 3PKMA 1VI7A 4JKFA 3BBBA 1ITGA 4FJGA 1X9WA 1HWLA 4OYXA 3LP0B 1UTAA 2IA0A 3C16A 3KYLA 4BJQA 2LM4A 1IBKJ 4AM6A 1KW4A 2XHBA 5U47A 2ROEA 3C6UB 3BS5B 4ZPBA 1C2PA 4WQ4C 2OHFA 1KN5A 4ZPVR 2DH7A 2NRVA 4C0HA 2HBQB 3ID8A 5DB7A 7ICNA 2ZQBA 2RU3A 2IVMA 2M52A 1A9NB 7ICVA 1JJ4A 5JVGL 4NZ6A 1RG6A 2ILYA 1BDGA 4G9ZA 1Q8IA 1HPMA 1K6YA 2PO4A 2PA8D 3CGIA 5HOOA 2DHAA 3DXSX 5ETMA 4CLFA 3FZFA 5ITHA 1RQLA 5IWAK 2HHSA 1O08A 4WCEL 8ICUA 3ISBA 5EVZA 3TANA 3WNEA 3IV6A 5KFUA 3GFYA 2KVSA 3CD7A 2KNJA 4J91A 3O80A 3FC9A 3OQ2A 3H1QA 1SGGA 3PVXA 1IBMJ 1TMJA 1T9XA 3OVNA 3M1YA 9ICTA 2FC0A 4HDHA 1H6KX 1P8ZA 3FAHA 3RMDA 2GO8A 1DK3A 5G0RA 1SZHA 1N63A 4KPCA 3AAWB 4RLEA 4RW8A 1RB0A 2W7OA 2YBVA 4X65J 4M3TA 1OPZA 5DRKA 4MF8A 1KS2A 2GW8A 4L75A 4CFAA 4KLDA 4E7IA 4IQMA 1EP4B 4NCGB 5E84A 1URJA 1WC5A 1NGIA 5B5EU 4ALZA 4WZMA 4X62F 2YNGB 4JS4A 2MB0B 7ICEA 4FVMA 2BE7D 3IRUA 3MMVA 1QQ7A 1RGIA 2EDUA 3VQ4A 9ICQA 3V4IA 4CJKA 1R8BA 2BQUA 2HVHA 2H51B 2VA8A 3ZX3A 3WKBA 2ZHBA 5J2GA 4BRCA 1RWWB 5J1NA 1RABB 3IBPA 2RAQA 1P8GA 3TKAA 9ATCB 3UPQA 4GVBB 5C10A 1ATNA 3QIDA 3MN7A 4TYBA 4YDXA 5HMMA 2F65A 1RAHB 3IR5B