2HVIA

Ddctp:g pair in the polymerase active site (0 position)
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
b'KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hviA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hviA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hviA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hviA01
5KFUA 1U45A 2VA2A 3ZSYA 2P5OA 2ASLA 2FMPA 3GIKA 1T3NA 3QZ8A 4DLEA 3V9SA 1CZ9A 3SYZA 3LPTA 2PXIA 1S97A 4YQWA 2OPRA 2IS3A 4UQGA 1IG9A 3V7KA 4FYDA 4GLXA 3RH6A 3RJFA 4CJTA 1S9GA 4NLGA 3EPGA 2HHWA 3QO9A 3V7JA 3MAQA 4RT2A 1NJYA 1TGOA 5J2AA 1BCOA 2J6TA 1SKSA 4KREA 2V4QA 4DQSA 3HWTA 4O5CA 3V1QA 4DS4A 3HK2A 2UVVA 4QWDA 3OSNA 2ZUCA 3ZSXA 1RDAA 2AGOA 3N4MB 2R7YA 5KI6A 4B3OA 1KFDA 4UB4A 4LSLA 4OLBA 7ICGA 2F1HA 1S9EA 4O0IA 3GIIA 2E6LA 4JV2A 4CFBA 9ICHA 1N48A 1ZQLA 1BQMA 4FJ7A 4DTRA 1TL3A 4BDYA 4CEZA 1ZQHA 4DL7A 4CJ5A 1Y88A 2F8TA 2BPCA 3VQ8A 1ZQYA 4QWCA 2W42A 4DTXA 2DPIA 4EBCA 2BHNA 3FFIA 1Z3EB 1NK0A 5HRNA 4KHSA 4PH5A 4F92B 1RBRA 4Q8EA 3QETA 5DMRA 2NRWA 3GFKB 1CUKA 3JPPA 2B5JA 3FDSA 4N56A 3C94A 3PX6A 3LZIA 2BCVA 4C8KA 3H8SA 4NM1A 5CHGA 2FLLA 1KEJA 4CEBA 3RJHA 4N47A 2KZMA 5T7BA 4CGGA 3V4IA 1BGXT 1BIUA 3V6KA 3G6XA 1S1VA 3V1RA 7ICKA 1EXQA 4DL6A 1EETA 1KFTA 5HMMA 4TQSA 4CGIA 1VSIA 3TANA 4FJIA 5HHIA 1L3UA 3TABA 1S5JA 5IIJA 3OS0A 3TAMA 4W5TA 1BPZA 1EX4A 4BDZA 2G8HA 1WLJA 2JZBA 2R8JA 2M9NA 2R8KA 2V4RA 4DTJA 2VA8A 1T05A 5KFMA 4F93B 4QCLA 3MEEA 1XS9D 1JLQA 1A77A 4QZDA 2FMQA 4J9LA 1ZQRA 1JLAA 3ZT3A 1D8LA 1WSFA 3NCIA 4P4OA 2W8KA 1L3TA 3B6OA 1NK8A 2QKKA 4ELTA 4ID1A 3V1OA 3VQAA 5KRTA 3SNNA 4OKKA 3V9ZA 1MQ2A 3RJGA 4M3UA 8ICJA 4TSXA 3AVFA 4PGQA 2G8WA 2BKEA 4P2HA 3PVXA 2HHQA 9ICCA 3VQCA 4CEEA 4TUSA 1RBUA 5FROA 4F3TA 4YG2A 3V6DA 4Q0BA 1JN3A 2KFZA 2YHBA 3K5MA 3PNCA 2FMSA 3D45A 2WOMA 3K4GA 4GW6A 4MF2A 3K5NA 4F4KA 3Q8SB 4KTQA 1VSFA 3P5JA 4N5SA 4UB5A 1DOQA 4E0DA 4R5PA 5J2FA 5L1JA 2NRXA 5EU7A 2OYQA 8ICAA 5KRSA 4DFPA 3OYEA 2BE2A 4PUOA 7ICVA 5BOMA 4RG8A 1L3VA 1B43A 2G8KA 3B6PA 4QWEA 1TK5A 3QEVA 4I9QA 5J2IA 1QS4A 4YD2A 4KLEA 1XWLA 4LD0A 4N76A 1SL1A 1LAVA 3KJVA 4DTMA 4QZ8A 3MDAA 2HHVA 4ZH4A 1XSPA 5J2BA 4R63A 9ICSA 5JS2A 1KTQA 1WN7A 5DBAA 1B9DA 3CQ8A 4Z4IA 1ZJMA 5KG4A 4RW4A 4RQ2A 5KFJA 3QERA 3OYKA 4C8MA 1QTMA 3MEDA 3T3FA 4O55A 1J53A 4X5VA 3KK3A 1ZQTA 1RBTA 1BPDA 2Z1JA 1IM4A 4Z4HA 4YXJA 1CEZA 3PW5A 1TL1A 1YTUA 1HRHA 3AVJA 5KG6A 1A5XA 1ZQAA 3NGIA 3AVAA 4CEOA 4FJKA 3B0XA 3QZ7A 4F4WA 2DFEA 2EX3A 4IQVA 4JRPA 4I2IA 3TAGA 1KVAA 3TAEA 4ICLA 4IR9A 4M9HA 3RH4A 5KT7A 3KTQA 4CJLA 1CLQA 4CHPA 4DOBA 2R8HA 8ICUA 5FRNA 3VQEA 1S10A 3RRGA 5HRPA 2PZSA 8ICPA 1S6QA 3WNHA 3ZT2A 2AQ0A 2JEJA 3ZSRA 3NBPA 2ZTEA 2YV0X 1WCNA 3NH2A 4H8KA 3RH5A 4ZTJA 1ZQIA 4QW9A 4OPKA 3SI6A 5DG7A 5KFSA 3QLHA 1W9HA 4QZBA 3TFSA 1HNVA 4CHYA 5CZ2A 4FJJA 7ICPA 3OJUA 3OJSA 2J6UA 5J0YA 4ECVA 5KFAA 4O4GA 2VWKA 3OYHA 3JPSA 1WAFA 4TUQA 1X9MA 2X6NA 4C8OA 4NLKA 2W9CA 4XIUA 2FBXA 1RNHA 3HJFA 1ZQDA 3AV9A 1JLCA 2I5JA 1Z25A 2IDOA 4JWMA 2AGPA 3DOLA 4I27A 4DL3A 3H8WA 4ELUA 2EHGA 1ZQEA 4QZEA 2PFQA 1U48A 3C95A 4FJGA 5KT5A 9ICUA 4Y1DA 3Q8MA 3D0PA 2XHBA 3L8BA 2NRZA 1I39A 3F73A 1JX4A 3BGRA 1X9WA 3KHGA 4UAYA 1L3SA 9ICWA 1J5OA 2ALZA 1IKYA 4DL5A 1REVA 4PWDA 4RQ4A 4GXKA 1ZQWA 3Q8LA 4I2PA 4YMOA 2HHUA 4J9QA 3DRSA 4Q44A 3ZSZA 3I8DA 5DG8A 3VQPA 3ZSOA 3BQ1A 4AHSA 4UB2A 1C0UA 3IM1A 1EP4A 2HB5A 3CYMA 4EBDA 4CGFA 3OS1A 3EWAA 4R65A 3KHHA 1IKXA 5J0SA 3BQ0A 4YMMA 4M3ZA 4DQRA 3MR3A 1WSEA 2P5GA 4HVJA 1S1TA 4AHTA 3M8RA 4O3SA 1N6QA 3G10A 5L1KA 3H7IA 4PGXA 3OYLA 9ICAA 4DWIA 1NJXA 2W9BA 2ISPA 3DLEA 5D46A 2HNYA 2VG5A 2KQ2A 4F5PA 3AVLA 2OPQA 5CB1A 4KHWA 4QZAA 3RR7A 1B92A 1SUQA 3V81A 4EP5A 2PYJA 4RUCA 2C2DA 4W5QA 2Z1GA 3DMJA 4CCHA 3C1YA 1NK6A 4B8AB 3SQ2A 2XY5A 2QK9A 3VQBA 5C24A 3ISDA 2P6UA 4CK2A 4FJNA 4E1NA 3QIOA 3QINA 4I7FA 3JPRA 2OZSA 4KB0A 3LDSA 2WONA 3KK2A 1S0MA 4M0AA 4CK1A 2KZZA 3IS9A 2HHTA 3DYAA 3RJIA 2ISOA 4P4MA 4DTNA 4HCCA 4B9UA 4BE2A 3HX0A 4J2DA 1TV6A 4ZTFA 3AO3A 2XY7A 3PX0A 1LAWA 1RDCA 4E1MA 1XHXA 5KG1A 3ITHA 2G8VA 3ETLA 4K4IA 2OPSA 2GUIA 9ICKA 5J2MA 3LPUA 4FJ9A 2G8IA 1LW0A 5KFEA 3DM2A 4BWMA 1C7YA 4AHRA 8ICOA 9ICFA 1ZETA 1HYSA 2KW4A 5KFIA 5HNKA 1RYSA 3GV8B 4RQ1A 1ZQCA 1MSWD 2XO7A 3K5OA 5TZVA 2ASDA 2P6RA 4IKFA 3ZT4A 4RU9A 2HNZA 4ED8A 1RTIA 9ICMA 2QXFA 2HVIA 1BPEA 7ICIA 4FXDA 3JPQA 4DSKA 1RTJA 1RT6A 3NDKA 3S3NA 1HJPA 3HP9A 4ECYA 4O9MA 3VN5A 2FPMA 1WNSA 1QSLA 4J9OA 1K1QA 4M41A 4DU4A 3NE6A 2FBVA 1RBSA 3BQTA 1N5YA 1NK5A 4RNNA 4UB3A 1ZBLA 3O4NA 2ITGA 1BQNA 1HPZA 3ORYA 3V9WA 7ICSA 1T4GA 2VG6A 4KN4A 3LP0A 1RXVA 4UB1A 7ICNA 4QZFA 5KT3A 4QZHA 3AA5X 3DLBA 5HRSA 4RW8A 2Y1IA 3NAEA 3TR8A 5DQHA 2UVUA 3AUOA 3AO5A 4K8XA 4DTPA 3RAXA 2A1RA 2KFNA 1C6VA 4OLAA 2WTFA 2C2EA 4YR2A 1IXRA 9ICEA 3SUNA 4J2BA 3DRPA 1WSJA 1MQ3A 4KLOA 3WNEA 1NJWA 3C2KA 4W5NA 2ZE2A 1BL3A 3KLFA 3AVKA 1SKWA 3WNGA 3OVNA 3VQ9A 2IGIA 3OY9A 5KFNA 3ZDCA 3B0YA 4IRCA 5DB6A 2X74A 5CYQA 5EWEA 1WSIA 2XCPA 3JPTA 1NK9A 2PFNA 2QKBA 2YHAA 4YR0A 4FLWA 5I42A 2J6SA 2BCSA 3MFIA 3S3OA 3RJKA 9ICPA 4F4ZA 1NJZA 4KHNA 1VSHA 4IRDA 4KMUA 4ZHRA 4ED6A 4CJPA 4EYHB 4NYNA 4E19A 2BPGA 4NLNA 2BQ3A 1FKOA 1A5VA 2JLEA 4BE0A 5IILA 4FJ5A 2BGGA 5JUMA 1JLBA 3CG7A 4I2DA 4OKEA 4J9SA 4FJMA 2ZJ5A 1VK0A 4CESA 5J2HA 3VQ4A 8ICMA 1RZTA 4KLMA 2GBZA 3PX4A 4F50A 3RJJA 1TKDA 1HYVA 3ISCA 4R66A 1RILA 3CFPA 4YVZA 3C21A 1JXLA 1CXQA 5KG7A 4RW9A 4GC6A 1C1CA 2VWJA 3P1GA 3IRXA 4I2EA 1DLOA 4OGEA 1C1BA 3QEWA 1WSGA 7ICRA 5IIMA 3PW7A 1ZQSA 4MEYA 3IG1A 3SV4A 3Q8RB 1RTDA 4XUSA 5C42A 1ZQUA 2R8IA 2YKMA 4IG0A 3PY8A 1ZQKA 4YP3A 2IHMA 4O3NA 1DGSA 1H38A 2IC3A 1IKVA 8ICCA 2BR0A 4KV8A 2ASJA 1LV5A 2ZTDA 4CJUA 5J1EA 4FLVA 8ICYA 1LWCA 2IMWP 1ZBIA 1EXNA 4GVMA 2IA6A 3AVMA 3C23A 5DK5A 1VSDA 1BPXA 4FK0A 3UXNA 2IHNA 4PGYA 3SV3A 3TAPA 1L5UA 2B21A 4CF9A 3U3YA 3KD5E 3BJYA 3UXOA 2FLPA 2KZ3A 3BDPA 3T5KA 4CERA 4CFCA 1W0HA 5J2GA 3T19A 1MU2A 4J9RA 4HHTA 1TKTA 4M3TA 2H5XA 7ICMA 4ECWA 4FM2A 3ULDA 1BI4A 4OGCA 3ZDAA 1JXBA 7ICFA 8ICZA 3SCXA 1HQUA 3QNOA 4FK4A 4EZ9A 3LP1A 9ICJA 3G6YA 5KFLA 4ED0A 4M9NA 4YN4A 4KLFA 3NF9A 2XRIA 5KT2A 3BQ2A 4ED1A 1J54A 2W9CB 1WSHA 3PMNA 5KFCA 2AQ4A 1VRTA 4PHEA 1NK7A 2DPJA 2OPPA 3AVGA 4DQQA 4FVMA 4DSJA 4YXMA 4F5QA 3OYNA 3GIMA 3IAYA 1UA1A 5CJ7A 1QQCA 4MQ3A 4CGJA 5KFFA 7ICEA 3E2EA 4XQ8A 1BVSA 4F2SA 1B9FA 4PPXA 3KHLA 4KLUA 3OS2A 4CJFA 1HJRA 3KD1E 5KFOA 3T5JA 4N41A 4F8RA 4CIEA 3HP6A 2ZJAA 1S76D 5J0XA 3JPOA 4NM2A 4ED2A 5DDMA 4IG3A 3HSTB 4I2HA 4RW7A 1SL0A 2V9WA 1WCLA 2PYLA 4FK2A 1LW2A 1MC8A 4QZGA 3KLEA 4UAWA 8ICSA 4M3RA 4DQIA 1RTHA 4KHYA 3MR5A 3M8QA 4M6WB 5KFTA 1Y97A 2D0CA 2W9MA 4AILC 4EBEA 4KO0A 2P51A 3RR8A 2G8FA 1ZBHA 4KITB 4MF8A 4DMNA 5KTQA 2BQRA 1UOCA 3MGHA 3LDAA 4FLUA 7ICJA 4QW8A 5KFHA 4OVLA 2W9BB 2OWOA 3OYDA 1C0TA 3RBDA 2Q0ZX 2A1JB 2FLNA 4KKOA 2HHXA 3NF8A 3ISNC 1KSPA 8ICKA 5D4BA 2E4LA 4RNOA 1T03A 4CFAA 5DB7A 3DLGA 3PV8A 4DSEA 3RB6A 1R0AA 4ECQA 4HYKA 1SZPA 5HBMA 2E6MA 2I9GA 5J0OA 2A1SA 1TFRA 1K1SA 3PR4A 1LWEA 1RPLA 2ZD1A 2FPLA 3DRRA 4K4GA 4I2CA 2RPIA 3EY1A 4O5BA 3HM9A 3M9OB 5C5JA 4CHOA 1VSMA 4E7IA 5DQGA 1XO1A 2ATLA 4CJ4A 1D9FA 4CJSA 4QZCA 3LANA 4O5KA 2PY5A 5KFKA 3UQ0A 2AJQA 2JEFA 1RBVA 4RZRA 1NK4A 4DU1A 1ZQOA 1TV9A 5KFXA 4FBUA 5KFWA 4ECUA 4BE1A 3MGIA 3QESA 1HUZA 1KFSA 5HP4A 1COOA 3VQ7A 4FM0A 4PHDA 1A5WA 1UWBA 4CGDA 3T5HA 5JS1A 4XA5A 4YD1A 1NOYA 5L9XA 4AHCA 3KIOA 4DF4A 3S3MA 1X9SA 2F1IA 4E3SA 4I9LA 1BHLA 3VQ6A 3CFOA 3OSPA 2I1QA 5J0QA 1IKWA 4O0JA 4KPYA 1NKEA 3C5GA 4DTUA 2O4IA 4DTSA 3RMBA 3SUOA 2DY4A 2JEGA 3AO4A 4CEDA 4ED3A 4M3YA 3TARA 9ICXA 5KT6A 4J2AA 2LYHA 2VANA 4M6WA 3KLHA 5E41A 5SWMA 1IO2A 4KLDA 4I2JA 8ICEA 4BGDA 4M3XA 2XGQA 1CZBA 4B08A 1ZQQA 4ECSA 3OHAA 4QOZB 4EYIB 4ECXA 1X1PA 1JL1A 2A1JA 3HPOA 2BGWA 1RT5A 4Z6FA 4LZGA 9ICNA 3QEBZ 3L2WA 2YKNA 4ED7A 5DGBA 3NFAA 4KLIA 3SJJA 4M9JA 1QHTA 4BXOA 1ZBFA 4ECZA 4DFJA 1QE1A 9ICQA 4Z6CA 4DSLA 5KGWA 3L2QA 3GILA 4M04A 3L3UA 4KB1A 8ICHA 5EWFA 3DI6A 3Q8QB 4F5NA 2FC0A 5CP2A 3MXIA 1RXWA 3JYTA 9ICTA 1BCMA 4DL4A 4F3OA 3LALA 4M45A 3V6JA 2BDPA 4CJEA 3OYCA 1JLGA 1Q9XA 1ZYQA 1ZQVA 4ECTA 3V7LA 4DSFA 3QNNA 2JEIA 3HVTA 5J0WA 1N56A 3HYFA 3K5LA 1S1XA 4BWJA 3ZSWA 2DFHA 4CF2A 3O3FA 4YR3A 4UAZA 2ZUBA 5J2DA 2KTQA 5F9NA 3VQDA 1YTAA 3HXMA 3AVBA 1Z00A 4I29A 4E7KA 5D3GA 1KVBA 4TUPA 3DLKA 4GXIA 1XSNA 4BDPA 5IIKA 2DFFA 4BACA 1ASUA 3V6HA 3RB0A 1ZQMA 3UIQA 3VQ5A 3NGYA 3FYHA 3DLHA 4Y1CA 4DLGA 1K6YA 5KG0A 4J9PA 4EZ6A 3EPIA 4JS5A 5J2PA 5CY4A 5DLFA 2KN7A 4E7LA 8ICXA 5HMLA 3QEAZ 4WE1A 4KLTA 4JRQA 4HTUA 3TFRA 4YCXA 2YNGA 4FBTA 2YNHA 2MAXA 4CECA 3H08A 3O3HA 4HUGA 1U04A 3QIPA 3OYMA 2Z1HA 1XU4A 2AGQA 3LZJA 8ICTA 5SZTA 3NF6A 2Q3SA 1FK9A 4NXZA 4CF8A 4O3PA 4XRHA 1LB2B 4NCGA 3C6TA 1KRPA 4CE9A 4JLHA 4EP4A 4DL2A 1ZQPA 2IOCA 2XCAA 5HHHA 2F96A 3ISBA 5HRRA 1F21A 4CEAA 7ICOA 8ICLA 4E7HA 2HW3A 4M42A 1S0VA 3TI0A 9ICRA 4B9NA 5HROA 3GQCA 1U4BA 1ZQNA 1X2IA 2ATQA 1NKBA 4IQUA 4B9VA 7ICUA 3PW2A 4Z4CA 3TWHA 2LSNA 4CGHA 3AA4A 9ICOA 4YNQA 2IBKA 5KFPA 2XGPA 2JGUA 1GOAA 3MFHA 3AO1A 2XY8A 4O3RA 4LY7A 3RTVA 1XSLA 4J9NA 3ZDBA 4GMJB 3V72A 2BCQA 3NH1A 1BI4B 2NUBA 4C8LA 3HT3A 4KLQA 4FLTA 4KTZA 4HUEA 4DOCA 4DFMA 4R64A 3ZD9A 1KCFA 2C28A 3N97B 1HUOA 1TVAA 3Q8PB 2GV9A 4KLJA 3K58A 2ZUDA 4Q43A 1BISA 1UT8A 1BPYA 4PA1A 4FZYA 5KFZA 4IQTA 1S9FA 1WAJA 4CHNA 3E01A 1VSJA 5IINA 3SPYA 5I3UA 1TK0A 4E7JA 4MFBA 4RQ8A 2ETJA 5KGXA 4O3QA 4ID5A 4AH9A 4F5OA 1S1UA 3L2UA 3MECA 3T5LA 2OA8A 1DTTA 3MXJA 5KG5A 4I2GA 5FRMA 3H8JA 5DG9A 4Z4EA 1NOMA 4MFFA 2RDIA 3LP2A 3L2RA 1G15A 3LAKA 3SQ4A 5EWGA 1Z26A 1ZQXA 1RCHA 4FZXC 4JV1A 1RT4A 1S6PA 3L3VA 2PI5A 1A76A 4KLGA 3MR2A 2Z1IA 4RNMA 4FLXA 8ICWA 5J0PA 1ZQGA 2VA3A 1ASWA 1J9AA 3GV7B 4FZZA 5DDYA 2HMIA 2X78A 1C0MA 3WNFA 4QZIA 4FLZA 3LK9A 2Y1JA 4CIFA 4CK3A 3F9KA 3T1AA 3AVCA 4RQ6A 4FS1A 3K75D 5CA7A 4KLSA 5D49A 4PHPA 8ICQA 3QE9Y 4DQPA 4M3WA 8ICIA 1JL2A 3MXMA 3OHBA 3H4BA 5BOLA 4YMNA 4CEFA 4DFKA 1S77D 1RDBA 4CJWA 3MABA 1JKHA 3EYZA 3U6FA 1D5AA 4B9TA 1QSYA 4DS5A 4LH4A 3RMAA 3SZ2A 4KN7A 1TAUA 3KHRA 3RB4A 3C2MA 2HVHA 3VA3A 4I2AA 4G1QA 4JV0A 1Q8IA 4AHUA 3RMDA 4TURA 5KFDA 3OGUA 5J2KA 5J2NA 2HNDA 4DG1A 1BPBA 1VSLA 4I2QA 3NTUA 1BIZA 5KG3A 3TAQA 4KHQA 2DTUA 4IFVA 2B4JA 3KKRA 4J2EA 4DOAA 3AU6A 4Z6EA 9ICGA 3LWMA 2RN2A 5DBCA 4RPXA 3OYFA 1ZQBA 4H4MA 4RQ0A 3NH0A 4CJVA 4LZDA 3MDCA 7ICTA 4FW1A 2FBTA 4HUFA 3VA0A 1B22A 3SUPA 3A2FA 2D0BA 3M9NB 3AA3A 2ZJ8A 3PUFA 1UT5A 2B6AA 4ELVA 2F1JA 4RPYA 4EEYA 1YT3A 4MFCA 3V9XA 2F8SA 1RDDA 1PZNA 4Z4FA 5BPCA 1RT3A 4FS2A 3PMLA 3HL8A 1JXEA 4G3IA 5KT4A 2YNIA 5CWRA 5HLFA 4Z6DA 1KDHA 1KLMA 3AU2A 2RKIA 4F2RA 8ICGA 1ZQFA 1U49A 4FJHA 4I28A 5DKWA 8ICFA 1T7PA 3DOKA 4IDKA 1S0OA 4F91B 1XHZA 4BXOB 4KTWA 5K14A 4Z4GA 2X6SA 4RW6A 3MR6A 3P83D 1I3AA 3AO2A 2VG7A 3RWUA 3I0RA 2NRVA 4ECRA 5KFQA 3RRHA 3EZ5A 4LVSA 4NY8A 2XC9A 3NGZA 4J9KA 4DF8A 4GXJA 4I2FA 3QEXA 1VSEA 4M9LA 1FKPA 5DQIA 3CM5A 4CF0A 3SI8A 4OPJA 1HYZA 4LSNA 4F5RA 4B9MA 7ICQA 1RT2A 2OZMA 3C5FA 3IHQB 3PW0A 3RBEA 4B9LA 2D5RA 4R8UB 2C2RA 2UVWA 4RPZA 4JUZA 4MFAA 1GOBA 3K59A 4W5OA 1C1AA 2ZTCA 1GOCA 4JS4A 4DTOA 2DFLA 4I2BA 4CIGA 5J2CA 4UBBA 3AA2A 5FDLA 4GC7A 4Z0UA 3VQQA 3O3GA 2MUTB 2G8UA 3PW4A 2O4GA 4CJQA 3K57A 1XI1A 1Z00B 1Q9YA 3ZSQA 1AROP 5CR0A 4IQWA 4L8RB 3THVA 5DBBA 1HMVA 4NLZA 4RUAA 3HO1A 5IIIA 2BPFA 3GDXA 1SL2A 3NGDA 3RJEA 7ICLA 3RMCA 3LP3A 1UAXA 4FCYA 4M9GA 3SQ0A 5J2JA 4CHQA 4KHUA 4M47A 4KLHA 3AVNA 1ITGA 2W8LA 4NYFA 4RQ3A 1QLNA 3Q8KA 3CFRA 1RYRA 1JMSA 1V9PA 1S1WA 2GWSA 4CHZA 3ASMA 3NF7A 1YVUA 1JLFA 4Q45A 5DGAA 4CJRA 2NRTA 3M8PA 3OYJA 1UA0A 5CYMA 4DO9A 4OJRA 3ZD8A 3KK1A 3TQ1A 3OYGA 1S0NA 4B9SA 4LH5A 1RT1A 9ICLA 3OYAA 3DLRA 4NCBA 1ZJNA 3MEGA 3MBYA 3TAFA 4B8CA 5HP1A 4F4XA 4C8NA 2PFPA 2BCRA 1TVRA 2XY6A 2C22A 9ICBA 1U47A 5IIOA 3KLIA 1SKRA 3UQ2A 4PQUA 4Q8FA 3JSMA 4PY5A 2FPKA 5J2QA 3L2VA 5J29A 3LWLA 3RAQA 3PO5A 1D9DA 2D0AA 4E89A 2W9AA 1ZQJA 3EW9A 4CFDA 2ZQBA 1U9LA 3ZT1A 3ZCMA 1TAQA 9ICVA 3HW8A 3S9HA 4CJKA 4CEQA 2AU0A 4HCBA 2YNFA 3I0SA 3ALYA 2HHSA 4KLLA 4DU3A 4KI4A 1ZQZA 4YFKA 3H4DA 4R8UA 3CM6A 1O1WA 2RDJA 5KG2A 4J9MA 4KI6A 3UXPA 1KVCA 4FJ8A 5DB9A 4QWBA 1VRUA 4IBNA 4CF1A 3O4QA 2P1JA 2MUTA 4IFYA 4FM1A 3G6VA 1DTQA 4Q5VA 3PO4A 4CJ3A 4F4YA 4MEXA 4FJXA 3SPZA 4K8ZA 3HVRA 3V9UA 4KRFA 1SV5A 1JIHA 5J2EA 4M2YA 3GV5B 2UVRA 5F9LA 4FO6A 3RB3A 3ZDEA 4RT3A 5DLGA 1NOZA 4JK1A 4NCAA 9ICIA 4IRKA 4OKJA 3H40A 2BCUA 8ICVA 5EOZA 4QAGA 1TK8A 1XC9A 1LWFA 3C2LA 1RT7A 4AHVA 3ZSVA 4W5RA 3OYIA 4QWAA 7ICHA 3JPNA 4FJLA 3NHGA 3M9MB 2R8GA 4FLYA 5J0TA 3AVIA 3M8SA 4IR1A 4TQRA 1QSSA 4O5EA 3LAMA 2IAJA 2BQUA 5KFRA 3K2PA 4QZ9A 1TKXA 3KLGA 4KAZA 5KFYA 1ASVA 4O3OA 3ZT0A 2RF2A 2BANA 1NKCA 4KFBA 1KLNA 3ZDDA 1EKEA 5KFVA 1TKZA 3QEIA 3HPHA 3UPQA 3GIJA 4FW2A 3C1ZA 2PI4A 4K4HA 1FXXA 2PFOA 4PHAA 8ICNA 1HQEA 3AVHA 5KFBA 4RQ5A 3SUQA 4UBCA 5CZ1A 4YFUA 3G0ZA 5DB8A 5KFGA 5C25A 1HNIA 5L1IA 4P4PA 1VSKA 1T8EA 2FBYA 4DEZA 1IH7A 1JLEA 3HPGA 3KKSA 1CXUA 8ICBA 5J0RA 1D8YA 3QEPA 5L1LA 4RQ7A 4JWNA 4O44A 2P66A 2JZBB 1ZBUA 3SQ1A 3C6UA 3OYBA 3PR5B 3U3GA 8ICRA 4H4OA 4DSIA 5J0UA
chains in the Genus database with same CATH superfamily
1U45A 3MGJA 1R31A 5ADXA 1UQVA 3RBZA 3GIKA 1N36J 3M30B 4BC4A 4K4YA 3D2EB 1N5SA 4YQWA 2YMQA 1IG9A 3V7KA 2FDNA 1ED1A 4GLXA 4DG1B 2GMJA 3Q86A 2G2OA 3RJFA 3IO1A 1H2TZ 3G8SA 2HWIA 3V7JA 4IFVB 4M95A 4DX5A 3SXLA 4OZ3A 1P6TA 4GO7X 1Q4RA 2J6TA 1UHUA 4OJ3A 4PZVA 3DLLQ 3HWTA 4O5CA 4WU3A 4A57A 1UL3A 2O3DA 2R2RA 4OX7A 3IFRA 3OSNA 3ENWA 1C0FA 2FY1A 5AQPA 4UB4A 2BE2B 4OLBA 4FVCA 5DRKA 4AL7A 1VJWA 2E6LA 4CFBA 1ZQLA 1H3DA 4DTRA 1OPIA 4E8UA 5ETPA 3C0BA 1ZQHA 3KOOA 4DV6J 4CJ5A 1SXDA 3AA8A 2BPCA 3PFOA 4QWCA 3K1ZA 1Z3EB 2MZSA 3LA0A 1BA1A 2GWKA 1NDCA 3IC1A 3GFYA 5DMRA 2H48B 2FJVA 3FDSA 4URQU 3LZIA 3ZYYX 3H8SA 4NM1A 3NKYA 3THXA 5CHGA 1KEJA 4N47A 4H54A 1VQKN 3EM1A 1F2GA 3V6KA 4QBUA 5IFMA 1KFTA 3QWUA 2EFVA 4CGIA 3OXLA 1VSIA 2NUUG 3IG8A 3SCIE 2E66A 4FJIA 3TABA 2ZNZA 1TL1B 2Y9TA 4M5DA 2RIJA 1EX4A 4LF5K 2LECA 2OXOA 2MQOA 4RNFA 2R8KA 1UW4A 4QIEA 2V4RA 4OCZA 4U7UD 3PRBA 1XS9D 3WKAA 4F71A 3ETRA 1A77A 2WAQC 2ZIXB 3QU5A 2YKOA 1MMLA 1YXQA 1RWKB 1CJUB 3OXGA 4DV0J 1WSFA 3NCIA 2QKKA 1S6QB 2N82B 4ID1A 1UKUA 2MZRA 1WOPA 1N5QA 2KSOA 8ICJA 4JYAJ 3D2EA 3MUMP 4ZIVA 1YIJN 1KN5A 3VGMA 1FO4A 1JN3A 2GO9A 5JICA 1ZZNA 3QRRA 3D45A 1VOMA 1TR0A 2P8IA 4WP9A 3K4GA 4EU0A 5AQQA 2OANA 4FFDA 4NLWA 3J7YU 4UB5A 5AI6A 4DCPB 1O08A 3AJDA 4E0DA 1HMVB 5J2FA 4NXMK 2KLAA 3CXCR 2OYQA 4WXWA 4DFPA 1KOHA 3QB0A 1XMBA 4Q2LA 2BE2A 4PUOA 2PE8A 2J7KA 4F3MA 1L3VA 4KJIA 2CQ0A 3B6PA 2G8KA 4ICAA 1P90A 4FZLA 3GWCA 1TK5A 3QICA 4I9QA 2PGCA 1RACB 4WFZA 3RFAA 4DV4J 2VUGA 4LFBK 4OYWA 4KLEA 4LD0A 4N76A 2CRLA 3KJVA 1Y0HA 4QZ8A 1HWJA 3MDAA 5EX5A 2K3IA 3EVMA 2HHPA 9ICSA 2LM4A 2XHCA 5JS2A 3M8PB 4CZFA 3SBTA 1ESVA 2A2DA 3CW2C 5DBAA 4Z4IA 1HX1A 1SKUB 3QERA 1YSJA 2P9LA 3SBGA 3IFEA 3OYKA 5F8IA 3QUCA 1QTMA 3MEDA 3T3FA 3CP8A 1SJ1A 3DGVA 1XMQF 3TADC 4X5VA 1RBOB 1RBTA 5DO2A 1M5SA 3D1HA 4FYYB 1CEZA 2MQNA 1KQGB 1TL1A 4C6AA 3MM6B 1IWAA 4DR4K 3OLBA 4MH8A 1Y00A 4KGZB 1X4BA 1VQ4N 2VG5B 3PIOQ 3QZ7A 2DFEA 2OPQB 3GLJA 4LRAA 2F44A 3IM9A 5BYSA 1IBLK 1RAHB 1KVAA 4LMZA 3TAEA 4M9HA 4PXEA 3KTQA 2ZIXA 4CJLA 1CJUA 8ICUA 2HPUA 5HRPA 5FRNA 2PZSA 1WHYA 1S6QA 3CJBA 3ZT2A 2AX0A 4Y34A 2C3YA 1TYQB 3NBPA 4QS7A 4MN4C 1RAJA 2DNLA 2UZAA 4NYZA 3KK2B 1ZQIA 2JHDA 1JCFA 3FE1A 4ZTJA 4QW9A 1N5VA 3O0FA 1HQ2A 1W9HA 4QZBA 4CHYA 3DAWA 4FJJA 2IRYA 4BCAA 4MLHA 2J6UA 2XMTA 3JPSA 3MUVP 4TUQA 4NLKA 3OL7A 1RDWX 1JALA 4NO7A 2AEMA 1L6NA 3HJFA 5GAGI 3C7NB 4PKHA 1JLCA 1NM1A 2IDOA 4JWMA 2YX1A 2RQ5A 1X4AA 5AXNA 4PYAA 1HNZF 2CNNB 4ES1A 2KJWA 1R0BG 2P9NB 3VERA 4F72A 1QAJA 3KVGA 4FJGA 2R7OA 3C16B 3SCJE 4Y1DA 3Q8MA 1E4GT 2W03A 3D0PA 2XHBA 3L8BA 1JX4A 3BGRA 5B0EA 4ILLA 1Q46A 1L3SA 3G25A 4GXKA 1ZQWA 4CBWA 2OEMA 1XIQA 4Q44A 2YWGA 1RTJB 3GYXB 2E5LJ 3BQ1A 4AHSA 1KVIA 4K0KF 3CYMA 3L7PA 4EBDA 7FD1A 3OS1A 4MTPA 2EXUA 2P5GA 3T1YK 2IMOA 4AHTA 4DX7A 1O13A 1V85A 1CQMA 1C4CA 3TX8A 2JSXA 8ATCB 4QYRA 2E1YA 3I5AA 4CGZA 2MHEA 3AB2B 1HQEB 2VQFK 3MM6A 5CZVA 5C25B 2ISPA 3OL6A 1F3VA 3UB5A 2A10A 3M1VB 2VG5A 3LM2A 2VCPA 5LM7E 3N4QA 4DN9A 2OPQA 3UW1A 3CCMN 4QZAA 2V67A 1B92A 2M88A 1J5EJ 4K41A 3UO0A 3J81U 2V69A 1TUVA 2KJ9A 4U8VA 5EN1A 5E3RA 3P8BB 2CKWA 3SQ2A 3CJ9A 1Z2ZA 3VQBA 4LR9A 5C24A 3HHLA 2JRZA 3GSIA 3R5CA 4FJNA 4E1NA 3QIOA 4C4SA 3P45B 1I94J 3KK2A 4CJ7A 4M0AA 2KZZA 4F0HA 2HHTA 1IUJA 4U7CA 2E2PA 2ISOA 2ZIUA 1OYDA 3QBCA 4DV3J 4BE2A 4EGLA 3O9QA 1IBKK 4J2DA 1TV6A 1LAWA 1RDCA 1XHXA 1P9QC 3NL0A 1COKA 1HA1A 2U2FA 1X4EA 1BWVA 2WK4A 5I42B 2G8IA 4A2BA 5KFEA 4BWMA 3TZYA 1TMJA 4OHZA 2V68A 3JB9k 2LXIA 4CM0A 5G4DA 4GKJJ 5HNKA 3TUZC 2H3GX 4R25A 2P9NA 3PM9A 4MO5A 3NVKA 1DRZA 3GV8B 4LF8F 1JLBB 3C16A 1WORA 2HFVA 3OR1B 1QQ7A 3K5OA 2QT7A 3G82B 2QL9B 3B8HA 5B8HA 1UPPA 5GAHI 3BBFA 2E9ZA 4IO9L 3WQUA 3ZNUA 1BPEA 3PFEA 2J0SD 3JPQA 1RTJA 2MLXA 5AKJA 2CQCA 4TU8A 5AM1A 3HP9A 1S49A 3N5FA 5ALQA 3OBIA 5IC6B 1T3OA 3E66A 3J80O 2FPMA 1NSKL 1J97A 1X40A 3IG1B 3FZLA 4KH4A 2FBVA 1RBSA 3BH7B 3MX5A 3BQTA 1M1KO 1A9NB 2M52A 4I4BA 4L76A 4TVAB 4MKYA 1S22A 2W2OP 1NK5A 1ZD4A 1UVKA 4JD2A 4RNNA 4UB3A 2KXFA 3O4NA 1X0PA 4CZIA 1N34K 3IWLA 1CLFA 3M1VA 3M8YA 3JQJA 3ZETB 1G2EA 1Q1KA 1PIEA 4A47A 4NZ0A 3AARA 4L75A 1Y5NB 4QZFA 1U1RA 3AA5X 2K1RA 2QV6A 2YHYA 5HRSA 1RKJA 2Y1IA 3NAEA 2WBRA 1TUUA 2UVUA 3VQTA 3AO5A 3RAXA 2CNOB 4URSA 3CI5A 4PG7A 1C6VA 1NPRA 1CSJA 2ZNYA 4WQ4C 4MAKA 1YG0A 3DRPA 3BGOP 3C2KA 1YRUA 1BL3A 3TA1A 3WNGA 1J2NA 2ZZTA 3VAIA 4GV6A 4OI2A 2LU1A 4NXMF 3HKWA 1T9UA 4A48A 1Q95G 1L7NA 3B0YA 3TTCA 2XCPA 1DGJA 2PFNA 3DOMB 5I42A 3CWJA 3RJKA 3VEXA 5J8YA 1GEHA 4F4ZA 4IRDA 4LFBF 5D0EA 4E19A 4M5KA 1UZHA 4A46A 4NLNA 1FKOA 3M05A 4C7YA 4U9RA 4WFBQ 2JLEA 4BE0A 4R5PB 5IILA 1ROFA 4FJ5A 2FVCA 1JLBA 1M5HA 1V6HA 2GJIA 3OR1A 4DUZJ 4C0BA 1VC5A 4K42A 4LF6K 3G82A 2ZH2A 4P2FA 3ZFVA 3ZTSA 4F50A 3N0VA 3K7RA 3CCUN 1HKCA 3BS7A 1RILA 3LL3A 3CFPA 4YVZA 3J81Y 3AT1B 5D6GA 4GC6A 2RDDA 5GTHU 2OELA 1C1BA 1LW2B 7ICRA 5GADP 3TQEA 2CYYA 4MEYA 3IG1A 4XUSA 1VQ4S 3GB0A 1YJ7A 5AE3A 4OX6A 2KRRA 1V5VA 4YP3A 1IBLF 4O3NA 5L38A 2B8QA 3ADAC 2OD6A 4FPIA 3ZETA 2LXUA 3THWB 4ZPCA 3GG1A 3QBXA 4FLVA 3UDVA 3G6EN 3HILA 3W5XA 1YBTA 1EXNA 2IA6A 5JVGL 4NLQA 1RG6A 2L08A 3CCQN 4B1YB 3SV3A 4KIAA 3TAPA 1FTRA 1WEZA 5ETKA 3KD5E 4NXNF 3CQYA 3UXOA 5LMUF 2FLPA 3JSRA 3K8VA 4JAXA 1W0HA 3IP0A 1H74A 4J9RA 4WQ5A 2W04A 4IKAA 1NGJA 3VTIA 3QJLA 3H3NO 2H5XA 3UE2A 1GFWB 2Q1LA 5AQWA 4OGCA 3ZDAA 1JXBA 8ICZA 3Q8UA 3DOMA 3VCBA 1AYEA 4KHRA 2XI2A 9ICJA 2GVDB 1X0FA 5KFLA 2XTJP 4M9NA 2YWHA 3E8OA 1VQ9N 5E33A 3H5YA 2G0JA 2KJ8A 2GCFA 3FMBA 4KLFA 2XRIA 2CPIA 5KT2A 3GE1A 3CULA 3DDHA 3BQ2A 4ED1A 5EX0A 4I6WA 3ULEB 1J54A 3TTFA 1K8AT 4B3TK 2AQ4A 4O5FA 1V4SA 2I5JB 3DGPB 4Z7YA 1NU4A 4PHEA 1UWBB 2MKYA 4TY8B 2OPPA 3J8AA 1OQ6A 1S12A 4EAHD 2W7OA 4YXMA 5L1MA 1VAZA 4FWQA 3AD7C 3GIMA 4NLXA 4MQ3A 7ICEA 1Z1BA 3TPQA 1N0VC 3NMUA 1QQOA 4F2SA 3KHLA 4KLUA 3KFWX 3OS2A 4CJFA 3KD1E 5KFOA 3T5JA 3CO9A 4CIEA 3T1YF 1U1KA 4O3MA 2BXJA 3HSTB 4OPHA 2V9WA 2AJ2A 1WCLA 1IKWB 3V2UC 3BO2A 1HNWF 1LW2A 2YPZA 1MC8A 2VQFF 1SVDA 3DRSB 3W64A 3H0RB 2C2NA 1Q53A 4DQIA 1RTHA 2MKIA 1C2PA 5HVGA 3M32B 1NWKA 5C12A 4J8FA 2CGKA 4Y6IA 5KAFU 5KFTA 1Y97A 4EBEA 1GTHA 2P51A 1WDTA 4YDUA 3ISZA 4DPWA 3DDNA 4MF8A 2J8AA 5KTQA 2R4FA 4DUYF 4FXWA 2RU9A 4DR3J 2B43A 1WG1A 4OX9K 3RBDA 1XNRJ 3H2LA 3RGIA 2HHXA 4PG6A 3ISNC 3M2UB 1OSDA 1AFIA 5D4BA 1T9YA 3D7SB 5LJ5Y 3VF2A 1DAXA 4HYKA 1SZPA 2I9GA 1TFRA 2P6TA 3LPEA 4IO1A 4WK1A 2QL5B 5C2DA 3L09A 4DKWA 1B4SA 2KDOA 4JI2J 2AIRB 2ZD1A 3WX8A 2ZH4A 1CS4B 3U9ZA 5C2FA 1I5OB 4B9QA 3M9OB 4UUWA 5C5JA 2WONB 2AEFA 4O5KA 2HRTA 2UXDF 2GVDA 4NL9A 2FJXA 2G9OA 2BRLA 4UZCA 1K73T 4DU1A 1ZQOA 3MWTA 2V7YA 1TV9A 2BUPA 4BE1A 1ZAVA 3ULEA 4GIBA 2BJ1A 3QESA 1KFSA 3E9PA 5HP4A 2EG1A 4P7VA 2VJ5A 3KUHA 3Q8VA 4FM0A 4PHDA 3DGPA 2CJXB 1T3VA 2R7UA 2KXHA 1UWBA 1YJ9S 1OXJA 1N32K 3T5HA 4AL6A 1NOYA 1ZPWX 5L9XA 3NCPA 5IWAJ 3OFFA 5LJ3Y 4MKVA 2RVJA 4I9LA 2A42A 1X4GA 3CFOA 5L9NA 3TP2A 4A8XA 1NGDA 1IKWA 4O0JA 4KPYA 1U2VB 3BSCA 1VQNS 4ED4A 3RMBA 2DY4A 2JEGA 1SC6A 2IVOA 5CCLA 1ZAXA 2D0OA 5GINA 3PDNA 3WK4A 4JI8K 5J2PB 2JXJA 4ZVFA 2ZJQL 4J2AA 1KHWA 3N7PD 2VANA 4NLBA 5E41A 3FEZA 3JQMA 2CGJA 5DZ7A 3TJ9A 3CCLS 2CG4A 2YNGB 3IGNA 3OQ2A 8ICEA 3NEKA 3SFUA 3QIPB 2I8EA 3OV7A 3TJAA 1BOTO 3E0FA 4EYIB 5IS2A 1OVQA 1X1PA 3RSEB 4DCOB 3HPOA 2BGWA 3N4PA 1CJKB 4JI7K 2M70A 3M2UA 4ED7A 1KQQA 5AK3A 2MQQA 5LJVA 1CULB 3SJJA 4M9JA 4FNHA 2F2AB 4ECZA 5F3ZA 5HMZA 3R3TA 2KRBA 1E6YB 2FGOA 4M04A 2WSCC 4ERDA 3DFEA 1CS4A 3L3UA 4H4KC 3AOBA 2KKVA 2LYBA 3O9UA 3Q8QB 5CP2A 2CJ9A 3DEEA 9ICTA 4JI5J 3IM8A 5BR8F 5GMKa 2IYGA 5HQLA 3DXSX 1KQKA 3MMAB 4DMZA 1F2HA 4QPXA 1WKLA 4LFCK 1VQLS 3V7LA 2D9OA 2AWZA 3NNCA 5EHHA 2DUYA 3TEHB 2RNEA 3QNNA 1Z4NA 5ETNA 5D4LA 1N56A 3KZIU 1WTFA 1EX8A 1X4HA 4BWJA 2QW9A 2DFHA 3QSYB 4YR3A 3NVVA 3VQDA 3M1FA 1Z00A 2C3OA 5EDWA 4XO0A 4KH6A 3CMEN 3E01B 3FZ2A 4JI4K 3UMGA 4G1PA 3H1QA 1XSNA 4BDPA 5I3UB 4MFBB 2DFFA 4FWMA 1NHKL 2DR9A 3RB0A 1ZQMA 4JBCA 1XMOF 1S1UB 2BOAA 3MECB 5BJRA 3P4IA 3UIQA 3LDNA 3VQ5A 1ULRA 3FYHA 5AI8A 4EIAA 1VR6A 1GLJO 4Y1CA 4DLGA 4X4UA 5KG0A 4KYZA 4J9PA 4EZ6A 3WEEB 1DXSA 4C3LA 5J2PA 2KN7A 4E7LA 3VAJA 3L95X 3HM8A 3VALA 4HTUA 1YF5L 3IUCA 4OZ5A 4YCXA 1DY3A 2YNGA 4CYUB 2MAXA 5G5GA 3H08A 4CECA 3O3HA 2BJEA 2KVSA 3QIPA 4X65F 3P6YC 3LZJA 2FSNA 3R8YA 3NF6A 1SC3B 3M2VA 3RRKA 1UJ4A 4WFAQ 3RSEA 4IFEA 4O3PA 1ZAWA 4KV8B 1LB2B 3UQSA 4QIWC 1KRPA 4EP4A 2AA4A 1CULA 3VETA 1NB7A 1OVYA 3OBWA 5HRRA 3V4MA 1F21A 2OEKA 4QR2A 8ICLA 3LVVA 4E7HA 4M42A 3GZ7A 3TI0A 3GQCA 4HDGA 4HEA9 4ANEA 2L9WA 1E6YA 1PK1B 3N4WA 4B9VA 2VYPA 4JKCA 2QLBB 2ZJRL 3OTBA 1WKKA 1U6BA 3N6NA 1W7WA 1WHVA 4Y2MA 3NUQA 4YNQA 3TA2A 1U8WA 2IBKA 3CD7A 2LEPA 2JGUA 3MMVA 4K4WA 1SJ3P 4W4MA 5AM5A 5I3PA 1Y64A 4J9NA 3ZDBA 3MMAA 3NH1A 1CG2A 1PC4A 2U1AA 3HZGA 2CZ9A 2ZITA 3HT3A 3AN1A 4DOCA 4DFMA 3VVUA 3L3FX 5FJ4A 1U1PA 1JCGA 4G1QB 4IEEA 3N97B 1WF0A 1HUOA 1TVAA 5JRTA 3OPKA 4JKGB 5GIPA 3THTA 2XMKA 2FSJA 4JK7A 1UT8A 2NRHA 4B6JA 2OSRA 3C6AA 4ZMMA 5K20B 4CHNA 4JI0J 1F6TA 3E01A 2I9SA 1T9VA 3MXHP 1VSJA 4WZMA 5I3UA 4MFBA 1PG5B 4O3QA 4ID5A 2XS7A 4F5OA 3D67A 4H4MB 1S1UA 3MECA 1OQ3A 2DJWA 1NCLA 4USJC 5KG5A 1WC1A 5KPRA 5FRMA 5DG9A 1FX2A 4A62A 4Z4EA 1NOMA 1QJHA 1VRQC 4MFFA 1HBUB 1GMUA 3T7ZA 3VGUA 3HHLC 2R3VA 4QNLA 3GFXA 1G15A 1Z26A 4HT7A 4FZXC 1WOQA 2LBOA 4LBIA 2HBKA 3ILLA 2VD3A 3I6PA 3QBWA 1R8AA 1V3SA 2BX6A 4K4UA 1N4LA 2Z1IA 5FPMA 4FLXA 3OBYA 5AKYA 2FC9A 3BN7A 2PKEA 3WKEA 4CLFA 1RLDA 1X6IA 1B64A 4FZZA 2RKIB 4V19S 2V63A 4XK8C 2HMIA 5CE3A 2ZKTA 2CJKA 3DKDA 1S8OA 4C4RA 5E2QA 3F9KA 2DHAA 4ID8A 1ACMB 4NRTA 4C1NK 2GV1A 1Q18A 4FS1A 4IDKB 2MKSA 4GFJA 3GJRB 2SXLA 1APSA 5F8LA 5HBMB 1KAXA 2W3RA 2CVIA 2V6AA 2QYGA 3FZKA 4J9VA 3WKBA 3IWXA 3MTKA 3VZIA 1V5IB 3IAM9 2HSEB 2VBYA 3U6FA 2J9EA 4JI6J 4U67L 1Q82O 1JROA 2VIXA 3K17A 1NDLA 3FGUA 1N32F 4JB8B 1RU2A 1URNA 2NXEA 3RB4A 1RT2B 2HURA 2QN6B 1TUGB 4G1QA 1XMQJ 5KFDA 5JVHQ 2HBYB 3EUNA 4CO3A 2V9KA 3JS6A 3NTUA 1BIZA 3RW7A 4KHQA 5SUHA 4FO0A 3CC4S 2DNRA 4LF7K 3IAS9 9ICGA 1N5TA 3LWMA 4MHVA 1UZDA 4DPUA 4YOVA 2K3KA 2ZDOA 3HKZD 4X4RA 2X1FA 1ZQBA 3A3PB 4RQ0A 3OXFA 4H4MA 4AUKA 2MZ1A 4JI8F 2HGNA 4CJVA 4IOAL 3RYLA 7ICTA 2D8CA 3VA0A 3VC8A 2RE1A 4C80A 3MN7A 2X3DA 3M9NB 3AA3A 4BQZA 2ZJ8A 3RAMA 2E2OA 3PUFA 5EXWA 5T41A 1QM9A 2WF8A 2H4YB 2YX4A 1RZMA 4RPYA 2DPNA 3V9XA 1PZNA 4Z4FA 5ADZA 4JI7F 2G06A 3UDCA 3DCAA 3KLHB 4CBUA 2G07A 5BPNA 2AV5A 1JXEA 4OJ1A 4RBTA 2HVZA 4G3IA 3GFZA 1JLFB 4JKBA 3D68A 3WC2A 5AK5A 1S7HA 4BBYA 4CT8A 1OMSA 5AXMA 3AU2A 2B8PA 4F2RA 2RKIA 2RHQB 1ZQFA 1SJQA 2F77X 3MD1A 1QY7A 3EXCX 2H3VA 3A1YG 5HP1B 2FGCA 5F8NA 4CZLA 3I31A 4IDKA 3JTOA 1TVRB 4IOCL 1YITN 3KLIB 4QJVA 3CIPA 2PBDA 3IR7B 3P83D 5EE9A 4LFCF 2QMWA 5KFQA 1QAYA 1VQSA 3EKSA 4DF8A 4YDDB 4WWSA 4NX9A 5AQIA 4GXJA 1HD0A 4I2FA 1PYTA 1VSEA 4M9LA 4O8UA 5AE1A 3J7YP 2YN4A 4CF0A 4OPJA 3E3XA 1FDNA 2FJEB 1RT2A 4C48A 4WJBA 2ZGZA 2O6KA 1N5WA 3IHQB 3PW0A 4B9LA 1SBRA 1TFYA 2D5RA 1ATNA 2V52B 2UVWA 4JI4F 4FN5A 4Y2KA 2M2BA 3KHYA 1TL7B 4JUZA 4EEKA 5H1SQ 1GOBA 4JS4A 3Q2TC 4DTOA 2YMPA 1N52B 4Z2XA 3VQQA 5HO4A 2UYTA 3GE9A 2D69A 3PW4A 1VGYA 3O8WA 4QS9A 3POTB 3VGKA 3DXMB 1BNPA 2BJ3A 1AROP 3CCSN 2V2KA 2QLTA 3HJEA 5CR0A 3L4BC 1L8OA 4F0KA 5DBBA 4NLZA 1K0VA 2V7ZA 5IZHA 2KYZA 5IIIA 3BKTA 3OFGA 1GX5A 1WELA 1SL2A 5AIBA 3OTDA 1TP7A 3R2CJ 2AHOB 3LP3A 2VC0A 4PZNA 2LKYA 3I32A 2UUAF 1YJWN 2ZJPQ 4CHQA 3HT0A 4KLHA 3AVNA 3UM9A 2BE7D 2W01A 2V4JB 1RYRA 3CFRA 4BY9C 1FF2A 1JLFA 1U8SA 2QWLA 5DGAA 1TKXB 3KLGB 4NWBA 3ILJA 4P73A 3H90A 4R79A 4DO9A 1ZD5A 4OJRA 2RRAA 3OYGA 4LH5A 2W4PA 1M1GA 9ICLA 4KSEB 4RWTA 2ZOGA 5HP1A 3MBYA 3TAFA 1W97L 2LA4A 3CJTA 4IYQA 4C8NA 3C6TB 2OH2A 1TVRA 2XY6A 3EMTA 1RQ0A 2QARB 2BV3A 2ZOMA 1U47A 3KLIA 1IV8A 3UQ2A 4F02A 2PMZC 4BR7A 5BYQA 2JH7A 4G6VB 2WC9A 1C0GA 2A1AA 3ID6A 3L2VA 5J29A 4IS7A 5E3AA 1KQSM 3BB5A 1P27B 2D0AA 1WUAA 4TN2A 3C15B 2XLJA 4BR4A 3W5ZA 3ZT1A 4BGAA 2W11A 2XMAA 1FIQA 3U27A 4CD1A 3W5YA 2APOA 1X3MA 3C6UB 4MK8A 5TKYA 2J9DE 4KI4A 1ZQZA 4H4OB 1SQGA 2K60A 3KJQB 4LF5J 4M5JA 1ZC6A 1TL7A 1O1WA 5EOYA 5L8RC 1Q8KA 3HKZF 1JXVA 1YJNS 3GDQA 3UCZP 3P5BP 4AQYK 2ACYA 2QA4G 4QWBA 1VRUA 2X1GA 4RUBA 4YDUC 2P1JA 2ZH7A 3CCEN 5JMNA 3A0BU 4Z94A 3POTA 3G6VA 3DXMA 4MEXA 1HI1A 3SPZA 1SPBP 1X5SA 3V9UA 2JC1A 3MM8A 2J76E 1NAQA 3GV5B 2XZWA 1KHVA 1H73A 2ZXIA 1Q7YT 2E1PA 2WW4A 3F2CA 4NA2A 5ALZA 4OKJA 3H40A 1DTTB 3UCGA 8ICVA 5EOZA 2FUG9 3MZIA 4B3OB 2HS4A 2HQIA 4FF4A 2F9JA 3ZSVA 1WDDA 2WSFC 2MY7A 2V4JA 4UAUA 1HBOB 2ACMA 3VEZA 3CJ1A 4CIOA 4NXMJ 1QSSA 1I3OB 3K2PA 4K4SA 1TKXA 3KLGA 1VIOA 2GWJA 3MF5A 1Z4UA 5CRXA 1ZM9A 2J7UA 4C11B 5D0RA 1KLNA 3ZDDA 2IYIA 1TKZA 3WK6A 4LFBJ 2BJ8A 1RWNB 2UXBF 4FW2A 3MPVA 3MPDA 3N6MA 1FRMA 3H7HB 2PFOA 2QARA 4BC9A 5KFBA 3V4IB 3U26A 5B0BA 2HMXA 4RBUA 1HNIA 3QGIA 2NRRA 5JLHA 3C15A 3EDQB 1VSKA 4KBIA 3T69A 1L8LA 1CXUA 1NHVA 3BF4A 4EX7A 4BRPA 1HEKA 1D8YA 2VPXB 3KYLA 3QEPA 4C4TA 1JRPA 3C6UA 3PR5B 1E4FT 2AEJA 5AQTA 8ICRA 4H4OA 2UUBK 3D0IE 4LF9K 4RWXA 4DR4J 4ZP7A 2VGNA 3K9KA 5J0UA 3SFGA 2ADBA 5HL7Q 1FFGB 2VA2A 1JJCB 2P5OA 2ZUGA 2FMPA 2ES6A 3I5CA 4PJ0U 3V9SA 3SYZA 8AT1B 1F5AA 3SEIA 1N2XA 4MIAA 2G0IA 2IS3A 4K4ZA 2CFXA 3HI0A 5IM0A 4OX8A 4NLGA 3T1HK 4RT2A 5GAGU 1NJYA 1LKZA 5J2AA 1SKSA 2FVRA 2XNQA 3O80A 3V1QA 4DS4A 3GCWP 5I9EB 1HNXK 2NXCA 2CPZA 4KGXB 3ZSXA 1RDAA 3N4MB 4B3OA 1KFDA 2VHGA 4NRUA 1NH7A 2QSWA 3ILIA 7ICGA 1SV4A 4H0TB 1E3MA 4O0IA 2BW7A 3HOSA 2KOBA 4A8YA 4FJ7A 4USKA 2B7BB 3K5PA 4CEZA 2B6GA 4WCEQ 1VLOA 2RS2A 4X4QA 1JJ4A 2F8TA 1WTBA 2FHJD 3FFIA 3ATVA 4C11A 3QT6A 4OJ6A 1VYAA 2FJWA 3H0MB 1T02A 1PO6A 3QETA 2NRWA 2E29A 3GFKB 1S79A 3I8BA 4N56A 3C94A 2BCVA 5D78A 1G3OA 1X4FA 2QL7B 2DL0A 2KZMA 1ZBTA 4CGGA 3V4IA 4NEZA 2J0WA 1BIUA 1S1VA 7ICKA 2OP5A 5CH7B 5HMMA 3TA0A 4FKXA 3DLJA 3TANA 1L3UA 5IIJA 2QXLA 3MWBA 5K14B 2NUHA 2DGZA 4M1KA 4LJMA 3T1YJ 2QA2A 1Q16B 3TACB 2G8HA 4X4VA 4ZVOB 3BDEA 4DTJA 5KFMA 5C0YA 4QCLA 2ABYA 4ICLB 2DHSA 3SQOP 3L4PA 2FMQA 4J9LA 1ZQRA 3ZT3A 2QLJB 3GJTB 4J5OA 2W8KA 3B6OA 3TTDA 4B3SK 2JOQA 2YKPA 3VQAA 2LI6A 3SNNA 4L6V3 5C2CA 2OTLS 3AVFA 5B09A 1UETA 4P2HA 3PVXA 1GXLA 3VQCA 3BREA 4TUSA 4CEEA 4EI2A 3M6KA 3ELHA 3O9SA 2KG1A 5AI4A 3AJ1A 2VFUA 2WOMA 4GW6A 4LT6A 4MF2A 2QA1A 3QFUA 2HFOA 4P2SA 4F4KA 1ZM2A 5CAAA 1VSFA 5AKEA 3OFEA 4USHA 1WYGA 1DOQA 3PJXA 1IBKJ 3BS5A 5L1JA 2QJ3A 1RCXB 4OJLA 2KVQE 5EU7A 1O0PA 5F0UA 3DHXA 4YUDA 3BEXA 2LKZA 3L9ZA 3OYEA 3PEHA 2KFYA 7ICVA 4RG8A 3W7BA 3IGVA 1TUYA 2IJRA 5GAHU 4QWEA 3OT9A 2RAQA 3CDEA 4BVOA 2HWTA 1KR4A 1XWLA 2MB0B 4CBXA 1SL1A 2WB4A 4DTMA 1REVB 4PWDB 4U67Q 1EJ7L 3M7DA 2HHVA 4ZVEA 4MMOA 3F2DA 4ZH4A 2B4VA 2IOFK 1GTEA 4BRQA 1B9DA 5IT4A 5KG4A 4I6MB 1EP4B 3D2NA 4DV0F 5ETRA 1HWUA 1IV0A 1RT1B 3CCJN 3GCXP 5K9FA 2C2MB 3A0HU 3UDLA 2DGXA 2UUCK 5AKXA 4P7TA 4O55A 1UEVA 2VJVA 4JYAF 2Q6CA 1S6OA 4EWTA 1ZQTA 1N6QB 5HVHA 2Z1JA 2HGMA 1D3WA 4YXJA 3A8KA 1LOUA 2OLWA 3QT5A 5KG6A 1XERA 3CC2N 1A5XA 2I5HA 1ZQAA 4C9DA 3DLEB 1ZTTA 4FJKA 4FZNA 4IQVA 5CCMA 3CC7S 3C6HA 2DKOB 4TKTA 3W66A 4P52A 4ICLA 1U6FA 4ILGB 4P75A 5KT7A 1N34J 1GLDG 2VDHA 1CLQA 3CNHA 1WOSA 3F0NA 4DOBA 2R8HA 1OJ4A 1S10A 3U4LA 3UPFA 8ICPA 2ZBRA 1GQEA 4X4OA 1AT1B 3ZSRA 2N7CA 2ZTEA 2YV0X 1WCNA 5FPNA 3RH5A 3D6TB 4OPKA 2GGPB 3SI6A 5DG7A 4DV4F 3QLHA 2LQJA 3UVJA 2FZKB 5MAOA 7ICPA 4IFYB 3R1XA 3W2WB 3NOCA 4WP3A 4K50A 4DUZK 2DXEA 1WAFA 2HBZB 2OPSB 2CJYB 1RNHA 3HD2A 1RWVB 3AV9A 2F9TA 3KWGA 2Y1RI 3CJ2A 4IOCQ 4BLGA 4B02A 1ZQEA 2MKHA 4UOCA 1HLWA 3W8PA 1FEZA 1H6KX 4PR6A 3C95A 3TKAA 5E79U 9ICUA 1LWFB 1JQGA 1X9WA 2I7PA 3LQVA 4UAYA 9ICWA 2JX2A 2H54B 1IKYA 4DL5A 1REVA 4PWDA 2HNZB 2W43A 1WHWA 2VV5A 4KHPK 4YS2A 3VGVA 2IAJB 5F8HA 5JU5A 1O03A 2RHKA 2HHUA 1TU0B 3BYPA 3FSYA 5K8PA 5DG8A 4LF6J 3ZEUB 2HI0A 3IM1A 1B0VA 1EP4A 2RHFA 4AYBD 3KHHA 2ZHAA 3BQ0A 4ISGA 4M3ZA 3IN5A 3CDUA 3MR3A 1PBAA 1N33J 1QZ5A 1WSEA 2D3O1 4HVJA 2KT5A 2B9WA 2E5JA 3M8RA 4ILMA 5ALWA 1N6QA 2QB0A 2ODGA 3H7IA 4PGXA 1XUPO 3OYLA 4Y2XA 1I51B 4DWIA 4KC5A 2FJDB 3FZMA 2F9WA 2UUBF 4LF9F 4LJXA 4C0ZA 3DLEA 3FJ2A 1HPZB 2IDEA 5D46A 2KQ2A 4F5PA 3AVLA 4KHWA 3H20A 2BZFA 3VAKA 1FEHA 4B3RK 1K5OA 2PYJA 2Z1GA 3C1YA 1NK6A 2C2KB 3EGWB 3T6BA 2CZVC 5AQMA 3IMXA 3ISDA 3ATUA 3W65A 3GZFA 1P1LA 4KGVB 3K1RB 3T1HF 3QFHA 2DRDA 3QINA 4I7FA 2OZSA 1FVQA 2ZM6J 1URRA 4BVPA 2KU7A 3BUZB 3IS9A 4BREA 4LRBA 1Q86O 3RJIA 1MG7A 1KN6A 4DTNA 4B9UA 3AAPA 1XBWA 4X4PA 3HMJG 3LW5C 2XY7A 1KXPA 3W2WA 2H5IB 5KG1A 3I82A 2ZHOA 2NZ4A 2DO4A 4CNQA 2G8VA 5B7WA 4FNIA 1Q7YO 2OPSA 9ICKA 2E5LF 5B0FA 2UXCJ 1LW0A 5DM7L 4FPRA 3N7RC 4DV5K 8ICOA 9ICFA 1KQSR 2P9PB 3IBFB 3QT7A 3GTYX 4ZHRB 3W2VB 5KFIA 1DQ8A 3AL0B 3CJRA 3TUJC 1RYSA 2MSSA 2YBVA 4WBFA 5AQFA 4K59A 4CLYA 5TZVA 2P6RA 4B3TJ 3O5TB 1BQMB 4RU9A 2HNZA 3AGRA 1TL3B 3X1LB 3WZ0A 4BUGA 1VIXA 2HK3A 5ITHA 4HR2A 3CETA 2QRRA 4EUVA 2XMWA 3ETMA 5IV4A 4E1JA 4DSKA 3KKAA 4MDAA 3ZEUA 2P35A 3NDKA 5AI5A 3S3NA 2BEFA 4RU2A 5ALFA 4RW9B 2CAJA 2VH7A 1RADB 1DLOB 4DR3K 2O8EB 3HF5A 2YB1A 4U6PA 1QSLA 2AJ1A 4M41A 4DU4A 1RTDB 3HX9A 4ILHA 1I94F 2F4VK 4GV3A 3SCLE 1N5YA 1O6XA 1QAXA 2DEIA 2CJQA 2JGAA 1VQ8S 2YKMB 3M5RA 5DDRC 3GONA 3KWMA 2ITGA 2MTLA 1EETB 4DV3F 1HPZA 3ORYA 1IKVB 1T9TA 1Y10A 3LP0A 5F0XA 4ZLJA 3HVWA 1RXVA 2UUWA 4RW8A 3WKDA 3IWNC 3TR8A 2HBQB 1JJ2M 1SGGA 1V9OA 4LSZB 4K2JA 3AMZA 4WU2A 4YDXA 2A1RA 2KFNA 1PBUA 1T9WA 3MEEB 1JLQB 4OX9J 2WTFA 2C2EA 2ZH6A 3ICXA 1QQ6A 3MCAB 1JLAB 3CCVN 1VQOS 2Y8YA 4KLOA 3HJVA 4CWBA 3WNEA 3CCWA 4W5NA 2ZE2A 4HL9A 2JWKA 3AVKA 3GSDA 3KUEA 2CPFA 1N5XA 2H3IA 1D9AA 2AP1A 3QAEA 2G5IB 5ALIA 4BRHA 1WSIA 2YWWA 5CHCB 4A59A 4FLWA 4FPBA 2BCSA 3HSGA 1UVMA 5E0OA 4UY8T 3IV6A 1QHAA 3H5SA 1NJZA 4KHNA 1VSHA 1NXIA 2XYGB 4ZHRA 4ED6A 3W2VA 2ADCA 4NYNA 4CDGA 2BPGA 3E58A 2QA4N 2AKWB 4L74A 1PK3A 4XAKA 4TLRA 1RGIA 1L7MA 1VK0A 2KEYA 4CESA 3R1HA 4NI2B 2GO7A 3VQ4A 2DNHA 8ICMA 4AYBF 4KLMA 4CM2A 2A5XA 2GBZA 3TUPA 4HAIA 2W41A 1AQ6A 2XMUA 2AYEA 4R66A 2UUCF 3NGSA 5T7LA 3IXQA 3ZZUA 4EELA 3C21A 1JXLA 4IG3B 4NLCA 4RW9A 2NYIA 2VWJA 4Y2VA 3P1GA 2RQKA 1S72N 4I2EA 1DLOA 1ZD2P 1WSGA 5H1SV 4EX6A 3KLEB 2KIVA 1ZQSA 5ALHA 3R1LA 4UARA 3SV4A 1RTDA 4PG5A 2XS5A 3A5OC 1RAIB 3HCXA 1K8KB 2KIWA 2Z2YB 2R8IA 2GW8A 2YKMA 3KJFB 1NNEA 2DITA 2O8BB 4LBPA 2FHMA 3C3LA 4XEIA 1DGSA 4PWUA 4PKIA 1IKVA 1FO1A 2BR0A 4L73A 4JI8J 2Z30B 3D2WA 2ZTDA 2VF3A 4OYAA 1Y3JA 4P10A 3G71S 1ZBIA 2BM0A 4GVMA 3C23A 1VSDA 5TKWA 4OHWA 1AUDA 4PRFA 1XQSC 5DDPC 4LVNP 4YOXA 1RBLA 2IIHA 3UXNA 2IHNA 5DETA 2B21A 3D5MA 4CF9A 2F8LA 3BJYA 4HT5A 3H45C 1B0PA 1LWEB 1DBDA 2OTJN 3T19A 4DUZF 1MU2A 5DS7A 4M3TA 4WKRA 3A3OB 4W92B 5EY4A 4CRJA 4ECWA 3AQEA 1B70B 4CNYA 2ASOA 3NS7B 4P9SA 3CJ0A 4ZCLA 1RGVA 3QNOA 4FK4A 2Y0SD 3R5BA 5CABA 5BN8A 3VQSA 3C28A 1FJGK 4O4GB 4A8QA 3NF9A 1JWWA 2W9CB 2BRKA 2IRXA 3THYB 4CLPA 2DPJA 3ZZTA 4FVMA 2CQ1A 4DSJA 4LQ9A 4NI2A 1NM2A 2DWQA 2FTRA 1VCTA 4KGKA 1QQCA 5KFFA 4PL8A 4FE3A 3VMFB 3ZX3A 3FRZA 4O4RA 2FHJA 2MQMA 4LUBA 3ID8A 1FFWB 1HJRA 3IDWA 2QO3A 3NOGA 1S76D 4O8KA 5E3PA 5JMVA 1DURA 4IG3A 2PYLA 1U1LA 4FK2A 4JI4J 5A8RB 4QZGA 2F3JA 3KLEA 4UAWA 2F63A 8ICSA 1C0UB 2PEBA 4F0MA 2H1YA 2IVYA 2DNMA 2OM6A 4M6WB 2B56A 5AK6A 2D0CA 4KO0A 1SC4B 2O8BA 4DR1J 3DXKA 2G8FA 1ZBHA 1T3QA 1RA6A 1ZXOA 5AJ3K 2NO4A 2W9BB 2MKCA 2FIUA 4JI3J 1BXNA 4KKOA 1RT5B 3NF8A 3WBZA 1KSPA 3H2UB 1SWVA 2E4LA 2NO5A 4RNOA 4DCJB 4CFAA 3H98A 4DSEA 3DMJB 3G86A 2E6MA 4G65A 1LWEA 3RU0A 2P2CB 3QU9A 4Y00A 1FE4A 3GP9A 2WTUA 4Z7CA 3SK3A 1YUWA 1VQMS 4I2CA 3MM7B 2RPIA 4JHDB 3EY1A 5M1PA 4GNIA 5D77A 5DQGA 1D9FA 4CJSA 2EBEA 4V19J 3G4SS 3LANA 5KFKA 3C19A 2B9XA 2VQEK 3O5BA 1JLGB 2M4MA 5KFWA 4ECUA 3ITHB 4CLTA 1X5OA 3UFCX 3SMZA 3D6MB 3X3UA 1UVNA 4TU9A 3C14B 2QEXS 4CGDA 5JS1A 1HWIA 3T9NA 4AHCA 3KIOA 1BLUA 1CQNA 3S3MA 1X9SA 4G1IA 1WNEA 2F8EX 1KS2A 2ZH3A 4P0QA 2WRMA 1X42A 1Q5VA 4DR3F 2X1AA 2WHOA 4H5WA 2ZC4A 2XMMA 2Z58B 5ALNA 4DPTA 5MLCQ 4KX3A 3N5BA 5J0QA 2G0CA 4PXDA 1YRTA 3MMCB 2HOFA 3CJAA 4B3MJ 1JNZB 2F40A 5A8RA 1PYOB 2YB4A 3L6QA 3BF3A 4DTSA 2O4IA 5HR6A 2NCKL 4DV7K 4MK9A 2R7TA 4I6AA 3TARA 3D1OA 2HGLA 5KT6A 2Y1LB 4F36A 4JEPA 4OQJA 2H5EA 2LYHA 4M6WA 2WAQD 2KHDA 5SWMA 2FHKA 4I2JA 2IOHA 2IJFA 4ETXA 1S4FA 4WFNL 4FP9A 2YY3A 5B0CA 1ZQQA 1PUZA 4ECSA 4CZCA 5F1XA 3OHAA 3BGFA 4QOZB 4BGBA 2HQFA 1FXDA 1FK9B 3UKUB 1RT5A 1FJEB 3CF5Q 1M1HA 3CNQP 5DGBA 2JLGA 3UN2A 1W7AA 4KLIA 1IR1A 1D8BA 4BXOA 1SQEA 5KPTA 1ZBFA 4DFJA 2WVEA 1S4EA 5KGWA 4BG9A 2GJ2A 4JI6K 3ENVA 5HROB 5A2QU 2KL8A 4A8WA 5I4MA 2QFIA 2Y0SF 4X62K 2BJ7A 3MM7A 5IWAF 2XSJB 1XTZA 8ICHA 4L3NA 2E7WA 4F67A 2C3UA 2FC0A 3MXIA 1RM6C 1RXWA 1BCMA 3FCWA 5HATA 4DR6K 5T14A 1YGYA 2YQ3A 2VOPA 5LSLA 2BDPA 2DYAA 3BBBA 2QA4S 5AZIA 1JLGA 1ZYQA 1SWWA 3LOUA 1BDGA 1Q79A 2WB1C 1IXKA 1HARA 5ALRA 1KC8T 3HVTA 4ZPVR 3L0QA 3PNIA 3ONQA 3K5LA 4UZBA 3O3FA 1QVGM 5F9NA 3KDOA 4RBVA 1YTAA 3M6WA 4I29A 2G08A 3D1QA 3FR0A 3PSTA 4G9BA 2KVIA 2QWRA 1NJIO 3FCVA 5AQXA 4DUTA 4NLPA 2NXJA 2MQ8A 3ET6B 3MMCA 4HHJA 5ETSA 3I4PA 3DLHA 4ISFA 4LF7J 3K9JA 4V1Ak 2ZEJA 4CNZA 3LP2B 3KG0A 1C1CB 4WZQA 5CY4A 2Z4PA 5HJYA 4H0XB 1WI6A 3QEAZ 3JAMO 4JRQA 1RT4B 3QMLA 4WIIA 2HWHA 3KK7A 2E9RX 4HUGA 2J8SA 5A0YB 2AGQA 3VENA 1WC4A 3QPIA 5LMNJ 3HD1A 2Z56B 2Y9HA 1FK9A 3UKUA 1F3FA 4K5SA 1XR5A 4CLUA 4CF8A 2MSNA 2IC3B 4PHTX 2AYBA 1MDUB 1SV0C 5E3QA 2W2NP 4DV1K 1WWHA 2HHHK 2D6FC 2XCAA 5HHHA 5E26A 2ZZNA 2DK2A 1S0VA 9ICRA 2CPDA 4B9NA 5HROA 1X2IA 1J2MA 2DKZA 3MCOA 4CT9A 2NQPA 1NMNA 3EE8A 3D0HE 3QUTA 3AEVA 3I33A 2LSNA 3UD4P 4DCCA 2F5GA 3D4JA 3HFZB 2O5DA 4ZN3A 2XGPA 1VBYA 3MN5A 1RP5A 3EN9A 2GEMA 1JKHB 2BKPA 2QG9B 2XY8A 3AO1A 4LY7A 4UY8O 4Y2JA 4WFYA 1BD6A 3HRGA 1BI4B 2NUBA 4S0MA 2JMGA 1KVKA 2G0AA 2DO0A 4H0OA 4KLQA 2W40A 4HUEA 4CE6A 2KHOA 5ETVA 3K58A 2GV9A 2E7XA 2G5HB 4Q43A 3VGSA 1VHXA 4CZGA 3EZWA 2HNDB 4I2QB 1BPYA 1IBMK 5D4NA 2HAIA 3TUIC 1GX6A 4PA1A 1T0TV 1HWLA 5HSPA 1WB9A 4KH1B 1RB0A 1JJ2R 4TYBA 3RG6A 3QXGA 3SPYA 5AKHA 5KGXA 1XK8A 3CCZA 1OPZA 1P8GA 1PCAA 4AH9A 1ZOTA 3L2UA 3QGGA 3NNHA 3ET6A 3P96A 2WAQF 2C3PA 1PJ7A 5FPEA 3DC2A 3MXJA 4I2GA 2HCFA 4YHHJ 1T6DA 3U1LA 2UUTA 4A8KA 3LP2A 2HEKA 3CJCA 1NGHA 3P39A 5A2QY 3VCDA 1YRXA 4KB7A 4JV1A 1RT4A 3WXLA 2PI5A 5IT9U 2YVSA 3PSIA 4X84A 2QWMA 3OTOK 3I96A 2BDUA 5A0YA 4CZEA 3ZZPA 2DH9A 4A61A 2YNIB 2G2ZA 1RFQA 3VF6A 3B78A 3THPA 2K4PA 5ALUA 3KD3A 5ETOA 3I4HX 4USVA 2D3UA 3HRDD 1WBDA 3WNFA 1UTAA 4FWRA 1C0TB 4I0WA 4NLTA 2Q1NA 2W2QP 5AM4A 2RQMA 2OJ3A 2W4CA 3AVCA 2VB6A 6FD1A 4PHPA 8ICQA 2V0NA 2JNJA 4DQPA 3AH6A 2MXYA 4AFFA 4ZKAA 8ICIA 3JTNA 4JI0F 3MXMA 1Q81T 1YZ7A 2VG7B 5BOLA 4A4JA 4AXIA 4YMNA 4QU7A 3GOIA 4DFKA 2V8PA 3BO3A 5G0RA 3MABA 2FJAB 5GAGP 1JKHA 3TU5A 1YX2A 3J7A1 1QSYA 2DB1A 3KKAC 2LMRA 4YB5A 1RQLA 3JQKA 2C2ZB 3VESA 3KHRA 2C2OB 4NEYA 2HVHA 4OHYA 2JJ4D 2D3DA 1CBKA 3M30A 2B3TB 5G5HA 1RHJB 2E1FA 5J2KA 4DU8A 2OI2A 2HNDA 4DG1A 5GIOA 3G2XA 1IQZA 2B51A 3PTWA 4I2QA 4OYPA 2JWLA 3TAQA 4CZMA 1FI4A 2DTUA 4IFVA 2B4JA 3MHYA 3KKRA 5M1NA 4DOAA 5FDLB 3AU6A 3MAAB 1RHMB 1WF2A 4FXVA 4C0OC 4DV2K 2Q2RA 2VPZB 3C46A 4AQYJ 3WQPA 1Q78A 2GHVC 4HUFA 1B22A 2DHHA 2LLZA 3SUPA 2GX9A 1KBUA 3A2FA 3UMBA 4MO4A 3EE9A 1UT5A 3W63A 3FNNA 3VVTA 2GELA 1GT8A 3VR1A 3Q7CA 4F9OA 3CJSA 4UAVA 2H65B 3G87A 3KG4A 1KEKA 2O8FB 5BPCA 4FS2A 5AKKA 4RCHA 2HIYA 1YI2N 3PMLA 2YNIA 3MTJA 2BKOA 3O6QA 3A8EA 4JI6F 2H3EB 4KH0B 2RUSA 3IBCB 2DNPA 5D0HA 2FF6A 4I28A 4X62F 3E1YA 3EUB2 2IVNA 2YX6A 2MGZB 3TJ8A 2GOLA 8ICFA 4OPAA 2GAGC 1SJFA 3CCRS 4BRMA 2L5YA 4KTWA 4Z4GA 2W6LA 2MYFA 1RAOA 2X6SA 5A76A 3VPZA 3I1YA 1I3AA 3JSMB 2VG7A 3ENQA 5J2QB 1P9YA 3AGKA 5K5MA 3RF9A 1CJVB 2YPYA 3QAUA 3WXMB 2JH1A 1BG3A 4J9KA 1WEXA 3HSJA 1YVFA 5DQIA 2YNFB 5AQGA 2C3MA 3I0SB 3TRGA 2OZMA 3FEYB 2WSEC 4U96A 3C5FA 3RBEA 4R8UB 2FJBB 3P5TL 4BG8A 4RPZA 5M1FA 1D0EA 4W5OA 1C1AA 2ZTCA 5IT9Y 2CGLA 5GAHP 2UUBJ 4LF9J 2UP1A 3AD9C 4MLEA 4CIGA 1K9MO 3MAAA 5FDLA 3O3GA 3M6UA 2YMLA 4WIQA 1AFJA 4CJQA 1SQKA 4PG4A 2FI1A 3CMAS 3CD5A 3TSUA 2J4RA 2OAUA 3DLKB 1HMVA 1R8BA 2GQCA 2F3NA 3BSNA 3HO1A 2KNJA 2BPFA 3GDXA 3NMAA 1NU0A 4EFAC 3ENHA 3NGDA 3PYGA 2A41A 3RJEA 7ICLA 3T1HJ 2HOQA 1UAXA 3E9LA 5AM3A 2CNLB 1AA1B 5IV3A 3S6EA 2EAMA 5HI7A 3MR7A 4ZA1A 4NYFA 2O8FA 2KB2A 1HNXJ 4C0HA 1JMSA 4PG8A 1ZTWA 2DHGA 2WVBA 3NF7A 1MLAA 2DGSA 2LM1A 4Q45A 4CJRA 2FY8A 3M8PA 3DRXA 4LIWA 4E2FB 1HKGA 3I9ZA 1S0NA 4B9SA 1R59O 2QWPA 2QLWA 1YJTA 2VBXA 4B1WB 4NCBA 3F5EA 1KD1T 3AA9A 2MGZA 2HBRB 4F4XA 4EO8A 2E1CA 2CIMA 1H2UX 5DM6Q 1PYSB 2Z0GA 4ILJA 1FKAF 1KAZA 2JL9A 5AQLA 1HHQA 2L48A 3JSMA 1TL5A 3AAWB 3QSIA 5J2QA 3LWLA 3PO5A 1D9DA 1CJVA 2W1BA 2W54A 5B0DA 5AQNA 1RWMB 4LRDA 2A6AA 3J7ZT 2E8OA 2JDJA 3ZCMA 9ICVA 3S9HA 1WD6A 4CEQA 1ITPA 2FPHX 4HCBA 2YNFA 3I0SA 2HZCA 2HHSA 1KC8O 2Y0BB 2OKQA 3H4DA 5H9FK 2C42A 4R8UA 2MZQA 1TYQA 4RNHA 2W25A 3WU2U 1K47A 2MKKA 1KTVA 1FNMA 2BYCA 3ZZYA 4KI6A 4BS2A 1DEJA 3UI3A 3FM9A 3UXPA 4FJ8A 5DB9A 2RT3A 1Y5LB 4CF1A 2OPRB 3N7SC 1YHQN 3PO4A 4CJ3A 4B3SJ 4CI0B 2HZAA 4K8ZA 3QO9B 3HVRA 4KRFA 2QGFB 4HACB 1NPKA 3C7NA 4RQMA 3H1VX 3DU5A 3KZBA 1FHTA 5EE0A 4IRKA 1T95A 1IR2A 2YQ1A 1RA7A 2NS1B 4QAGA 1B7FA 1TK8A 3ISND 4FWLA 4CF4A 4A8SA 3CJKB 3C2LA 1OYEA 5GAEI 3J7Z5 1EQ0A 4W5RA 2QM1A 2HVDA 4FYXB 1S9EB 3NHGA 2V2ZA 3MOJB 5B0AA 4JN4A 4GVBB 4FSVA 1ZXIA 2D3ZA 2GQQA 2A3VA 1YJ9N 4O5EA 4ZOHC 3LAMA 5KFRA 3AY9A 4KAZA 3EZUA 4IH5A 2XLKA 5DDOC 4QJFB 3M7VA 3ZT0A 4A8MP 3DU6A 3B54A 1NKCA 2PMWA 3CIMA 1QVGR 2BZ2A 3HPHA 5FLXO 5FPDA 3UPQA 3NS1A 3DLLL 4LF5F 4K4HA 2UU9K 2Q3PA 4RQNA 2PC6A 3QGPA 1FXXA 5F8GA 4N8OA 1RAEB 8ICNA 1HQEA 1B4FA 2G4BA 1VQNN 2K06A 4RQ5A 2Y3YA 3SSRA 4YFUA 5GADU 5DB8A 5KFGA 5C25A 5ALXA 1R27B 4J7CA 4Q2MA 2VPWB 4DEZA 3G8QA 1W25A 1IH7A 1JCEA 3HSCA 8ICBA 3CCLN 5J0RA 2UUCJ 1P7DA 1X9XA 2EI5A 2CPYA 3PHTA 4H0PA 3P31A 2JZBB 3HHNB 4OZ0A 1X8DA 2BVZA 1T05B 4ZIWA 4ZVRB 3P49B 4DSIA 3J7AP 1R6VA 4P72A 3K2YA 2K8GA 3F5TA 2ASLA 1BY9A 1OY9A 4F4AA 1T3NA 1SH3A 3QZ8A 3SMVA 4EO6A 2KM8C 1S97A 2OPRA 4ZPTR 3OLAA 1J2VA 1VJ5A 2WVDA 4HDHA 5LL6d 4FYDA 3RH6A 1QDUB 2E20A 5AFUH 3AHPA 4Q0BB 3EPGA 2EKNA 3AXMA 4W98A 2HHWA 3QO9A 1M90T 1KWMA 3BZCA 4HACA 1TGOA 3LDPA 4M7XA 4KREA 2V4QA 4DQSA 1OH5A 1T6CA 4H0YB 2PFDA 2UVVA 4WFXA 4QWDA 2ZUCA 1YI2S 2AGOA 2OUGA 3AODA 3CJKA 1VQLN 3FC9A 2BM1A 3B4DA 4OJGA 5HMWA 1NLVA 2F1HA 1S9EA 2IVPA 9ICHA 1N48A 2HZVA 2YKQA 4C1NI 2VONA 2NLXA 2M7SA 4DL7A 1N33K 1Y88A 2JC0A 3CQXA 2DGQA 2HRYA 3VQ8A 2W42A 1L3KA 2J9DA 2OMOA 4EBCA 2BHNA 1NK0A 2CPRA 1EO1A 3J80U 4KHSA 4F92B 1RHQB 3O1LA 2KKZA 3GBTA 2BBEA 3JPPA 4DR4F 3PX6A 4RW4B 2E2QA 4CEBA 3RJHA 4KHPJ 3NCQA 2J0XA 1NG9A 4GKKK 4DL6A 1FEEA 2ILZA 4IXCA 3IKMA 3KK3B 1EIYB 4X66K 2AW0A 3FCHA 3OS0A 4W5TA 1T94A 4ZP8A 1YQHA 5MLCV 3I0RB 1WLJA 2JZBA 2R8JA 2XLIA 2ZM6K 2KVCA 4Y2QA 3SJHA 2VA8A 1SXEA 1T05A 5IQ6A 3GMGA 2HBJA 4LFAK 3VHQA 3SSSA 2P9IB 1D8LA 1FRXA 1M5VC 4P4OA 1L3TA 1KP6A 1NK8A 2XMJA 4ELTA 4LSNB 2DTJA 3VV2B 2N3LA 4B3RJ 5KRTA 4OKKA 1S57A 3RJGA 2UXCK 2EVZA 1RWXB 4M3UA 2FVSA 2BKEA 2QMXA 2HHQA 1FWLA 3UNGC 4A8FA 2KO1A 1RBUA 4GV9A 1AXQA 5FROA 4F3TA 4YG2A 1J27A 2F1FA 3LGHA 4Q0BA 2KFZA 3K5MA 2YHBA 4ZPDA 2KG5A 1HNVB 1U6ZA 4OYIA 3QFWA 3Q8SB 1Q5YA 3BGLA 2FVPA 2ZG6A 4KTQA 2WFBA 1Y7PA 4N5SA 3EGVA 5E84A 3PIOL 1F44A 1EARA 4BROA 4R5PA 1FRHA 2IM1A 1UVLA 2GMLA 1Z6RA 8ICAA 5KRSA 4WYWA 4QIWD 3DOLB 3CHWA 4C3MA 4CO4A 3I56S 5BOMA 3L5KA 3BKUA 2RU3A 3QEVA 2J7WA 4DV5J 4LRFA 4PQAA 2V51B 1QS4A 1YK9A 5B66U 1S1WB 3MAHA 1KOOA 3ZO7A 2WHEA 4I2PB 1UEKA 1KTQA 2FHOB 2ZGYA 4LC9B 4PL7A 1HBNB 1U24A 3CQ8A 1ZJMA 2XULA 1QTNB 1U25A 1UWAA 4RW4A 2E9TA 4RQ2A 2CRXA 4NLOA 1IKXB 3P3DA 4C8MA 2LEAA 2ZBQA 4WK3A 1FXRA 3NXZA 3OR2B 3D3CJ 3KK3A 3F5AA 1BPDA 3THWA 1NNLA 2ZIWB 3MX2A 1YTUA 2VC1A 1X31C 4ZJQA 3T6JA 5B5EU 3AVJA 4DI6A 3NGIA 3O2IA 3AVAA 4CEOA 1H7XA 3BZQA 2W24A 2K7KA 3B0XA 3RW6A 3FEXB 2F4VJ 3UR0A 4JRPA 4US8A 1CPZA 3TAGA 2PDAA 2VASA 1SUQB 3V81B 3RH4A 2NNWA 1LFPA 3NVZA 2JZ5A 3EJMA 2K4EA 4HTLA 4RWWA 2EK1A 4USTA 1IBKF 4N7TA 3H6EA 4CHPA 4OI3A 2P9IA 3VQEA 3RRGA 1ZA1B 3WNHA 3U1MA 1HLUA 1YHQS 2B4OA 3VF0B 4XH5A 2JEJA 1JJHA 5TISU 3HHLD 4H8KA 2RJZA 1LVHA 3ZX2A 3IRUA 2RMLA 3DYAB 3KMSA 2ZWOA <