2HVIA

Ddctp:g pair in the polymerase active site (0 position)
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'
total genus 210
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hviA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hviA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hviA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hviA01
3NTUA 1VSDA 2VG7A 4N76A 1SKWA 1WSEA 5I3UA 3HXMA 4GC6A 2YNHA 1JKHA 2Z1GA 1RDBA 5HROA 4KLDA 4M3XA 1LAVA 1ZJMA 3AVNA 3SQ1A 1RDCA 1KVCA 1N56A 4O9MA 1XU4A 3KIOA 3L2QA 3OHAA 1B43A 4AH9A 5DQIA 4TURA 9ICXA 1SKRA 2UVUA 4CEEA 4I2CA 2F1IA 1QSYA 3VQ4A 3DOKA 3UIQA 2XRIA 5KFLA 1FXXA 2YNGA 4IFYA 5J1EA 1S5JA 4YMNA 2PI4A 2R8GA 1KDHA 5KFNA 4YD1A 1ZQXA 4LVSA 2R8IA 4BDZA 3ZD9A 3T5JA 4R64A 4HCCA 1A5WA 3TI0A 4CEDA 4DFPA 4O4GA 4E0DA 4R66A 4B3OA 4E19A 1CLQA 3KHHA 1TVRA 3C94A 3AV9A 2LSNA 4GMJB 4LZGA 5DB7A 2ITGA 3L3UA 4FBUA 4CJ3A 5KFRA 3HPGA 8ICUA 1SZPA 2J6UA 1T03A 5HLFA 8ICLA 4ICLA 2BDPA 3CQ8A 5KI6A 5D3GA 9ICSA 4ECUA 4IG3A 4HUFA 4CHOA 4RPYA 1JLFA 4M3RA 1H38A 3DM2A 3MDCA 4UAYA 4ED3A 1B22A 3G6YA 4AHVA 3OYHA 4RQ8A 1B9FA 4EP4A 3NCIA 3V72A 1TFRA 3V7LA 3AU6A 4RNOA 1SKSA 2R8JA 2FC0A 4Z6EA 3RB6A 3CFPA 1W0HA 1JX4A 2YKNA 4DQSA 4O44A 5CY4A 2Y1IA 5DMRA 3GV5B 1TAUA 5CHGA 3OYEA 3QEXA 3T19A 4Z6CA 1JLAA 4P4OA 2V9WA 2FLPA 4PGYA 4L8RB 1Z3EB 4PHAA 5CR0A 5KT3A 4FLXA 1HYVA 4IG0A 4DL6A 3OJUA 3N4MB 3RJFA 2BQUA 3RJGA 4C8KA 5SWMA 3OYLA 4TUQA 1S77D 3VQ9A 2BR0A 3SPYA 4J9MA 4RW4A 3MGHA 3T5LA 4EZ6A 2A1JA 3PR5B 4O5BA 5J2NA 3EYZA 4XRHA 4M9NA 3MFIA 2G8WA 3PNCA 3V9ZA 3KJVA 1QE1A 5HHIA 4IRKA 4F91B 4DL5A 1VSJA 4KHYA 4IQTA 3AUOA 5TZVA 3T5KA 4RT3A 4J9QA 3UPQA 1RILA 4JRPA 5D46A 1G15A 2FBXA 4CHPA 4E7LA 1LW0A 1KVAA 3HL8A 7ICIA 4KLHA 5KFUA 4E7JA 4M3YA 4Y1CA 2B5JA 2HVHA 1TGOA 3P83D 2RDIA 1DTQA 4M6WB 1QS4A 4KPYA 4M04A 2P51A 3PX4A 3HM9A 4I2PA 4O3SA 5KRSA 3QZ8A 4FJJA 1ZQSA 1XSLA 4B9UA 2ZUBA 3ZCMA 3OYJA 2C2EA 2JZBA 2I5JA 5KT5A 4QZHA 2P1JA 4RPZA 1XHZA 4OJRA 4PUOA 5L1KA 3M9OB 3RMAA 3GV8B 1T8EA 1BIUA 3SPZA 2HNDA 5FRMA 1SUQA 3QNOA 4RQ2A 4FO6A 3IAYA 4KTQA 3ASMA 4PHPA 3VQ8A 2VANA 1T05A 1HYZA 3EPGA 4IQWA 3PX6A 3AVCA 4ZHRA 1D8LA 3SZ2A 4CJPA 4LD0A 2OZMA 3VQDA 1LWFA 4NLNA 1YTAA 3LPUA 4Q44A 4J9KA 5DG9A 2ISOA 3ALYA 1YTUA 3OS1A 3BQ0A 1DGSA 7ICPA 4KHWA 2BQRA 4K4IA 3HO1A 4FJMA 1NKCA 4JUZA 4QZGA 4CJKA 4W5OA 4FW1A 4CIEA 3O3HA 3NF6A 3IM1A 1CEZA 2HNYA 3B6PA 4DTSA 4DTJA 4YR0A 2PFNA 3SUOA 2BQ3A 4R5PA 4RZRA 2ZJ5A 1S1WA 1QQCA 1BPYA 4FLUA 8ICKA 3C2KA 2O4GA 3B0XA 4B08A 1S9FA 4MFCA 1NOYA 5DDMA 3DLBA 3K59A 3ISDA 4KITB 5KFCA 2ISPA 3ZSRA 3UXNA 1UT8A 2A1SA 1F21A 3SUQA 4F8RA 1RYRA 3HX0A 4ECYA 4FM2A 2WTFA 2AJQA 2FBVA 3RAXA 1U49A 1B9DA 3IRXA 2HHWA 2PY5A 1JMSA 4Z4GA 4O0IA 3RJEA 3Q8PB 1NKBA 7ICHA 4ECZA 1ZBIA 5IILA 3RB4A 2DPJA 3H40A 2PYLA 4YNQA 2C2DA 5HBMA 4M41A 5DG8A 2KW4A 2ASDA 2XY5A 3JPPA 4KN4A 3C6UA 4YXMA 1TL3A 5C24A 4F4YA 3V7KA 3EY1A 4F2RA 3MR6A 2XGPA 4ED1A 2HB5A 3V9UA 2ZUCA 4WE1A 3TFRA 4NCBA 4DTPA 1S1TA 4K8ZA 4DTXA 4KI4A 1LB2B 4UB2A 1XS9D 1VSIA 5HRSA 4RQ0A 5IIIA 5T7BA 3E2EA 5IIMA 1UA0A 5BOLA 5KFSA 1EX4A 4UB5A 4KLLA 4HCBA 2NRVA 4PHDA 3BQ2A 1KFSA 4QZBA 7ICOA 8ICVA 2AU0A 4C8LA 4Z4IA 5DB8A 4M2YA 2UVWA 3QZ7A 1BPZA 4FLVA 3RTVA 2R8HA 4OKEA 3RWUA 1U04A 1HNIA 1BI4B 3NH0A 4NYNA 1LWEA 3V6KA 4FK2A 1K1SA 1BPBA 3EPIA 3QEWA 4Q0BA 5KFBA 9ICUA 2IS3A 4E7KA 5SZTA 3AA4A 3VQCA 1S0MA 1VSKA 3M9NB 4QZAA 1BQMA 3TAPA 4DS4A 4UB1A 4MEXA 2W9AA 3DYAA 2C2RA 1ZQTA 4YVZA 1TV9A 4P2HA 4DFMA 4YMMA 1NJXA 5EOZA 3FYHA 5L1IA 9ICEA 2KQ2A 5KGWA 1ZJNA 3GDXA 4FXDA 3BGRA 1ZQFA 2XHBA 3C1ZA 4CEBA 4ID1A 4CEOA 4QAGA 1FKOA 3HVTA 3M8QA 5J2EA 4B9SA 2HHSA 2E4LA 2ZE2A 2BCQA 4IKFA 4IDKA 1RDDA 1BISA 4CCHA 2BPFA 4N47A 4OPKA 3NH1A 2BPGA 4RW8A 7ICUA 3U3YA 2YHAA 8ICSA 2OWOA 3LP1A 1ZQYA 3L8BA 2C28A 3Q8SB 1RTIA 4C8MA 5DLFA 1RBRA 1QLNA 8ICGA 4FZYA 2RKIA 4DTUA 2YNIA 1U48A 4FVMA 4I29A 3CM6A 2G8VA 4DOBA 4CJRA 5DBBA 3VQ5A 2VG5A 3IS9A 4FYDA 3U6FA 3PR4A 2PFOA 3QNNA 4PH5A 4DF4A 4ELUA 4ECQA 1L5UA 3T1AA 8ICMA 3AVMA 3H4DA 4CFBA 1RTDA 3PW4A 2PI5A 3U3GA 1ASUA 2W9MA 4OGCA 2IOCA 3GQCA 4M3TA 2FMSA 2BGGA 4F3OA 4FS1A 4Z4HA 4BE0A 3HP6A 4CJLA 3MXIA 3NHGA 1ZQLA 3HK2A 3VN5A 5JS2A 4PGQA 3CG7A 7ICEA 1X1PA 1U4BA 2HHVA 4OKKA 3L3VA 4KREA 2ZQBA 5D49A 1C1AA 4RNMA 4KLJA 3MEGA 5C5JA 2PFPA 4Q5VA 3I8DA 2R7YA 2KZ3A 2OYQA 3KHLA 4CEZA 3TAEA 2FBYA 4ED8A 4DTMA 3HJFA 3LPTA 4W5QA 1N6QA 5CP2A 3AVFA 4IRCA 7ICFA 3V6DA 3PY8A 1ITGA 4M9JA 2G8IA 3RMBA 5J2KA 4KHQA 1J5OA 3I0RA 3LAKA 1NJZA 4Z4FA 1Z00B 9ICPA 3VQAA 4DL4A 4J2AA 2KFNA 4Q43A 1VSLA 4CK2A 1T3NA 4K8XA 5L1JA 5J2PA 2QKBA 2BHNA 5J0PA 3LAMA 1TKTA 4G1QA 2W9BA 4FK0A 4ECVA 2B6AA 5IIKA 2OPPA 3QESA 2I1QA 5KG1A 3M8RA 7ICNA 4YG2A 3CYMA 5CB1A 3C6TA 3EWAA 4DWIA 4F2SA 2D5RA 3KLFA 3SQ2A 1I3AA 1XC9A 2MUTA 1RPLA 3BJYA 1IH7A 5DBCA 5EU7A 3I0SA 3RJKA 2Z1HA 4TUPA 1BGXT 4KHUA 1KCFA 4O5CA 3O3FA 3GIMA 4JV0A 4NYFA 3P5JA 3MECA 3NBPA 4JWMA 4M6WA 1V9PA 4DSLA 3AVBA 4AILC 1XWLA 2H5XA 5J2IA 2BANA 3ZDCA 2JEGA 3HPOA 2J6SA 1ZETA 4ED0A 1NK9A 3TABA 3FFIA 2IA6A 2F96A 1NKEA 1IKYA 1CUKA 4F93B 1RT6A 4YQWA 9ICFA 1QSLA 2VA3A 8ICIA 5EWGA 3OYCA 4UB4A 4F92B 4DSKA 4FJHA 1KRPA 3TWHA 5KFDA 2NUBA 4FJ5A 3WNHA 3DRPA 1DTTA 3O4NA 2EX3A 3KD5E 2VA8A 2B21A 3SUPA 3ZSZA 4CJEA 2D0AA 4KLIA 4UQGA 1VSHA 9ICJA 2OPQA 5KG2A 3GIJA 3C5FA 4DTNA 1ASWA 3LP2A 3ZT0A 4I7FA 4CJVA 1RT7A 4CESA 2G8HA 3MEDA 2KN7A 3MXJA 1FK9A 2X6SA 4CK3A 5KFPA 3RRGA 4QWEA 4CECA 5L9XA 7ICVA 4YFUA 3G10A 3UQ2A 4I2BA 4I2QA 4C8OA 1UWBA 2P5OA 3LANA 3SQ4A 2F1JA 1ZQOA 1BCMA 4NLZA 4N56A 2BCRA 1HPZA 5IIJA 3OYGA 1CXUA 3AO5A 3O3GA 1BI4A 4ECSA 3QIPA 5J2QA 3RH5A 4CHNA 1RBUA 4DL2A 4DMNA 3QETA 4DU1A 3KK1A 3AVLA 5FROA 2PYJA 4EP5A 1RT5A 3WNFA 5KFYA 4CF9A 4R65A 5J2HA 2BKEA 1RXWA 4FZZA 3NDKA 3LWMA 2BE2A 1EKEA 4QCLA 4M47A 9ICQA 3RR8A 3KLEA 4RQ7A 4IRDA 3OYIA 4RNNA 3UQ0A 4EBEA 1IM4A 3PX0A 4KHNA 2HMIA 4Z4EA 3JPNA 5JS1A 1YVUA 1GOAA 3DLHA 4KLOA 3C2LA 5KG4A 4B8AB 4B9NA 4KLUA 4CK1A 1LAWA 3PO4A 2HW3A 4I28A 3ZSQA 3VQBA 4E7HA 5DB6A 2JLEA 3AVHA 2DFLA 3L2WA 1RCHA 4YR3A 1S0NA 1Z25A 3ZSXA 2UVRA 4JS5A 1WAFA 3H7IA 4M3ZA 3RB0A 2FPMA 5J2MA 2IDOA 2AGPA 4DSEA 3LK9A 3QEIA 4F5QA 3LDAA 4F4XA 3NGDA 2IBKA 4RW9A 5KFIA 2R8KA 1ZQAA 4OLAA 3V9SA 4BGDA 8ICWA 4OGEA 3PW5A 4H4MA 1JLQA 1WSFA 3P1GA 2Q3SA 5HP1A 4RPXA 3ZSYA 3PUFA 1ZQCA 4BDPA 4P4PA 4DLEA 4LSNA 4M0AA 1S0OA 4YCXA 4NCAA 4JRQA 4NY8A 1KLMA 4BACA 3TAMA 3H08A 3H4BA 4O3OA 3HT3A 3SQ0A 1S1XA 3V7JA 4FJLA 3PMNA 1HRHA 3KK3A 2IMWP 4CF0A 1TK8A 3RBDA 3C5GA 5HRPA 1MQ2A 4I2JA 9ICKA 4LZDA 1D9FA 4YXJA 1C6VA 1BVSA 4O3QA 4F4KA 4J9PA 3K58A 4CJQA 1MU2A 1TL1A 5KG3A 9ICRA 2NRTA 4FZXC 1U47A 3PO5A 5KFXA 3PMLA 3QEVA 5J0TA 3K75D 3VQPA 1ZQRA 4IBNA 4CGJA 3MR3A 4QWAA 4DOCA 1PZNA 4QZFA 4PGXA 1KVBA 2RDJA 3OYBA 5CYMA 4FS2A 1U9LA 1HMVA 9ICVA 3ETLA 4IQVA 5KRTA 3M8SA 1U45A 3SYZA 3RRHA 1ZQQA 2ZTDA 1JLBA 1ZQVA 5DLGA 1RYSA 5HNKA 3KD1E 3M9MB 3TAFA 3H8JA 4CHQA 1NK7A 5IINA 3V6HA 5J2GA 1ZQIA 4PQUA 4XUSA 2QK9A 1X9MA 4KB1A 5KG5A 3AO4A 4BE1A 4H8KA 2DPIA 2WONA 3NE6A 1ZQMA 1ZQUA 4KKOA 1BL3A 1Z26A 1GOCA 3AVKA 4Q45A 2GWSA 4GLXA 2DFHA 4Y1DA 4CGDA 2HHXA 1LWCA 2Z1JA 2V4RA 2FLLA 1RTHA 2W8LA 4IR9A 3C1YA 4NCGA 4Z0UA 2Z1IA 5HRNA 2EHGA 3S9HA 1JXBA 3OYNA 1GOBA 4CJ5A 4DF8A 3HW8A 1Q9YA 3KKSA 5F9NA 5DG7A 3B6OA 1ZQBA 3V1QA 2F8SA 4QWCA 5KFAA 4XQ8A 3PW0A 4QZ8A 2OZSA 1T7PA 3V81A 4QOZB 4MF2A 2ATQA 3LALA 3VQEA 4KLGA 5J0QA 4GVMA 4KTWA 4JK1A 2OPSA 2NRWA 4QZIA 4RUAA 1VSFA 1X2IA 3QO9A 1KTQA 3HPHA 4KAZA 4FBTA 4E1NA 3LP0A 3K57A 4FJKA 1A76A 3OYKA 1ZQZA 2BCSA 1L3UA 5KFKA 1BCOA 2QKKA 1XSPA 5DQGA 3QIOA 1JLEA 9ICOA 1C0UA 1ZQGA 4MFBA 3S3OA 3NAEA 2BCVA 1Y97A 4I2DA 3ZSVA 2D0CA 4EZ9A 3ZDBA 3OYDA 1JN3A 4MFFA 4FJ8A 4CHYA 3F73A 1VSMA 2VG6A 3NF7A 3Q8MA 1S10A 4NLGA 4KV8A 4I2FA 2I9GA 2ETJA 3LZIA 4ED2A 4BXOB 4BWMA 4Q8FA 1WSJA 3IG1A 2OA8A 4GXIA 1J53A 4M3WA 4F5OA 4XIUA 2P6UA 1VRTA 5FDLA 3GFKB 1Q8IA 5KFZA 2HNZA 3PVXA 8ICHA 3ULDA 1TKZA 4B9LA 2W42A 2G8FA 4X5VA 2BGWA 5KGXA 4LSLA 4EBCA 9ICGA 4I2HA 4W5RA 5KFGA 3UXOA 4HVJA 4YR2A 1NJYA 3AVGA 2KZZA 4O3RA 1N5YA 4QWBA 4EYHB 3V9XA 3TAQA 4I9LA 4W5NA 2MAXA 1L3TA 1BHLA 1EXQA 5I42A 4E1MA 4TSXA 4E3SA 2XGQA 4IQUA 4LH5A 1C0MA 4JS4A 4DSIA 3V9WA 3RMCA 4KRFA 1X9SA 2ALZA 1CXQA 3Q8RB 4FLZA 5DGAA 4KN7A 4LH4A 1XO1A 3AVJA 3ZT4A 4G3IA 5K14A 4DFKA 2X78A 4PWDA 4KFBA 4C8NA 2ASJA 1S6PA 5KT7A 4J9NA 4CJTA 3GV7B 4NXZA 4LY7A 9ICTA 4DEZA 1K1QA 3QEAZ 2J6TA 4YD2A 8ICJA 4CF8A 4YP3A 4CJWA 3KKRA 4DS5A 4DTRA 1SL2A 1VSEA 5C25A 2DTUA 3RJJA 1S6QA 4CFCA 4FLYA 2G8UA 3S3NA 1SL1A 4DSFA 4DU4A 5DB9A 1EXNA 4W5TA 3TARA 1C0TA 1ZQEA 3ZSOA 1S9GA 4TQRA 3KHGA 5CWRA 1RXVA 3THVA 1IO2A 3OHBA 3JPSA 4DQIA 4GXKA 1J9AA 4J9RA 2BCUA 1EETA 4O3NA 3EZ5A 2LYHA 4FM0A 3DRSA 5HMLA 4OPJA 4F4WA 4CIFA 1XHXA 4FJ7A 2ZTEA 4CEAA 2Q0ZX 1S9EA 3JPRA 5E41A 4HTUA 4I2IA 1ZQHA 4PPXA 1HUOA 1RT4A 4FW2A 3K5NA 1VK0A 5EWFA 3B0YA 4I2GA 1MSWD 8ICYA 5DKWA 2HVIA 5KT4A 9ICBA 1BIZA 4E7IA 5DQHA 4Z6DA 4RQ1A 1LW2A 2JEJA 2ASLA 4MQ3A 2JEIA 3M8PA 4QZDA 3TFSA 7ICSA 4F5RA 4K4HA 4KMUA 5CJ7A 4Q8EA 1TKXA 4HUGA 1S1VA 4QZCA 5L1LA 5KFOA 1S0VA 1XSNA 4MFAA 4KHSA 4FM1A 4E89A 4KLFA 3JSMA 3SV3A 1ASVA 4JLHA 3V1OA 4GC7A 1NK5A 2XO7A 3DLRA 2YKMA 1JXEA 3KHRA 4BE2A 1IG9A 4CERA 1KFDA 4UAWA 2P5GA 1XI1A 4DO9A 5KFVA 4KLMA 2B4JA 3IHQB 1ZQNA 4RG8A 3MR2A 3MGIA 4DQRA 3T5HA 3PW2A 4RQ3A 1TK5A 3OVNA 4KLQA 3Q8LA 1RT2A 4UAZA 3Q8QB 3SCXA 4FJXA 4ED7A 4B9TA 1S1UA 2NRXA 3QERA 2FMQA 3KK2A 1JLGA 5CYQA 5DGBA 1CZBA 4AHRA 4P4MA 4KTZA 3AU2A 3RAQA 4FCYA 1WCLA 1CZ9A 4DQPA 3WNGA 3L2RA 1RZTA 4DU3A 2XCAA 2WOMA 1ZQKA 1A5XA 1RT3A 5J2DA 1IKWA 2YHBA 4GXJA 8ICFA 1T4GA 4ZH4A 7ICTA 1QHTA 3G0ZA 2ZD1A 5KG6A 3E01A 4CJUA 4N41A 4M9HA 1MC8A 1NOMA 8ICQA 2ATLA 9ICCA 4ECRA 4O5KA 4M42A 2HHTA 2VA2A 2P66A 4J9OA 1WCNA 3F9KA 5DBAA 2E6MA 1IKVA 2VWKA 3OYFA 1UA1A 3HWTA 9ICAA 3GILA 4CHZA 2C22A 4I2EA 4RW6A 1TVAA 4J9LA 1C1BA 3K2PA 4AHSA 1R0AA 1ZBLA 4ECWA 4TQSA 3C21A 3VQ7A 4XA5A 3K5LA 3TQ1A 1NJWA 1TK0A 3OS2A 4TUSA 3QE9Y 4I9QA 4F50A 3MEEA 3NF9A 2JGUA 1WNSA 1UAXA 3QLHA 4QZEA 2E6LA 1C7YA 3AA5X 1K6YA 4J2BA 1RNHA 1L3VA 1N48A 4JWNA 1SL0A 3OYAA 4QZ9A 5KFWA 4ZTFA 3NH2A 1BPDA 3QEBZ 3H8SA 4RQ6A 5CZ2A 3ZT1A 1HJPA 3RJIA 1NOZA 3RH4A 3DOLA 2KTQA 3ZDAA 5J2FA 5JUMA 5J0XA 2M9NA 2XY7A 3FDSA 2OPRA 3V4IA 2W8KA 3KLIA 3SJJA 3ISBA 1SV5A 5KT6A 1HUZA 5FRNA 1ZBUA 4HYKA 1AROP 4CF2A 4NM1A 3TANA 3V6JA 8ICBA 3D45A 3OY9A 3MAQA 4B9MA 4YN4A 1A77A 9ICLA 4EYIB 4R8UA 2FMPA 4JV2A 4FLTA 2FPKA 4PHEA 2GBZA 3RR7A 2XY6A 3VQQA 8ICNA 1TV6A 1RTJA 3AO3A 4ED6A 3OGUA 3RH6A 2V4QA 5IIOA 5BOMA 4O0JA 1NK4A 1BPXA 2HHUA 3N97B 3S3MA 3OSNA 4I27A 3KTQA 1C1CA 4F3TA 4RT2A 1I39A 5KT2A 3V1RA 4RQ5A 3SUNA 2XC9A 5KTQA 3ZDDA 3KLGA 4QW9A 3MABA 1J54A 4KO0A 3UXPA 5CZ1A 3LWLA 1LV5A 4H4OA 2VWJA 3RBEA 2IGIA 2ZUDA 2ZJAA 4DSJA 3NFAA 1D9DA 3RB3A 1S76D 2YNFA 4IFVA 4B8CA 4CJ4A 4ECTA 3RJHA 5BPCA 4DG1A 1ZQJA 4Z6FA 1RT1A 9ICWA 3K4GA 4BXOA 4CGHA 5D4BA 4YMOA 5KFQA 8ICEA 1TAQA 8ICPA 3TAGA 2DY4A 3Q8KA 2PXIA 4J2DA 4ID5A 1S97A 7ICRA 1ZQPA 2W9BB 1TKDA 4BWJA 2ZTCA 5J0WA 4NLKA 3NGYA 3RMDA 4OLBA 3NF8A 4CJSA 4CEFA 1A5VA 4RQ4A 1JLCA 4GW6A 3LP3A 3CFRA 4M45A 1W9HA 5DDYA 1WSHA 3JPQA 3DI6A 3LDSA 1KSPA 4M3UA 4DLGA 3GIIA 2MUTB 4JV1A 3C2MA 3OJSA 3AVAA 1HYSA 7ICMA 8ICTA 3D0PA 4KI6A 4AHUA 1JIHA 4FK4A 3BQTA 1COOA 3SI8A 3L2UA 8ICXA 4KLEA 7ICJA 3DMJA 5J0OA 1ZQWA 4F5PA 3L2VA 2F8TA 5KFFA 3GIKA 4AHCA 2G8KA 3AO2A 1VRUA 2RN2A 1HQEA 3KLHA 3ZT2A 4CIGA 3CM5A 3C23A 3SNNA 4I2AA 3SV4A 1IKXA 4UBCA 3OSPA 2AGQA 1WLJA 2ZJ8A 5HP4A 3A2FA 2DFFA 4FLWA 3OS0A 3DLGA 2XY8A 5CA7A 4BDYA 1JXLA 3PW7A 3MR5A 1QSSA 1YT3A 4B9VA 3AVIA 5J2JA 5HMMA 2KZMA 2PFQA 8ICCA 2JEFA 4CJFA 3LZJA 3C95A 4ELTA 9ICHA 5KFJA 4N5SA 1DLOA 1Y88A 1RDAA 3VA0A 4F4ZA 8ICRA 4ZTJA 2AQ0A 1NK8A 3JPOA 2GUIA 3DLKA 3NGIA 4NM2A 3JYTA 4K4GA 1RBSA 1L3SA 1KEJA 4O55A 8ICOA 4PY5A 4MF8A 2GV9A 3PV8A 1UOCA 4HHTA 3HVRA 1B92A 5KFHA 4UBBA 1REVA 2AGOA 4DOAA 1BPEA 1Q9XA 1O1WA 3ISNC 3H8WA 1EP4A 4FJNA 3OYMA 9ICMA 4PA1A 1WAJA 4CEQA 4CGFA 3EW9A 2KFZA 2P6RA 2PZSA 4J2EA 4KB0A 3ITHA 1UT5A 1KFTA 3AA3A 2YV0X 3ZD8A 2IHMA 5J0UA 1X9WA 2X74A 5HHHA 3QEPA 4FJ9A 2W9CA 3BDPA 1JL1A 4QWDA 5KG0A 4EBDA 2F1HA 1WN7A 5EWEA 1DOQA 1RBVA 3MBYA 1RBTA 4DL3A 1JL2A 2UVVA 3VQ6A 3QINA 4DL7A 4AHTA 2JZBB 8ICZA 5DK5A 4RW7A 2W9CB 5J2BA 1ZYQA 4CE9A 3MFHA 3DLEA 4ECXA 4FJIA 2HHQA 4CF1A 3JPTA 2XCPA 4CFDA 3MDAA 9ICNA 4R63A 3NGZA 3G6VA 4OVLA 1QTMA 2AQ4A 3ZSWA 3K5MA 3MXMA 4J9SA 5KG7A 2NRZA 4DQQA 7ICLA 2O4IA 4MEYA 1D5AA 5F9LA 2DFEA 3ZDEA 4O5EA 3HP9A 4CGIA 2IHNA 2X6NA 3O4QA 3VA3A 4CFAA 1Z00A 1D8YA 1HQUA 1ZBHA 1HNVA 2A1RA 2RPIA 1ZQDA 4HUEA 5KFEA 1HJRA 5J0RA 4RU9A 2A1JB 3DRRA 2FPLA 4KLSA 2IAJA 1FKPA 9ICIA 4IR1A 5J0YA 4M9LA 4R8UB 3ISCA 4FJGA 7ICQA 3CFOA 3T3FA 4EEYA 3TR8A 4YFKA 3AO1A 1WSGA 5J0SA 3G6XA 5J2AA 5HRRA 3SI6A 1KLNA 5KFTA 4DTOA 3BQ1A 2Y1JA 3ORYA 3HSTB 2FLNA 4Z4CA 5J2CA 1IXRA 4UB3A 2RF2A 1WSIA 7ICKA 2FBTA 4F5NA 4OKJA 5J29A 1NK0A 1MQ3A 5C42A 3WNEA 4RUCA 4DFJA 2IC3A 5KFMA 3HYFA 4QW8A 1NK6A 2QXFA 2BPCA 4CGGA 4M9GA 1ZBFA 2D0BA 8ICAA 3ZT3A 4O3PA 7ICGA 4KLTA 3K5OA 1BQNA 3AA2A 4ELVA
chains in the Genus database with same CATH superfamily
4N76A 2QTWA 4EMDA 3BF3A 2Z1GA 4C0ZA 5DDPC 3CJ3A 2ADCA 2XMMA 3K8WA 3ILJA 2XNQA 1LAVA 4M3XA 5AE2A 3AVNA 4UOCA 1RDCA 2QZ8A 3S6JA 1LKYB 4CTAB 3KIOA 4GKJK 1NGGA 3WUHA 5TKYA 2MGZB 2DR9A 2UVUA 1QSYA 1U6ZA 3QT8A 4Y3CA 4EO8A 3DOKA 3W66A 3VQ4A 1EARA 1FXXA 3HZEA 2DIVA 4AD6A 2XMJA 2QL7B 2E3TA 3K9KA 5AQMA 5HMWA 2R7XA 1ZM3A 1Z1ZA 2R8GA 4DV5K 1KDHA 4BR2A 4YD1A 2HVDA 2R8IA 4YB1P 4BDZA 3KZIU 3ZD9A 4DMZA 4R64A 1BNPA 4UUXA 4F0HA 2KIVA 3TI0A 4H5RA 1NGJA 2O5DA 4R66A 1CLQA 3DLJA 4CW7B 4A8XA 3H20A 2LSNA 1KHWA 4GMJB 5DB7A 3AN1A 2ITGA 5HI7A 1VHXA 4NASA 5KFRA 4YDDB 5AQTA 5LMUK 1WKLA 3KD3A 4OJ6A 3QYPA 2J6UA 1D3WA 3V4IB 1T03A 3KVGA 1V3RA 1F3VA 1JLFA 4M3RA 1B22A 2ZIXA 4BJQA 3ETRA 3H2LA 3N01A 4RQ8A 1B9FA 1ACMB 4O5FA 1TL5A 3OUYB 4KR0B 1MMDA 1WC0A 2R8JA 3X1LB 1LWEB 3MCPA 2M88A 5E3PA 2FXUA 1H2UX 1X5OA 1UL3A 1YJ9S 3MMAA 3HHLC 2XI2A 3U7JA 4Y2IA 3DV9A 3GCWP 1VQLS 1JLBB 5ALOA 1PJ6A 1XQSC 3GV5B 1RA6A 4ANDA 3CD0A 2MLYA 3U1LA 4LFCF 5AKJA 2V9WA 1H98A 2VV5A 5AQVA 3JAMU 4IOCQ 4A8SA 3VESA 2OMOA 1HYVA 3E9PA 4YOVA 5U47A 2DR7A 1RLCL 3RJFA 2E1YA 3OYLA 4TUQA 3DOMB 4KO0B 4NZ6A 4RW4A 1XBWA 3UVJB 2A1JA 1KVKA 2NYIA 4USWA 4O5BA 1HWKA 3EYZA 2GWKA 4ZIVA 3HRDD 3N6LA 3UW1A 1LKZA 1WORA 2MY7A 4IRKA 4DL5A 4BGBA 4KHYA 1SV0A 1VS3A 3AUOA 3C66A 2LM4A 2CJKA 2IOHA 3T5KA 1YJNS 3PFOA 2FBXA 4E7LA 3UMCA 2PN6A 7ICIA 2D8CA 4UT4A 2ZG6A 4PXBA 1WC1A 4E7JA 3R5CA 4Y1CA 1YK9A 5AR0A 1DJ0A 2POKA 2EKNA 5ETTA 2YH1A 2RDIA 1DTQA 4LFBF 1UVLA 4M04A 4RUHA 5F8NA 1J5EF 3HM9A 2ASMA 1SWWA 4KGVB 3BN4A 1L7NA 3ZCMA 5GAEI 4V19S 2C2EA 2I5JA 3GU0A 5KT5A 2XSJB 4QZHA 2XSJA 2P1JA 3SEIA 5IS2A 4JI7F 2D0OA 2YJEA 2VQFJ 4CD3A 3VZIA 2PKEA 4LF8F 3HMJG 2YNHB 3WQTA 1FNXH 3MCSA 3O8WA 3SPZA 1S6PB 2HNDA 4H4OB 3H5SA 3BS5B 3CC7S 3H25A 3QNOA 1C0FA 4RQ2A 4H0TB 1X4GA 2VGNA 1S1TB 1Z2ZA 2F2AB 3QDKA 3VQ8A 2VANA 2A3VA 4K42A 4US8A 5AKLA 3EPGA 3PSPA 4CDGA 4ZHRA 4MAKA 1H2VZ 4PYDA 4NLNA 2HEKA 5EE0A 3LPUA 5ETVA 2HURA 3WQPA 4Q44A 3SENA 3BUZB 2UXDK 2MZRA 4NA3A 7ICPA 3FKBA 4KHWA 1PAEX 2VG5B 1DHMA 1U1RA 3SSQA 3NF6A 3IM1A 4DTSA 4YR0A 2PFNA 2BQ3A 2ZJ5A 1BA1A 4IG3B 4EK2A 1WOOA 2QG9B 1BPYA 8ICKA 3IBFB 2FPHX 3C2KA 4B08A 3QJJA 5DDMA 3EE9A 1FJGK 3DLBA 2ISPA 3L4BC 5IFMA 1JJCB 1B99A 4BGAA 1OQ6A 4K8RA 2WW8A 4B3SK 2VGMA 4OZJA 2UXDF 2AJQA 3NMAA 1NAQA 2FBVA 2X3DA 2C42A 3MHYA 2W11A 3FC9A 5C2CA 3BKUA 3Q8PB 4JI6J 3H45C 2GW8A 3DRPB 5D78A 2C2DA 5E84A 4M41A 3ENOA 2I9SA 1ZQ1C 2ASDA 9RUBA 3I56S 2ZM6F 2EZYA 2Y1RI 4YXMA 1RXOB 2DNZA 2KB2A 1HNVB 4ERDA 2RDDA 2C3OA 3FFIB 1WTFA 4XEIA 2HSTA 3G6ES 1NZ8A 2HGMA 2QWNA 1NXIA 3SMSA 3WKCA 1LB2B 3R5GA 1XS9D 1H2TZ 2FGOA 1VSIA 3I4HX 3QSYB 5ALVA 2WSCC 2QYGA 6AT1B 3E2EA 1HWLA 1VQNN 5BOLA 3M6VA 1J5EK 1XR5A 4KLLA 4HCBA 2KVSA 2OSQA 3HOSA 7ICOA 2H3IA 1JNZB 3N6MA 2XZTB 3IC1A 1IJEB 4C8LA 2H5JB 4X4SA 3DU6A 2EG1A 5GAHP 3QZ7A 1R27B 2HLTA 2MXYA 1WEXA 2P9SA 2LYBA 1IVZA 4LFCJ 2W7PA 2DCUB 4Z94A 4PG5A 1U04A 4DR7K 1Q86O 2H4YB 2CNKB 2QL9B 1RKIA 1K1SA 4KRWA 2DHGA 3HZ6A 3ENWA 5JXSA 9ICUA 3AOCA 4FYYB 9ATCB 4P0PA 4B1WB 4JMUA 1BQXA 3MPWA 1YLXA 3UD4P 1S0MA 1S4FA 1BQMA 3TAPA 4MEXA 1MG7A 2A42A 4CZFA 1TV9A 4E1JA 1NJXA 5EOZA 1JNRB 4JKBA 2KQ2A 3VGLA 5KGWA 4WWSA 3NBPB 3GDXA 2VPZB 4CWBA 3BGRA 1OH6A 2KKHA 4UZCA 3KWMA 2BJEA 5AQUA 2VFVA 5J2EA 4B9SA 3QBWA 4CM2A 2EAMA 1S5ZA 2HHSA 1NGFA 4H5NA 2E4LA 1J97A 1IKVB 2DO0A 3BYRA 3QU4A 1NGDA 2YB4A 4IDKA 2XMTA 4N47A 3PIOL 8ICSA 3T9ZA 4CZMA 2NLXA 5AQHA 3UN5A 2C28A 3M8YA 2IBOA 2Y9UA 3NCRA 4C8MA 1RHRB 3I1YA 4OX7A 4BRHA 3Q8YA 3O08A 5HO4A 2HYIB 3R3LA 3O9TA 4BRKA 1N62A 3CM6A 4DOBA 3W5XA 2ZHOA 3G2XA 3KK2B 3V5RA 1VYAA 2XMAA 4FYDA 3H3NO 1LOUA 4DF4A 4ELUA 5LMUJ 4ECQA 2QWOA 1HBOB 1AUSL 3H4DA 4G1PA 3G9CA 3N7SC 2AYEA 2XWXA 1RTDA 3PW4A 1U1NA 1YJVA 2NYHA 1IR1A 2IOCA 2PA3A 5GVQA 1RWXB 1VQPS 3CT9A 4M5KA 2AKWB 2JHEA 2FVRA 4F3OA 4FS1A 2KLAA 4BE0A 4ZDNA 1U1LA 1XNQJ 3NVZA 2FVQA 3HLUA 5H9EK 1ZQLA 4Y2JA 3KLEB 3HK2A 4OIXA 5JS2A 1RZMA 2W3RA 1UCNA 2PMZF 3Q2SC 1WHVA 4WYWA 2HHVA 1ZXIA 4KREA 2ZQBA 2IVPA 3CCZA 3ZLJA 2H5IB 4ID8A 4LFBJ 4RNMA 4KLJA 3V2UC 2AA4A 3MEGA 3GJSB 1I94F 1OJ4A 2K4EA 2KZ3A 2G9OA 3CIMA 1U1OA 5CCMA 1UPMB 2FSKA 4CE6A 2ZH8A 1P6TA 2FBYA 4ED8A 2M4MA 4DTMA 3W61A 4BG8A 1RWVB 3MGVA 5BYQA 1F2GA 3LDQA 3V6DA 7ICFA 3KFWX 2HOIA 2CZVC 4YY3F 2G8IA 4IO9Q 3HSGA 4KHQA 3AQPA 4Z4FA 2HOFA 5A0YB 2ZBQA 3VQAA 4J2AA 5K5MA 2VICA 3MEDB 4CI0B 2HMPA 3KBBA 2R9LA 2VL1A 1NWKA 4HTLA 3CD6S 4K7QA 5J0PA 5K8MA 1PK1A 4G1QA 1GX6A 4URSA 4LFAK 2B8QA 3QESA 2BE2B 3M8RA 2MSSA 4PL2A 4JV5F 1E6YA 3C6TA 3EWAA 4DWIA 3KLFA 2D5RA 3EE8A 1RPLA 3EUB2 5EX3A 2E44A 2VBYA 4K4SA 1SIWB 1YDLA 4ZN3A 2JLGA 1KCFA 2YB1A 3GIMA 3M2UB 2XS2A 1SBRA 5C2FA 1NPKA 3ILIA 4J9UE 2UXBF 4DPUA 1EQYA 3DGVA 1NK9A 2F96A 2Y9HA 1NKEA 3CHWA 4FWOA 1SQGA 3WK6A 2QLBB 2VA3A 2E5SA 4BRGA 4FJ5A 4DR1K 2EVZA 3DRPA 4NPOA 2ZE2B 2Y0BB 3KMQA 2RE2A 3SUPA 3A13A 2ZVSA 1HJOA 3MEEB 4LJMA 9ICJA 3IG8A 3NGTA 4GKKF 4ZPTR 3EM1A 1DTTB 3R7BB 2RQCA 3BM7A 4EI2A 4WYBA 2VONA 4CESA 4ENOA 4CK3A 4HT5A 5K9FA 5J1EB 4QWEA 2GZOA 5L9XA 3ADAC 1Q79A 1Z4OA 2HS4A 2NO5A 4ILGB 4K0KK 4FVCA 5H1SV 3LTOA 2F1JA 1HPZA 2E1MC 4RLEA 3DKDA 2FZCB 2FJVA 1RDRA 3OTOK 3AO5A 3O3GA 3QIPA 5J2QA 4PZVA 4CHNA 1SGGA 3D3CJ 5LM7E 4DL2A 3OD2A 4LBPA 3VGKA 1HD1A 1A6LA 5FROA 1G7CB 4DR6F 5A6PA 2AYGA 4FF1A 1RT5A 1HR0J 1VHIA 1T6CA 3WNFA 5KFYA 1SXLA 2ZM6J 2XYHB 2ROPA 4NLRA 3CVKA 3TZWA 7FD1A 5J2HA 1RXWA 5C42B 2QM1A 4C1NI 1EKEA 5JLFA 3CTRA 3O0FA 3SQGA 2A40A 4URGA 3B6BA 4IRDA 4GNIA 2WHEA 4EX6A 3PX0A 2J0XA 2HMIA 1VAZA 2HMIB 3G82A 1YVUA 1U8SA 3DLHA 3G82B 1C1BB 3AHPA 3AH6A 4FKXA 1WD6A 4CK1A 4L3QA 4WPAA 3KZXA 3BR9A 1TYQB 3HHNB 3ZSQA 2G06A 4NA1A 1O13A 2JLEA 2XS5A 1WHWA 1VQKS 3MM7A 3HM8A 2R7WA 4BC9A 3L2WA 4YR3A 1S0NA 1Z25A 2RQMA 1XNQF 4JS5A 3K1RB 4M5HA 2V4JB 1RWKB 3QUCA 4FWNA 3VEVA 4FF2A 1QQ7A 1R89A 3UD3P 2F8EX 4Y2YA 4YDUA 4PZNA 2X1FA 4DPOA 2KRBA 3QIPB 2Q3PA 1K73O 5GIPA 4IKAA 2IBKA 1FEEA 4NB4A 4JB3A 2PSZA 4CNQA 1EAYC 3PW5A 3I28A 3KWIA 1WSFA 2CJ9A 5HP1A 3VEOA 1KQFB 4EHUA 2K7KA 2RQ4A 1JLFB 3QXGA 2EXUA 1ZQCA 4BDPA 3L7PA 3OA9A 4P4PA 3I5BA 3QRPA 3IMXA 1RTHB 2ZIUA 4YCXA 3RGIA 4BACA 4LF2A 3H4BA 1FVQA 4JYAF 3FAHA 1RT3B 4DR7F 4O3OA 2AX1A 3WHIA 1HBOA 3SQ0A 4UASA 1S1XA 3PMNA 3E66A 1Z1VA 3VAIA 3HJVA 3QJPA 1QE1B 3OFHA 2MJNA 4CYUA 3LVWA 1EHWA 2KD1A 2P9KB 1MQ2A 9ICKA 2O66A 1OVYA 4WYLA 2H3ZA 2NSCA 2BH1A 4YXJA 1JMTA 4O3QA 5LJVA 4J9PA 3MUTP 3DC2A 2AJFE 4HACB 3AM9A 1W25A 4CJQA 1RAAB 1HNZK 2CXEA 2HBRB 5DS7A 1WB9A 3PMLA 1RQNA 1U25A 5J0TA 3K75D 1G99A 4ZVPB 1ZS6A 3VQPA 1UPHA 3TVKA 1ZQRA 3MR3A 1SJ4P 1YJ9N 3MMBB 4OI4A 1SH3A 2QFIA 2RDJA 1X5SA 5CYMA 4K4TA 4FS2A 1IKXB 1BC6A 1U9LA 5K8OA 1HMVA 2P9LB 2HBQB 2JFKA 3VTHA 4IQVA 5FPDA 4CM0A 2RT3A 1YJRA 2PGCA 1X60A 5DM7Q 4MDAA 3SYZA 1R8BA 5DLGA 1K8AT 4DUTA 4ALZA 3FM9A 3WU2U 3H8JA 5KAFU 1NK7A 4F26A 4O8UA 5IINA 3V6HA 2E5GA 4PQUA 1X9MA 5KG5A 5T14A 3THYA 4H8KA 2DPIA 2LKYA 3NE6A 1ZQUA 1PG5B 2LA4A 2CJQA 1GOCA 3NRBA 3IN5A 1LWCA 2Z1JA 2V4RA 2V2VA 1S72S 2W8LA 4IR9A 1FFVA 2LI6A 1TAMA 1C20A 4Z0UA 5HRNA 2EHGA 3OYNA 1JROA 4G9ZA 4DF8A 4DUYF 1Q9YA 5CE3A 2E8OA 5F9NA 1SB6A 5DG7A 1ZQBA 3V1QA 1J2VA 4QWCA 4CRJA 1FA0A 3PW0A 1KC8O 1O03A 3WEEA 1T7PA 2KHVA 1BNOA 4NLUA 1EKRA 2MLZA 2VU5A 2Q1LA 2D69A 3LALA 3VQEA 4KTWA 3LW5C 4JK1A 1HMVB 2HPUA 4CBXA 3R1XA 4QZIA 3FZFA 2O8EA 1VSFA 1FDNA 5ALXA 5LXRA 2FDNA 4WU2A 2NSBA 3QPIA 2NZ4A 3HPHA 2EFQA 2IPOB 7FDRA 2E1CA 3EJMA 2CQDA 4ED4A 1ZQZA 2AMCB 1JLAB 4ZIWA 4JI6F 2QKKA 2SXLA 5DQGA 3AFGA 3FEZA 4FWSA 1W2IA 2WZ1A 4ZPBA 2I0XA 1YIJN 1VDHA 4J03A 1FDBA 3N7PD 3D6JA 3G8TA 2PT0A 2R7TA 2MTLA 3NMRA 3GIRA 1FRJA 1AFIA 4FJ8A 4ID5B 1EZZB 5B5EU 3BR8A 3M2RA 3D6RA 3Q23A 3TUZC 3Q8MA 1S10A 4URQU 3SMVA 2ETJA 3PJ9A 5F0XA 4BWMA 5AK3A 1ZPWX 2VDHA 4Q8FA 4P74A 4DR5F 5BN9A 1WEYA 3ZEUA 1Q18A 1OPIA 2FD2A 3GE1A 3MAAB 5FPNA 3IG1A 3MM9A 4ATNA 5KPRA 3JSYA 2OUGA 4U6PA 4EIAA 3BSCA 2AHOB 3SD7A 4I6YA 3W5YA 2HFUA 3H5UA 2HNZA 3ULDA 3CCUS 2KH9A 4BR5A 4AQYJ 4L3KA 1IG8A 4X5VA 2W2NP 1YXQA 3VGUA 5ALHA 2ZH1A 4LSLA 4JI8K 4EBCA 4U7UK 2O3DA 1FEHA 4ILLA 4HVJA 3AVGA 2KZZA 4O3RA 1N5YA 1G3OA 3THXA 1T95A 4Y6IA 2XMWA 5BN8A 4JK9A 1VGYA 1L3TA 1BHLA 4R79A 2ZH5A 3FC4A 1RTDB 4OYBA 1C0MA 3HD1A 4ZITA 3FE1A 4JP8A 2K7JA 3DAWA 4KRFA 1X9SA 1RBLA 4X65J 1NJIO 2MMYA 4FLZA 1N34F 4LH4A 4KN7A 3AVJA 5K14A 2MQLA 2HFVA 3VAFA 2NXEA 4CRXA 3U27A 4C8NA 4NZ0A 2HGLA 3H42A 3NY0A 2FSJA 5KT7A 1GAOA 1KKHA 2FZGB 1TL7B 5LJ5Y 4DEZA 4M7XA 1CULB 1Q78A 3ZZZA 4CF8A 1C0UB 3R2CJ 4DS5A 4W4MA 2QSFA 4U67L 2DTUA 3M6KA 3RJJA 1S6QA 4ETXA 4CFCA 4FLYA 2HF4A 3CCJN 1TUYA 4DSFA 2YX7A 2MYFA 3W9HA 4OJPA 1R8CA 2HNZB 3H5YA 3POTB 1KL9A 1ZQEA 2WF8A 4Y2VA 1TUUA 1S9GA 3W5ZA 2P6TA 4TQRA 4KHPJ 2DHXA 4CQ1A 3NNAA 1SIJA 1VRQC 1J9AA 2E9RX 3DHXA 2LYHA 2XLJA 4FJ7A 3O6WA 2LXFA 2DNMA 4DV0J 2WTUA 1S9EA 1FXRA 3JPRA 1XMQF 4U7UD 4CZCA 3C29A 2VZ9A 1U2FA 2C2NA 2LXIA 4I2IA 1UEVA 2N1RA 1HLUA 3VEWA 3NCPA 3K5NA 3AJDA 3MX5A 2QN6B 1Z1BA 3A3OB 1HW8A 4C4TA 2E8AA 2HVIA 2ZKTA 5KT4A 2J9DA 4FWMA 4LC9B 1MNEA 1RFQA 2M0GB 3HHLA 1NDLA 3TUPA 1BIZA 4RQ1A 1LW2A 2ASLA 2DO4A 3BO3A 1NMNA 4QZDA 4F5RA 4KMUA 4KGKA 3ID6A 1OH8A 4Q8EA 2KM8C 3MEGB 4QZCA 3F5AA 2ES6A 1WG8A 5KFOA 3CDEA 4GKJF 4F4AA 3D4JA 1N34K 3MM6A 4WFAL 2R2UA 1NB2A 3V1OA 4XH5A 4GC7A 1X7VA 1XR6A 2YKMA 1A0PA 4OQJA 3TSQA 1IBLF 2DYAA 4BE2A 4JI0J 2GVZB 2YHXA 1IQZA 4DHYA 1S12A 1WYGA 5F3XB 4CERA 3H90A 1K9MO 4UAWA 3VZHA 2P5GA 3FVYA 4PQAA 2GX8A 2F9TA 1QQ6A 3AOAA 3MR2A 4DQRA 3T5HA 2O8CB 3CPWM 4KLQA 1JK9B 1TP7A 3SCXA 1FTRA 4DQ8A 3QNMA 4J91A 4B9TA 2NRXA 2IM3A 1WKJA 2P9PA 5CYQA 1T9WA 1CZBA 1HNZJ 1J2NA 3RAQA 2HOQA 3JAMY 5EXWA 4DU3A 1WC5A 2WOMA 1ZQKA 1RCOB 2OAUA 5J2DA 2G09A 2YHBA 4QYZJ 8ICFA 5B08A 2N7YA 5A8WB 4ZJQA 3FR0A 1I1GA 3G0ZA 3WKAA 1KWMA 4N41A 3T69A 4M9HA 2P9GA 1IBKF 1MC8A 2LVWA 2NPFA 2ATLA 2FJ6A 5KL8B 4FZMA 3EGNA 1FD8A 4L75A 3WK8A 3C15A 4KJIA 2LEPA 3ZTRA 4J9OA 2E6MA 2A2DA 3I55N 2VWKA 3OYFA 3DGPA 1MMLA 3TADC 2UU9J 3DHWC 2F77X 2W1BA 4RQNA 5FLXY 2HSZA 2HS3A 2XHWA 3N6NA 3ZTPA 3TQ1A 1TK0A 4CT8A 2V2KA 3QE9Y 5I4MA 4WP3A 3VWSA 4A2AA 2J8SA 2JGUA 3PJWA 3OPKA 5A8RA 3VAKA 3R7SB 2HBKA 2KT2A 3EICA 5AIBA 3FSIA 3PRDA 1U24A 2KKZA 4RW9B 2ZJQQ 3NGSA 4BVPA 1BPDA 3MPDA 3QEBZ 1UW4A 2Y8WA 2J7WA 1MA9B 2DGSA 4RQ6A 5CZ2A 1KD1T 4AT1B 3QFUA 3RH4A 3DOLA 5J2FA 3Q22A 4MIBA 2KK0A 2M9NA 2OP5A 2HFNA 2BZFA 1L8OA 3F2CA 4X64J 5B09A 3ISBA 1CJTB 2EPIA 2K60A 1CJTA 3CPWR 2R2TA 3I4PA 4FWLA 1SV5A 5KT6A 5ALRA 5AKEA 4XK8C 4CF2A 1EETB 1M1KT 4NM1A 4DV4F 3LDNA 2IDLA 4K43A 4YN4A 3HHKA 5JJBA 9ICLA 4DHVA 4H5WA 2VKRA 4EYIB 1FFSB 1RBAA 1X4EA 4TYAA 5ALYA 2FPKA 1VMBA 3H3OB 3S01A 2XY6A 5GAGP 1Q7YO 3DDKA 4JHDB 4UAVA 2DITA 3AD7C 2WBNA 3L4QA 5IIOA 5A8RB 5BOMA 2E7XA 3M8WA 2KRRA 4EX7A 4L73A 2JWNA 2VQFK 3S3MA 4Y2QA 2X1AA 3KTQA 4YOTA 4IH6A 4TNOA 3HRGA 4CZGA 3FBEA 4F3TA 3NGUA 1AQ6A 4PXEA 3IAM9 2UUCF 4RQ5A 4ISEA 1AZSB 1IBKK 5KTQA 1ICEB 1WDTA 3CMQA 3WK5A 3KLGA 2JV3A 2CPHA 5CZ1A 2DNRA 1U7LA 1LV5A 1SUQB 1HNWJ 2C1EB 4ETZA 2I38A 1S76D 1ZD5A 2EC2A 4LF4F 3LM2A 3H0LB 1DRZA 1FXDA 4X66F 2UUAJ 3NS1A 1ZQJA 5AI8A 2XBPA 1WC3A 1S6QB 4RX6A 1HBNB 3K89A 2MKKA 4YMOA 5KFQA 2G2YA 2DY4A 3EUNA 4C48A 2OPQB 1PSDA 4DPYA 4DJBA 3ZETA 1N5VA 3QFWA 1TKDA 1K5OA 4BWJA 5J0WA 1X4DA 4YHHF 3NF8A 2ODGA 5H9FK 1A5VA 2RMLA 4RQ4A 4M45A 5DDYA 2K8AA 1AB8A 3LDSA 3SK3A 2EFNA 4USKA 1ZA2B 4DLGA 4HHHA 2MUTB 4JV1A 3AVAA 1WSVA 7ICMA 3C14B 4I6AA 8ICTA 4BRCA 1JIHA 5H9FJ 3BQTA 3SI8A 4OJ5A 2FE9A 3ATVA 3L2UA 1OYEA 8ICXA 1O8BA 3EGZA 4JI2J 2OHDA 1OWXA 1P7DA 2LDIA 3HSCA 4C0HA 1NNDA 3NS7B 4F5PA 3JXUA 1RHKB 1N36K 4C0OC 5KFFA 1HI0P 3MCMA 3WIVA 5HL7L 1HQEA 4H5TA 2KVIA 3O4WA 3J80O 4QIEA 1R0AB 2EI5A 3GYNA 3T79A 1S7HA 1IKXA 1DBDA 1SB3C 4UBCA 1WLJA 5HP4A 1NZBA 4FLWA 3OS0A 5L39A 3UR0A 2B9YA 1UZDA 4HVZA 3MM6B 3P4UB 5HVHA 1WHXA 3PW7A 3OR1B 1YT3A 4B9VA 3JB9k 5LSRA 1S1UB 5LY3A 2PFQA 4YB5A 1VQSA 4DR2J 4JEPA 5K20B 2XM3A 1DLOA 1Y88A 2ZOFA 4F4ZA 1TL4A 1YKWA 3FK4A 1NK8A 2HFSA 1NGCA 4NM2A 2BM0A 3JYTA 4X4VA 1QQ5A 3IG5A 5F3TA 1KEJA 4O55A 8ICOA 2AJ0A 4NYOA 1EWRA 1BHNA 3SAGA 2FC9A 3ITHB 2AGOA 4WJ3B 1HBMA 4MK8A 2WRMA 1BPEA 1Q9XA 2ZH7A 1O1WA 2QE5A 3KUHA 1NDCA 5AK5A 4ZP8A 5AZJB 4CGFA 2KFZA 3DRSB 3AA3A 1YZ6A 2IHMA 3J80U 1VQYA 1RT2B 2PEHA 1X9WA 4QS7A 1H0HB 2QWRA 3BDPA 2F1HA 5AM3A 2E5LJ 3MBYA 3KMSA 3Q8VA 4HEA9 2UVVA 3P5BP 1VBXA 4LF6J 4DL7A 3QO9B 3N9UC 4GIBA 1EJ7L 2JZBB 4X4RA 4JYAK 3OTEA 1WF1A 3CCRS 2LM1A 5J2BA 2NXUA 1KVIA 2HHQA 2XCPA 3MDAA 4QNLA 5LMNJ 3DLLQ 1QTMA 3SBGA 3K5MA 4FWKA 4YN3B 2NRRA 2NRZA 3I87A 3OL9A 3TACB 4A57A 5IT9U 3TNVA 7ICLA 4YUDA 5IT0A 1NPRA 2DFEA 4KX3A 4X66K 4GO7X 1WWHA 4CGIA 2IHNA 4C11A 2X6NA 4LRAA 3O4QA 4RTFD 4NJ8A 4DR4K 1D8YA 3F9MA 1HNVA 3NXZA 2J9EA 3CCVN 1I51B 4CLTA 2LDYA 4JI2K 4NYPA 1XR7A 2DNNA 1SC1B 1FKPA 4M9LA 4JI5F 2AP6A 2PMHA 1RGIA 3D0HE 3EWGA 3AAPA 1HQ2A 2HRUA 4FJGA 3CFOA 2NO4A 2A6AA 1T05B 4IOAL 3AO1A 1ZRMA 4I68A 2F9JA 1YJWS 5HRRA 3SI6A 1GLAG 4P52A 2C3YA 3HI0A 3CCVS 4DV1J 1B0VA 2GMJA 3M2VB 3HKWA 1AT1B 2RF2A 2XI3A 1WSIA 7ICKA 3SQGB 1PBAA 3TA1A 4W90B 2BE9B 5C42A 2RILA 2CDRB 3QU5A 3WK9A 4RUCA 1F3FA 1LK7A 4XO0A 5KFMA 2DNQA 4C2MA 3MMAB 5JVHL 5B0GA 3ZT3A 8ICAA 1X6IA 2K8BB 3BGRB 4KLTA 1IJJA 3NTUA 4Y2TA 5C2DA 5DZ7A 1UVKA 2W6KA 1SKWA 3ZNJ1 3NKYA 1I94K 4M5MA 1GX5A 2ZH4A 5HROA 4WCEL 3OR2B 3J7ZT 3N4WA 3QIDA 1D09B 3RSEA 1A7GE 3RSEB 3QLHB 3W0LA 3NRZA 1D4XA 1KVCA 4I56A 4MLEA 3L2QA 1B43A 4AH9A 2ZDPA 5DQIA 9ICXA 5HBMB 3MN9A 4CEEA 4I2CA 1BOTO 4GY2B 1JJHA 2XRIA 5KFLA 4M94A 4PZOA 3BDEA 1S5JA 3HF5A 4YMNA 2PI4A 3NMUA 4NLOA 4E98A 3K0SA 1ZQXA 1WKKA 4LVSA 3A8EA 3E01B 3O1LA 1JJ4A 3O9SA 3T5JA 3UFCX 3EO3A 2B5JB 4O4GA 4E0DA 2XLKA 4FF4A 1TVRA 3MM8B 3AV9A 2W01A 3NWGA 1YI2S 5DJBA 3K17A 2HS0A 4A8OA 4LJXA 3DWLA 3HPGA 4ISFA 2VIXA 4USIA 3PM9A 8ICLA 4ICLA 4BREA 2BDPA 1RISA 3A0HU 1NNLA 1JWWA 4UW2A 1NDPA 3DM2A 3L9ZA 3V4MA 3OYHA 2V2ZA 4EP4A 5E3RA 4DN0A 3V7LA 2EANA 4AM6A 4RNOA 1SKSA 3H6EA 1IWAA 1U8WA 3O80A 4A46A 1XMOF 4RBVA 2FJWA 4JV5K 1JX4A 1OY8A 3D2FA 1YQHA 1CQMA 2LQ9A 4DQSA 4LFAF 3W63A 1QQNA 1NHUA 3PYGA 5M2RA 2Y1IA 3LVVA 3T41A 3O2IA 3M1VA 1HA1A 2MKYA 3QEXA 3T19A 2V6AA 3WBZA 2MKIA 1S6OA 2HNDB 4P4OA 4K0KJ 1SPBP 1ZM4A 4PGYA 1Z3EB 4IZ9A 2M70A 3OJUA 3N4MB 2RHQB 5AT1B 3CCMN 3CIPA 4IO9L 3H1VX 5HVFA 1U1QA 4KV8B 4WIQA 2BR0A 3D28A 1W26A 3T5LA 2AYMA 3PYFA 5AM5A 2WB1D 5J2NA 1D1UA 1YVNA 2RUSA 4XRHA 4M9NA 2ASOA 2G8WA 3PNCA 3KJVA 1QE1A 4UUWA 3OL6A 1PUZA 4IQTA 3H8MA 4GVLA 4B3TF 1YITN 4J9QA 1JRPA 2JC0A 1G15A 2GHVC 1FF2A 4CHPA 1KVAA 3HL8A 3WT0A 4KLHA 1KEKA 1AFJA 4FVUA 1Q3VA 1QVFM 3SMZA 2HVHA 1TGOA 4BUGA 4RBUA 4ZCLA 2UU9K 1QS4A 1RWMB 2P51A 4JI5J 3PX4A 4WQ5C 4O3SA 3C2PA 2DNPA 4FJJA 4C3LA 1ZQSA 3SFUA 5JMVA 5B0FA 2JZBA 4DUZJ 1SS6A 4RPZA 1XHZA 5AQWA 2DEJA 5L1KA 1LXNA 2A6MA 4KBIA 2LBOA 3M6GA 3OUYA 5HQLA 4X4NA 2J0WA 4JOUA 4GVEA 5BYSA 4C8YA 3ASMA 4PHPA 2FHKA 3EL2A 2GTDA 2QA4G 1HYZA 1N33J 2P9PB 4M8LA 3AVCA 5C12A 3ZYYX 2P9EA 4P2XA 2OZMA 2HQGA 3OTOF 3SXLA 4HHUA 2UUWA 3CJ9A 3CJTA 1FJGF 2J7UA 2NZCA 4Y2RA 4C9DA 1DGSA 2LYAA 4BRFA 2BQRA 4LIWA 4X62J 4JUZA 4QZGA 2W2OP 1XUPO 4MIWA 5AZIA 4CIEA 3TX8A 2DL0A 5ALMA 3B6PA 1CJVA 2HNYA 4C4RA 4NWBA 3CC2N 1S1WA 2E7WA 4FLUA 1VQ6N 2HF3A 4ES3A 4KBOA 2O4GA 3NG8A 3O9UA 1M5SA 3Q89A 5DZ6A 5CD4A 4H0OA 5A6WA 3AXMA 2CN1A 2CPZA 4PKHA 1MN8A 3HI9A 5KFCA 4M5GA 5EOYA 2YKAA 3ZSRA 3UXNA 1BUXA 1P1LA 2A1SA 3SUQA 3FZ2A 4F8RA 1RYRA 1NH8A 3DJCA 3TJ8A 4I67A 4JD2A 3C8YA 3I55S 3MM5A 2PFUA 3RAXA 2VUGA 1DEJA 3HX9A 1BXNA 2HHWA 2PY5A 1SIZA 1JMSA 3SAHA 4Z4GA 1NKBA 4OX9K 5IILA 3RB4A 1C1CB 2KYXA 4ZPWR 4DN9A 2P9KA 4IEIA 1A0OB 2Z30B 3RW7A 3BP8A 2XY5A 5F3ZA 3JPPA 2D41A 2VIHA 4U67Q 4WFNL 4KHPF 1JLEB 4P75A 2R2RA 2CPRA 1XQIA 4ZJLA 3V7KA 3PDNA 4CZEA 3EY1A 3MR6A 2V67A 4ED1A 5JU5A 1LWFB 4JK8A 4LFBK 4C6AA 2JXJA 2PD1A 2JFDA 3M6UA 3KLVA 1AW0A 4DTXA 2BOPA 4KI4A 2NREA 3QT6A 1QQMA 1FIQA 5HRSA 2CQ2A 3BZKA 2IMOA 2P9SB 3W3SA 3M7DA 3CD6N 5KFSA 4UB5A 2F9DA 3W2WB 4XDCA 1KFSA 4UY8T 8ICVA 1F9HA 5F1XA 5GAHI 1N5SA 1GXLA 1BPZA 1APSA 2R8HA 4OKEA 4WZQA 2IRXA 2HSEB 4G65A 4L76A 4EFHA 3GBTA 3KNGA 1HNIA 4AYBC 1RHUB 3M3ZA 5AI0A 2X1GA 1LK5A 1LWEA 4NYNA 3VENA 1AUDA 1COKA 1S1XB 4EWTA 8AT1B 1V9OA 3R6LB 3IR5B 3EPIA 5KFBA 3A8KA 3F41A 3THPA 1KBRA 2H48B 2UXCJ 3BN7A 3HSDA 3R8EA 3TADA 1YJUA 3AA4A 1NGBA 2YI1A 1VSKA 5AQQA 5IZHA 2RJZA 4LR9A 2XSFA 4UB1A 2IJNA 2BTFA 3DYAA 1FI4A 1ZQTA 4P2HA 4YMMA 4A61A 3AY9A 2DBBA 3P3DA 2AJ4A 1Y10A 3M32B 1CC8A 1LOTB 3HULA 1B4FA 4FXDA 1ZQFA 2DEIA 3DMJB 1URRA 1RA7A 4CEBA 1HD0A 3HVTA 2K4IA 2VJ4A 2MY8A 5BREA 5ALQA 4AF1A 5D4LA 4IKFA 1GTHA 3ENVA 1BISA 4CCHA 2BPFA 1PVPA 1S59A 2V51B 2VBWA 2OWOA 1RU1A 3L8BA 4B1YB 1AYEA 5SUHA 1T9YA 1NSAA 4C4SA 2PA8D 4ZPDA 1U48A 2UV8A 4I29A 1MDUB 1RWUA 2DGVA 1YF5L 2B7BB 5C25B 4ZPCA 3SQOP 4CJRA 2XMKA 3MR7A 5CYQB 3J7A1 5AQJA 2VG5A 3VQ5A 1TUWA 3HHLD 3IS9A 4JI0F 2CG8A 3QNNA 3KZBA 1T9XA 2IAJB 2H9ZA 1FJEB 4IOBA 3A4TA 1N54B 1WC6A 4M5IA 3T1AA 8ICMA 4CFBA 2BJ8A 4CO0A 2LU2A 4E8UA 3NVYA 2PI5A 3GYGA 3U3GA 4MYTA 3M32A 2DB1A 3GQCA 4P9SA 4OZ2A 2FMSA 1HX1A 5HMYA 2WC9A 4OI6A 3UKUB 3HP6A 4CJLA 2CGJA 3CULA 4JV5J 2WVEA 4WP8A 1RWWB 3CG7A 5B66U 1HKAA 2V69A 2AEFA 4TN2A 1U4BA 3KUEA 2YPZA 2DR6A 1S1VB 1Y00A 2D74B 3I8DA 4KHMA 3KHLA 1IXKA 3SDEA 2IVFB 4B1ZA 4CEZA 4OZ3A 4IFYB 3GR0A 4H03B 4QZVB 4B17A 3PTWA 3I5AA 4USMA 1N6QA 3K8VA 3GSDA 4LF9J 2R7UA 4MO4A 3I0RA 2MKCA 1NJZA 1Z00B 3CDBA 4USVA 3OL8A 1N32F 1VSLA 5B0AA 2YH0A 3VCDA 1XNQK 5IV3A 2CQBA 3E58A 2ZHAA 1J5OB 4R0JA 3QMQA 1N36J 2F4FA 2Y3YA 1EQ0A 2B6AA 5ADZA 5IIKA 3GFXA 3I76A 5KG1A 2ZF5O 5EX5A 3CYMA 2VB6A 5CB1A 4HI2A 2M2BA 2GAGC 1S9GB 5AQKA 1LXJA 3BJYA 3L4IA 2QIFA 5DBCA 4DU7A 2PAVA 2DY9A 3E3XA 2WF6A 2IOFA 4TUPA 1BGXT 3L0QA 4BRLA 4KHUA 2IRUA 1IBMJ 2GWJA 4O5CA 1RWPB 2AV5A 3CEDA 4NYFA 5EGYA 3MECA 4JWMA 4WFBL 4M6WA 2BANA 4FZLA 4JI6K 2JEGA 3HPOA 4ZS6A 1CJUA 1XMBA 3FQLA 5MLCQ 3FFIA 5GADU 1K44A 4OHWA 4F93B 1RT6A 2EZXA 3M8ZA 3G71N 3OL7A 8ICIA 5EWGA 5HAOA 4F3QA 1KONA 3UDCA 2QI2A 4KH6A 4DCPB 3UR3C 4FJHA 1KRPA 1EQMA 3TWHA 2V7ZA 1RYUA 4WBFA 1DTTA 3KD5E 4DV5F 2J0QD 2B21A 3M6WA 4CJEA 2D0AA 4ZVHA 5A2QU 3VEYA 1K9MT 3C5FA 3D68A 1NMEB 3TUJC 4NLXA 3RVCA 5D0GA 1IBMK 4MIAA 3Q0AA 4OLPA 4IH7A 1WOQA 4I7FA 1SC6A 4B9QA 4CJVA 1HBNA 3LYSA 1KVJA 1HHSA 1RT7A 2EFPA 2CAJA 3SFGA 2W4DA 5HSPA 3T1HJ 2WONB 5ALLA 1GMWD 7ICVA 5AXNA 2P5OA 4C8OA 4P73A 2G0JA 4L6V3 3SCKE 2RU3A 1ZQOA 2E5JA 2BCRA 3OYGA 1FWLA 3LGHA 4GVBA 4HDGA 2EFGA 3TTCA 1R3NA 4DMNA 3KK1A 1WOSA 5D15A 3ULHA 3UPFA 8RUCA 2IHR1 4I69A 1XNRJ 3PZPA 2BJ9A 5AKIA 4CF9A 2MZJA 2ZXIA 4R65A 3U9ZA 1F2HA 3CCQS 2DNGA 1HR0F 4PKIA 5M1QA 1V5VA 2G2OA 3CE8A 5MLCV 5AQXA 3ETOA 2K3IA 1FO1A 1RTJB 2BE2A 1DARA 4M47A 1PKUA 2Q6CA 3KLEA 1K0TA 4RQ7A 2ZUAA 3OYIA 5ETOA 3KOAA 2GCFA 3UQ0A 4EBEA 4Z4EA 3FNNA 1GOAA 4JI2F 4KLOA 3C2LA 5KG4A 2CH6A 4B8AB 1ZZFA 1R59O 4B9NA 4KLUA 1JKHB 1ZAVA 2P9UA 1S8OA 1VC5A 2HQ3A 2WB1C 1YI2N 1ZD2P 5KPTA 4DBQA 4DR3J 4CZJA 4V19J 2PC6A 1YJTA 1RCHA 2JMGA 2G13A 1WAFA 4FP9A 3FZMA 3RB0A 3EX7B 2ZVIA 2J9CA 2FPMA 4F7VA 5J2MA 2IDOA 4WK1A 2W3SA 2AGPA 1X4HA 2WFAA 3U4LA 3QEIA 4YOWA 1U0HA 3BPSP 2U1AA 1KD1O 4N77A 1WI8A 3M8QB 1EO1A 1HQUB 3NGDA 3EXYA 5KFIA 1YBUA 3WXLA 5AE3A 2R8KA 4OLAA 2ZJPQ 3V9SA 2KI2A 4IUFA 4MKYA 1JLQA 2E20A 2W2MP 3ZSYA 1HIWA 3A12A 1GQEA 1RWOB 3JAMO 2Y8YA 4CZKA 3LO3A 2YVSA 1CC7A 3O44A 5GADI 1S0OA 5J1PA 3RF9A 3BEXA 3ZZPA 1TQLA 1ZM9A 1KLMA 4FXWA 5D0RA 3TAMA 3H08A 4JKHA 2WFBA 2FJBB 2OEJA 3HT3A 3Q2TC 2IMWP 2W54A 3BZCA 4LFCK 3CCLS 4CF0A 3L3CA 2HCFA 1HWIA 1VQOS 4ZPAA 1ELOA 4I2JA 3GFYA 1VQMN 4DUYK 3TSUA 3AB2B 1S57A 1TL1A 4FZXC 1J6ZA 2QA2A 5AI9A 2ZITA 2BJ1A 2ZWPA 3M2UA 4CGJA 3CCSN 4EEKA 4XH4A 1KVBA 4KPCA 1KW4A 3TZZA 5ADXH 2AEMA 1KOHA 3C15B 5F8LA 2D0PA 9ICVA 3ETLA 5KRTA 2YMQA 2QO3A 1EWQA 1ZQQA 2ZTDA 4U8VA 1N2XA 1UCVA 3DRRB 4OJ1A 1BA0A 3JS6A 2IY5B 3ZX3A 5HNKA 4FE3A 3C7NA 4CHQA 2YKNB 3KUGA 1BU6O 4IYQA 4XUSA 2QK9A 3CCQN 4KB1A 3A3NB 3AO4A 2Q0RA 3PXGa 2UU9F 4C11B 2FJXA 3TAMB 4K25A 3MAAA 2WVBA 4NXMF 2K4HA 1HBMB 4XAKA 1BL3A 1Z26A 3PYDA 3AVKA 4Q45A 2I5HA 2GWSA 2F44A 2DFHA 4CGDA 2QGFB 3MPYA 4JKGB 3GONA 2FLLA 2DGQA 1ATSA 1KAXA 4US9A 5T7LB 5HLFB 3S9HA 1JXBA 2D7SA 1GOBA 4CJ5A 3HW8A 4CO5A 3KKSA 3OTBA 4DV6J 2DKZA 3B6OA 3KKAC 4KY3A 4USAA 2HI0A 4XQ8A 1DURA 4QZ8A 5K4LA 3WXJA 1FNMA 2O8EB 3NOGA 1Y5NB 1NDKA 1EKSA 4DR5J 3V81A 2NNWA 4DPXA 1JJ2R 2ATQA 4GVMA 1Q86T 1G2EA 2G0IA 2NRWA 3CERA 3NASA 4RUAA 1P27B 3U1NA 1VQ4S 3HJEA 3DNCA 2OH2A 2HVZA 3P45B 4FBTA 1X8DA 3WX8A 3BS9A 2AH5A 2P5VA 5K14B 2ZIXB 2AJ1A 3K57A 4K4UA 3MTKA 1V4SA 1W7AA 1MWYA 3BSOA 1NZAA 1L3UA 4OHXA 2UXBK 1UTAA 1FFUA 4OHVA 1QAYA 1C0UA 2EKYA 3QRRA 5I9EB 3ONNA 3ZI4A 1BD6A 2LQ8A 2FSNA 1Y3JA 2CDQA 3ZDBA 2CYYA 1JN3A 2WF9A 2UUCK 5J2QB 3F73A 1IBCB 1OSCA 3EZOA 4NLGA 4I2FA 2I9GA 3LZIA 1O08A 3VEXA 4K5SA 2IRYA 4H4MB 4BRIA 3NGKA 2EAPA 2GO8A 1WSJA 2D6FC 2GO7A 3GPAA 2OA8A 4A48A 3CC2S 2Y0SD 2O8BA 4XIUA 2O8BB 1AXQA 2P6UA 3M30A 3GFKB 1L7MA 2KXNB 5AM4A 1Q8IA 3D0IE 3D3BJ 1TKZA 2VQEJ 2W42A 4MLHA 2NLWA 9ICGA 5GAEP 2EZZA 2B56A 3VOVA 3J7YU 4DV4K 5KFGA 4JKFA 3UXOA 1NJYA 2ZEJA 1WF0A 1WHYA 4EYHB 3TAQA 4U9RA 5E5NA 1EIYB 2NCKL 3IM9A 4E1MA 4TSXA 4OZ1A 4JS4A 1CVJA 1OVQA 4DSIA 3A0IX 1IKYB 1SH0A 4MK7A 2ALZA 4CLSA 5LL6Z 5DGAA 4FZNA 3G86A 4DFKA 3N5BA 1C2PA 4CJ7A 2E7VA 3RJMB 4KFBA 2A3ZA 1CZAN 3CC7N 3NLCA 3GV7B 2H3QA 2VH7A 9ICTA 2VC1A 3QEAZ 2ASPA 2J6TA 3CJ8A 4PWWA 4YD2A 8ICJA 1N5QA 4YP3A 4DTRA 4X4QA 2P9LA 1RT1B 1OO0B 1FERA 4CZLA 2GIFA 3AY0A 3S3NA 1EXNA 3TARA 1C0TA 1K8KB 4NRTA 3W2VA 1DY3A 3TTFA 1HKBA 1V5IB 5CWRA 1TKTB 1NGHA 2A6OA 1IO2A 1Y5IB 3NS5A 4OX6A 2JHDA 3MCAB 1VRTB 3KYLA 4OL8A 3ICLA 4LF8K 3D9BA 5HMLA 1KLMB 4F4WA 3HBTA 2F4VF 2ZTEA 1PK1B 3J7YP 3I9V9 1CRXA 3LPYA 1EP4B 4NLPA 1FDAA 3TVZA 2MZSA 5E41A 4HTUA 3Q24A 1XERA 3HT0A 1ZQHA 2LHTA 5E0OA 4NYZA 5F0WA 4K4YA 1RAEB 4UATA 2GS8A 4F71A 3GP9A 1VQ5N 1U0SA 9ICBA 4E7IA 5DQHA 2JEJA 2JEIA 2VF3A 3M8PA 3MN5A 3TFSA 3M5RA 7ICSA 4K4HA 4L3NA 1Q8KA 4FPIA 4HUGA 1S1VA 2GJIA 1S0VA 4JKDA 4KHSA 4FM1A 1F9FA 4KLFA 3W62A 2VJVA 4WQ4C 5GAHU 1DGJA 3CP8A 3O6QA 3SV3A 4USTA 1ASVA 2FHMA 3P39A 3QWPA 2F3JA 3E51A 5JVGL 1NK5A 4Y2SA 2XO7A 3DLRA 1JXEA 1LWCB 2OFGX 3KHRA 1PIEA 2JJ4D 4WF9Q 2O8CA 3IV6A 1FRKA 3HFZB 1KXPA 1NJIT 2BVZA 1ZQNA 4K4WA 3VGMA 2QLFB 3MGIA 3DFEA 4OX8A 2JH3A 3PG9A 3GG1A 3AQOA 1TK5A 1B70B 3OVNA 3Q8LA 3T1YK 1RT2A 2H3VA 3H8YA 2B9XA 4OV1A 1U09A 1P9QC 2CIMA 1HNXK 2FMQA 2J8AA 2CZ9A 4I7FB 1JLGA 2MQQA 5DGBA 1QAIA 4Q0BB 3AU2A 4OV6A 4KTZA 3CCMS 4QR0A 4LBIA 3THWB 1WCLA 1OH7A 3ULEB 2RH3A 2XCAA 2YWKA 4DZDA 1A5XA 3K9JA 3J81U 3CCSS 1QZ6A 4ZH4A 3SEOA 3PIPQ 1QUVA 1ZTTA 1CBKA 3E01A 1XMQK 1V3SA 4XPCA 5CAAA 1VRUB 2CQ4A 4LRBA 3GOIA 4R5PB 2EG2A 9ICCA 2Q36A 4A2BA 4ECRA 3IMQJ 3CDWA 2AEJA 3MEKA 2KO1A 3CB4A 1REGX 2P66A 1B0XA 1WCNA 1CJUB 2UUCJ 1NM2A 2Z8QA 3CJQA 4F72A 3WK7A 4QOTA 4LT6A 4CHZA 5EY4A 2DNLA 1TVAA 2JDJA 3H59A 3GLJA 1BO5O 4J9LA 1M1GA 3BV8A 1C1BA 1F60B 1Q53A 4WTYA 3EZWA 3CJBA 4B3SF 3D2QA 1KNZA 5CR4A 4ECWA 4TQSA 1RHMB 3VQ7A 2QLWA 2YWHA 4LF4J 4FYVB 4TUSA 3F2DA 4X66J 4I9QA 4F50A 5AI4A 1X31C 3MEEA 1QAXA 3OV7A 1S5LU 2GFFA 4LIRA 3T6JA 3QLHA 3PKYA 3PHTA 1UAXA 2OELA 3FBCA 2E6LA 1UZHA 1K6YA 1Q8LA 1L3VA 2BBEA 4ZVOB 2UUBF 1N48A 1SL0A 1KQKA 5KFWA 3I5CA 3NH2A 2VPWB 3R1HA 2XI9A 4BR7A 2WSFC 3M05A 2E9TA 3H8SA 5ALTA 3MUMP 1B7FA 2IJRA 2U2FA 2HBZB 4Y2MA 1K73T 4LF7F 1NHVA 2F7TA 4OZ5A 2RF2B 2HDOA 3V4IA 1VLYA 2V50A 2GA7A 4DU8A 1ZD3A 2VJ5A 3PLAA 2OTJN 3CDAA 1ZBUA 4BROA 1AROP 1KDNA 3U26A 1Q81O 3TANA 3LH2S 3V6JA 8ICBA 1YBAA 1N0VC 3R3TA 4DXLA 1X4AA 2XHCA 4B9MA 3HVAA 4A8MP 1VQPN 2QRRA 3JXOA 4DFDA 3CSKA 1UJ4A 4R8UA 4BCAA 3O5TB 3J7YI 2JX2A 5A2QY 3G6EN 3VQQA 3M4XA 4CVNE 5GTHU 3HZGA 4UAUA 8ICNA 1RTJA 4C98A 2DY1A 2I8EA 5JMNA 5FIIA 1JB0C 2R42A 2NRHA 3AJ2A 2Q31A 4O0JA 3B4MA 2VPYB 1NK4A 3R6GB 1YTYA 5ALWA 2FVPA 3TVYA 3N97B 2V7YA 3BH7B 4HLBA 2CRXA 1FE4A 2O67A 5ALPA 5AK6A 5G4DA 1T9UA 5FJ4A 2CPFA 2XB2D 1XC3A 2D1CA 3SUNA 2W41A 3IWXA 2GOLA 4HR2A 1SWVA 4LF6K 3FBBA 5C24B 1PAUB 4QW9A 1T6DA 1Q82O 3MABA 1J54A 4KO0A 4CF4A 4H4OA 4QIWD 4CGZA 3VR1A 3RBEA 2CQ3A 3N28A 2IGIA 2ACMA 4QIGA 4RU2A 5KOWA 3IP4B 3VAMA 2ZH6A 4O4GB 1K8KA 4B8CA 4ECTA 5CCLA 3JYTB 1WDDA 3UDVA 4JNEA 2HRYA 5ADXA 4TYBA 1RT1A 2PE8A 3PKMA 3CUNA 1F1BB 9ICWA 5HVGA 3F44A 4BXOA 3UM9A 2ZOGA 2GVZA 4CGHA 2ZFHA 3CW2C 3VQTA 1TAQA 8ICPA 3TAGA 1T94A 4ZOHC 2BXJA 3ZTSA 3Q8KA 1TZ0A 2V8PA 4J2DA 2PEBA 5DO2A 2H3EB 4LF1A 1RAJA 2ZTCA 3NGYA 4C80A 4GW6A 1VQ8N 1WSHA 4QS8A 3DI6A 3CQYA 4LF7K 1KSPA 4JI7J 2KV2A 3HCXA 5GAGU 4HACA 4G1QB 4MT1A 5GAEU 1Y5LB 4A8QA 3TQEA 4H0VB 3OBYA 3OJSA 3TA0A 4BY9C 3IA0A 4CYUB 3QUTA 5HJYA 1DFDA 2OJ3A 3D0PA 3VHQA 2FVCA 4BX9C 2WVCA 1M5HA 4FF3A 5LJ3Y 1SVDA 4F0KA 3DMJA 4JI3J 3UD5A 4NWIA 1SXDA 2F8TA 4LFAJ 2EK6A 1BG3A 2VBXA 2DGOA 2JOQA 1C4CA 3BREA 1T11A 4KGXB 5AM2A 3MURP 2DR5A 3OR1A 2R7RA 4BLGA 1L6NA 3AARA 2DFFA 2OD4A 4H54A 2QL5B 4OYPA 1XK8A 3QX7A 1K47A 1FK9B 3NEKA 4WFYA 3AVIA 4H5VA 3A1YG 5J2JA 2GMHA 3CCES 4NI2B 4BC3A 4CJFA 2OEHA 5F8IA 5KFJA 5AXLA 4BRMA 8ICRA 1VQ9S 4JI7K 4PYAA 1H7WA 2AQ0A 1WELA 1IJFB 3HD2A 4MKBA 3DLKA 1FKPB 4DR2K 2XO6A 2DH9A 3GMGA 4PY5A 1N8RT 4MF8A 2MSTA 2ZJRL 4NEZA 1B3TA 3CMAN 3BY5A 5KFHA 3BGUA 4CH1A 4TU9A 2OHFA 3ISNC 4M5LA 4OYMA 2I7PA 1M0SA 3H8WA 4CNYA 4FOEA 3OYMA 1OY6A 2J76E 1OQ3A 2QEXS 1GMUA 2B0GA 1VCTA 4D3HA 2GQ2A 4J2EA 2P6RA 4PEOA 4KB0A 4C8ZA 1UT5A 5C0YA 2DT9A 3W2WA 2YV0X 1Q8BA 4BR0A 1LNQA 5HHHA 1Y9OA 1E4FT 1FJGJ 2KP7A 1WN7A 5EWEA 1DOQA 4RUBA 1RBTA 1Y64A 4A62A 4LVNP 4DL3A 2RHSB 2N7CA 1FRHA 4KQZA 3QINA 1GTEA 3VGVA 8ICZA 1SQEA 1IQTA 3LM9A 4Z7YA 1ZYQA 1FKOB 4IJNA 3MFHA 3DLEA 5D0EA 2DNOA 4DV1F 4ECXA 1CS4B 2AXTU 4CF1A 1IBLK 4K2JA 2KYZA 3QGPA 5HATA 1JJ2M 2GVDB 2WVDA 4J5OA 3NL0A 2KG5A 3MN6A 4TY8A 5AKZA 4J37A 3AQFA 5EE9A 2QB1A 1MU2B 1ATRA 4FN5A 4TLRA 2Z57B 3AJ1A 2ZJQL 3W9IA 3DYAB 4RQMA 3VMFB 4JKGA 1TKXB 4ZVUB 2AYBA 4OX9J 5IV4A 2A1AA 4CLUA 4MEYA 1CG2A 3ZDEA 2HG4A 3VF0B 1WF2A 2YNIB 3M2RB 4CD1A 3VA3A 4XPEA 1ZBHA 2A1RA 1T0TV 4FYXB 2ZZMA 1ZQDA 4HUEA 3ISZA 1FE0A 4M5DA 2YHYA 5LOQA 3WXMB 2FPLA 9ICIA 5J0YA 1T3OA 3J7AN 1YWXA 2QTDA 3KG1A 2FJAB 3T1HF 3T3FA 3S8SA 1CQNA 2ZBIA 3CJ5A 4ILHA 1WSGA 5J0SA 2ROEA 2XTJP 3G6XA 3N4PA 1KLNA 5ETNA 1IV0A 4DTOA 2VFRA 4LF5F 4NLCA 3VETA 1UWBB 2HQDA 1QH9A 5LMUF 1PJ5A 3JQJA 4LRFA 2KHDA 3IR7B 4UB3A 5IC4B 4BBYA 1BWEA 4BRAA 1Z05A 1MQ3A 3D6FB 2N4DA 5DDRC 1N33K 1Z4NA 4DFJA 1R31A 2KJWA 4JN4A 2CPJA 3HYFA 5HROB 4K0KF 2HRTA 4QW8A 1NK6A 3IWLA 2QT7A 4KHRA 4CGGA 1KC8T 1VIOA 2XS7A 1JCGA 4O3PA 1HWJA 1DTQB 4NL9C 4ELVA 2D3ZA 4FNIA 5LSOA 1VSDA 1PYTA 3D7EO 2YKOA 5I3UA 2L9DA 2NQPA 3HXMA 4S0MA 2YNHA 1JKHA 1RDBA 3EZUA 2R18A 3CCRN 4B3RK 3K7RA 2C2MB 1KN5A 3UDLA 3TEHB 3DXKA 3GSIA 4KLDA 1I94J 1S4EA 4KKOB 4DV7F 3N0VA 3THTA 2OD6A 3ZETB 3L4PA 5TISU 1XU4A 3OHAA 4UZBA 3V6DB 3NS6A 1SKRA 1E4GT 3R5BA 2ZC4A 5ETRA 4A59A 1XIQA 1U2VB 2WAQF 4B6JA 3UIQA 2PMZC 3FQKA 4IFYA 3W2VB 2HK3A 2OXOA 3GDQA 2WK4A 1FX2A 1TVRB 4Q2MA 4JI4F 3K5PA 5KFNA 3CJRA 5ETMA 1RB0A 2KJ5A 3HFVA 2FI1A 2KEYA 1RKJA 2CQIA 4H0XB 4DFPA 5FPEA 3JTNA 3QAUA 3G87A 4E19A 2AWZA 4LZGA 3GR1A 3KJVB 3J7Z5 4FBUA 4CJ3A 4PWUA 1TUGB 1SZPA 2CQHA 3H5XA 2G5HB 5D3GA 4IG3A 4HUFA 2PMZD 1H38A 3MDCA 2B43A 4UAYA 4M7YA 1B7YB 2JWKA 2ZOMA 3HHLB 3MPUB 1RI7A 2QFJA 2GELA 4KHPK 3AU6A 1P1TA 5B0EA 2FC0A 1WUAA 4QYZK 1GXTA 4Z6EA 1OYDA 3KK7A 1R8HA 3TSPA 3CFPA 1W0HA 1TV6B 2B8PA 2UXBJ 3VAHA 5J2MB 2QXLA 4O44A 5CY4A 4B02A 4BS2A 5DMRA 5KQ8A 1TAUA 3A3PB 5CHGA 4Z6CA 1JLAA 5A76A 3R9KA 1SAZA 3FRYA 3VC8A 2HBYB 3B8AX 1SJFA 5CR0A 5KT3A 1IBLJ 2L3MA 4DL6A 3H0PA 4IG0A 4DUZF 3P6YC 2CFXA 2X1BA 3A5LC 4QIFA 1YJ7A 5C15A 2BQUA 3RJGA 4C8KA 1JXVA 2BV3A 5SWMA 1S77D 4I2QB 1U1MA 1RLDA 2RHKA 3GYXB 3WZ0A 4LQ3A 4J9MA 2YQ0A 4EZ6A 2BW2A 2ESEA 2HBJA 2BKPA 4DDFA 3W3DA 2B51A 2FF3B 2NXJA 1U6BA 3MFIA 3V9ZA 4F91B 3QBXA 4EU0A 3TA2A 4QS9A 3ZNUA 1NSPA 1X3MA 4GV6A 4PRFA 3CJKA 4UARA 1RILA 5D46A 3MAHA 5CEHA 2E66A 2Q97A 3CIZA 2OM6A 2DGUA 5IM0B 4DL0C 3EVOA 1KOOA 2B5JA 3P83D 4M6WB 4KPYA 4FPRA 3OTDA 5KRSA 1F5CA 3DLLL 3QZ8A 1RG6A 2LU1A 1CS4A 4B9UA 2W43<