2HVIA

Ddctp:g pair in the polymerase active site (0 position)
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'
total genus 210
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hviA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hviA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hviA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hviA01
3M8SA 3NHGA 2F1HA 3AVKA 1COOA 3WNGA 3S3MA 7ICMA 4ID5A 5C25A 5KFQA 3BGRA 4KB0A 2XY7A 3QEIA 1TAUA 2HVIA 3RJKA 4BXOB 4M9HA 1T7PA 8ICUA 4DTXA 5DDMA 3RJJA 5KT2A 5J2FA 3MDCA 4QZ9A 2Z1JA 3V6DA 4M3ZA 1WSIA 5C24A 4Q45A 3NCIA 5L1IA 4DTNA 2HHWA 3RB6A 4DOBA 4N47A 1ZBHA 4JV0A 4EZ6A 1RZTA 5KG6A 3MR2A 4KHQA 4LD0A 1WLJA 4DFMA 3C2KA 2IGIA 2ATLA 4ECUA 1VSFA 4DOCA 5DBBA 2IMWP 4H4MA 4BGDA 3RMDA 1GOCA 7ICIA 3M9OB 3ZDCA 1SUQA 2R8HA 4DL2A 2C22A 1QSLA 8ICHA 2ZJAA 3LPTA 2DY4A 1BCOA 1A5VA 3MXMA 2ZTEA 1ZQZA 2C28A 4M47A 3MGIA 4MF8A 5J2PA 4RPZA 4F4WA 3QEXA 4J2EA 3H8JA 7ICGA 4YMNA 4Z4EA 3AO4A 4R63A 1BI4B 4UBCA 4GXIA 4RUCA 3MR5A 4DTRA 5J2KA 3PW7A 3PW5A 2ZJ8A 4OKJA 3SZ2A 1RBUA 1HYVA 4KITB 4ED2A 9ICIA 1XO1A 4XA5A 1XSLA 2G8UA 4KLHA 4E7JA 1TV6A 5KTQA 4FO6A 2BCVA 1N5YA 4XIUA 1AROP 4H4OA 4HTUA 4KLMA 3ISCA 4KTWA 2HHQA 5HBMA 4I2IA 4RPXA 5KG0A 4DQQA 3DRPA 1ZQEA 1W9HA 3V1QA 5KFBA 4M3YA 1KVCA 4UB2A 4R65A 2EX3A 3QZ8A 4DTPA 3N97B 3H8SA 4DEZA 5KT7A 2VA2A 2VG5A 1RYRA 1JKHA 1KCFA 2D5RA 1S1TA 4J2BA 4B9TA 1C6VA 1RDCA 4C8OA 2G8FA 1EP4A 3ETLA 3NE6A 1UT8A 1VSDA 3ISNC 3BQTA 1ZQNA 4H8KA 1PZNA 5CZ2A 4NM1A 3OY9A 4XUSA 2WONA 3OSPA 3RWUA 1Z00A 5BPCA 3HT3A 2Y1JA 4RUAA 4CF1A 3GQCA 3M9MB 1D8LA 3V7JA 3IHQB 2HW3A 3NGZA 4I2FA 1KFTA 2UVVA 4FVMA 1JLQA 1EETA 5J2QA 3K5LA 4QW9A 1C0MA 3B6PA 2HHVA 2NRXA 4KLQA 3OYGA 1ASUA 4LH4A 5I42A 3QETA 2J6UA 4CFDA 3NH2A 4PGXA 4ELTA 1BQMA 3DOLA 3I0SA 4PA1A 4N56A 4CF2A 3I8DA 2IA6A 2B5JA 3THVA 4RQ8A 4ED7A 3AO3A 5J2BA 3NDKA 4ECSA 1A77A 4CJPA 4KAZA 2OPQA 3JYTA 4CJTA 5DB9A 4ED8A 4DQPA 3GILA 4RW7A 5J2JA 8ICRA 2VG6A 4G1QA 2BGWA 3DM2A 9ICKA 4FLVA 2O4IA 1CZBA 4BXOA 2VANA 3VQDA 4J2AA 3JPRA 3ALYA 2B6AA 3BDPA 3NBPA 9ICUA 4DSFA 3NF7A 1T03A 5IILA 2FBTA 3H08A 4CJKA 4M3TA 1V9PA 4OVLA 9ICOA 4CJEA 1L3UA 4E1NA 3ZSRA 8ICYA 4CHNA 1NK4A 4RQ4A 3LP3A 4DFPA 5J0XA 1KLNA 1SKWA 4DSEA 1B92A 2XY5A 3K2PA 2HHSA 1S97A 4F50A 2ZUDA 4DSKA 1XSNA 1JLGA 5KFZA 2QKBA 1NK5A 2KTQA 3DLBA 3T5HA 4QWDA 4B9LA 5J0WA 3KIOA 3ZSVA 1NK0A 5KFGA 4IKFA 2RN2A 3SQ4A 4K4IA 1NJXA 3D45A 4Z4IA 5J0RA 2FMQA 1ASVA 3Q8RB 3ZSQA 5EWFA 4KLSA 4ELUA 5CZ1A 3VQ8A 2BKEA 3HPOA 1HNVA 5CJ7A 1A5XA 3VQEA 3ZSYA 5TZVA 4B08A 4FM2A 2ZTCA 4FZZA 4O4GA 1TK5A 8ICSA 4Z0UA 4CGIA 5J0PA 2G8VA 1XHZA 5D49A 3AVBA 2YKNA 4C8NA 5L1KA 1IKXA 4AILC 4YR3A 2ASDA 3BQ2A 5IIJA 4CGDA 4KHYA 4KRFA 4PHPA 4EZ9A 1TKDA 4QZCA 4YCXA 3JSMA 4RNMA 3CFPA 3MDAA 4E1MA 5DBCA 2ASJA 1NKEA 4QZBA 3NFAA 1TK0A 4J9QA 2PI4A 3V6HA 5KFDA 4B8AB 3CFOA 1T4GA 3MXJA 4IDKA 7ICTA 3O4NA 5J1EA 3C23A 4ECXA 1WCNA 4KLIA 3UXPA 9ICCA 4QZEA 2YNIA 2AJQA 1C1CA 2KZMA 2C2EA 3KD1E 8ICLA 3ZT3A 1SL2A 2KQ2A 1DGSA 1LWFA 3C21A 2XCPA 3GDXA 4DO9A 4PUOA 4NLKA 4Q43A 4J9KA 3DRSA 3DMJA 1Y97A 2X74A 4CFCA 2IBKA 2FLNA 4AHCA 3HXMA 1Z00B 4CJQA 2KN7A 8ICBA 4B9SA 4YFKA 3KKRA 2VWJA 1NJZA 3OYEA 4QOZB 3RR8A 1WSEA 4BWMA 3VQPA 3RBEA 7ICRA 3ZDEA 4KLGA 1ZETA 2D0AA 3LWMA 1BPBA 5DBAA 1SZPA 2KW4A 4O3OA 3M8RA 2VG7A 1CUKA 4DG1A 5C5JA 4O3RA 1IG9A 1BPZA 8ICFA 4PHDA 3OS1A 5DG7A 2JEIA 1CXQA 4MFCA 3AO2A 5EWEA 3N4MB 2Y1IA 1RTDA 5DQGA 1S0MA 5KG2A 5DB7A 1SL0A 4PWDA 2VA3A 5JS1A 7ICEA 5IIOA 1VSHA 2F8TA 2YHBA 3AVNA 5DLGA 2HNZA 2I5JA 3PR5B 2RPIA 8ICTA 4FLUA 2A1JA 3SYZA 3RR7A 4W5NA 4GXJA 2HMIA 4YXJA 2R7YA 1TL3A 1JLAA 1X9MA 4FCYA 4M3XA 4I2BA 2ITGA 4FJNA 1HJPA 4PY5A 4ECYA 2DFLA 3P83D 2RDIA 3OJUA 5KFTA 2XCAA 3MEEA 3FFIA 3JPTA 2Z1GA 4QZIA 4CIGA 4RT2A 1XSPA 2GBZA 4JWMA 3HPGA 4BE2A 3C1YA 5BOMA 3VN5A 2XC9A 2BHNA 3MBYA 2W8LA 4FM0A 3HPHA 4M6WA 4YQWA 3TAQA 1TVAA 2QXFA 4RU9A 4FK0A 1N48A 4M42A 5HNKA 4I2JA 1S9EA 2EHGA 3AA4A 5DK5A 1Z3EB 3T5JA 4KLJA 4CESA 3LALA 2W8KA 4CF9A 4UB3A 4CJFA 2PYLA 4KPYA 1C7YA 3VA3A 3ZSZA 1RT3A 3GIJA 2AGQA 5J2GA 3RJIA 4QW8A 4F91B 4FW2A 1U04A 2C2DA 4Q0BA 3AV9A 9ICPA 4DQSA 2W9CA 2PFQA 4AHUA 4IRDA 5KFVA 3V6JA 1U47A 2JEGA 1IXRA 5JS2A 4JWNA 4CERA 3SPYA 4NCAA 3DLKA 4E19A 3ZT0A 3RMCA 4ED0A 3AA3A 4CJWA 2NRZA 5HLFA 4P4MA 1TK8A 3RB3A 1KSPA 4MFFA 7ICHA 4CGGA 2OZMA 4ECWA 5KG7A 1NKBA 2P5OA 2AQ4A 2ETJA 3LP2A 1C1BA 1F21A 4TSXA 4FLTA 5KFYA 2J6SA 1BPYA 1S76D 5HRRA 2FLPA 1ZQHA 9ICQA 4MFAA 2KFZA 1TAQA 3OYMA 1ZQAA 3PO5A 5KFSA 4I9LA 1Q8IA 4OJRA 4FLXA 4IFYA 1ZBLA 1RTJA 1O1WA 1GOBA 4UBBA 3JPQA 4ZTFA 4OKKA 4FZXC 5L1JA 1FK9A 3IRXA 4IQUA 2VWKA 1L3TA 3RRHA 2C2RA 3EW9A 3H8WA 1VSJA 4ICLA 1TFRA 4Y1DA 1LAVA 8ICPA 1NOZA 3LZIA 1S5JA 1RT6A 1FXXA 5HMMA 4LZGA 2WTFA 2AQ0A 3VQBA 4N5SA 4CGHA 4ECVA 1C1AA 9ICTA 1IM4A 1QE1A 5FRMA 3H7IA 2PY5A 5KI6A 4YMMA 9ICHA 2JGUA 4JV2A 4UB5A 3RJFA 2FMSA 3HO1A 5J0OA 2WOMA 4J2DA 4DF8A 4CEFA 5C42A 5EU7A 3LWLA 5HMLA 3SQ1A 2BR0A 3QNOA 4JUZA 2KZ3A 5HRSA 2UVRA 8ICIA 3QIOA 3DLGA 4IQVA 4RW9A 3AVJA 3L2VA 3OHBA 5L1LA 3HYFA 4BDPA 5J0SA 4X5VA 3ZSOA 3UPQA 3L8BA 2P1JA 1JIHA 1KVBA 4B9UA 4I2EA 4O44A 4K8ZA 2IAJA 3KJVA 3AU2A 4QZHA 4DTSA 4DWIA 4FXDA 4YXMA 5FDLA 3MR6A 4CJ3A 3DI6A 1HJRA 2QK9A 2F8SA 4ELVA 4RW4A 5J2AA 4RT3A 1U48A 1TGOA 4TUQA 4KO0A 5T7BA 2XHBA 4CEBA 2PFNA 2BDPA 3EZ5A 2QKKA 1NK6A 4GVMA 4EYHB 4KI4A 3HL8A 3AVIA 4WE1A 2O4GA 3Q8PB 2OZSA 1HYZA 4GC7A 4HUGA 3NGDA 5KRSA 4DS5A 2OPSA 4M3WA 4DSJA 5KFHA 5DGBA 4EBCA 5DDYA 9ICAA 4Q44A 4XRHA 4RQ5A 2YHAA 3TFRA 3HM9A 4K4HA 1BQNA 3O4QA 3VQ6A 4UB1A 4JK1A 4NLGA 3MABA 3LP1A 4BE0A 1TKTA 9ICBA 5K14A 4YP3A 4J9SA 4CHPA 5HRPA 4RW6A 3MXIA 1YT3A 4W5TA 3ZSXA 4C8KA 1RT1A 3G6YA 3TQ1A 2Q0ZX 5J29A 1VRTA 4UQGA 4FZYA 1RTIA 1D5AA 5HHHA 1NOMA 3UXOA 2IS3A 2BCUA 3QO9A 5J2HA 1D9FA 4I2HA 3OS0A 1CEZA 3E01A 3GV7B 4IRKA 1A5WA 1HUOA 4CIEA 3KLGA 4OGEA 9ICMA 4L8RB 4FJXA 1UAXA 1ZYQA 4M0AA 3PW2A 4RPYA 1J9AA 1S0NA 2MAXA 4M45A 3TI0A 2ZUCA 3QNNA 4PPXA 3HVRA 3RB0A 4QZFA 1S0OA 1ZQMA 3L2QA 9ICVA 4FLZA 4AHTA 2XGQA 1RT7A 4Q5VA 4QZGA 4R8UB 5KFNA 5KFOA 3OYJA 3C1ZA 4EBEA 5KFUA 4Q8FA 4KV8A 3SI6A 4ECRA 5J2MA 4Z4GA 4I2DA 4OLAA 4NLZA 1S77D 5KFEA 1SKSA 4ED3A 4YVZA 1RTHA 4CCHA 3LK9A 2E6LA 2V4QA 1R0AA 4J9RA 3FYHA 4JS5A 4KHSA 1RDDA 1VSKA 1HQUA 3RH5A 1LW2A 2ZD1A 1WNSA 2BPCA 3WNEA 1ZQWA 3UQ2A 4DF4A 3EPIA 2BPGA 3MFIA 1BI4A 2ZUBA 2P6UA 1YVUA 4DLGA 4M9NA 3CM5A 1BPXA 3ZD9A 4EP4A 4P2HA 7ICVA 3U3GA 4KLDA 3CG7A 5FRNA 3OYFA 3LDAA 1FKPA 5KT4A 3KTQA 3AVMA 3NTUA 1X2IA 2E6MA 3OGUA 2FPKA 4CHZA 1ASWA 5KT6A 1X9SA 9ICLA 1RDBA 4KTZA 3QEVA 3PMLA 9ICGA 3V9UA 5KRTA 3K59A 2XO7A 4R66A 1KFSA 5DLFA 3ZT4A 4R5PA 4TUPA 4KLLA 5JUMA 3SCXA 1RXWA 5DQHA 3T3FA 2FLLA 1IH7A 4ZHRA 5KFCA 2R8IA 3HP6A 3TAGA 3RMBA 4QWBA 3SV3A 1HYSA 4MEYA 1SL1A 2H5XA 2DPJA 4I2GA 2ZE2A 5SZTA 4KI6A 2LYHA 3H40A 3K4GA 3KLIA 4TQRA 3SPZA 3D0PA 4UB4A 4E0DA 3ISBA 4FS1A 4F8RA 2IDOA 3GV5B 3PX0A 3S3NA 1BGXT 3HW8A 4TQSA 8ICOA 5EWGA 1B22A 1S6QA 4NYFA 3F73A 5J2NA 1Z26A 3OHAA 3JPPA 4ED1A 2HVHA 3M8PA 1TV9A 4ED6A 1NK8A 1XS9D 5D3GA 4J9OA 3DOKA 3OYKA 4YD2A 3H4DA 4KLOA 2R8GA 2GUIA 4DLEA 1LAWA 4LH5A 3V7LA 4KMUA 4LZDA 3H4BA 1Q9XA 1WN7A 1J54A 4DL7A 1A76A 4IQTA 4KTQA 8ICWA 4B9NA 1RPLA 3C5FA 1UA0A 8ICQA 3OYCA 4O0IA 1MQ2A 4F5OA 2Z1IA 4YMOA 3S3OA 3V9XA 2JZBB 2PFOA 3VA0A 3AVLA 1U49A 4PH5A 2G8KA 4CJSA 1B9FA 8ICVA 5HROA 4FLYA 4CJLA 4O3NA 4DOAA 4Z6CA 3TWHA 1K1QA 1MSWD 5KFJA 5CYQA 4KN7A 4RQ2A 3QERA 3QESA 3OYDA 3ZDBA 3MEDA 3GIKA 4ECTA 5KFKA 1EX4A 1GOAA 2ASLA 2X78A 3EPGA 3T5KA 1ZQDA 2BQ3A 4F5PA 4I7FA 3U3YA 3UIQA 4DTJA 5KFWA 1JMSA 2FBVA 2D0BA 4RG8A 4F5RA 5CYMA 3NGIA 2ISOA 4HHTA 3G10A 1VSLA 3CM6A 4EYIB 1TKZA 4KHWA 3DRRA 4F5NA 3MEGA 3K5NA 5I3UA 4DL5A 5EOZA 4J9MA 1QTMA 3AO1A 4NLNA 3LAKA 3RH4A 4CJRA 3NGYA 4FK4A 3LPUA 4E7HA 2RDJA 1BCMA 3PX4A 3CQ8A 2OWOA 3AO5A 9ICSA 3AA5X 2YNFA 3RAQA 3RJHA 3Q8QB 3P1GA 3RBDA 3TAEA 4J9NA 8ICEA 1ZBFA 4I29A 2GV9A 4KLEA 4FJ7A 3AUOA 1XHXA 3V4IA 1ZQLA 4IQWA 1BPEA 5F9LA 1N6QA 4EBDA 3O3GA 2IOCA 3EY1A 1QHTA 4QZAA 4DU4A 3DLEA 5J0QA 2BPFA 5BOLA 3QINA 2YNGA 2R8KA 2I1QA 4E89A 2P5GA 4O5KA 3VQ4A 1VSMA 3K5MA 1B43A 3C2LA 1ZJNA 1QLNA 5KGWA 3QZ7A 4I9QA 1KVAA 2KZZA 4F3OA 4LSNA 2W9MA 5D46A 3PY8A 3SJJA 2G8HA 5D4BA 5J2DA 1RBRA 3OYLA 5KT3A 2IHNA 2HHUA 2XGPA 1BIZA 3AVHA 3V9WA 3OS2A 3DYAA 4CK2A 4KFBA 4AHRA 4QAGA 4CJ4A 3T1AA 7ICOA 3OYIA 1ZQSA 4E7IA 3K5OA 4O55A 1LW0A 2J6TA 4RW8A 2PFPA 4M9GA 4I28A 4O3QA 1MU2A 3ZD8A 1IO2A 4FBUA 1I39A 4IFVA 1QQCA 4FJ9A 3HSTB 2FMPA 3UXNA 3SI8A 1XI1A 4QCLA 4KHNA 4CFBA 4C8MA 4HCCA 4LSLA 3PW4A 1WAJA 2E4LA 2F1JA 1CXUA 2D0CA 4CGJA 5DG9A 3V1RA 1ZQTA 3HVTA 3OYBA 1RNHA 4Y1CA 2F96A 3AVFA 2W42A 3JPSA 4K4GA 1H38A 2MUTA 4RQ0A 3GIMA 3UQ0A 4M3UA 4NXZA 1MC8A 9ICNA 1RT4A 1ZBUA 3JPNA 1ZJMA 3DLHA 1S9GA 3OYNA 1KRPA 4JV1A 4M04A 4RQ6A 4R64A 3KHLA 3KK3A 2V9WA 5KFXA 4EEYA 5DKWA 4XQ8A 3C2MA 3C5GA 3U6FA 4CEDA 1HNIA 4QWEA 1UWBA 4IG3A 5FROA 1T05A 1WSFA 8ICAA 4Z6FA 3QLHA 3KD5E 2RKIA 3Q8MA 2IC3A 3FDSA 4BACA 8ICJA 3MAQA 1U45A 3NF6A 4JS4A 1JLCA 1K1SA 4ID1A 3KHRA 4MEXA 2FPMA 4DFKA 3L3UA 3NAEA 4OPJA 3DLRA 2AGOA 3C95A 3RMAA 3QEAZ 1HQEA 3O3FA 1YTUA 3GIIA 3G6XA 8ICCA 3OYAA 1ITGA 3ZDDA 4UAZA 2JLEA 1Q9YA 4BDYA 3TR8A 2NUBA 4FJJA 8ICGA 1UT5A 3SUQA 5L9XA 1DLOA 5E41A 4LVSA 7ICJA 1LWEA 4CK1A 4TURA 2OYQA 1S1UA 1JL1A 4ZTJA 4J9PA 4I2PA 2G8WA 1JXLA 4HVJA 1KDHA 2PYJA 7ICLA 4FJMA 3KLHA 2NRTA 5CA7A 4BE1A 4HYKA 1HRHA 3PNCA 2Z1HA 3K57A 1NJWA 4RQ7A 4E7LA 4IRCA 4YG2A 4MF2A 5DB8A 2A1JB 3NH1A 4N41A 4O3SA 4GXKA 4NY8A 1WCLA 5IIIA 4NM2A 1ZQGA 5KG5A 3V72A 1C0UA 3VQ5A 3V81A 4PGQA 2ZTDA 2YKMA 2DFHA 4QWCA 4B9MA 3RH6A 4IG0A 3T5LA 5IIMA 7ICQA 3A2FA 4F4XA 1BVSA 1ZQIA 2FBYA 1RCHA 3TANA 1S10A 3TFSA 1HUZA 4DQRA 2I9GA 2JEFA 3K75D 2PI5A 4NYNA 2A1RA 3ULDA 2VA8A 3KK1A 3SV4A 4KHUA 4RNNA 1VK0A 4O5EA 5J0TA 5KFMA 4I2CA 1RILA 2BCRA 3G0ZA 7ICSA 3PV8A 4JRPA 4FS2A 4JRQA 3VQ9A 5IINA 1NKCA 4IR1A 2NRWA 5J0YA 2RF2A 4E7KA 4KLFA 1J53A 2P51A 3OJSA 1RT5A 1X9WA 3M8QA 1BL3A 2BCSA 3TARA 3WNFA 3L2WA 2BQRA 4OLBA 4FLWA 4FJ8A 4FK2A 4FJIA 3CYMA 5J2CA 1WSJA 1SV5A 1WSHA 3VQAA 3K58A 3BQ0A 4Z4CA 1U9LA 4BWJA 9ICJA 3AVCA 4RNOA 5KG4A 3OVNA 1ZQPA 3OYHA 4DMNA 4YN4A 1ZQVA 3MGHA 2P66A 4M6WB 4B8CA 3ITHA 2HB5A 1NK9A 5KFRA 3AVGA 4DFJA 2G8IA 4O9MA 3HJFA 4Z6DA 2BANA 1JXBA 5DG8A 4DL6A 3IAYA 1D8YA 3L2RA 3QEWA 3MR3A 2W9BB 1JL2A 2AU0A 1WSGA 3GFKB 3RJEA 4F4ZA 1QSSA 4FBTA 4F3TA 5HRNA 2DTUA 9ICRA 2LSNA 4FJ5A 4KLTA 1G15A 1TVRA 3V7KA 3LAMA 3BQ1A 4IBNA 3G6VA 3TABA 3LANA 4KN4A 1ZQQA 4I2AA 3WNHA 5SWMA 5KFAA 1S6PA 3LDSA 3I0RA 3SNNA 4QZDA 3C6UA 4F93B 4DSIA 1ZQCA 4BDZA 4CJ5A 1CLQA 2MUTB 3B0XA 5CY4A 2XY6A 2UVUA 1VRUA 5KG3A 3RJGA 4C8LA 5KFLA 1UOCA 7ICPA 2X6SA 9ICEA 4CHQA 2PZSA 3S9HA 3C6TA 5CWRA 3QIPA 4CE9A 3RTVA 4Q8EA 1WAFA 4OKEA 4TUSA 4B9VA 2ATQA 3Q8LA 4KREA 4LY7A 3L2UA 4B3OA 5DMRA 1S1VA 1RT2A 4YNQA 4FJLA 2YV0X 2KFNA 1NK7A 3RB4A 4KLUA 2JZBA 7ICNA 4F2SA 1ZQKA 3QEPA 2Q3SA 4CK3A 4M9JA 9ICXA 3KHHA 4GLXA 5CB1A 1XWLA 1IKVA 4MFBA 5KFIA 3VQ7A 8ICZA 5CHGA 1BPDA 1T3NA 2XRIA 4W5RA 4NCBA 5HP4A 4CEAA 1J5OA 1LB2B 4PHAA 3PMNA 1D9DA 2OPPA 8ICMA 5DB6A 3SQ2A 4RZRA 1ZQRA 4YR0A 5KT5A 1EXNA 2X6NA 1KTQA 4KB1A 1Y88A 4O0JA 1JLBA 3ASMA 4NCGA 9ICWA 4GMJB 3L3VA 1HMVA 2HNYA 4CJVA 4F4YA 9ICFA 3AA2A 3HWTA 4MQ3A 4I27A 4UAYA 2A1SA 4DL3A 1LWCA 4G3IA 3E2EA 4CF0A 4I2QA 1TKXA 3Q8SB 3B6OA 4JLHA 3KLEA 4RQ1A 1ZQYA 7ICKA 4PHEA 4PGYA 4CEEA 3KK2A 4AH9A 4O5BA 2IHMA 3EYZA 1I3AA 1KLMA 2B21A 3V9ZA 2M9NA 3TAFA 1JXEA 1VSIA 3SUOA 3PO4A 3VQQA 4DTMA 1KFDA 1JX4A 4PQUA 2AGPA 4AHSA 1JLEA 4M3RA 1B9DA 8ICXA 3PX6A 1W0HA 2YNHA 2P6RA 2W9CB 1BHLA 4RQ3A 3VQCA 4F4KA 3KKSA 4FW1A 2B4JA 3HX0A 2DPIA 2W9BA 5IIKA 4QZ8A 1K6YA 2XY8A 3MECA 2HHXA 3HK2A 3IS9A 4K8XA 3QE9Y 3ZT1A 1FKOA 3PVXA 3EWAA 5F9NA 1EKEA 4CEOA 4FJHA 2ZQBA 4O3PA 1L5UA 4DTOA 2BE2A 4Z4FA 2GWSA 3CFRA 3BJYA 4J9LA 1T8EA 3RRGA 3P5JA 3JPOA 4R8UA 3IM1A 2OPRA 1RBVA 4CHYA 1L3SA 7ICFA 4F5QA 4HCBA 1QSYA 3V1OA 3PW0A 1KEJA 4YD1A 1RYSA 4GC6A 4W5QA 3TAMA 4CEZA 1N56A 1HPZA 5KFFA 4HUFA 3IG1A 4CFAA 3SQ0A 1IKYA 4HUEA 1ZQUA 5KFPA 4W5OA 1S9FA 3ZT2A 5DQIA 3NF8A 1S0VA 4KKOA 1ZBIA 7ICUA 4CGFA 1C0TA 4DQIA 3TAPA 4YFUA 1ZQBA 4GW6A 1IKWA 5KG1A 4P4PA 2FBXA 1XU4A 2V4RA 1U4BA 4FM1A 3ZDAA 3KLFA 8ICNA 3SUNA 4CJUA 2HNDA 4Z6EA 5J2IA 3SUPA 4DL4A 3M9NB 3ORYA 4M2YA 1ZQJA 5CP2A 1LV5A 5HP1A 3V6KA 3MFHA 4FJKA 1SKRA 4EP5A 4UAWA 4IR9A 1JN3A 3AVAA 4FJGA 1BISA 4DTUA 4DSLA 3C94A 1RXVA 2BCQA 5HHIA 4DS4A 5DGAA 1REVA 1EXQA 3AU6A 4P4OA 1BIUA 1TL1A 2FC0A 1YTAA 2DFFA 3V9SA 2R8JA 2ISPA 4CEQA 2HHTA 4ECQA 1JLFA 4F92B 2BGGA 2ALZA 3OSNA 2DFEA 3PUFA 3F9KA 3HP9A 3LP0A 4OPKA 4CF8A 3Q8KA 1ZQFA 1UA1A 1RDAA 5KGXA 1QS4A 4Z4HA 1RBTA 4AHVA 3LZJA 1NOYA 1DTQA 2UVWA 2W9AA 3KHGA 5J0UA 3GV8B 2JEJA 4M41A 4DU1A 1CZ9A 1DTTA 1Z25A 4F2RA 1RBSA 4CECA 4FYDA 1ZQXA 4CHOA 1VSEA 4E3SA 4N76A 1NJYA 1X1PA 5J2EA 4OGCA 3RAXA 2ZJ5A 1DOQA 5CR0A 4QWAA 3ISDA 3NH0A 4O5CA 4YR2A 3NF9A 2FPLA 1XC9A 1S1XA 2BQUA 3T19A 2OA8A 4ECZA 3PR4A 1ZQOA 3B0YA 3O3HA 1S1WA 3QEBZ 4M9LA 2PXIA 2F1IA 2NRVA 8ICKA 3ZCMA 4ZH4A 4DU3A 4CIFA 1MQ3A 3ZSWA 1L3VA
chains in the Genus database with same CATH superfamily
2IYGA 2E1ZA 4YHHK 4GV9A 1S6QB 3NHGA 2G09A 1URRA 3FEXB 3BN4A 5CYQB 3HRDD 1GK8A 3U1LA 5C25A 3DU6A 1VQ8S 2HURA 2HVIA 3RJKA 4Y2AA 4FWPA 3CMAN 5DDMA 2QYCA 4Z37A 2AJ1A 3C6HA 4NRUA 2CPFA 5CXTA 3J7A1 4QZ9A 4EHUA 5JVHL 2DNYA 2DH8A 2VKZG 1B0TA 4OI1A 1Q82T 1VYAA 1Q78A 2EKYA 4KX3A 2HHWA 1K73O 3RB6A 2F5GA 4N47A 1AUSL 1F9EB 4JV0A 4OFZA 1I6JA 3PHTA 1F2GA 3CC2N 1YKWA 3CJAA 1EQYA 4KHQA 4FZMA 3EVOA 1WLJA 5LL6d 2UUBK 3ZEUA 5LY3A 2H4YB 3ULHA 4DR7F 1VSFA 1J5EF 3D6FB 1YITN 1DK3A 2IMWP 4H4MA 1GOCA 3GE1A 5B0GA 2OD4A 2F4VJ 2C2ZB 1LKYA 5F0WA 2R8HA 5ETPA 8ICHA 3LPTA 3LTOA 2EZXA 1M1GA 4LF4F 1IV8A 3W1YC 3QUQA 2V7ZA 2CPEA 4J5OA 1ZQZA 4RCHA 3MGIA 4MF8A 2R18A 1X5OA 4RO0A 3QEXA 1DRZA 2AYBA 4YMNA 4Z4EA 3POTB 4ZN1A 3KKFA 3WK8A 1V3SA 1NMNA 1JXVA 5GMDA 4F4AA 1OY9A 4JI4J 1UFWA 1DEJA 4YOTA 4A4JA 4ED2A 3PIPL 5K8MA 4TVAB 4XA5A 2L48A 4ZLPA 2DBYA 2EG2A 1R8AA 3G87A 3QT6A 1T6DA 4E7JA 4O23A 1TV6A 1WUDA 2MQNA 4CZFA 3J7ZO 2LYBA 2FLOA 3D0IE 4XIUA 2DEJA 1ITPA 4HTUA 1RM6C 3ISCA 2K3KA 3IBFB 3KDNA 1MDUB 4CLKA 4LQ3A 4RPXA 2RT3A 1S6PB 4DQQA 1AA1B 1SJFA 5IXUA 1W9HA 4XH4A 3V1QA 1RADB 4CP5A 5ALJA 2ILZA 4UASA 1EO1A 1P7DA 3QU4A 1DTQB 3ILOA 3SMSA 4JKGA 2E20A 5GINA 2WW4A 4U7UD 3MM7A 3V2UC 5C12A 3H8SA 3NMAA 3ET6A 5EX0A 4PG8A 2BACA 2HFNA 4ZVOB 2P9UA 3PEJA 5C2FA 1N34K 1JKHA 1ZPVA 1KCFA 1S1TA 4J2BA 4B9TA 5JXSA 1C6VA 1RDCA 1X0PA 2IIHA 4NOHA 5E3QA 4ANCA 1TL7A 4C8YA 3X1LB 4ATNA 2A0FB 3QGPA 1VSDA 3ISNC 2L9NA 5H1SV 4E8UA 1JLFB 4FPIA 5CZ2A 3OY9A 4CZMA 2QZ8A 4IWVA 4XUSA 3D3CJ 4OYMA 5B0DA 1CVJA 1W97L 3RWUA 1Z00A 5BPCA 3HT3A 2Y1JA 2B3TB 4FWOA 3E9LA 4RUAA 1NGHA 3M9MB 1D8LA 2BABA 5D4LA 1Q81O 4ANDA 2HW3A 3NGZA 4I2FA 3J7Z5 1L6NA 4UAUA 2UVVA 5J1EB 4MK9A 2DR9A 1Q4RA 1XMOF 4CBXA 1PBUA 5H9FK 3BO2A 1JJHA 4U8YA 3B6PA 5FJ4A 2W4CA 1OYDA 5C24B 4IC9A 4KLQA 4O5FA 3WUHA 3KFWX 4LF7K 3OYGA 1VLBA 3A3PB 3DRSB 3MWPA 4PGXA 2HSEB 3DOLA 4RBVA 3I0SA 3NCPA 2GIQA 4CF2A 4H5WA 4KB7A 3I8DA 4M5DB 1EHWA 2HFUA 4ED7A 1VIXA 3LGMA 1V4TA 4ECSA 4FWSA 4KHMA 4HHJA 8AT1B 2UU9F 3H5YA 4RW7A 4DZDA 1YJTA 2LMRA 3M5RA 3B4MA 4FLVA 4BXOA 3WIUA 5IV3A 2Y8WA 2IJNA 2K60A 4EELA 4BJQA 4H0YB 1LFWA 1U1RA 4FWLA 4DSFA 4DCCA 4EEKA 2E8MA 5AQZA 2YWEA 2FBTA 4CJKA 5IM0A 3O3LA 3TSUA 3F5TA 3A3OB 1YJ9S 2EWSA 2I6XA 1L3UA 1N32K 2O8CA 3ZSRA 1NI3A 4CHNA 2BE9B 3NGRA 2BE2B 3JAMO 3LP3A 1BWVA 1B92A 4DSEA 4I56A 1FIQA 2ZUDA 1PILA 2QKBA 4USHA 2E5LF 9ATCB 2WB1D 4JB3A 4I2QB 3DLBA 2ZZNA 5J0WA 1D0EA 4IS7A 4KGVB 1NK0A 4H4MB 3CJQA 5KFGA 1X4CA 2RN2A 2Q6CA 3IBCB 2YTUA 1BMQB 1CJTB 3F2CA 3N6LA 3MEEB 3CCVN 4K4IA 2AZ1A 4OD0A 2W4PA 5J0RA 2ROGA 4F0KA 2KU7A 5CHIA 5CZ1A 2WVEA 1HNVA 2HHPA 5ALMA 3VF2A 1A5XA 1KBUA 2NR0A 3ZSYA 5AI9A 3ZI4A 2BJ7A 4NLBA 4FZZA 2RRDA 4C2MA 4O4GA 2K3IA 4KHPJ 5AJ3K 2ZHAA 4CGIA 1RWKB 3TADA 4MAKA 1K73T 2V68A 1RISA 4C8NA 1MWQA 1N32F 3TNVA 3QB0A 1IR0A 2NLXA 3VGKA 4WIQA 4CLTA 4CGDA 2ATCB 1T44A 5ALNA 3UE2A 2VC0A 2V8GA 4KRWA 5AM4A 3OXLA 5ADXH 3G2XA 5HVFA 1ZQ1C 4RNMA 3QAUA 2Q36A 4IDHA 3M6ZA 5DBCA 1NKEA 4QZBA 3HVTB 1HEKA 5U47A 2BVZA 2PI4A 2KMDA 3M32A 4MDBA 3QU7A 3SEOA 2DNPA 5HLFB 2NNWA 3BS9A 4AQYF 4IDKA 3O4NA 4HDGA 3M30B 3C15A 5AE1A 5CR4A 1WCNA 3A1YG 1MNEA 1HPZB 3MC1A 3OFGA 4OQJA 3IFEA 4ZP7A 4AT1B 3CCTA 1SL2A 4ZLJA 2D3UA 3C21A 2XCPA 4LRAA 5DM7Q 4AF1A 4KKOB 3R7NB 4PUOA 5A6WA 2Z4PA 3QUTA 2VJ5A 3VOVA 2OFHX 3TUIC 3SQIA 4OYOA 2X74A 5K5MA 5E84A 4K8RA 2E1FA 1OMSA 4HEA9 3HXMA 1Z00B 2MLZA 4U8VA 2VWJA 3OYEA 4DV7K 3RR8A 1WSEA 5HAOA 2EBGA 3VQPA 3IBPA 3DMJB 5CH7B 1ZETA 1NSQA 2UUCJ 2ZF5O 3EZUA 1O13A 5DBAA 2F4VF 2KW4A 3M8RA 3AXKA 2KRBA 4Q2MA 4DG1A 3HHLC 5C5JA 4FNHA 5DRKA 3CVKA 2JZ5A 2CZ9A 2Y9HA 5DG7A 2GOLA 3DI6B 2E3TA 4I2PB 2ZJQL 4MFCA 4FFDA 3V5RA 1TL5A 4OX9F 1F0XA 2UUCF 3ILJA 1NZPA 7ICEA 3MAAB 2N1RA 1NEEA 3AA9A 1S72S 2HNZA 2VIHA 2I5JA 5E26A 1H1VA 5HROB 3PR5B 2BH1A 2A1JA 3I55S 4ZCLA 3EVMA 1UTAA 3FZ2A 3J81U 4FF4A 4YXJA 1H74A 3CO9A 4GFJA 2FJEB 4FJNA 4WK3A 4PPZA 3OJUA 3M3ZA 7AT1B 1OH5A 2GELA 4CIGA 1XSPA 1ZH5A 5LMNJ 3LDOA 4EAHD 5BOMA 3VN5A 2BHNA 1U2CA 4M6WA 4G9ZA 3D2EA 1TVAA 1N48A 5HNKA 1W26A 2VFRA 1Q1KA 3C16A 1S9EA 3R1LA 5AQUA 2MKKA 2EHGA 5E2QA 3W0LA 3TA1A 4KLJA 4CESA 1YK9A 2W8KA 3VQTA 4KPYA 2HRTA 1C7YA 3MGJA 1R8HA 3L5KA 3CCMN 4NYZA 3IMXA 3DLKB 4OPAA 5CYMB 2VPWB 1IIPA 5J2GA 5DO2A 4QW8A 4QIFA 2C2DA 5ALLA 5ALQA 4ILGB 4W4MA 5H9EK 4DQSA 1ILYA 2PFQA 3ENWA 3VGLA 2JFKA 4IRDA 3V6JA 1U47A 3ATUA 2JEGA 5B0AA 1IXRA 1H2UX 1VISA 4ER8A 3B82A 1M5VC 1VLOA 3RMCA 4AD6A 3AA3A 1MMLA 3VAHA 3QJLA 2NRZA 3D7EO 3RB3A 3OPXA 1KSPA 4CGGA 3TX0A 2HFSA 3H8MA 3V4IB 3TWZA 2BM0A 1F60B 4PPDA 1T3QA 2F4VK 2ETJA 4TSXA 3GPAA 4FLTA 3U26A 3D68A 4M5GA 4JAXA 1Y5NB 4LMZA 4H54A 3KLGB 5IC6B 4H03B 3JXUA 2NXEA 2VFVA 1TAQA 3OYMA 2CWKA 4OJRA 1BUPA 1RWWB 2B4PA 1O1WA 1SQEA 1GOBA 4ZTFA 1S22A 2O67A 2W7OA 4YDXA 1DT9A 4IQUA 3WK6A 5ALRA 3TZXA 2C2RA 3OA9A 1UZDA 3H8WA 3IAM9 4P74A 3U7JA 3LYSA 3HFZB 4ICLA 4BRPA 1NOZA 1OJ4A 3IGVA 1RT6A 3AAWB 1NZBA 1U1MA 3RG6A 5HMMA 3SBGA 2A19A 2WTFA 1RK8A 4N5SA 3NXZA 3THYB 4ECVA 1IN0A 3QXGA 1JUDA 9ICTA 1QE1A 5FRMA 3WXIA 3H7IA 4YMMA 9ICHA 4ZOSA 1CC8A 1FD2A 1WKLA 3RJFA 5D0HA 4H0TB 4B9QA 4NZ7A 5KPTA 2Z0GA 2YHYA 4P0QA 3CIMA 1ZOTA 5M2PA 4JNEA 5C42A 5EU7A 3LWLA 1V97A 3CJKB 1H7XA 4ZVTB 1B4SA 2XG8A 3D0HE 3Q2SC 1ZD5A 3KJVB 3BGLA 2CIMA 2KZ3A 3I6PA 1UEUA 1FKPB 3V4MA 1T05B 5FDLB 3QIOA 1NGBA 4C48A 2YQEA 2WC9A 5DDPC 4CZKA 3DEEA 1Y3JA 1TL1B 2M0GB 2O8EB 4QIEA 1P9YA 2GUPA 2DD8S 1J2NA 2VG7B 4B9UA 1QUVA 4RWXA 4TU9A 2LLZA 4X65J 3DLJA 4OX6A 4QZHA 4RKUC 3QYPA 2RHFA 2P9SB 1CPZA 2QK9A 4DFDA 3MMAA 1HJRA 1KHWA 3D9BA 2FVRA 4QU6A 5GAHU 2VG6B 4JI5K 1U48A 2ZXHA 2XHBA 2DYAA 4PWDB 5AI4A 4LF8K 4U7UK 2HRUA 4B3MF 1YGYA 3EZ5A 1IBLK 3ZXWA 3K1ZA 2P9NA 4GVMA 3LP1B 4NLRA 2NSCA 1FJ7A 3HL8A 2OZSA 3KG4A 3WC2A 2OPSA 1FHTA 2KYZA 3ONQA 4DSJA 1X5PA 2XMTA 1SV0C 1NNDA 1SC4B 2GS8A 2E5HA 2E9ZA 3MUTP 4QPXA 4JI2J 5AZJA 5EDWA 2MGZB 1UZHA 2CG8A 2ZVSA 2AP6A 3J80U 4OZ2A 1FTRA 3L09A 4OJLA 3W5YA 1YBUA 1P90A 1OPIA 3JSYA 2FZGB 2C2MB 3IM9A 4LF1A 3ZSXA 1RT1A 2OANA 3NWRA 3KWMA 2DO4A 5J29A 1RTIA 1D5AA 4BR2A 3C7NB 4CH0S 2RAQA 4CJ7A 2VQFF 3GZ7A 2F4FA 3QO9A 1R8CA 2Y1LB 3ZTRA 4JI5F 1CEZA 3IG1B 4DV1J 1CQNA 3VENA 1A5WA 1X4AA 4CIEA 2DIUA 3OTDA 2KVSA 9ICMA 4L8RB 4K2JA 4M0AA 1SZ2A 2W43A 2A42A 3DDIA 4M45A 3TI0A 4EHTA 5ALOA 3RB0A 1U8WA 3J80O 9ICVA 3M6GA 1QY7A 3SBMA 1RT7A 4QZGA 4R8UB 2ZH3A 3HSGA 3Q83A 1O51A 4ZPBA 2R7SA 2IJRA 4EBEA 4KV8A 3AB4B 1S12A 1WD6A 2IVFB 3W2WA 4ECRA 3UR0A 3AD7C 4PYDA 4NLZA 1S77D 3J80Y 4DR5J 2QEXS 2B51A 4OYWA 1T11A 4P2FA 4ED3A 1GNKA 4LF4J 4CCHA 2IDEA 1HKCA 1U2RA 2WSFC 1R0AA 1G6BA 2KVIA 1VSKA 2UUBF 3UD3P 2GX8A 1LW2A 2QWNA 3P5BP 5AQTA 1WNSA 1MWKA 4DF4A 1W2BM 2FZCB 1Y5IB 1YZ6A 3MFIA 3KJFB 2ZUBA 4DLGA 4M9NA 5JMNA 3C66A 4EP4A 2G06A 4UUXA 1U2FA 5F8MA 2PO4A 4KLDA 3CG7A 5FRNA 4OHZA 4PAAA 3OUYB 4WFZA 1FFWB 1RQLA 1VQ4N 3MUMP 2IOFA 3MM6B 1TMMA 1Q3VA 4ICLB 3C14A 2ACMA 9ICLA 4OX7A 4KTZA 2VIXA 2YMPA 3V9UA 2Z30B 4CO4A 3AOCA 2AA4A 2XO7A 1S4FA 1KFSA 3D28A 3R3LA 3QPIA 3ZT4A 2BANB 4R5PA 1G1XA 1PVQA 1UVIA 4KLLA 3UNGC 3SCXA 2RQMA 4UARA 1IH7A 4EU0A 3BZCA 3UO0A 4ZHRA 4DR3F 2R8IA 3E9PA 3HP6A 4M5HA 4TY8B 4P0QB 3ISZA 1ZTWA 3N28A 3PNIA 1SL1A 5F8GA 4ZPAA 4CZHA 5SZTA 2LYHA 4I6MB 4DR4J 2CDRB 3ILIA 3D0PA 3P38A 3ISBA 1V85A 2R3VA 1U7LA 1QQ7A 1H3DA 3QLHB 1S6QA 1JNZB 3F73A 4NYFA 3R7SB 1U1OA 2CQPA 2E7WA 2HVHA 2R7OA 1TV9A 2KXNB 3A5OC 4S0MA 3I56N 2LHTA 1HNWF 2R9LA 1PO6A 2I8EA 4YD2A 4KLOA 1TUYA 2YX8A 1GFWB 2GUIA 4DLEA 4NXNF 5ITHA 3CJRA 1AT1B 3H42A 3BYRA 1Q9XA 1YJWN 1ECWA 4IQTA 4B3OB 3P8BB 3HFVA 2DPNA 2Y9UA 3OYCA 4UOCA 2KG0A 3HOTA 3MGVA 3WK9A 3V9XA 2XMMA 1U09A 4FVUA 1DLOB 4CZIA 1U49A 2G8KA 1B9FA 8ICVA 4YB1P 2BOPA 2XEXA 4QR1A 2JVOA 4DOAA 1AFIA 1LEOA 2GQQA 1EQMA 2B8QA 3TWHA 2Q4TA 1RZMA 1UFKA 2FHMA 3BGUA 4A8MP 5DDQC 2E9RX 2ASLA 2QN6B 3EPGA 2CVIA 1VGYA 1ZQDA 4UZBA 4I7FA 4L74A 4LR8A 1YTYA 1Z4UA 4NLYA 3N9UC 3DRYA 3AT1B 4OJPA 4HHTA 1TKZA 4KHWA 3DXMB 4F5NA 1NBEB 3AO1A 2P35A 4UF4A 3RBXA 4B3RF 3MMCB 2I7PA 3RH4A 4EMDA 4CJRA 1I94J 2RDJA 2HOFA 2OWOA 2B4OA 3AA5X 3E1YA 4P6QA 1P8ZA 4J9NA 4PQUB 3FQLA 1ZBFA 4R0EA 2DUYA 5D4NA 3V4IA 1ZQLA 1N6QA 3O3GA 3EY1A 4KAIA 1C1BB 1PC4A 5J0QA 1R8BA 4JI4K 2H5EA 3QINA 1SGGA 1FNMA 3THPA 2RHSB 3GFYA 3PG9A 5KPRA 4E89A 1N54B 4HH1A 2GVDA 3Q7CA 4UUWA 4UAVA 1UMJA 2Z56B 1B43A 1YIJS 4L76A 3LGNA 3HKZC 3MI7X 4ETZA 3KG1A 2OEJA 4LSNA 2EI5A 2G8HA 3CE8A 2ADCA 5J2DA 3RGIA 2DRDA 3ZO7A 1RBRA 2IHNA 2IM2A 2KM8B 1BIZA 1CJKB 1VIOA 1RT3B 4CK2A 4HVZA 4QYRA 4AHRA 1R0CB 2JVRA 4X84A 1CRXA 4ENOA 1IUJA 7ICOA 3KK1B 5G0RB 1JCFA 2F7VA 1ZQSA 1JCGA 3MMVA 4E7IA 3TACB 4O55A 1M1HA 1GO3F 1JLGB 4GKJK 2PFPA 1T6CA 1VC6A 3ZD8A 4CO3A 3H1QA 1FRHA 3BGFA 3HSTB 1U24A 1PVRA 4HH0A 2G4BA 3Q8YA 1WTFA 4KHNA 4V19X 4C8MA 3CP8A 2W4DA 4NLVA 3OTOJ 1WAJA 3WK5A 3RYLA 2FUG9 1CXUA 3N6NA 4ZPCA 1SIWB 2M88A 2ZIXA 4B1YB 2W42A 4K4GA 4K41A 1IXKA 3GIMA 2MQOA 3F9MA 3S1TA 1DQAA 3SIPB 1RT4A 4ZLLA 2V67A 3D4JA 2YX1A 2MA1A 1IKXB 3VF6A 2L9DA 5KFXA 3N7SC 5LM7E 3C5GA 5D77A 4CEDA 3FK4A 3WEEB 1F6TA 3O6QA 2QWLA 2DR8A 1UWBA 4IG3A 1N4LA 3QICA 4CYUB 3QLHA 3KD5E 2RKIA 1QVFM 3GR1A 3Q8MA 3L95X 2IC3A 1QQMA 1HNZJ 2UXDF 2M0NA 3S41A 4BACA 3MAQA 4U6PA 1U45A 4FP9A 2G0CA 5F8JA 4ID1A 5AI8A 4MEXA 1R31A 2FPMA 2EFOA 3D2SA 3NAEA 4QU7A 5M1NA 3CXCM 4LF9K 3L4PA 2MKYA 3QEAZ 3GIIA 2A1BA 2GO7A 8ICCA 4C7YA 5D4PA 2MKIA 3BSOA 4ZDNA 2KT2A 8ICGA 4PG4A 5L9XA 1DLOA 2OYQA 4O4RA 1JL1A 3GJTB 3LDNA 3R5GA 2VDIA 2A3JA 2G8WA 3H0MB 1JXLA 1PYOB 1ZXIA 1GTEA 4IQMA 4FJMA 3KLHA 3R6LB 1CG2A 3DU5A 3NNCA 5CA7A 1K8KA 5FIIA 1HRHA 2V4JA 3SCJE 3BQ7A 1RSCA 4USVA 2DNGA 2OCEA 1XN9A 1Q0NA 4RQ7A 4E7LA 3OFFA 3K0SA 3MOZA 4IRCA 1HW9A 1N88A 1KC8T 4KX5A 2A1JB 5GAGI 2W2QP 3LQVA 1QVGR 2H48B 2V2VA 3HZEA 3MUVP 3NH1A 3DXKA 2QG9B 4O3SA 2KO1A 1WC5A 2I7NA 1SC6A 3N7RC 1LKZA 4K43A 1GQEA 4AQYJ 4BR9A 5KG5A 4Y34A 3P49B 2G1HA 2OPPB 3VQ5A 3V81A 1TU0B 3ZX0A 2NYVA 3O9TA 1DRGA 5F8HA 1UJ6A 4BRHA 5AFUH 2DFHA 3CHWA 2KDOA 5IIMA 5FPDA 3RSEB 1Z19A 3CCRN 5BR9A 2ZHBA 2H3FA 3OTQA 3JXOA 1S10A 3D54A 5J2PB 3EDQB 4FWMA 4HL9A 4K4UA 1HUZA 2JEFA 3KFUF 3K75D 1RP5A 2VA8A 3SV4A 5AHXA 4CQ1A 3NS7B 1V3ZA 4ZITA 4CZEA 4MN4C 2XYPB 5KFMA 3G0ZA 2O8BA 3PV8A 1IBMJ 2B9YA 3VQ9A 5IINA 1Q8BA 2NRWA 1UEVA 2RF2A 1Y00A 4KLFA 3OJSA 1JJCB 3GE9A 4K2XA 3AD9C 2ZUGA 3M8QA 1BL3A 1NRKA 1OVQA 3H2LA 3ZNJ1 2JH3A 3OLBA 2WHOA 4FK2A 4AL6A 3C15B 2M3DA 3FVYA 3R5BA 2ZXIA 2GV1A 3BQ0A 2UU9K 4Z4CA 2KJ8A 4BWJA 1ZQPA 1MROA 2P66A 4C0HA 4LUBA 2HB5A 1YRUA 4F26A 1VDHA 4GKKF 3AVGA 3GONA 1GX5A 4DFJA 1X4EA 3HJFA 3KNGA 2QKQA 2MQQA 1IJEB 1M5KC 4EUVA 1PBAA 5ADXA 3TR5A 4DHVA 1YX2A 2ZUAA 4GKKK 1D8YA 3L2RA 4ISGA 1N5XA 2KSOA 2MLYA 3GFKB 3I55N 2F7TA 4F3TA 3CJ0A 5HRNA 2LSNA 2IVPA 1F1BB 1IBLF 3BQ1A 4IBNA 3TABA 1WG4A 4KN4A 3W8GA 4I2AA 1H6KX 5SWMA 2MXYA 2H9ZA 3C6UA 3R2CJ 1VFJA 4DSIA 4BDZA 4OI2A 1CLQA 2MUTB 4G65A 2XI3A 2UVUA 3MN5A 1RT4B 2XSJA 1UOCA 3TSQA 5TKWA 2H3VA 4KGKA 2X6SA 1UPHA 2FXUA 4CHQA 3S9HA 2XS2A 4A47A 2M52A 4B9VA 3S8SA 4LY7A 4AFFA 3CD0A 4DV1K 1Y64A 4ZCMA 4USKA 3M05A 5DMRA 3H98A 3RB4A 8ATCB 4C1NK 1I1GA 3SD7A 3QEPA 3VAFA 4CZJA 4G6VB 1J6ZA 9ICXA 3KHHA 3T6JA 1M0SA 3FGUA 2NSBA 3LPYA 3E3XA 1NLKL 5AE2A 3MZIA 4CEAA 1D9DA 3PXGa 4A46A 4KMOB 1A6SA 4US8A 5DB6A 1S9EB 3MD3A 1ZQRA 1EXNA 3PFEA 3QMQA 5IT4A 1SWWA 2CQ4A 3MF5A 1XMQF 4FF1A 3CUNA 5HO4A 1JLAB 4JKHA 1K8KB 4NXMK 2DKZA 2HNYA 3CDUA 4X66J 9ICFA 1REGX 3HWTA 4DKWA 2MSTA 5HI7A 3WX8A 3HZ6A 5J2QB 2DNZA 1UVNA 1LWCA 4G3IA 3E2EA 4CF0A 3ZTOA 1ZM3A 3Q8SB 1ZQYA 7ICKA 4Y2CA 4PHEA 3U4LA 1HNXJ 3ADAC 2RHKA 2QL5B 2IHMA 5LMUK 1AFJA 4KY3A 3EYZA 2VQEF 3PKYA 2MY7A 1VSIA 2DGOA 2SXLA 3HT0A 2DNLA 4DTMA 1KFDA 5E3CA 4DV7J 2R2UA 1O08A 3G71N 2IM3A 2AGPA 2J7KA 4ITSA 2IPOB 5HJXA 3W9HA 1IQZA 1JLEA 4NE9C 3LDPA 4C3MA 1N34F 2P6RA 1BHLA 3DOMB 4ZVPB 1QCKA 1NHVA 4LFBJ 3AAQA 2ZOFA 3FEZA 3HK2A 4BR7A 4CI6A 3AA8A 4WYLA 5F9NA 2HAFA 1EKEA 2KRRA 4FJHA 5BN8A 4X4NA 1L5UA 3CPEA 2E7VA 2FF6A 3K5PA 4CLUA 4JI7K 1L3KA 1T8EA 3RRGA 4ZVEA 2XZWA 2DL0A 4R8UA 1D3WA 3O0FA 3TUPA 2OPRA 3C46A 1GMWD 3A3NB 2VFUA 2MJUA 5HMYA 3TVYA 4GO7X 3W5ZA 2XLIA 1NBWA 3PW0A 3W9JA 4PZVA 4CH1A 4KGXB 2XYGB 1NMEB 1RYSA 4NASA 2ASYA 4YN3B 3FJ2A 5L46A 5D0EA 1S5ZA 3Q0AA 2Q0RA 4CFAA 3SQ0A 4DCJB 1IKYA 2YNGB 2VOOA 5ALEA 1YF5L 2HYIB 3NGTA 3IWLA 4NI2A 7ICUA 2ZGZA 1ZM2A 4CI0B 3DC2A 2MDAA 2J8AA 1U0HB 1LKYB 4DQIA 2DGTA 5KAFU 1SWVA 2MY8A 2PT0A 5KG1A 1Q3UA 4QJVA 2VASA 2FBXA 4QYZJ 3W7BA 2BMBA 2V4RA 3ZDAA 3ULEB 2H3EB 2W2PP 2RU3A 4FE3A 4KBIA 4ANEA 1HWUA 1KONA 3AXMA 2DR5A 1S99A 3R1XA 3D7SB 2XS5A 2J8SA 1NDPA 5F0UA 1KAYA 3EO3A 4FJKA 4PL2A 2OLWA 2VG5B 1SKRA 2F77X 4UAWA 1JN3A 1N52B 1HNXF 4FJGA 4DTUA 4DSLA 1FESA 4LSZB 2HQDA 3IV6A 2YWGA 3IG5A 3N4QA 1H2TZ 3OTEA 3AU6A 1HNXK 4Y2QA 4ECQA 2BGGA 1D9AA 3T1HK 3T1HF 2LCWA 5M1PA 3H2UB 3UN2A 5LMNK 1SQGA 3R27A 2C3YA 3BO4A 5M2UA 1RBTA 3MN9A 4WXWA 2CFXA 4RW4B 1DTQA 2UVWA 4MJKA 2JEJA 1S1XB 1DTTA 3QGGA 1CZ9A 3AQOA 4GVBA 2VBYA 4OHXA 1N36F 3TQEA 4GNIA 2OELA 2O8DB 2ZOMA 4JD2B 1CJUB 2GMHA 5HATA 4N76A 4UB8U 1F5CA 3MCSA 1DOQA 4QYZK 3NH0A 2AT1B 4YR2A 2HVZA 2CQIA 1YJNS 4M5NA 1XJWB 2YJEA 1VQ6S 3MAAA 2OGUA 3WXJA 4ECZA 1RA7A 2VV5A 4DZ6A 5F0XA 3O3HA 1S1WA 5AQOA 2K7JA 3D2QA 4ZH4A 4X4PA 1MQ3A 1G3OA 1AYEA 1JI7A 2F1HA 3AVKA 2OPQB 1COOA 1FWLA 3FMWA 2KN4A 3PM9A 5KFQA 1ICEB 1SC3B 1FDDA 4IQXA 2KK0A 4M9HA 1FCAA 1T7PA 2QMUB 8ICUA 1SCJB 4CO2A 4DTXA 3H2VE 2XLJA 4IYQA 2X1BA 1NG9A 4F3QA 3MDCA 2OEKA 1WSIA 5C24A 4ZVFA 5AQRA 2CH6A 1WWHA 3NCIA 1XMOK 4AQYK 4BUGA 5AQFA 4DTNA 1YBAA 5ALWA 2DNNA 2ZZTA 1RZTA 3MR2A 3I0SB 4LD0A 3WQUA 1I51B 2Q3PA 4DFMA 2WB4A 4X4QA 2OD6A 4DPXA 2BRLA 4KSEB 1U1PA 3R6GB 2IGIA 4ECUA 4WFXA 2DRAA 1DKGD 3LM9A 4RW7B 4LVNP 3RMDA 1RWMB 2HBMA 2DGVA 3EM1A 3QU2A 2ALYB 3OL9A 3R6MA 3C65A 2J7UA 2ACYA 4PG6A 4LF9J 5J1NA 1HNWK 3PJ9A 4F0MA 4OCZA 2C28A 2VGNA 5J2PA 1RAFB 4JYAF 4BLGA 7ICGA 2UXBF 4C0ZA 3LDLA 4UBCA 5HVGA 2F8HA 3J7YI 3SBTA 3WXMB 4UTGA 1TL4A 3PW7A 3PW5A 2VKQA 2ZJ8A 1P27B 4OKJA 2HOIA 2HQGA 1BNPA 3UKRB 4KITB 1V9OA 3A5LC 1XO1A 3MHYA 1GLFO 5A6PA 1NPKA 4FWQA 3DFEA 1SI9A 2JX2A 4JI8K 2FI1A 4FO6A 2GJIA 3CCLS 2HBLA 1N5YA 4LRCA 3C2PA 5CEHA 2V8HA 1AROP 4H4OA 3EXYA 3QBWA 3U9DA 4KLMA 1APSA 2ZBRA 2HHQA 4M5IA 2WTUA 3PHEA 1HNVB 5LT5A 1JKHB 4M94A 2XBPA 4UW9A 5KFBA 4M3YA 2D7SA 3M6VA 1KVCA 1N5TA 2LU2A 4QR0A 1IWGA 3RRKA 5A8WB 1N5VA 4R65A 1S59A 2EX3A 2F76X 3OFHA 1BOTO 3O8MA 3N97B 3W63A 2UUAJ 3D3BJ 2CPHA 2E1EA 1GTHA 4WFYA 2VG5A 3EGWB 2D5RA 5B09A 2K8AA 2UP1A 1CZAN 4A2AA 3ETLA 5EXWA 1UT8A 3IP0A 2LP4A 3BQTA 3PZPA 4BX9C 1IBKF 4H8KA 4UT4A 5B5EU 2RU9A 4MIAA 2RRNA 1RWPB 2NXUA 3UN5A 2WB1C 3N0VA 2FJWA 4CYUA 4B3MJ 5L39A 4YY3K 3WIVA 3GQCA 3CCZA 4D3GA 3V7JA 2DGSA 4QIVA 1IQTA 1PAUB 1HKGA 3QUBA 1RG6A 3FZMA 4BRGA 4OV1A 3JSBA 1SIZA 2XI2A 4H0VB 2WVCA 4DV0F 1VC0A 3NS6A 1SKUB 4NZ6A 1RWOB 4BC7A 1ASUA 5HL7Q 2GWJA 3QETA 5ETLA 5AXMA 4IEEA 4B6JA 2WBNA 2P9NB 1NB2A 4WE1B 3GJSB 2IA6A 2GGPA 4BRKA 4RQ8A 4FZLA 2K8BB 3AO3A 3JS6A 1RFQA 2YBVA 5J2BA 5AXLA 1KQFB 3CCSN 1A77A 3KZIU 4CJPA 5DB9A 4ED8A 3CJ9A 2NV3A 2WF9A 2WFAA 4DQPA 3VC8A 4MYTA 5AZJB 8ICRA 2XIDA 2G07A 3R97A 3VQDA 2UXCK 1K5OA 3JPRA 2B6AA 2R7VA 3NBPA 4J03A 3G25A 3NF7A 3WX4A 1T03A 4DU7A 1KVIA 3CDAA 3IC1A 2FJXA 4ZVQB 4YUDA 1V9PA 5F3TA 9ICOA 4Y2TA 1NK4A 3PFOA 2A41A 4DFPA 4WP9A 1KLNA 1UWAA 1SKWA 3W3SA 2XY5A 3TUJC 4DX6A 3K2PA 2P9KA 2I5JB 4UOHA 1S97A 5KQ8A 4F50A 5GAGP 4DSKA 1XSNA 1U1LA 2HMXA 4F04B 1NK5A 2XHCA 5M1KA 4B9LA 3UD5A 3KIOA 2FGCA 1HI8A 2B7BB 3D67A 4RBUA 1YJUA 3NVKA 5FP0A 4IO9L 3J7YP 1VRTB 1SH3A 3TZWA 5BR8F 2FMQA 4JK9A 4KLSA 4ELUA 1FJGF 4MKYA 3W2WB 2FJVA 3H3OB 2P2CB 5RUBA 3CIZA 1N63A 1Q79A 1TK5A 8ICSA 5H9EJ 4NMXA 2ZZMA 3N4PA 3AVBA 2HBRB 1IKXA 3BSAA 1SBRA 3DV9A 4YR3A 1ROFA 5DZ7A 5E7OB 2E1AA 3BQ2A 4MMOA 5IIJA 1NM1A 4KHYA 3NUQA 4UB6U 4FKXA 2IM0A 1XR5A 4X66K 6FDRA 4JN4A 5J2MB 3SLCA 2IIRA 2NXNA 3JSMA 5A0YA 5CZVA 4BC3A 4DCOB 3NRWA 3P45B 3CFPA 3MDAA 4DV5J 2ASJA 2E88A 4ZK7M 4JKCA 2G0IA 3IMQJ 3V6HA 2W54A 2G2OA 1WBBA 1RAAB 1ZS6A 1RT5B 5ALVA 4GO5X 2QT7A 3CFOA 4MKAA 3MXJA 4HI2A 1FW6A 4XAKA 5AQQA 3H90A 1U0SA 4QIGA 2EH9A 1N33F 3C23A 4B3RJ 2MZ1A 3NEKA 4ECXA 3HDSA 5AI6A 3MN7A 3DGPA 1XMBA 3TTFA 2V94A 4F72A 3HULA 2AJQA 2C2EA 2NZ4A 1V5IB 8ICLA 4WK1A 3CCJN 3C29A 2ZH8A 1LWFA 3GDXA 4J9KA 3DRSA 5JVGQ 3M30A 1G7CB 3DMJA 4LFAJ 1Y97A 1RU1A 1Q81T 3RJMB 2MQPA 4JKAA 3CCWA 4UQTA 2DRBA 1A6LA 4CD1A 2LFVA 2RRAA 4CFCA 4LF6F 2LYVA 2FLNA 1DQ8A 4JI1F 5ALUA 1IM6A 4LC9B 3BV8A 1OQ3A 2FHJD 3OW2R 4DL0C 4JK7A 4YFKA 4B9SA 1DQ9A 2A1AA 1NJZA 1HW8A 1XBWA 3SSQA 1X5SA 4BWMA 2R7XA 7ICRA 2BJ1A 4KLGA 2GHWA 3H45C 2RH3A 2EXUA 3H8YA 8ICFA 4PHDA 2V2KA 3TVKA 3OS1A 1N36K 2DXEA 4X64K 2HQ3A 3O2IA 3AO2A 3N4MB 5LL6Z 2ODGA 1S0MA 4LBHA 1H0HB 2F40A 3FZHA 1UW9A 1SL0A 5I3UB 5LSOA 1JROA 1C2PA 2YHBA 3J81Y 3AVNA 5DLGA 2CDQA 2RPIA 8ICTA 4FLUA 2QC3A 4W5NA 1Q7YO 4RNFA 4P52A 4CRJA 2R7YA 4B1WB 3CIPA 1JLAA 3W61A 1TE2A 4FCYA 1GLBG 3MK6A 2XZTB 4DR4F 2VBZA 3WZ0A 4ECYA 2DFLA 2RDIA 5C25B 2QTDA 5KFTA 2XCAA 4QS7A 2KI2A 3TJ8A 2NRHA 3GBTA 4TU8A 2AYMA 4LIRA 1PJ5A 1NO8A 1GX6A 1ESVA 2IJFA 5D78A 4RT2A 2GBZA 1T3OA 3KWIA 2GHPA 3LGHA 4BE2A 3WBZA 2XC9A 3L4QA 3MBYA 4YQWA 4FXVA 4B1XB 4CF3A 1U6FA 4M42A 1Q16B 1LXNA 2UUAF 2DHXA 3AA4A 3T1YJ 1PK1B 1WOQA 5CAAA 3LALA 2QWQA 4HAIA 3W64A 4UB3A 2ERRA 1JNRB 2A6AA 1ZTTA 1M5OC 4L75A 4F25A 3HKWA 3KUHA 3OL8A 3GIJA 4CO0A 2G0JA 1U04A 2Z2ZA 4DV6J 5AJ3F 2JH1A 3ELHA 1IG8A 4Q0BA 4CNQA 4YHHF 9ICPA 3UKRA 3CWJA 2MKCA 5KFVA 4OZ0A 4EWTA 3ZZZA 3CCUN 5JVHQ 1OH6A 1L7MA 5AQPA 4C23A 4CERA 3DLKA 3E8OA 3NNHA 2DHSA 2IFXA 4WFBQ 2OZMA 4ECWA 1NKBA 1FNOA 2M8DB 1PVPA 3LP2A 2V0NA 5GVQA 4C98A 3CCMS 1X60A 3VEZA 4Z7CA 5HRRA 2FLPA 4DX5A 4DPTA 1N8RT 3D1QA 1J97A 2PKEA 1ZBSA 1ZQAA 3TW0A 4B3TF 2W40A 4KR0B 2M5YA 4B3TK 2GHVC 2VH7A 2KHVA 2VPXB 4UBBA 4V1Ak 4OKKA 5L1JA 3LPEA 4MH8A 1NDCA 2VWKA 3O9QA 2HOQA 5IT9O 4OHWA 3IP4B 3TEHB 4X4TA 4OLPA 8ICPA 3LZIA 4DV3F 4G9BA 2O66A 2MZQA 3CJKA 4CGHA 3PRDA 1IM4A 1K8AO 3HSZA 2X1FA 2PY5A 5KI6A 3WKBA 4JV2A 2FMSA 3VV2B 4IKAA 2PIIA 3GFXA 4IFVB 4IOAL 3J81j 3M6XA 4RWWA 2CKWA 5J0OA 3O9SA 4J2DA 4KH6A 4CEFA 1I94K 3M2UB 5HMLA 1ZD2P 4JUZA 5HRSA 8ICIA 5HJYA 2P9SA 3AVJA 5AQGA 1N61A 1F5AA 1CLFA 4MIWA 3L2VA 4YOVA 3HYFA 4BDPA 5J0SA 4OJ5A 3OQ2A 4WFAQ 4DUTA 3ZSOA 3D2NA 2CQDA 2P9CA 2MQLA 2E8NA 3MR7A 3RF9A 3R5CA 3KJVA 5AJ3J 3AU2A 3M8ZA 2K06A 5TKYA 4FXDA 1HQ2A 5FDLA 1T94A 4YY3F 3J7YU 2F8SA 2OJ3A 3HKZF 1NGGA 4HDHA 2P9LA 4BRLA 4RW4A 5J2AA 4KO0A 4DBQA 1H98A 5T7BA 4X4VA 1NPRA 1AXQA 2HGLA 1FX4A 2BDPA 3ENVA 5M2RA 1RGIA 3H7HB 2CJAA 1NK6A 2J9DE 3VHQA 4LRDA 4KI4A 4OI4A 4X65K 3AVIA 3OVBA 3Q8PB 5HK4A 3NGDA 5KRSA 2VB6A 3EE3A 3EX7B 1UETA 3BM7A 4M3WA 3SAGA 1HPMA 5KFHA 2H1YA 3TSPA 2O8FA 2AF6A 2HOEA 3BREA 5DDYA 2YHAA 4K5SA 4DOZA 1BQNA 2A6OA 3E51A 3O4QA 4JK8A 4NLGA 4DCHA 4CHPA 2WF7A 2UXCF 3BS5A 4P73A 5K9FA 4C8KA 6FD1A 1DAXA 1OH8A 1HBUB 1QQ6A 1VRTA 4B1UB 2QIFA 1NOMA 4NX9A 2B0CA 3UXOA 4AL7A 5J2HA 1NHKL 2PFFB 1DGJA 1D9FA 3OS0A 4ILHA 1VMBA 3GV7B 4K25A 4WWSA 1HUOA 4OGEA 1KDNA 2EK1A 1X9JA 2QB0B 1K9MO 1UAXA 4FJXA 1HLWA 3PW2A 2MAXA 3RFAA 4URQU 3HVRA 1RAOA 3L2QA 2A5XA 2E1YA 4CZLA 2VF3A 1ZAWA 4FLZA 4I67A 2XGQA 4FDFA 1Q82O 3MDQA 2JR5A 4Q5VA 2W01A 5KFNA 2QMXA 4U7CA 4DPWA 2YKAA 4JI8J 4OJ3A 2CNKB 4J90A 4Q8FA 1W7AA 4Z4GA 3IR7B 4WFNL 4OLAA 1AUDA 1SKSA 1FERA 3MMCA 2MU2A 2VJVA 2FC9A 3VAGA 3LK9A 5EN1A 2QJ3A 9RUBA 3UKUA 5IFMA 3FYHA 3LOUA 3WXKA 5AXKA 1ZRMA 3SCKE 3BH6B 2KL8A 5ETOA 1ZZNA 1EKRA 3WNEA 3UQ2A 4RWTA 4M63C 1RHUB 1BI4A 2WOMB 3AODA 3GLJA 5C42B 2CADA 2A3VA 2BKPA 2CRXA 1RTJB 3NRZA 3OXGA 4P2HA 2LA4A 4QS8A 3H5UA 4M63A 3FZBA 2DNHA 5KOWA 5BRFA 2VOPA 5KT4A 1DFDA 3CQXA 4LF5J 1R8PA 3M32B 3NVVA 4K0KJ 3HSDA 4CHZA 2O8EA 5KT6A 3TRGA 2UXBK 3PMLA 9ICGA 3F5EA 3G9CA 5AQHA 2ZM6J 2JXJA 1YSJA 5DLFA 3US5A 4KBOA 3M2VB 1RE1B 1NU0A 5JUMA 4M5KA 2OEMA 1MW7A 2GA7A 1CJKA 2FLLA 2XICA 3SJHA 2IRUA 3NASA 2D3ZA 2E44A 2VKRA 5G0RA 2RJZA 3I5CA 3ZZTA 2YWFA 4RUBA 1LW0B 2Q1NA 1S1WB 4DR1K 4DUYJ 4TQRA 1U6BA 1T3VA 4UB4A 4E0DA 2ZIVB 2DXFA 4MDAA 4M7YA 5EWGA 5J2NA 2E2NA 1CS4B 4ED1A 2D1KA 4KIAA 1XS9D 3MAHA 5EVZA 3QGHA 4X66F 3DOKA 2YMLA 1URNA 2R4FA 2E2QA 4W92B 2ZBCA 4WF9Q 2Z7JA 3NVMA 3AHPA 4UZCA 3FC9A 2OHFA 1IBMK 4KMUA 2CH5A 1DXSA 1VDVA 2QWOA 2ZGYA 1WN7A 1J54A 4KTQA 1RPLA 1UA0A 4WU2A 4F5OA 3BF4A 5AICA 2IA0A 1HI1A 4HTJA 4YMOA 2PFOA 1WACA 5FPNA 4A8XA 1Z6RA 4CJSA 1KAZA 5HROA 2O6KA 2KG1A 4O3NA 3KD3A 1MSWD 1BU6O 5CYQA 4RQ2A 3QERA 3BGRB 3M1YA 3ILLA 4QS9A 3ZDBA 3MEDA 3GIKA 4ECTA 4JI8F 2QFJA 1BUXA 2YWKA 4GKJJ 1J2VA 3HVWA 3U3YA 3VGMA 4O3MA 2YQ3A 1YI2N 1RT7B 1JMSA 3E66A 3HHEA 2D0BA 2E5LK 4F5RA 4CLYA 4NL9A 3VAJA 3G10A 1RTDB 2GAGC 3DRRA 1L8OA 5G5HA 2N82B 3H5SA 5I3UA 1WUAA 3J81O 1CULA 3LAKA 3I9V9 2J0WA 4AYBC 3NGYA 4FK4A 3NBPB 3NL0A 3CQ8A 9ICSA 4OJ6A 1HWJA 3AO5A 3RAQA 4F9OA 3Q8QB 3P1GA 1UJ5A 3KWGA 3RBDA 2U1AA 1N33K 1EQ0A 2HI0A 2HQFA 4X64F 3VTHA 3D2FB 1JLEB 3AUOA 1XHXA 8RUCA 3N6MA 5F9LA 1E4GT 4EBDA 2IOCA 1R43A 2YNHB 1JMTA 3DOMA 1R6YA 4WQ4C 4X4OA 4ES2A 4WZMA 1B0PA 3FC4A 4KH4A 5JLHA 3U1NA 1ATSA 1NGEA 4C4RA 2GO9A 1SQFA 2R7QA 1T9VA 2LU1A 3VQ4A 2VGMA 3CDBA 3CJ8A 3EDRB 5IQQA 4ID8A 1DY3A 4TLRA 1QLNA 4YOXA 5ALDA 3OBYA 4I9QA 4JI0K 1UW4A 4RJVA 3PY8A 5ADZA 5D4BA 4V19J 4BRNA 2GMJA 3OYLA 4WZQA 2AJFE 3UDLA 2PEBA 1FJGJ 3AVHA 1WI8A 1Q86O 4KFBA 4BVPA 4K50A 1C4CA 3T1AA 4BY9C 3CMEN 3CJCA 3MCOA 3K5OA 1RWXB 1B7YB 2J6TA 4RW8A 5AKZA 2E66A 2AYGA 3NGUA 2Y8YA 4M9GA 1MU2A 1PK3A 1IO2A 3CCUS 1I39A 4IFVA 1A9NB 2NO5A 3WKDA 2ZH4A 1QQCA 2G5IB 2HBQB 1LOTB 1NWKA 3ZLJA 3UXNA 1YIJN 1FRKA 4QCLA 1XI1A 2M4MA 1BWFO 1D4XA 1VQYA 4A8FA 4OPHA 2CGKA 1HHSA 4Y0FA 4LSLA 5A0YB 2E4LA 3NY0A 4PKIA 3CJBA 5FD1A 3FE1A 5DG9A 1T95A 3F44A 1S1TB 1NZAA 3QMLA 1K8AT 2UYTA 3WXLA 1H38A 3P96A 4C11B 2CQ1A 3UQ0A 3CC2S 2DY9A 1ZJMA 1ZM9A 1WC6A 3UCGA 4PL1A 2EEYA 4WFBL 1UEKA 2GEMA 3VZHA 2XMWA 2ZOGA 5DKWA 3AJDA 2GGPB 1S72N 1YJ7A 4QWEA 5FROA 3NOCA 1Z1VA 1WSFA 8ICAA 1WNEA 4LF9F 3TA0A 2POKA 3FDSA 4BRIA 3GWCA 1PGZA 1VOMA 4WFNQ 3NF6A 4JS4A 2V52B 1COKA 2B9EA 4GV6A 1K1SA 2FDRA 3WKCA 3KHRA 4V19S 1WB9A 5AR0A 4DFKA 1HNIB 3UI3A 3D2WA 2KP7A 3DLRA 3GCWP 2RKIB 3C95A 1WSRA 4ZP8A 3NAHA 1TUVA 3O5TB 1L7OA 1EARA 3RMAA 1HQEA 3O3FA 3N5BA 4ZKAA 1YTUA 5E3PA 2C3PA 2JLFA 4UAZA 3R8YA 1Q9YA 3TR8A 2EW9A 4FJJA 2VHGA 1UT5A 5K14B 3M2UA 4C1NI 4NLCA 4LVSA 1LWEA 3SR6A 5EHHA 1WG8A 4ZTJA 2KNJA 1C1CB 1X66A 2XSFA 3HHDA 1HLUA 3O6WA 2QW9A 4USAA 7ICLA 1C0FA 2NRTA 2CPYA 4HYKA 2EFGA 2Y1RI 3PNCA 1GMUA 1K9MT 3K57A 1NJWA 1HIYA 3FFKB 2JV3A 3DLEB 4YG2A 5DB8A 1FA0A 3W62A 2NXJA 1ZZFA 3AY9A 4U67L 3UMBA 4CTAB 4BC9A 1WTBA 4GXKA 1WWUA 2V4JB 4MK8A 3V72A 3KK2B 2XMKA 5BYQA 1N5QA 4C0BA 4RX6A 5B0FA 4PGQA 2HHHF 2ASPA 2ZTDA 4DMZA 1AZSB 4KH0B 1OVYA 4QWCA 4LF4K 3RH6A 2A2CA 3QO9B 1BVSA 2F65A 2FBYA 4CBUA 2VCPA 1HKAA 1RCHA 4I1TA 5GADI 2FVPA 4USIA 3MM5A 2QLBB 4A8SA 2RS8A 4ED4A 2PI5A 3M8QB 1NDKA 3ULDA 4K4WA 4NWBA 1U2VA 4RNNA 2ZH6A 1D8ZA 5J0TA 5CA5A 5AM3A 2BCRA 2X51A 7ICSA 3K17A 1EZZB 4JRPA 3A8EA 1NKCA 1TV6B 4X62K 2F8MA 4E7KA 3RAMA 1J53A 2P51A 1RT5A 1X9WA 4ZIWA 3SFGA 4O4GB 3CSKA 2GO8A 5KAKA 1LK5A 1WSJA 5L38A 2G1DA 1WSHA 1FDBA 3K58A 3R9PA 1JJ2R 3QU9A 3AVCA 4RNOA 1LCUA 3OVNA 5SUHA 4DMNA 1ZQVA 1VQON 3I5BA 2DVIA 4BREA 3TKAA 2OAUA 3AL0B 3H46O 3C16B 2G8IA 4CDGA 2HLUA 3M1VB 1PSDA 4B3RK 1SV5B 2P9IB 1JXBA 3ZX2A 3MCPA 5DG8A 4DL6A 3CB4A 2DGZA 4BBYA 3QEWA 2E1RA 1WSGA 3R5DA 4F4ZA 1QSSA 4FBTA 3A13A 2FB0A 2V63A 2ZM6F 1N5YB 2IBOA 4FJ5A 3B54A 1TVRA 1TYQA 3LAMA 1U25A 1ZAXA 3WNHA 3I0RA 3SNNA 4X64J 4DDFA 5BYSA 3TU5A 2LXIA 3AD8C 3HHNB 4CJ5A 4IFEA 4QBUA 3B0XA 3LO3A 4BR5A 3K9KA 1VRUA 5KG3A 2F3NA 4JI7F 4NA1A 3KG0A 4PEOA 3C6TA 5CWRA 2KE7A 2MTLA 4CE9A 4RQNA 3RTVA 1IBKK 1V6HA 1RAEB 4TUSA 2JWKA 2D69A 1OW5A 2AHOB 2J76E 2AJ0A 4IO9Q 1S1VA 1RT2A 4P72A 1KOHA 3UPFA 1U0HA 2DGWA 4OZLA 3VR1A 2Q3SA 4M9JA 3RVCA 1LFPA 1Z05A 3F56A 1IKVA 1N0UA 1WF2A 5DDOC 3FBBA 3AEVA 4HHUA 2OI2A 5AM2A 1T3NA 1FWKA 5F8IA 4OYZA 2X3GA 5EE9A 4NCGB 2DISA 4U96A 1RDWX 5DDRC 1J5OA 4C7ZA 2AYEA 7FD1A 2FTRA 2HQIA 2W03A 2U2FA 1RACB 2EZYA 4KB1A 1Y88A 2YB4A 9ICWA 4GMJB 2ZC4A 1K0TA 3FCWA 1HBOB 1Z4OA 3M1FA 4NLDA 2PMZD 4CJVA 1MA7A 3AA2A 4Y2JA 5DM7L 4BC4A 4UAYA 4IOCQ 4F0HA 2DK2A 3D5MA 4RW9B 2JFDA 4CVNE 1WHVA 2HHHK 2VBXA 3B6OA 4JLHA 3A8KA 4PGYA 1ELOA 2OEHA 3KK2A 2QYGA 1HARA 1HR0J 4BRDA 2HGNA 2GIFA 2XWYA 3MEGB 4GVBB 2C2OB 4QQBA 3DOLB 2R42A 1D1UA 2DHAA 5AZIB 4TN2A 3W2VB 2CWXA 2MPUA 2Q1LA 3TAFA 3HI0A 5A76A 5HQMA 3VQQA 2WVFA 2FD2A 1SAZA 2YKPA 1U02A 4O8KA 4L3QA 1KKHA 2CNOB 3H25A 2DCLA 3IFRA 3GJRB 4M3RA 4E98A 2P9KB 1P8GA 3OV7A 1U8SA 2E5JA 4RQ3A 3KKSA 3LDQA 3CERA 2B4JA 2ZDPA 2DPIA 2W9BA 2R7WA 2OSQA 4DR2F 3H1VX 3MECA 3CJ1A 4U95A 3FBCA 4ZVSB 1T9TA 3ZT1A 2QA1A 2GX9A 4USTA 1FKOA 2H51B 2O8CB 3UMCA 1RXOB 4CEOA 2ZQBA 2WB1F 1SPBP 3AJ1A 2GWSA 4RW8B 3CFRA 3EXCX 3SAHA 1P1LA 2E8AA 3BJYA 3JPOA 2CZVC 4HR2A 3IM1A 2FVQA 3P31A 2FJBB 7ICFA 2UV8A 1O8BA 1UVJA 4HACA 3ZTSA 3V1OA 1FXRA 5JVGL 2I1RA 1HBMB 2KB2A 4W5QA 1BD6A 4DV0J 4ZCKA 3TAMA 2ZM6K 4FOEA 1N56A 4JI7J 4HUFA 3IG1A 3MEKA 2YNIB 3SMPA 3CCQN 4C11A 1URJA 1S9FA 3ZT2A 3D1OA 4KKOA 2Y3YA 2KICA 3DXBA 1U1NA 2WVDA 1Q7LB 3G82A 3BSCA 3TAPA 4UW2A 3IAS9 3HF5A 2NPFA 1IBLJ 1SXDA 4DR2K 5KPZA 1YXQA 5BRHA 1XU4A 3P4IA 4FM1A 4JHDB 1HKBA 5GAEP 4CJUA 3CQYA 5ALPA 4XK8C 5HQLA 3M9NB 3PYFA 4M5LA 3VQSA 4Z94A 1LV5A 2HKEA 2A2DA 2QRRA 1R7IA 1TFYA 5KL8B 3AVAA 1BISA 1RXVA 2D9PA 5HHIA 3O44A 4NWIA 1X8DA 5M1OA 5MLCQ 2QA2A 2D0PA 4WJ3B 2QE5A 5JRTA 4ZCIA 2LQJA 3I32A 2JGAA 3FSIA 3MCAB 5K20B 2BX6A 1JLFA 2HNZB 4CM2A 2ALZA 3OSNA 2DFEA 3PUFA 1EAYC 1RBAA 2I0XA 5GAEU 3LP0A 4ZVGA 3JTOA 3WHIA 1ATNA 5T41A 1CJUA 1UA1A 1RDAA 3OT9A 2WSCC 4Z4HA 1E6VA 3IM8A 3C14B 4AHVA 3QFHA 3LZJA 1NOYA 3RW6A 1X5TA 5J0UA 4DU1A 5HOOA 2YVSA 3FFIB 3WQPA 2QL9B 3G4SN 3VERA 2ZWHA 5BPLA 2VWBA 2V69A 4CHOA 1VSEA 4XPCA 1FEEA 2W6LA 1NJYA 1X1PA 4BG9A 2ZJ5A 4C9DA 1E6YB 5B0EA 2LEAA 3PRVA 1S1XA 2MQ8A 2XZDB 5ETMA 4X65F 3QFUA 3VAKA 1ZPWX 1RHRB 1VQLN 3OR2A 4BCAA 3ZTQA 2RUSA 3QEBZ 4ILLA 4M9LA 2F1IA 1RB0A 3ZCMA 3MX2A 4X62F 3H0RB 2GMLA 2NUHA 4CIFA 4RW6B 2LDYA 5KQDA 3M8SA 5EX3A 3JYTB 3S3MA 1RBOB 3TZZA 7ICMA 4LVOP 1HQEB 4ID5A 4DV4K 3CJ5A 5EGYA 3BGRA 2XY7A 3QEIA 4DR1J 4BXOB 3VEVA 3C7NA 2P9PB 3TP2A 3RJJA 5KT2A 5J2FA 2K8GA 2FHOB 1GLCG 1KD1O 3HHLA 3ETRA 3CJ4A 3E01B 4ZIVA 4Q45A 5KL1B 5L1IA 2QA4S 1TL3B 5BYRA 2ZC3A 4I68A 1NZ8A 1ZBHA 3R8EA 1HWIA 1OY8A 4EZ6A 2D1CA 2RVJA 5KG6A 3KUGA 1WBDA 2JWLA 1WEZA 3VALA 2HBKA 1VAZA 2FJDB 3PIPQ 5CYJA 2HF3A 1P6TA 2ATLA 2V7YA 2ZBPA 1F44A 5DBBA 1GLAG 4BGDA 2KH9A 3O4WA 3ZNUA 4NLPA 4GMKA 2G0AA 3RUBL 4DL2A 3OW2M 2C22A 1QSLA 4GKKJ 2ZJAA 2KT5A 2I2YA 2V8VA 2DY4A 4IG0B 1R59O 4PXEA 2HZCA 1A5VA 4C4WA 2OTJS 2ZTEA 3DXMA 4M47A 3C3LA 2C3OA 4RPZA 4F4WA 5IV4A 4J2EA 5E5NA 2XVTA 3MM9A 1UQVA 2CQ3A 4L6V3 4GXIA 5LMUJ 3MR5A 4DTRA 5J2KA 4FPRA 1KN6A 2WCXA 3SZ2A 1RBUA 2KKPA 2J5AA 3Q22A 2IYIA 3QWUA 9ICIA 2W7PA 1N5WA 1XSLA 4KLHA 2D8CA 3BBCA 3OPKA 5KTQA 3AQPA 1NGFA 4DV2J 4A61A 1LNQA 4DV6K 4KTWA 3IRXB 1AW0A 1WHWA 1G2EA 4KGMA 5HBMA 2VPYB 4JI1K 5KG0A 3DRPA 1ZQEA 2QLTA 4I6YA 4IOBA 4UB2A 2C42A 1HR0K 3CC7N 1QAIA 4H4OB 3QZ8A 1QDUB 4DEZA 4MIBA 4A8KA 2E7XA 2A18A 3PSPA 1RYRA 4P7TA 1X0FA 3JQMA 5DS7A 2HFZA 1EP4A 5IC4B 4TYBA 1JB0C 3UCUP 4WTOB 2QV6A 1PC5A 1ZQNA 2PFUA 1PZNA 3FEYB 4NM1A 4P0PB 1O0PA 3OSPA 2YXLA 2CGLA 1TUWA 3M6UA 4NLTA 1RI7A 3THYA 1FJEB 4CF1A 1HX1A 4MFBB 3MPWA 3IHQB 2PE8A 4LF7F 3OR1A 1KFTA 1DHMA 5F1XA 2ZHOA 2KM8C 2DNKA 1VQKS 5B66U 3PEHA 1EETA 3AOBA 4QW9A 3R9LA 5LJ3Y 5CRXA 4B1ZA 1WF1A 3QRRA 5AK5A 1TTHB 5ETRA 1RT1B 2J6UA 1S79A 4CFDA 3MCNA 3NH2A 4ELTA 1I94F 3Q7BA 1VJQA 4UY85 3NVYA 4QJFB 3FBFA 5D0RA 1LK7A 2V6AA 5G5GA 1C4AA 1A0PA 3BPDA 4O44B 2B5JA 1X40A 2JRZA 1IV0A 5E3RA 2M9KA 3HRGA 3JYTA 3HSJA 2VD3A 2UZAA 4ID5B 3GILA 5J2JA 3KXDA 2VG6A 4LF6J 4G1QA 1J5OB 3DM2A 1RWVB 2VQFK 1NXIA 1S49A 1CZBA 5GAHI 2VANA 1UAWA 4N77A 3CDWA 2Q31A 3ALYA 4JI3K 2F8LA 3BDPA 1C0GA 3JB9k 9ICUA 3HHKA 4M3TA 3SSRA 1KQKA 1W2BR 2V8DA 4KV8B 4CJEA 1TAMA 1NCLA 3KYLA 1N0V<