2HVIA

Ddctp:g pair in the polymerase active site (0 position)
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hviA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hviA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hviA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hviA01
4FZXC 1J54A 1A76A 4FZZA 2X74A 9ICWA 1QQCA 7ICEA 2BHNA 3DLEA 3Q8SB 3PX0A 4MF2A 2C2DA 1Z25A 4I2IA 4YXMA 3RB4A 1ZQNA 7ICIA 1X2IA 2HHUA 3MXJA 3NHGA 4KKOA 3LPUA 5DB7A 4IDKA 4PGQA 1JL1A 4HUFA 5CYQA 4CF8A 3ZD8A 2NRVA 4QOZB 3TQ1A 1C1CA 4QZGA 3EPIA 1KCFA 2BE2A 9ICBA 2Z1IA 1HYZA 3Q8RB 4MFAA 2Y1IA 3K59A 1ZQJA 4CEDA 1DLOA 3JPNA 5CZ1A 3F73A 3ZT4A 3LP1A 3BQ2A 4GC6A 2IAJA 2RPIA 3C1YA 2YNFA 4F4YA 1KSPA 2B21A 1S9EA 2D0AA 9ICSA 4DFKA 5J0XA 2C2EA 4JV1A 3M8SA 5KTQA 2ISOA 4B9SA 3HPGA 4RNOA 9ICUA 3OSNA 3BQ0A 4M6WB 3ISBA 3K4GA 3OYIA 4BE1A 5KFCA 3SPZA 1LB2B 1S1WA 2DFFA 3HL8A 5DQGA 3L2RA 4O3RA 2W9BB 4KFBA 3PV8A 1TVAA 9ICIA 4DL4A 5IILA 5J29A 3ZDDA 4CJPA 4DFPA 4CEOA 2G8VA 4IQWA 4HTUA 8ICIA 1BPXA 1ZQRA 2YHBA 2W9MA 3HWTA 4DTXA 2H5XA 1WSFA 5IIIA 4KO0A 1U47A 1LAWA 4QZIA 2RDIA 3DLBA 4DTNA 5I42A 4LZDA 4F4XA 3ZSOA 4CGJA 3RWUA 4F4ZA 1WSJA 4RQ0A 4QCLA 2MUTA 4EZ9A 4YXJA 5J0TA 4BGDA 3V7JA 2KZ3A 3UPQA 5CJ7A 4LH5A 4CJ3A 5HRSA 1U49A 3LPTA 4KLUA 1GOBA 2UVWA 1XI1A 5KG5A 4CHPA 3M9OB 2OWOA 3L3UA 1QTMA 5DB8A 1TAQA 2G8HA 3P5JA 1RTHA 3VA3A 4YR2A 5J2FA 4B9MA 5HHHA 3K5MA 2XCAA 5KFAA 3HXMA 1T03A 1QS4A 5KFUA 1COOA 4I2EA 4ID1A 5KG6A 2IDOA 1UT8A 4TQSA 4DLEA 9ICVA 5L9XA 4CFCA 3RH4A 2DFLA 1ZBFA 3DLHA 3PX4A 3M8RA 3ZSQA 1BL3A 1RNHA 5J2BA 3DYAA 1K1QA 4CGFA 3NF6A 4JK1A 4OPJA 4CESA 1MQ3A 1VSHA 1RBTA 2DPJA 3O3GA 1XS9D 1LWEA 5DG8A 4CGGA 3O4NA 3GDXA 3L3VA 2FBXA 2I5JA 2PYJA 1LW2A 2HVHA 3MABA 4I2AA 4KMUA 4Z6EA 4M9LA 1SUQA 4CJFA 3LDAA 2BANA 3O3FA 5KFIA 4N41A 4Q45A 2OPPA 4KLLA 5FRMA 3KLHA 4DFMA 2YV0X 2ZE2A 4AHRA 4K4IA 3KJVA 4J9SA 3GV7B 9ICRA 4AHCA 3OS2A 3KD5E 7ICNA 2KZMA 4K8XA 3B0XA 5DK5A 3EPGA 5KFNA 5KT2A 3AVFA 3AU2A 4CIFA 4CF1A 4PGXA 1GOCA 4K4HA 4QWAA 3LWMA 1Y97A 1SKRA 4ZTJA 3RB6A 3VQ4A 4ECSA 3AVAA 1RZTA 1RT2A 3PW4A 3L8BA 4R5PA 5DKWA 1ZQKA 5KFFA 3RR8A 4FCYA 4QZBA 8ICGA 9ICTA 4N56A 5SZTA 4CJSA 3NBPA 4KLHA 3F9KA 1QSLA 2ASDA 1C7YA 2R8JA 3LAMA 1VSLA 5EOZA 4O44A 3BGRA 1XSLA 4HCBA 4L8RB 1ZBHA 3IM1A 2XY7A 3QO9A 1VSDA 2Y1JA 4KN4A 4C8MA 1J53A 3N97B 4R65A 1IO2A 2BQ3A 1CZ9A 4RW6A 4O5BA 4RQ5A 4O5EA 3OYGA 3NF9A 5BPCA 3OY9A 4ECRA 2M9NA 4LVSA 3RRGA 1QSYA 4Q5VA 1WSHA 9ICEA 4FLZA 4KHUA 8ICTA 5KT5A 1NK8A 3GIKA 4FLVA 3VQQA 1EXNA 2DY4A 4DF4A 3KHGA 4YMMA 1T3NA 4BXOB 3ALYA 4KLEA 3VQPA 2UVRA 4CECA 3EY1A 1HMVA 1VSEA 1KVAA 5IIJA 3RAQA 2XY5A 3QNOA 4YR0A 2VA2A 4GMJB 4BWJA 2C2RA 1X9MA 1RXWA 4KTWA 5DMRA 1TKDA 3SUPA 4O5CA 3DLRA 4J9NA 5KT6A 4PQUA 2FBTA 4Y1DA 4H4OA 1UAXA 3LDSA 1IM4A 1ZBUA 3GILA 4X5VA 3V6JA 1L3TA 1NK5A 8ICUA 5F9LA 3QEBZ 3MBYA 1ZQFA 3G10A 4DTUA 3DRSA 2NUBA 3I0RA 4BWMA 2BGGA 3LAKA 2B4JA 4F3TA 3HP9A 4DLGA 3NGYA 3HW8A 4DSKA 4M42A 2JZBB 3PW2A 4J9KA 1ZQXA 2J6TA 2YHAA 8ICXA 2BCUA 3VQCA 5KFEA 1ASVA 4GC7A 4DQRA 4IG3A 3LALA 4Z4IA 3KTQA 1NOMA 5J2EA 1VK0A 1LW0A 3GFKB 4PUOA 1JXBA 2MAXA 5KFMA 3TAGA 2P6UA 2ZTCA 4PHAA 3OYKA 4ED1A 1D5AA 4DTJA 3DRPA 1CXUA 3QESA 4IQVA 4PHEA 2F1IA 4RQ2A 2C22A 5J0WA 3C94A 4KN7A 7ICMA 1YTUA 2ETJA 4RQ6A 4M2YA 4F2RA 4Q8EA 1FK9A 2QKBA 4KLMA 2JGUA 4BE2A 3SPYA 3OSPA 1TVRA 1NJZA 1IH7A 3V7KA 5KRTA 5FDLA 3EWAA 3KLGA 4NCAA 3S3OA 1JLEA 1WAJA 5J2QA 1JLAA 3DI6A 2XHBA 2IBKA 1CLQA 1RDCA 5J2NA 5DBBA 3LK9A 1B43A 3JPPA 4F5NA 4HHTA 4RW4A 4RW9A 1DTQA 1W0HA 1ASWA 1BI4A 3AO5A 4FXDA 8ICKA 2V9WA 1TK8A 3PVXA 1RT4A 1TKTA 7ICQA 3NE6A 4N5SA 3TAMA 1XWLA 4E7IA 1X9SA 4CJ5A 2NRWA 3SYZA 1HYVA 3NCIA 4RQ8A 3H08A 1N5YA 2FLPA 1KRPA 3ASMA 2ZUBA 5KFQA 1TGOA 1BHLA 4O0IA 3CYMA 4PH5A 4Z4EA 1JLFA 5JUMA 4CJTA 3MECA 4XRHA 4N47A 1JXEA 5KG3A 3TI0A 4AHTA 3L2UA 3SZ2A 5CR0A 1D9FA 5L1JA 4JUZA 3LP2A 4O3NA 3PW0A 4CJKA 1AROP 3NTUA 1WCLA 4NLGA 4HCCA 3NF7A 5K14A 3RJHA 1BCMA 3V72A 1VSFA 1JXLA 3T19A 3OS1A 1ZQTA 4CGIA 1F21A 1Y88A 5KFKA 2YNIA 3ZSVA 5DB6A 3OYAA 5KG2A 4RT2A 3AO2A 7ICTA 4QZAA 3RMCA 5CZ2A 4TUQA 1Q9XA 1WSEA 4M04A 3QZ8A 1KFTA 4AHSA 1DOQA 3ZDCA 4W5RA 5DBCA 4KPYA 4H8KA 4MF8A 3MR3A 4OLBA 3EW9A 4ID5A 4Q8FA 3AO4A 4F5QA 2BCRA 1ASUA 3ZDBA 4LD0A 4NLKA 1Q9YA 5HRPA 4RUCA 3IAYA 4AH9A 3KHRA 4KREA 4BDZA 3MEDA 1K1SA 4UBCA 2X6NA 4OGEA 2HNYA 8ICMA 2BPGA 3KK3A 2WTFA 4JRQA 1ZQYA 4Z4CA 3ISNC 5J2PA 3KK2A 2W9AA 3OYFA 4Z4GA 4KLOA 2UVVA 4ED2A 4CK3A 1CUKA 4JLHA 4NYFA 3V7LA 3MXMA 4MFFA 4M47A 4KLIA 8ICVA 4R8UA 1VRTA 5HRRA 1ZQOA 4UQGA 7ICVA 1RBVA 4RU9A 2VWJA 2ZTDA 1FKOA 3VQ8A 3V81A 2G8FA 3V1OA 1G15A 1EX4A 5BOLA 4FLWA 1DGSA 3SUQA 2VA8A 4J9LA 3CFPA 1NK9A 2XRIA 4FLXA 1HUOA 4DTOA 5J2HA 2FC0A 2IC3A 5I3UA 1R0AA 4F3OA 4DU1A 5KGWA 4TUPA 5DG9A 2BCSA 3LP0A 3JPQA 4IQTA 1FXXA 4KTZA 1RT5A 4Z4FA 4F93B 4KLJA 2FMPA 1ZQAA 4Z0UA 1N56A 5J2JA 5IIKA 3CM6A 1GOAA 4OGCA 9ICQA 3L2QA 3OYCA 1L3SA 1TKZA 4RNNA 4IRDA 2PI5A 3AVNA 3T5KA 4FS1A 5IIMA 4GW6A 4UBBA 4MFCA 4ZTFA 5T7BA 3THVA 3OVNA 4GXJA 4LSLA 1I39A 4RW7A 3L2VA 4DL3A 4IFVA 1QHTA 8ICPA 1A77A 2DPIA 4KTQA 3TFRA 1J5OA 1H38A 1SKWA 3I8DA 5IINA 2AGPA 4KHNA 4F92B 3ZSZA 4AILC 4NM1A 3T5HA 4FJMA 5CA7A 4ECUA 1T7PA 5C42A 3M9NB 2RDJA 3O3HA 4CEEA 4YMNA 4DEZA 3WNFA 2PY5A 5KFTA 5SWMA 3SQ0A 3AVMA 3BJYA 5HRNA 5DQIA 3IS9A 1T8EA 2P66A 4KV8A 3AA5X 4FO6A 4EP4A 3OYDA 4RQ4A 4RPXA 4DL7A 1JX4A 1ZETA 3AA2A 4AHUA 3OYHA 1S9FA 2W9CB 1KFSA 4FBTA 3FFIA 2OA8A 4NY8A 4CF9A 1IKVA 2RN2A 3AVBA 4O0JA 4FM2A 1VSKA 3UXNA 1HUZA 4UB4A 3HVTA 3H8SA 3IG1A 5J0OA 4F4WA 4CJLA 4DSEA 3RRHA 5DG7A 4IRCA 9ICFA 3K5NA 4B8AB 2HVIA 2I9GA 4YD2A 1RDDA 3PO5A 3VQ6A 2A1JB 2P51A 2XCPA 3JPOA 1S0OA 7ICRA 4I7FA 4P4MA 4B8CA 3K2PA 4ECZA 1K6YA 5KT4A 2R8KA 3HM9A 5J2MA 2PFOA 2QKKA 1ZQGA 3AU6A 8ICLA 9ICHA 4IR1A 1XU4A 4OPKA 2HHXA 4K8ZA 3DLKA 3ZT1A 3QNNA 3TR8A 3B6OA 4J2DA 4KLTA 3C21A 1Z3EB 3K5OA 2HHSA 4MEYA 3V9ZA 4IBNA 1RTIA 1XSNA 2IMWP 5CP2A 5J2KA 4W5QA 4DL2A 7ICKA 4BACA 2ZJ5A 1VSMA 4PHPA 4OJRA 1YTAA 1SKSA 4ECVA 1TV6A 4NYNA 4IFYA 4QAGA 2AQ0A 2Q3SA 3AA3A 3NDKA 4QZCA 7ICUA 9ICNA 4ELUA 4P4PA 3H8JA 5IIOA 4ED0A 3VQBA 3C5GA 4UB1A 4KLDA 3HPOA 3PW5A 3RMDA 4M6WA 8ICZA 4B08A 2P6RA 5KFYA 2XO7A 1BISA 2YKMA 4FK4A 2AQ4A 4Z4HA 3PO4A 3U3GA 2C28A 4FJXA 3K58A 1XO1A 2X78A 3NGDA 2W9BA 2IOCA 4LH4A 9ICLA 4NM2A 4RQ7A 1CEZA 4YCXA 3VA0A 3QEWA 2DFEA 3KD1E 4J9PA 5DDYA 7ICPA 5HHIA 5CWRA 3ISCA 3V4IA 2BCVA 5EWGA 1RILA 5HP1A 1RT6A 3SQ2A 3PW7A 8ICBA 4DQPA 5TZVA 4J9MA 2GWSA 7ICHA 1NKEA 3JPSA 4EYIB 1C1BA 3PX6A 3KHLA 1HRHA 1NK6A 1JLGA 3U3YA 2BPFA 3UXOA 4CF0A 3FDSA 5KFHA 5C25A 3U6FA 1ZQWA 3OYBA 5J0YA 3DLGA 4B3OA 2F8TA 4E1NA 2AGOA 1L3VA 3OYJA 2D0BA 1SV5A 3AVHA 2DFHA 3SQ1A 3B0YA 4QWBA 2XGPA 4BDPA 2D0CA 1S1TA 1KDHA 2PYLA 3RMBA 3LWLA 1REVA 1NOYA 3MEEA 3Q8QB 2W9CA 3AV9A 2BDPA 3GIIA 4OKKA 4OVLA 4Y1CA 1ZBIA 4KI4A 1IKWA 1ZQZA 4DF8A 2UVUA 4O4GA 3UQ2A 4AHVA 4HYKA 2P5GA 2HNZA 1BIUA 1KVBA 5D46A 2JLEA 3RMAA 4F91B 3EYZA 1XC9A 4N76A 3OYEA 3NAEA 4XQ8A 4DSJA 4CFBA 1X1PA 1S1VA 3UQ0A 2XGQA 2FPLA 4PPXA 4E7LA 2RF2A 3VQAA 2BR0A 3D45A 2KFZA 4EP5A 4DSLA 2ASLA 8ICAA 4I2CA 1ZQCA 4LY7A 4M3TA 3C5FA 1HPZA 5J0UA 1JL2A 2JEJA 5KG0A 4CEFA 2FMSA 1V9PA 1S77D 4E89A 4NLNA 5KFPA 5FRNA 4KHYA 1RYRA 3ORYA 4ED8A 2PFNA 5J0SA 3Q8PB 1S10A 1ZQSA 5CHGA 4CK2A 1RYSA 1BCOA 1A5VA 5L1KA 5JS1A 2R7YA 5KG4A 2EX3A 3RTVA 3H40A 3C95A 4CJRA 4P4OA 4DU3A 2E6MA 3TWHA 4DOBA 4PA1A 4DTMA 7ICFA 3VN5A 4IKFA 4C8OA 1S97A 4B9NA 3HP6A 1RCHA 4FBUA 5DLGA 4EBEA 5J2IA 3O4QA 1SZPA 5J0PA 5DB9A 1C0MA 4EYHB 1WSGA 3DOLA 3MAQA 4F5RA 5KT7A 2ZJ8A 2KN7A 3TANA 2VA3A 3NH0A 2ITGA 2ZJAA 3V9WA 2BKEA 3RH6A 4FJNA 3PUFA 1NJXA 5KGXA 4CJWA 2P5OA 2V4QA 3MFHA 3OYLA 1KEJA 4PY5A 4I2GA 3HO1A 1BQNA 2NRXA 3NF8A 4I2BA 3SI6A 4RNMA 4JV2A 4ELTA 4J9QA 3SV4A 9ICMA 2HB5A 1TK5A 2VG7A 1CZBA 8ICSA 4J2BA 3ITHA 4R66A 2RKIA 4J9OA 4CEQA 1RPLA 2BPCA 2O4GA 3MXIA 2PZSA 4PWDA 1ZJMA 8ICCA 4TSXA 1EKEA 4M3YA 3ZD9A 2HW3A 3TARA 4K4GA 4DTRA 2QK9A 4DG1A 2VWKA 3V6KA 3JPTA 7ICOA 2Z1JA 2VANA 2ATQA 4Q43A 1WLJA 4HUGA 4G1QA 4FJGA 1KTQA 9ICJA 3RH5A 2B6AA 4R63A 4FVMA 1S6PA 4C8NA 4M3XA 4TQRA 4DMNA 4ED7A 4GLXA 2WONA 4BXOA 3SUOA 3RR7A 2HNDA 2LYHA 4CFDA 4I2QA 3HSTB 3OGUA 3MDCA 2MUTB 1RTJA 3CG7A 8ICOA 1UWBA 4CGDA 8ICEA 2FLNA 4I9QA 2AU0A 4ELVA 4WE1A 3IRXA 1VSJA 3RJFA 3QETA 4E7HA 2ZTEA 2JEIA 3GIMA 3QE9Y 3JYTA 1TV9A 5HROA 4XIUA 3IHQB 2W8LA 4ECXA 2HHWA 9ICAA 3QEVA 7ICGA 2F8SA 1O1WA 4UAZA 4EZ6A 2GV9A 1WSIA 3ISDA 3DRRA 1S1XA 5DDMA 5HMMA 4DS4A 4JRPA 4RG8A 2JZBA 1PZNA 5KFZA 1B22A 2OPSA 4UB2A 4M9NA 4O5KA 3G6VA 1QLNA 3E01A 4E7KA 3V6HA 5D49A 3HYFA 4B9TA 4I28A 4MFBA 1I3AA 4CK1A 1LAVA 4DSFA 4ED6A 9ICKA 9ICCA 3NGZA 5C5JA 3QEXA 3G6YA 8ICFA 2G8KA 4FJKA 5BOMA 3VQEA 1HJRA 1FKPA 5KRSA 3V1QA 1S6QA 3RJIA 5HP4A 3AVIA 2LSNA 4IQUA 3KK1A 4CF2A 4Z6FA 4ED3A 2Z1HA 3MGHA 2JEGA 2ZUCA 1BIZA 5FROA 1XHZA 1NJWA 5L1LA 4RPZA 4IG0A 5EWEA 5KFSA 4ECQA 1MU2A 3ZT2A 2B5JA 1BPZA 1WAFA 2IHMA 1KLMA 4CHNA 2VG6A 3C6TA 4QZDA 4B9UA 3VQDA 2Z1GA 3PMLA 3MEGA 5CB1A 2ZUDA 9ICPA 5KFWA 5JS2A 3I0SA 4NXZA 1ZQMA 2YNGA 4DL6A 4JS4A 2OYQA 1LWCA 2FMQA 1TL1A 2E4LA 1RBRA 4G3IA 4EEYA 2XY6A 4O3OA 1ZBLA 1NOZA 4M3UA 1ZJNA 4OKEA 4DL5A 2KW4A 1TL3A 1NKCA 3V6DA 2X6SA 1HNIA 3ZDEA 5CYMA 1X9WA 1N6QA 3TAEA 1T4GA 4B9VA 4O9MA 9ICXA 5KT3A 3RBEA 3QEPA 3C23A 8ICJA 4KAZA 5EWFA 1L5UA 4JWNA 2I1QA 2A1SA 4DQIA 4E3SA 1NJYA 1EP4A 3OYNA 1ZQHA 3B6PA 1S1UA 4FJ8A 1RTDA 3ETLA 4BE0A 4KITB 9ICOA 3H8WA 1MSWD 3V9SA 1D8YA 1JKHA 1ZQIA 4YFUA 3RJGA 3QIPA 1RDAA 2ATLA 1D8LA 2DTUA 4ECYA 4CEAA 3FYHA 1ZQUA 3DOKA 4J2EA 4QWDA 3HJFA 1BGXT 3SNNA 2YKNA 2OZSA 4FK2A 3CM5A 4CGHA 3SQ4A 2R8IA 3RJKA 4DTPA 3AVJA 4CJQA 3ZT3A 4W5TA 1IKXA 3QLHA 4GXKA 4E1MA 4FJLA 3RJEA 1ZQEA 5KI6A 3AUOA 4RQ3A 8ICWA 2PI4A 4OLAA 5J0QA 4YMOA 1ZQPA 1JLBA 4TURA 2IGIA 5DGAA 1S0VA 1Z26A 4FJ9A 5D4BA 4O3SA 4CE9A 3A2FA 4UAYA 1A5WA 4DU4A 1U45A 3QEIA 1NK0A 3BQ1A 2BQUA 1B92A 3CQ8A 4CHOA 1WN7A 3PMNA 4FM1A 4FS2A 4CJ4A 1BPEA 3MDAA 5KFVA 3OHAA 4EBCA 2AJQA 2WOMA 3S3MA 4KI6A 5J1EA 3HT3A 1RXVA 5J2CA 4CEZA 3M9MB 4GVMA 1C0TA 4M45A 3G0ZA 5KFGA 1WCNA 5C24A 4CEBA 2OZMA 2G8WA 1BPBA 4J9RA 3BQTA 4I2JA 1QSSA 2AGQA 1MQ2A 2FBVA 2BCQA 3C2MA 3H4DA 3ZCMA 4QW8A 4CCHA 1QE1A 3V9UA 3AVKA 3LANA 3PY8A 1VRUA 2FPMA 4HUEA 3C2LA 3MGIA 2G8UA 2ASJA 4O3PA 1ZQVA 5L1IA 2R8GA 4C8KA 2FLLA 2OPRA 8ICHA 5J0RA 4MQ3A 2QXFA 3KIOA 4CERA 2YNHA 3VQ5A 4I2FA 3RB3A 1U9LA 2HHQA 1SL0A 1B9FA 2F1JA 1RT1A 5KFBA 3Q8LA 4MEXA 1JN3A 4I2HA 3N4MB 4QZEA 2PFPA 1MC8A 4Q44A 4OKJA 1EXQA 5DQHA 5KFOA 3GQCA 5J2AA 4P2HA 2BQRA 1TFRA 4M9HA 4IRKA 1DTTA 4DTSA 4KRFA 4PGYA 3UXPA 4PHDA 3WNEA 3P1GA 2JEFA 5KFLA 4DFJA 2VG5A 3V9XA 2HMIA 1BI4B 1LWFA 3P83D 2Q0ZX 4E7JA 1ZQQA 4BDYA 4ZHRA 4DOAA 4KLGA 4FM0A 1NK7A 2G8IA 3CFRA 3KLIA 4M41A 3ZT0A 4FW2A 4KB0A 4H4MA 4KLSA 4F50A 4O3QA 1TAUA 3M8PA 4F5PA 2ZD1A 5DLFA 2F1HA 2FPKA 3HK2A 5KFRA 1U04A 1S0NA 3QIOA 3HVRA 4E0DA 4DQQA 3E2EA 4CJVA 1JMSA 3OYMA 4FYDA 1UA0A 1HJPA 3KKRA 8ICRA 4J2AA 3L2WA 3BDPA 1NK4A 4W5NA 4ZH4A 3AA4A 4YVZA 4YNQA 4R64A 3RBDA 1T05A 1D9DA 1S5JA 1YT3A 7ICJA 3ZSXA 3DMJA 4QWCA 4QWEA 3TFSA 1TK0A 4RQ1A 8ICQA 1HNVA 5KFJA 3RAXA 1W9HA 1ZYQA 4F5OA 5CY4A 4YR3A 3TAQA 4M9GA 1BQMA 4KLFA 1Z00B 2ISPA 1RDBA 4IR9A 3AVLA 4W5OA 3H4BA 3ULDA 1RBSA 3JPRA 1RBUA 3PR5B 4FJIA 4M3WA 4LSNA 4ECTA 5KG7A 4I2PA 1EETA 4O55A 2OPQA 4CIEA 2IHNA 4ECWA 3ZDAA 5HBMA 3OJSA 2A1JA 4HVJA 5EU7A 4CHYA 4KB1A 7ICLA 4Z6DA 5F9NA 4FLTA 4M3RA 4F2SA 2P1JA 3K5LA 3PR4A 3D0PA 1U4BA 1Q8IA 3HX0A 2D5RA 1IXRA 1ZQLA 4FK0A 1S9GA 4FJHA 2PFQA 2HHVA 4NLZA 3NH2A 1A5XA 4DSIA 5KFDA 3QEAZ 4DQSA 3M8QA 4QZ8A 3OS0A 4RW8A 3LP3A 3TAFA 5D3GA 1JIHA 4CJUA 4YFKA 3UIQA 4FJ7A 1ITGA 4F4KA 3GV5B 2PXIA 4YQWA 1RT3A 3LZJA 2KZZA 4KHWA 4YG2A 4RZRA 1RT7A 3AO3A 1C0UA 3T5LA 4R8UB 1C6VA 3WNGA 2EHGA 1IG9A 8ICNA 2E6LA 4YP3A 3SI8A 3MR6A 3KHHA 3NGIA 3VQ7A 1KVCA 4UAWA 4CJEA 3ZSRA 1U48A 4Z6CA 3T5JA 5HNKA 1N48A 3RJJA 4JWMA 4E19A 1ZQDA 3RB0A 3C1ZA 1BPYA 1S76D 2ZQBA 3AO1A 4C8LA 3Q8MA 1XSPA 4I9LA 4FJ5A 3MFIA 4I27A 4TUSA 5KFXA 2BGWA 4FLYA 3S3NA 3K57A 2W42A 1UT5A 2J6UA 2KQ2A 3SJJA 2XY8A 3TAPA 3QERA 2O4IA 1NKBA 4Q0BA 4GXIA 4I2DA 1UOCA 4JV0A 5J2DA 5HLFA 3H7IA 1TKXA 1LV5A 4KHSA 1HQUA 1L3UA 1HQEA 3DM2A 1SL2A 4FZYA 3G6XA 3C2KA 4JS5A 4DWIA 3NFAA 5DBAA 2NRTA 4B9LA 4QZHA 3MR2A 3KLFA 3C6UA 5J2GA 2F96A 1CXQA 5KG1A 4XUSA 4RPYA 2J6SA 2ALZA 3AVGA 7ICSA 5E41A 3CFOA 3T1AA 4CHZA 4I29A 1VSIA 4CIGA 4F8RA 4CFAA 4FJJA 3KLEA 2NRZA 4M0AA 3Q8KA 1B9DA 3EZ5A 3VQ9A 1WNSA 2A1RA 3TABA 4DOCA 4M9JA 1UA1A 3HPHA 4UB3A 3K75D 2IS3A 4YD1A 1SL1A 3GV8B 3T3FA 1ZQBA 4RUAA 5DGBA 1BPDA 1YVUA 4M3ZA 4QZ9A 1KLNA 2W8KA 9ICGA 2R8HA 4EBDA 4FW1A 1Z00A 1JLQA 4XA5A 1KFDA 2FBYA 3SV3A 3MR5A 2KFNA 5HMLA 2XC9A 3S9HA 1BVSA 4NCGA 2KTQA 4NCBA 1JLCA 1IKYA 1J9AA 4KLQA 4LZGA 4CHQA 2GBZA 3SUNA 3ZSWA 1HYSA 2V4RA 2GUIA 2HHTA 1XHXA 3NH1A 3ZSYA 4QZFA 4FLUA 3QINA 3OJUA 4RT3A 4KHQA 3WNHA 1S0MA 3JSMA 3OHBA 8ICYA 3QZ7A 3SCXA 3LZIA 3V1RA 3KKSA 4ICLA 2IA6A 3AVCA 4UB5A 4YN4A 4QW9A 4DO9A 4DS5A 3PNCA 3GIJA 1C1AA
chains in the Genus database with same CATH superfamily
5EE9A 4FZXC 2V51B 5E3CA 4K50A 2I5JB 3KLVA 2WBMA 3Q8SB 2Z30B 2C2DA 1VYAA 2L3MA 2QI2A 1ZQNA 7ICIA 4NLUA 4M94A 2CJBA 5ALNA 4PGQA 4ZVTB 4OYAA 1JL1A 2RHFA 2YTUA 5CYQA 3IWNC 2E29A 2NRVA 3F2BA 1GT8A 3K7RA 3TSPA 3L3CA 3B4MA 4USAA 1NNEA 3I31A 4US9A 2R2RA 5M2PA 1GXTA 3SDEB 2F4VF 1RE1B 1A6SA 9ICBA 3Q8RB 3UR0A 2YH0A 3CXCR 1XC3A 1IJEB 4A47A 3JPNA 2OLWA 1Q8BA 3D2QA 1TV6B 3F73A 2DGVA 2IAJA 3H2VE 3TEGA 2B21A 4CLFA 2YKAA 4DFKA 3FSIA 1LVHA 1VQ8S 1X31C 5J0XA 4JV1A 4B9SA 4K0KK 1FNXH 1RT2B 3IGNA 1HWKA 4EX7A 2XNRA 3DXSX 1M90T 3J80O 5DDPC 1BQXA 4MDAA 2KM8B 3HL8A 5DQGA 3L2RA 2RQKA 1NM1A 3CCUN 3PV8A 1TVAA 2QO3A 3LDQA 4CM2A 2BDUA 1C0FA 2IRYA 3R5BA 1XJWB 2LYBA 4CEOA 1Q86T 3MPYA 5IWAF 2X1BA 2UXDJ 2YHBA 1FESA 3PYFA 3MMCB 4FZMA 4ZMMA 3SLCA 2QA1A 1F5CA 5HP1B 1RT6B 2RSQA 3K8WA 3CD6S 1WSFA 4KO0A 1U47A 1RHMB 1TFWA 4QZIA 2QJ3A 2RDIA 1FDAA 2NLWA 2JSXA 3WX8A 1OPIA 3NWRA 1KW4A 4DV4F 2DT9A 5J0TA 3ZTQA 4BGDA 2N3OA 1W2BM 2KZ3A 3UPQA 4QJFB 4PZNA 3PXGa 3QNMA 3NVWA 1A0OB 4DR5F 5ETOA 3FZHA 2QT7A 2QLWA 4PYAA 3N79A 4CHPA 1S1TB 3HD2A 1QTMA 5DB8A 1IBKK 5JRTA 4KGZB 2I7PA 3P5JA 2HVEA 1X9XA 3VA3A 4YR2A 2DB1A 5J2FA 2GVZB 5HL7L 5HHHA 4USIA 1NGIA 4X84A 3HXMA 3CB4A 1IJFB 4QS9A 2GQCA 4LF8J 4C3KA 3C16B 4DV3J 2LKYA 3L0QA 3HSCA 3SENA 5JVGL 3RH4A 1HD1A 1PJ6A 3H59A 3DLHA 2XYHB 4LBHA 4UB6U 2GHPA 1IR2A 1BL3A 1VLOA 4OHWA 2RHKA 1VAZA 2W7OA 3M1YA 1ZA1B 3MAAB 1K1QA 3DRSB 4CESA 1MQ3A 2DPJA 1OY8A 3VEWA 3O3GA 1XS9D 5DG8A 4DUZF 3UKUB 1T3OA 4NRUA 2XLJA 2E1MC 1QQMA 5M1FA 1RADB 1LW2A 2X51A 4I69A 3PRVA 1XQSC 2PO4A 4I2AA 4LBIA 4KMUA 3FE1A 5AQLA 1QD1A 1VRQC 2K60A 3OR1B 4IO1A 1T9WA 2QWPA 4PG5A 3AODA 1FKAF 1M90O 3P5TL 3KLHA 3DU5A 1SB6A 2HBZB 3KJVA 4NEZA 4J9SA 1W2IA 4AL5A 3W5ZA 1L7PA 3MOZA 4AHCA 3KD5E 3CJAA 7ICNA 5G0RB 2H51B 4K8XA 2DVIA 5E2QA 4K2JA 1Q7LB 1Q86O 2MQMA 1RZMA 5KT2A 3AVFA 3ID8A 3P45B 2GA7A 5T7LB 2DNGA 4HTJA 2VOOA 3LWMA 2FHJA 3R1XA 4ZTJA 1F5SA 2WB1D 1WBBA 3I82A 5CH7B 1UVLA 5B7WA 2EFVA 3FMBA 4LR8A 2CXYA 3PW4A 3L8BA 1M5VC 4CF3A 1HI0P 5EXWA 2IVYA 2EFNA 4QZBA 8ICGA 1QAYA 5LOQA 4F71A 4U67Q 4Y2TA 2ZHAA 2JDJA 3CDWA 1BQNB 2HWTA 5AXMA 2ZBPA 1QSLA 2ASDA 3VEXA 4YUDA 1D3WA 2R8JA 5H9EJ 1RBOB 4OJGA 2JJ4D 1JLFB 4KHRA 4DPUA 2LI6A 4DI6A 4DX8H 2IFXA 1P6TA 1XSLA 1UEUA 4ZDNA 2XY7A 3DJCA 1RAOA 2D41A 3SBTA 3J7ZO 4FYXB 3DXBA 1J53A 4DXLA 3EUNA 1CZ9A 4PWDB 4RW6A 4O5EA 4W92B 4HVZA 3TX8A 3OYGA 3HCXA 2VIXA 3NF9A 1URJA 4FXWA 3PM9A 4DV5J 3AQOA 1R43A 3VMFB 2MKCA 4MKYA 1WSHA 9ICEA 2CDRB 3PIPL 1J5EF 2VQFK 4QS7A 3SCLE 2ZH8A 3CMES 3RAMA 4ES1A 2PGCA 3OTCA 1HJOA 8ICTA 5GVQA 1NK8A 2U1AA 1S6PB 2DY4A 3ALYA 4BXOB 4CIOA 4DL0C 4KLEA 4CECA 5AM0A 2AA4A 3P38A 3RAQA 4YR0A 2WFAA 2VA2A 1KD1T 4P73A 3HILA 2ASOA 1RTJB 4GMJB 4BWJA 1RXWA 4KTWA 2BJ8A 5DMRA 2C3YA 3CCLS 3H5UA 1I94K 3SUPA 1N32F 1RHQB 3J80U 4QQBA 3DLRA 3IRXB 5KT6A 1OW5A 1UVMA 1I3OB 4Y1DA 4OO1J 2K3KA 4QU6A 2K4HA 2ZHOA 2VBWA 1FO1A 4X5VA 1N5XA 5F9LA 2W03A 4DR7K 1ZQFA 1U2VB 5GTIU 5E3RA 3G9CA 3LAKA 2B4JA 4CLWA 3NGYA 1S1XB 5ALVA 2JZBB 2HHHJ 1O03A 1ZQXA 1H3DA 1RBAA 3HOSA 3CC4N 3VQCA 3LALA 3UDLA 5KPZA 4DPXA 4OV6A 1VK0A 1LW0A 1JXBA 2MAXA 4FXVA 4P6QA 4LFAF 4PHAA 2VPWB 4BY9C 3DRYA 2GO8A 3MM6B 4JOUA 4ED1A 1D5AA 4Y2RA 3QESA 5CEHA 4OYIA 4IQVA 4PHEA 2F1IA 4CRJA 2QWQA 4KN7A 7ICMA 4RQ6A 3MTJA 3H46O 3VEVA 3H6EA 5CHIA 1HARA 5ADZA 3CULA 4W98A 3PEJA 1NZBA 1W97L 1FWKA 2DR9A 2WRMA 1QY7A 2ZOFA 2P9NA 1JLEA 4LFBK 4WFYA 2VKQA 1NGBA 1XMOJ 2QC3A 4IG0B 4BRFA 1MU2B 1F9EB 4F5NA 3GYNA 4ZOHC 1CI4A 4HHTA 4OX9F 1WHVA 1UPHA 3C6TB 4KJIA 4DQ8A 1RHUB 3L5KA 1ASWA 4XTTA 8ICKA 5B0CA 1TK8A 2BVZA 2R2UA 4N5SA 2KB2A 1VC0A 3I0SB 1RAFB 2BKPA 2YNGB 3O9QA 4RQ8A 3GFXA 2ACYA 5IV4A 1EKSA 4OHYA 1BHLA 4O0IA 1FIQA 1JNZB 1LXNA 3MCOA 4N47A 1SCJB 2OXOA 3SZ2A 2IVMA 5H9FJ 4HWIA 3CDUA 5F8NA 4IOCL 5F0UA 2FJBB 1KD1O 1N5QA 4PWUA 5L1JA 5AM1A 3JSRA 4C0BA 5K8PA 1OY6A 1U02A 3LQVA 4ZA1A 1TUVA 4PEOA 2QMUB 5F1XA 1IBLK 1WB9A 1EP4B 1H74A 1Z4NA 2IM0A 3GMGA 1Z1ZA 1BXNA 5ALPA 5AFUA 3V72A 4ILLA 3G96A 3OS1A 3FFKB 2FTRA 1JKHB 4CGIA 3QIPB 3D7SB 1Y88A 2E1YA 2HQGA 2ZIXB 1OVYA 2CG4A 3EO3A 5I3PA 3C3LA 3QMQA 7ICTA 4QZAA 2YWKA 4FOIA 3QLHB 4M5NA 4CI6A 4J9VA 3LVWA 4NPOA 1Q9XA 3W66A 1KFTA 1WEYA 2FF6A 3UCUP 1KONA 4LF4J 4TU7A 4KPYA 3MPVA 3CC2N 2RJZA 4OLBA 3EW9A 4Q8FA 4IJNA 3ZDBA 4NLKA 3FRYA 1ZM2A 4M63C 2E5HA 5LMUF 2W2NP 3O9RA 3KHRA 1YJNS 4C2MA 1UJ4A 2XHCA 3NY0A 1SXEA 4BDZA 2X6NA 3C8YA 2NSBA 4WIQA 2HNYA 8ICMA 4U7CA 2WTFA 4BROA 4JRQA 1YUWA 3U27A 4Q2MA 4PXDA 3C66A 1WOPA 5LSOA 5J2PA 5E84A 4V19X 1P27B 2W9AA 4OPHA 1PYOB 2ZIUB 4A2AA 4RNHA 4LF6K 4CZEA 1XIQA 1M1KT 4O4RA 4OFZA 3QWUA 4ED2A 4JK7A 2A6MA 4JLHA 2I6WA 4KH6A 4Z7YA 2LPEA 2OKQA 3MPUB 4JB3A 3TO8A 4DU7A 3KOOA 1QUVA 2NPFA 1VRTA 5HRRA 1ZQOA 3R5CA 2P9EA 2K7KA 4HH1A 3U9ZA 1T9VA 3CJRA 3V81A 1IJJA 4GVBA 2O8EB 4FLWA 4FWPA 2VA8A 3CFPA 3TYTA 4WYWA 2FC0A 4B1WB 2O8BB 4OV1A 5HQLA 2DGTA 3TR5A 2R7TA 4TUPA 3O5TB 3CRXA 3LP0A 2VYPA 4QZVB 2CQ4A 1IUJA 5AQOA 1BMQB 1RT5A 3I33A 4KLJA 3EE8A 2XTJP 3P31A 4Z0UA 1N56A 3GJTB 1FRHA 3L4QA 4IRDA 1N36F 4TLQA 2B7CB 4YY3F 1N60A 3THVA 3OVNA 2XIDA 3D66A 4LSLA 1I39A 1T9YA 2HZCA 3WDOA 4RW7A 4DL3A 4H4MB 4KTQA 3TFRA 3ZETB 3J7AN 1J5OA 1WG4A 2NZTA 1UETA 4KE5A 4BC7A 2UUCF 2EC0A 1X0PA 2FJXA 3ZSZA 2IDEA 4KH0B 1YJVA 1TMMA 3T5HA 4FJMA 4F72A 1GLLO 1T7PA 2HS0A 5C42A 2RDJA 3R6GB 3ZX2A 4JI4F 4DEZA 1PC5A 2H4YB 2V63A 1OMSA 2YWFA 1MMLA 3IS9A 1JJ2R 4BR7A 2KJVA 2DGWA 4N7TA 4RR5A 3H45C 4RPXA 4UW9A 5GAGI 1NZPA 2LM1A 1JX4A 1NHVA 2JR5A 2D6FC 2HPUA 3OYHA 1KFSA 4QIFA 1SXLA 3MPWA 3ZX3A 4L75A 4FBTA 2OA8A 4CF9A 1M1KO 4O0JA 5ELZA 1VSKA 3UXNA 1HUZA 3HVTA 2EH9A 2HNZB 3MM5A 3WK7A 3D6RA 3RRHA 3CD0A 4ILGB 3BO3A 2J0QD 4X4PA 4MYTA 1HKCA 2QLBB 1NLKL 3MMBB 4YD2A 3IRWP 4BC5A 3PKMA 4FYYB 4RNFA 3B82A 2A1JB 3E1YA 2NS1B 4M5DA 7ICRA 4I7FA 2RF2B 3C29A 1CRXA 2B6GA 1V3ZA 5KT4A 2R8KA 2Q0RA 4FZLA 5J2MA 1HA1A 5AJ3F 3AU6A 2X7IA 2BACA 5THWA 1FJGJ 2HHXA 3OA9A 2P6TA 2QYCA 3B6OA 2HAIA 2OTLS 3C21A 2HHSA 3V9ZA 4DR3K 2OSQA 2KVIA 4RW8B 5J2KA 1TUYA 3GONA 1GEHA 1VHIA 2HFVA 4DL2A 4M95A 2ZJ5A 1VSMA 4L3QA 4OJRA 3Q23A 1T0TV 2B8QA 1BUPA 1SKSA 3BSAA 5CRXA 4NYNA 3VPZA 4BC2A 4IFYA 8AT1B 5L1MA 1KOHA 3NDKA 2B9XA 1DJ0A 1RA7A 1L8LA 3B78A 4QZCA 9ICNA 1BA0A 3MD3A 4I64A 2EBEA 3A3NB 5IIOA 4URSA 3X1LB 4JI3F 2UXDK 4TLRA 3JSBA 1YJWN 1B0XA 1NSPA 4CDGA 1Y0HA 2P6RA 5KFYA 2YKMA 2UXCJ 2AQ4A 2Y0SF 3PO4A 3U3GA 2C28A 3VVTA 2MXYA 2NZ4A 4A8MP 4F3MA 2HS3A 2W9BA 2A18A 4LH4A 9ICLA 3NRBA 4CNQA 4YCXA 1U1NA 3E9OA 1WC1A 2BUPA 3WK4A 3PJ9A 5HHIA 3V4IA 1M5OC 5EWGA 3KKFA 1RILA 4OZ5A 5A8WA 3SQ2A 1ATRA 1Y9OA 4J9MA 1V97A 1DURA 3L09A 3GE9A 3ZNJ1 3UD5A 1NKEA 4IO9Q 2OFHX 2V4JA 4QYZK 1C1BA 4R0JA 1JQGA 4QU7A 4YOXA 2GHWA 2AEFA 4BG8A 2X3GA 2W6LA 1JLGA 3EX7B 3OL6A 3FDSA 5BPNA 3U6FA 1HQEB 3RUBL 2H3FA 3IR6B 1SH0A 4H0TB 1S5ZA 2M8DB 3O1BA 4C1NI 3KLFB 2U2FA 2F7TA 4LFCK 4YB7A 1MN9A 3ETOA 3CMAN 1DARA 3I32A 3SQ1A 2DFHA 3H0RB 4HACB 5AI0A 4Q2LA 2HAFA 2D0CA 1RQ0A 3E9LA 1DRGA 2UU9J 2PSZA 4BBYA 3J81U 1NPKA 2QN6B 2HKEA 1VC6A 3P39A 1NOYA 3PRDA 2KHQA 3MEEA 3Q8QB 4MDBA 3AV9A 2BDPA 4OKKA 2GX9A 2K4PA 4J9UE 4Y1CA 1VQLN 2V2KA 4J5OA 3G4SS 3KYLA 1L7OA 1QDUB 4K41A 1R8BA 1CULB 4O4GA 2KEYA 3WKEA 4AHVA 3ISND 4YDUA 1WOSA 3HLUA 3IA0A 4YS2A 3AD9C 3M30A 4NXNF 2IJNA 4H0XB 3P6YC 4XQ8A 1SPBP 1S1VA 5D4OA 4M7XA 3IG5A 2XGQA 1FX4A 1SC6A 4E7LA 1FTCA 5CABA 4DSLA 3D6FB 8ICAA 1ZD4A 4I2CA 3W1YC 3NRWA 2E20A 3C5FA 1Z2LA 3IXQA 5F8HA 2HZAA 2MMYA 4CEFA 1D9AA 3WX4A 5GIOA 2KN4A 4OZ3A 2DIVA 3FZMA 1RYRA 2Y1RI 4NZ0A 1S10A 2IOFA 4K7QA 4CK2A 1RYSA 1BCOA 1TUUA 2F8HA 2UV8A 5JS1A 2R7YA 4L74A 1QVFR 4DJBA 2E6MA 3DXKA 5HR7A 1NPPA 3VGKA 5CYQB 1F5BA 4IKFA 4RPFA 2FPHX 2Z7JA 1GMVA 4NL9A 4K4UA 3J81j 5DLGA 5J2IA 1SZPA 5DB9A 3BV8A 4AE5A 2DISA 3DOLA 2R2TA 4IH5A 2X1FA 3W3DA 5KT7A 4WBFA 4ANCA 4NWIA 2P9LA 2VA3A 3OQ2A 1HBMB 3NH0A 1XNQJ 2ITGA 3M2UA 4FJNA 2IAJB 1Q78A 3QIDA 2XWXA 2NREA 1XR5A 1X3MA 4RBTA 2FLOA 1YJ9S 4DV5K 3BKTA 5JVHL 2NRXA 4I2BA 3D54A 3PSTA 4RNMA 5J8YC 2WF6A 4F04B 2I0XA 3ZI4A 2L9WA 2D3O1 4J2BA 4R66A 1ZAXA 1RPLA 2UUBK 2BPCA 4OI6A 3AAWB 3HHLB 4AYBD 1N33J 2C42A 2WW8A 3GG1A 3LA0A 3CJCA 3X3UA 3N7SC 3JPTA 1HBNA 4LRFA 4KO0B 1RTDB 2ATQA 1WLJA 4HUGA 2XSJA 4FJGA 4WQ4A 2EDUA 3C46A 9ICJA 3RH5A 4K4ZA 2B6AA 4FVMA 4U8VA 4DMNA 4Y2MA 3P8BB 2LYHA 1WYGA 4C1NK 1NB2A 3HSTB 2MQ8A 4FZVA 2YY3A 5CR4A 2H3GX 4I6MA 3NNAA 1UWBA 3FMWA 1VLYA 2VHGA 3A0BU 3OFGA 4JV5K 2ZWOA 4Y28C 1NZ8A 2BE9B 2Y9TA 4WE1A 2HHHK 2DNLA 3QETA 3HDSA 2JEIA 4P10A 3QE9Y 2P9IB 3JYTA 1TV9A 2VUGA 2IPOB 3QEVA 1Q95G 2W25A 3SCKE 2YX1A 1C4AA 1HHQA 3ZO7A 2BUNA 4EUVA 2F8SA 4K4YA 4FWMA 4UAZA 3CCJS 2GV9A 4ACOA 3DRRA 1WSIA 1VMBA 5HMMA 2POKA 1B22A 2OPSA 2FZKB 3SAFA 2IVFB 5J1EB 3QFUA 3E01A 1ZQ1C 1KDNA 4PL7A 1F44A 1K0TA 1U7LA 4UZBA 2JV3A 4B9TA 1V3SA 4CT9A 1X60A 5C24B 4ED6A 3LVVA 2PIIA 3NGZA 1WOOA 1XMOK 1Q3UA 1VQNS 4LJMA 1N4LA 1LW2B 3FJ2A 3KZBA 4OZNA 3NP5A 1HJRA 4PL2A 4OYMA 2ALYB 4JMUA 2Q3PA 1G4CA 1S6QA 2XO6A 5HO4A 4IO8A 3BYPA 4ZVGA 2AJFE 1S22A 4Z6FA 5JLFA 1CC8A 2JEGA 1YVNA 4KGKA 4OI4A 2YNHB 2ZH1A 1BIZA 5FROA 5AE2A 1NJWA 3KLHB 3NCQA 5L1LA 4RPZA 3AAQA 3RSEA 5EWEA 5KFSA 3K17A 3Q24A 5A0LA 1WAFA 2VG6A 3HKZD 1ZOLA 3CDBA 4B9UA 2B4UA 3PMLA 1RQNA 3OW2M 5KFWA 4NZ6A 3TADC 2E1AA 4NXZA 2VBYA 1IXKA 4JI5J 3SSSA 3BS5B 3W9JA 4L72B 3EVWA 1TL1A 4M1KA 1RBRA 2XY6A 5HVHA 3BGUA 2RS2A 3PJXA 1NOZA 5K8MA 4M3UA 1ZJNA 4MLHA 1PSDA 2E5JA 3G8SA 1K47A 4ILHA 1GTHA 2QWOA 3IUCA 3GZ7A 3ZDEA 1X9WA 1N6QA 4FWQA 2QA2A 2UUAK 4O9MA 1KQFB 3M8PB 3CCUS 2FJWA 3W5YA 2LA6A 1YITN 1RDRA 5AK3A 2HCFA 2I1QA 2W41A 4HHJA 3WC2A 1NJYA 3OYNA 2MLXA 2GC8A 4FWRA 1N52B 2CAJA 2KSOB 2QM1A 3BZQA 4BE0A 2KHDA 2GW8A 2RRNA 4XPEA 2FVPA 3R3TA 1P8ZA 3W64A 2KXNB 4LF4K 1D8LA 2DTUA 2CDQA 3M6WA 4X62F 4P75A 2XI3A 3DOKA 2DNOA 1KQSR 4OJOA 4CGHA 2R8IA 4H4KA 2GIQA 2LKZA 4CZKA 4E8UA 4M8LA 5CCMA 3WQPA 4GXKA 3POTB 3P96A 3M6XA 3K2YA 4CLTA 2K3IA 4GKJF 3HFVA 3AUOA 2V7YA 1IBMJ 1G99A 1NZAA 1RI7A 4KBOA 4NLBA 1JLBA 1UAWA 3THWB 4TURA 2DXFA 4F0HA 3EMTA 2GV1A 2EAOA 2R7UA 3T41A 3CQYA 4DU4A 1WDTA 2KL8A 2F65A 2K2PA 4OX6A 3M8ZA 5KOXA 3PMNA 2QARA 2Q0UA 3SQOP 5HBMB 3OHAA 1J5EJ 1RXVA 5E3PA 2J7KA 3VEOA 5J2CA 1F60B 3M9MB 3ULHA 2HSZA 1XNSA 4JBCA 5KFGA 1BPBA 3BQTA 2AGQA 1MQ2A 1UFLA 3QB0A 1R6VA 1RCXB 2W2PP 4CCHA 2B8PA 1QAIA 3AVKA 1JCEA 3PY8A 2GHVC 3MGIA 2V8GA 2ASJA 5GAGP 1LW0B 1JCGA 1ZQVA 4IEEA 5L1IA 2FLLA 3UW1A 2IOHA 4DV0K 8ICHA 5J0RA 1MLAA 4PG7A 3QU2A 1ELOA 3TEHB 5HL7Q 5F3XB 3QUBA 1EAYC 4DV2K 3OBWA 3AA9A 1YBTA 1T9UA 2CQGA 5D8HB 2D3UA 4NV0A 1WKJA 3VESA 1U6BA 1P7DA 4DUYK 1VQKN 5JVGQ 4FVCA 1KKXA 1MC8A 4Q44A 2P9NB 1JROA 1EXQA 1JLEB 1FCAA 5AE3A 2BQRA 3K5PA 3FQKA 5K5MA 3P1GA 2JEFA 1ZH5A 2VG5A 3TA0A 2D0PA 4IL6U 2C3PA 1I6JA 3V9XA 3VCBA 5LMNK 1SC4B 2FVQA 1HKGA 2Q0ZX 3MXHP 3S8SA 4BDYA 3I6PA 4FM0A 3SR6A 1OIAA 3KLIA 1RGIA 1WSRA 4Q0BB 3OV7A 3GJQB 5HMZA 1D1UA 4O3QA 4F5PA 1HHTP 5DLFA 5F8GA 3SEOA 2YY6A 5ETMA 3C2PA 3HK2A 2D0OA 4K5SA 5KFRA 1WG1A 3HVRA 5ALXA 4E0DA 4DQQA 4BGBA 1KOOA 4MKBA 3AM9A 1JMSA 4J90A 3SEIA 4C11B 3L7UA 2AH5A 2AYBA 4OCZA 4RUHA 2VQFF 3CVKA 3BDPA 1BE4A 1NNDA 2J9DA 3ED5A 2EFPA 4HT7A 4DU8A 4URGA 2WB4A 5DDQC 2NXJA 3RBDA 3DHXA 1D9DA 1UCNA 4WQ5C 2CPYA 3TTDA 4QWCA 3TFSA 8ICQA 4DB3A 5K8NA 5M1KA 4BUGA 1V6HA 4M5MA 1NGAA 2EZYA 3FQLA 4USMA 2ISPA 4IR9A 2H48B 2XS2A 4W5OA 3T1HJ 4TY8B 1RBUA 2KG0A 4M3WA 1EETA 2OPQA 2DKZA 2W54A 1FJGK 4QNLA 3DHWC 2DEJA 4DR7F 2CJAA 4MH8A 2FJDB 3M6ZA 2LQ5A 4OYOA 2C2MB 4JI2J 5EU7A 2DCLA 1WUAA 4Z6DA 3JSMB 1C4CA 4M3RA 2P1JA 3HX0A 4ICLB 1ZQLA 3O8MA 2XMKA 3D4JA 3PIPQ 2WUSA 2VWBA 2PFQA 1WNEA 2VB6A 3FCWA 1GQEA 3N7PD 3QEAZ 1YK9A 3CEDA 1KN5A 5J2PB 4ZP9A 1UZDA 3HI9A 3M8QA 2RVJA 3CC4S 3WXMB 3ZLJA 5AQMA 4NO7A 3CJTA 5MLCQ 4CJUA 2N3LA 3BEXA 1U2FA 3UIQA 4KKOB 4FJ7A 3DFEA 1ITGA 3GFHA 1V5IB 4IDKB 4BGAA 4C4WA 4F4KA 3AAPA 3LZJA 2V50A 4KHWA 4YG2A 3T9NA 1C0UA 2KNJA 3K9KA 4X2BA 1C6VA 2Q2RA 1VRTB 2EHGA 4DV7F 2E6LA 4HDHA 4CLYA 1HWUA 5IFMA 3NGIA 4UAWA 3D3BJ 3ZSRA 2CQ0A 3H90A 3V81B 3MM7B 1IR0A 2D1CA 1DLOB 1GK8A 3RJJA 3CPWR 1IWAA 4LVOP 4NX9A 1ZQDA 2KKZA 2BJ7A 2QTDA 3KZXA 2ZQBA 3AO1A 2M7SA 3Q8MA 2ZITA 1VQON 1XSPA 4I9LA 4QS8A 2SXLA 1R31A 1TYQA 1QQ6A 5KFXA 1GLJO 3D28A 2BGWA 2W3SA 1LXJA 3J7A1 4WTOB 2J6UA 4ZKAA 2KQ2A 4URQU 4U8YA 2XY8A 4ZPDA 3JTOA 4A2BA 4L76A 5HLFA 2WB1C 1TKXA 1LV5A 1N5WA 4NB4A 3N9UC 4V1Ak 5JMVA 4WYBA 3BSCA 2FQQB 4FZYA 4AXJA 3G6XA 3C2KA 2FIUA 2ZHBA 4JS5A 4DWIA 5DBAA 1FEZA 4Y2CA 2YQEA 5ALWA 2F96A 1Y10A 1CXQA 4ZP6A 3FZKA 1HLUA 2KFYA 4NMLA 7ICSA 2ZOMA 3T1AA 3WK5A 2BJEA 4CHZA 4CIGA 2GVDA 3PSIA 1RLCL 4NL5A 4M0AA 5ALKA 3M5RA 1L8OA 2PA8D 4WKRA 2B56A 3D3CJ 4CO3A 4A8OA 2E2OA 2IS3A 2D7SA 3IR5B 4JI8J 2FY1A 3EEQA 1Q16B 5E7OB 4B3TK 4I67A 5AQWA 2APOA 4FW1A 1Z00A 3C19A 2OI2A 2FBYA 3CF5L 4TXSA 2ZM6J 1G6BA 2XC9A 3S9HA 2HRYA 4LT6A 1IKYA 4CO5A 2YCHA 4XH5A 4KLQA 3F5TA 1S79A 3SUNA 2YX8A 5C15A 4IOCQ 2V4RA 2HLUA 3R9KA 3ZSYA 4ID8A 4RBUA 2E5LJ 3QINA 1MW7A 5BN9A 3OHBA 3CC2S 4CBXA 3MM5B 2AZ3A 4UB5A 1EIYB 1VLBA 4WFNL 1GMUA 3QATA 1J54A 4FZZA 2GAGC 2NQPA 7ICEA 4I7FB 1R8HA 3DLEA 5ALEA 3BP8A 3EJMA 4MF2A 1Z25A 4PABA 4KC5A 1YJ7A 4YXMA 4ZVOB 3RB4A 1ROFA 5J2MB 1X2IA 2HHUA 5CZXA 3NHGA 1VFJA 2OPPB 3VVUA 3OFHA 3EKSA 3HJEA 2M4MA 1FI4A 2PFDA 5M1OA 4DR4J 4QOZB 2P9GA 3EN9A 2H5EA 1C1CA 1WF2A 3EPIA 1KCFA 4N8OA 2DNNA 1HYZA 4IWVA 3K59A 1ZQJA 2XHWA 2VZ9A 3QNWB 3WZ0A 2LEAA 5RUBA 5DO2A 3PNIA 3ZT4A 3LP1A 3BQ2A 4MK7A 2ILYA 4IFYB 4CDIA 1TQLA 3C1YA 2RPIA 2YNFA 4F4YA 4G1PA 1KSPA 1VQ5N 2A6AA 1S9EA 4GV9A 3SIPB 9ICSA 3AA8A 5HATA 2DHAA 3VEZA 4B3MK 3BQ0A 1LOUA 4ZOSA 3K4GA 5KFCA 2YKMB 1NBWA 3DV9A 3R7SB 1LB2B 1R89A 2I1RA 4O3RA 2W9BB 9ICIA 4DL4A 4M5IA 1N5VA 1OKJA 4DFPA 2HSEB 1K0VA 2G8VA 3A8JA 4IQWA 2A42A 2AJ1A 3EXCX 1BPXA 2HF3A 5GADU 5TKWA 2H5XA 5A8WB 2I2YA 2H3ZA 3FAHA 3KWMA 2ZIVA 3GOIA 4FNHA 3OTOJ 2V4JB 3ILJA 5I42A 5B66U 2AHOB 4EO6A 2O6KA 2OEHA 4UW2A 4X64J 4LZDA 1VJWA 1JLGB 3PCOB 3OD2A 4LF9J 2GMJA 4RQ0A 4BRCA 1OUQA 3VAHA 2MUTA 3V7JA 2R7SA 4M5HA 4CJ3A 3PDNA 5HJYA 1U49A 3EGWB 4KLUA 4LF2A 4C8ZA 5A0YA 3HZGA 2B9EA 1HW9A 4K43A 1FERA 1RAEB 3N5FA 3ZXWA 2OEMA 1U2RA 4IJAA 2G8HA 3WU2U 4FYVB 3TACB 5ALFA 3K5MA 1A9NB 4JHDA 3MEEB 5AIAA 3FC9A 5KFAA 1Q53A 2DR7A 1COOA 5GADI 4ID1A 1B64A 2QXLA 2NO5A 4J37A 4GVEA 2R42A 1XMBA 3M05A 1QZ6A 4O4GB 3G8TA 1HIWA 9ICVA 1YZ7A 5L9XA 2ZH5A 4CFCA 3PFEA 4B3SJ 2DFLA 3PX4A 2JH3A 4CH0S 4USVA 3M30B 5J2BA 2FGCA 2FJAB 3UFCX 4PWWA 4CGFA 2ZWPA 5AXNA 3NF6A 3Q2SC 3AD8C 3WXJA 1S1VB 2LQ9A 2RIJA 4L3KA 4CGGA 3O4NA 2I5JA 2PYJA 5LY3A 2XVTA 1JJHA 4ED5A 2ZKUA 3IRUA 2JC0A 4WP9A 2BANA 3OTDA 1N63A 3NAHA 1FRLA 3A13A 3SJHA 3UDVA 2F3JA 2F2AB 2ZH7A 5FRMA 2D3ZA 2YV0X 5F0XA 2ZE2A 2V68A 2NLXA 2QSFA 2Y1LB 3SDEA 2KT2A 2L9NA 2GIRA 5B0DA 2KZMA 3BR9A 3BSOA 5DK5A 4USKA 5BPLA 3BF3A 3I56N 2UXDF 4CIFA 5ALRA 1X3NA 1Q82O 2KU7A 1NG9A 1M1GA 2LMRA 1JCFA 4QWAA 4TU9A 1Y97A 1LEOA 3VQ4A 2YHXA 1RKIA 4YOTA 1Q5YA 1NSKL 2O8FA 5AQIA 1YI2N 1RT2A 3DOLB 4RW9B 2C2NA 2P9LB 4R5PA 2ZJQL 1TKTB 3M2UB 3CCSS 1YJWS 2CUYA 5KFFA 3CO0P 3VF0B 4DR6J 3ZC4A 1X6JA 2N7CA 3NBPA 2XMWA 3F9KA 1S4FA 4D3HA 5HJXA 3LAMA 5ETLA 4RO0A 2J4RA 1M5PC 1RLDA 2YKPA 4HCBA 2AV5A 4OIXA 4CNZA 4L8RB 1ZBHA 3IM1A 3QO9A 1S72N 1SV0A 2BV3A 1AYEA 3SXLA 2FHJD 3N97B 1Z1VA 2WBRA 1BHNA 2VPXB 4RQ5A 2LQ8A 4KIAA 1MDUB 3OY9A 2HBJA 2M9NA 4LF8F 4DV3F 4WJBA 3U7JA 1MMDA 4P74A 4JI1J 2XSJB 3HSGA 1AFIA 3BBCA 1HPMA 5KT5A 1RKJA 3VQQA 4EI2A 4NEYA 3BYRA 4YMMA 4ES2A 3TJ9A 3CMAS 3VQPA 2FJ6A 2YNIB 3EY1A 1KVAA 1CSJA 4R25A 2LEPA 2E1ZA 5EVZA 4I6MB 2GVZA 3A0IX 1UWBB 1CZAN 1AUSL 4JI7J 4IOAL 2QX0A 3O08A 4C0HA 1OJ4A 2G0IA 1QAJA 4J9NA 3DCAA 3C16A 2FBTA 2A40A 4WYLA 4UY8T 1FFWB 1VQLS 5HAOA 5AQTA 4H4OA 4ID5B 3JYTB 3V6JA 3W3SA 2D4WA 3K8VA 3UVJB 8ICUA 1K73T 1X66A 4FL9A 1IWGA 3MM8B 3DRSA 5EE1A 2Q66A 1GAOA 5IQQA 3HP9A 1T11A 3HW8A 4DSKA 2W55A 3UKUA 3PW2A 4ETZA 2OPSB 2RRAA 2RU9A 2DNPA 5KFEA 2NUUG 3MK6A 4GC7A 4DQRA 3E01B 1Q5VA 4ANEA 4QR0A 2BE7D 4OHVA 3SBGA 3PEHA 5KFMA 2P6UA 4OYBA 2FUG9 3I5BA 4C4SA 1MWYA 3OR1A 2ZTCA 2KICA 3OYKA 4CGZA 3FM9A 5AKHA 3AOCA 4NLVA 2DHSA 1CXUA 2DPNA 2C22A 5GAHP 2I8EA 3D2SA 3C94A 4M2YA 4Q8EA 4F2RA 2OO4A 1FK9A 5ETVA 1RWPB 3VR1A 3R7NB 4AQYJ 1S6QB 1N34J 4CZFA 1KVJA 3TVKA 1YIJS 2W24A 2ZUGA 2E2QA 1FKOB 3V7KA 3KLGA 3EWAA 2CJQA 4NCAA 4IUFA 5T7LA 2O8CA 3DI6A 5A2QY 3QGHA 3CETA 2HOEA 5AM3A 3JPPA 1BG3A 5DS7A 5FPNA 5H1SQ 1R0AB 1X5OA 2WF9A 4WPAA 2WSFC 4K59A 1BNPA 2ZXIA 1UVKA 3PVXA 3R5DA 4C98A 4DV5F 2QKQA 3AD7C 2HWHA 4NA3A 2UYTA 1R0BG 2NR0A 5FP0A 2V69A 4E7IA 4CJ5A 1XN9A 5ALMA 5ALQA 2CPEA 1TKZB 1Q81O 3H08A 2FJEB 3QMLA 1TL1B 5CA5A 2ZUBA 5KFQA 2YQ0A 4Y65A 1X5PA 1JLFA 4CJTA 4TN2A 2PD1A 3AGRA 4Y2IA 4X66K 4JAXA 2W7PA 1PIEA 1YBAA 5CR0A 1D9FA 3LPEA 4ZVQB 4DPYA 4LF1A 2CPFA 3NTUA 4K0KJ 4NLGA 2EWSA 2M0GB 5BR8J 1AA1B 2E1PA 2M9KA 1DQAA 3B8AX 3NF7A 4UY8O 1BCMA 3VEYA 4MKAA 1JXLA 3VF4A 1ZQTA 4LF5K 3ZX0A 2VPZB 2VU5A 1WC5A 4K5RA 2YB1A 1P1TA 3HMJG 3DOKB 1ZTTA 1Y3KA 3ZSVA 5DB6A 3K0JA 4JI2K 1RP5A 3U4LA 3UNGC 3AH6A 2HHHF 5JVHQ 3RMCA 5CZ2A 5LJWA 4CRXA 2CQ2A 3HVWA 2GUPA 4AHSA 4CZLA 4NLCA 3RVCA 3R2DJ 3MR3A 4F3QA 5HN0A 2J7UA 3I87A 5DJBA 3CC7N 3IG1B 5LXYA 5F3ZA 4OPAA 5CD4A 4UBCA 2RB7A 2OTJN 1Y5NB 2QARB 1HI8A 5T41A 4Z4CA 4KR0B 1IBKJ 3ISNC 1KQGB 5KAFU 2QB1A 3KKAC 4OYPA 3NNCA 1OH8A 1XMOF 2B0GA 2A3JA 1RAAB 4WTYA 1OPZA 4X65K 3QAEA 1PBUA 4ZVHA 4MFFA 4M47A 1Z4UA 1LNQA 2IRUA 1RTIB 4UQGA 1RCOB 2N1RA 1RBVA 1UKUA 4P2XA 1F0XA 2JWNA 3VAFA 5AKGA 4BR9A 5AICA 4DX5A 4LMZA 1NDKA 2ZXHA 3SUQA 2QW9A 1NK9A 3A1YG 2XRIA 4FLXA 1KN6A 3QGPA 2M5YA 2YI1A 5D15A 4F3OA 3MDQA 4FN5A 1NGFA 1A7GE 3JPQA 5BYQA 4A8WA 5ALGA 1WSVA 2G2OA 4Z4FA 4F93B 2DGSA 2FMPA 3MN7A 4H0YB 3BSNA 5J2JA 1W25A 2F9TA 3D2FA 4GY2B 5CXTA 2RT3A 1Q7YT 2QWLA 1BWVA 3ETRA 4RQMA 2VG5B 2UUAF 4GO7X 4MFCA 1E6VB 1P8GA 2J0XA 2V2ZA 3L2VA 3KLIB 1PKUA 1YLXA 1PVQA 4TYAA 2DPIA 1LCUA 1IBCB 3N0VA 1SKWA 1DZ5A 5IINA 2BTFA 3IBPA 5C25B 4LF4F 1JALA 4RL1A 5G5HA 3DLGB 2K8AA 3T9ZA 2EPIA 4CEEA 4YMNA 2PY5A 3N4PA 4KHPJ 2KRRA 3L7PA 4AYBC 3UNYA 3BJYA 5DQIA 3ZZRA 2ZIXA 2EVZA 2E5LK 2WSEC 3P5BP 3AA5X 4P72A 2RHQB 2JFKA 4YB1P 3U8XA 4DL7A 2VPYB 3MURP 2EQYA 2M88A 2D9OA 4AHUA 2W9CB 2OANA 1XNRJ 1NGCA 4NY8A 2FGOA 3MPDA 4MK9A 3SFGA 4DV1K 1U1PA 3VTHA 4OD0A 5K4LA 2VQFJ 4DSEA 5DG7A 1WDDA 1EETB 1B7YB 1QHAA 1UW4A 1NGDA 4JI0J 4DCHA 2I9GA 4U95A 1DEJA 2E9RX 1BNOA 1UP1A 3VQ6A 1HNZK 5HANA 3CCQN 4B8CA 4EEKA 3K2PA 1K6YA 2HI0A 4CE6A 1HPZB 1ZQGA 9ICHA 1RACB 4FFDA 1I94J 3TU5A 4IR1A 4NJ8A 1XU4A 4OPKA 3DLKA 4CLLA 4J2DA 4WCEL 3THPA 1Z3EB 4MEYA 1RWKB 4IBNA 1O13A 3Q8UA 1MG7A 1XSNA 3TP2A 4QPXA 1Q7YO 3H3NO 4MLEA 1YTAA 3TVZA 3NGUA 1S3XA 4QAGA 2AQ0A 2Q3SA 2ZBCA 3CCRS 4DCJB 5AK6A 1J2MA 1C0UB 5BYSA 7ICUA 3RF9A 3MX2A 2HHPA 4EK2A 4ELUA 4P4PA 3RBXA 3WK9A 2P9KB 4KLDA 3AL0B 1HHSA 2G5HB 4M6WA 2DNHA 4B08A 4ATNA 3OXFA 5M1QA 4CVNE 4FJXA 5GAHU 5ALDA 1VC5A 4CBUA 4FWLA 1KQSM 3HZ6A 2IOCA 2IJFA 4NM2A 2OEJA 4RQ7A 4A48A 3VA0A 3PZPA 1TYQB 1PAEX 1ESVA 1FRMA 1RGVA 3TOQA 3KD1E 2XZDB 3WUHA 2MHEA 3HKZC 5DDYA 5CWRA 2KJ8A 3UE5A 2XB2D 1A6LA 5E0OA 1SV4A 4LFBJ 2CVEA 2UV8G 2E1RA 2VDIA 3O9UA 1GX6A 5HLFB 1HRHA 3BF1A 1VJ5A 4E1JA 3W5XA 4CF0A 2ZDPA 2G1DA 3W2VB 3IBCB 1ZQWA 3PG9A 3GTYX 5J0YA 4H5RA 5F8JA 1R8AA 7FD1A 3OYJA 1ZC6A 3BO2A 4UATA 1SV5A 4I6YA 2J8AA 2WONB 3LO3A 2BOPA 3WIUA 4QWBA 4OMFG 2XGPA 3NMAA 3R5JB 4B3SK 4I2QB 2GVDB 3OPKA 1VBKA 4OX7A 1TUWA 5E5NA 3ONNA 1CLFA 2MPUA 3PKYA 1K9MT 2HMXA 4OLOA 3TX0A 5I9EB 3FBFA 3GIIA 4WP3A 3HHNB 2PFUA 1ZQZA 2J76E 4DF8A 2UVUA 3MMAA 1FJGF 1FEHA 1IBLJ 4JKFA 2NV3A 5ALSA 2P5GA 1KTVA 1WKLA 2HNZA 1EHWA 2QWNA 4CNYA 1KVBA 1IKYB 5D46A 3RMAA 3EYZA 2FSJA 3OYEA 3NAEA 3EZUA 3MMBA 5AZJB 3OTBA 4DSJA 1PJ5A 4CFBA 4B3RK 1IV8A 2EK6A 2CRLA 3RU0A 2RF2A 2DR5A 2BR0A 4BR4A 4V19J 3M2RA 1ZQCA 4LY7A 4GKKJ 1F0MA 4M3TA 3NGKA 1JL2A 5AI6A 1S77D 1I1GA 3R3LA 2UXCF 2MEWA 3TUZC 4M7YA 3ENHA 1MA9B 2DGUA 3ZZYA 3ORYA 1ZQSA 2GS8A 3UN2A 2OP5A 1A5VA 5EOYA 4Z37A 2EX3A 5A8RB 2PKEA 4R0EA 3C95A 2E7VA 4P4OA 3KK1B 3SMSA 4YHHK 3OTEA 3IWLA 4DTMA 3VN5A 2DH9A 4C8OA 1ULRA 2WSCC 4DR6K 3HP6A 1RCHA 2K89A 2JWKA 3UD3P 5IT9Y 1FNOA 1VQ7N 4XDCA 3H5SA 4NLQA 1VQ9N 3SSRA 2GJIA 4EYHB 1HKAA 2Y0BB 3HVAA 2Z2YB 3MAQA 4LF6J 1N62A 2ZJ8A 3GB0A 5AKZA 3VALA 2QWRA 1VJQA 2BKEA 5AQNA 1KAXA 3LP1B 1T9TA 1XMQJ 1FRXA 2YNFB 4Y2YA 2BRKA 4WK3A 2LP4A 4CZCA 1S9EB 2P5OA 3OYLA 4R79A 3P4UB 2GIFA 1LWCB 2CYYA 1HBUB 1VQOS 3NVZA 3NF8A 4BRDA 3SI6A 4ELTA 4J9QA 9ICMA 1XQIA 1G2EA 2HB5A 3HM8A 3L4IA 5EN1A 2H65B 2BMBA 3V6DB 2AX0A 4YB5A 1HNXJ 2KHVA 4CEQA 2YQ1A 3C14A 1EKEA 2ZH2A 3ZD9A 1RHKB 3TARA 1EWQA 3AQFA 3V6KA 1QJHA 2VJ4A 2VANA 3ENWA 3ZNUA 4G1QA 5TKYA 3LDNA 4R63A 4M3XA 1HWJA 1NCLA 3OW2R 3NCPA 1UPPA 4UUXA 4EGLA 4DX7A 4WK1A 3U1NA 2GELA 1DGKN 4B3TF 2MUTB 4P52A 8ICOA 2F77X 1QAXA 3AJ1A 3AQPA 8ICEA 5K20B 4BQZA 3KBBA 2WVFA 3WBZA 5A0YB 3HD1A 1KC8O 4RU2A 1CJTA 4BR0A 4E7HA 2ZTEA 1CULA 5EE3A 3GIMA 5IT0A 3KWGA 3CDAA 4XIUA 3IHQB 1U1OA 5CAAA 1F9HA 3EKUA 9ICAA 7ICGA 1IR1A 4H5NA 8ATCB 3M1FA 5L46A 1O1WA 4ZCIA 4PRFA 2WCXA 2MKYA 3GJRB 4C8YA 4DS4A 3LPYA 5LSLA 4O5KA 2BJ1A 4C4RA 4E7KA 1NB7A 4FO0A 3TKAA 4AQYK 1KBUA 1Y7PA 3V6HA 2OSRA 3A3PB 1GLCG 1XUPO 1I3AA 2YB4A 9ICKA 3UMGA 5C5JA 1V9OA 1XNQF 3CJ3A 2LECA 5M2RA 8ICFA 3MI7X 5BOMA 4LQ9A 1AZSA 2E2PA 4KGMA 4FPIA 1VRUB 2L48A 7AT1B 2V52B 5HP4A 2BANB 3CDEA 5ALLA 4O23A 3CF5Q 4CF2A 4XH4A 4FWNA 1NJIO 1G1XA 3L4BC 1TZ0A 1X4CA 2ZUCA 2KO1A 1XHZA 2R9LA 2ZE2B 3GL1A 3ID6A 5AM5A 2QEXS 3ZT2A 2I5HA 5KPTA 1KLMA 2Z58B 4CHNA 1ZRMA 1URNA 3J7AP 4DUTA 4CTAA 1HBMA 3J7YU 1N33F 4PCQA 4QZDA 2NYIA 4IKAA 3D5MA 1S5LU 3MEGA 5CB1A 1N0UA 1SWWA 5JS2A 5DM7L 1NGEA 3L7OA 4WFNQ 1AFJA 2Q43A 1DTTB 2AEJA 2OYQA 2R4FA 4DR3J 3RW7A 1YTYA 3HBTA 2FMQA 1VQ5S 3VQTA 2O8FB 5HK4A 4G3IA 5BR8K 4EEYA 4O3OA 1ZBLA 3H0MB 2HMIB 2OMOA 2JVOA 1LWFB 4R5PB 2F9WA 1DFDA 4ZHRB 1JWWA 5AQVA 4TNOA 2KP7A 4C7YA 5EY4A 1P1LA 1U25A 2CVIA 3I5CA 2W11A 1HNIA 5GAEP 1T4GA 3TUJC 5IM0B 9ICXA 3NBPB 3HHLA 4BREA 5J1NA 3IBFB 3QEPA 1V38A 5EWFA 2CGKA 2V5HG 4DQIA 3D1QA 1ZQHA 3B6PA 4FJ8A 2NRRA 3ALRA 1RTDA 3QO9B 4HTLA 3ETLA 3H8WA 3V9SA 3QBWA 4H54A 3THYA 1ZQIA 1MROA 3RJGA 4P0QB 3J7YI 4ECYA 4CEAA 4RJVA 4QWDA 1BGXT 2OUGA 2V8PA 3SNNA 5E3QA 2OZSA 2GWJA 1J2VA 2XMUA 3RJKA 4CJQA 1SKUB 3PYGA 2E9ZA 2HGMA 4E1MA 3NRZA 3GIRA 2AW0A 1WACA 2ZJRL 4QYZJ 5AXLA 4IFEA 1NDPA 3KG0A 4ZIVA 3M1VA 8ICWA 3NKYA 2P9IA 4UQTA 4YMOA 3J7ZT 1SQGA 2KDOA 2EW9A 2IGIA 5DGAA 5D4BA 1MWKA 3A2FA 1YRXA 2R2SA 2JLGA 4LFCJ 2CPIA 3KDNA 3K0SA 4U7UD 1B92A 1VQMN 3CQ8A 2ACMA 4C80A 1M5SA 3PYEA 3DXMA 2FB0A 2XI2A 4BLGA 4FM1A 4CJ4A 1BPEA 2AJQA 5KFVA 3ZTPA 3A5MC 5J1EA 4H4OB 4MIBA 3HZEA 3CWJA 4GVMA 3EGZA 2MY7A 2ROGA 1HBOA 5C24A 2OZMA 2JC1A 5F0WA 4DUZK 2E3TA 1S9GB 5JMNA 4CWBA 2FBVA 4EMDA 4X4NA 1KS2A 3ZCMA 4QW8A 1IG8A 4CH1A 3V9UA 1UEKA 2CQ3A 2F3NA 1FDDA 1PK1B 4JI5F 1JUDA 2P9UA 3A0HU 2IHR1 2ZZTA 2A2DA 3BZKA 4EENA 4C8KA 3NOGA 2OPRA 2PA3A 1T9XA 3O44A 2QXFA 3KIOA 4CERA 2YNHA 3J81Y 4CQ1A 1KXPA 2AP6A 4ZCLA 2HHQA 2IVPA 3U26A 3AXMA 1FK9B 2MKJA 4KGVB 3C0BA 4MEXA 1RABB 3DAWA 3EVOA 3N4MB 2V34A 4XPCA 3CJSA 3KLGB 4OKJA 2V94A 3RG6A 3KJQB 5DQHA 2FZGB 3VTIA 2XMMA 3DI6B 2O8CB 3Q83A 4KX5A 4P2HA 3ILIA 4M9HA 5AR0A 1CS4B 2CZVC 4QIVA 2MKSA 5A76A 3BS5A 4F02A 4KB7A 1WKKA 2R7WA 1P9QC 2XYGB 3NWGA 3QT6A 1WORA 5KNIA 2RRBA 3FZBA 1YI2S 1EO1A 3P83D 1R8PA 3DGPA 4DOAA 2J7WA 3CFRA 2XMTA 3ZT0A 2ASPA 4KHPK 4KB0A 2KHCA 1HKBA 4F50A 3M8PA 3JTPA 5ETKA 1ZAVA 2Y9HA 2KIWA 3EVMA 3SCJE 3MN6A 4A59A 3AJDA 3CMEN 2KSOA 1S0NA 2K4IA 1IBMF 3MOJB 1XEZA 4FYDA 4YOWA 1HJPA 3BPSP 4Y2PA 3D6JA 4ZITA 1XNRK 8ICRA 1GXUA 4J2AA 3OFEA 4EHUA 1GO3F 1K44A 4ZH4A 2DRBA 2GX8A 2W40A 4AL6A 3E8OA 1T05A 4ILMA 1JMTA 3TW0A 5AZIA 2RD5C 3POTA 2ZJQQ 2NNWA 3ZSXA 2ZH6A 4BG9A 2UUBJ 4JI0K 5KFJA 3RAXA 2PMZD 3LM9A 2HURA 2ZOGA 4FE3A 4YR3A 3SFUA 2DR6A 3TAQA 3SSQA 2L08A 5U47A 4M9GA 1FFVA 3THWA 3TVYA 3LUYA 4F9OA 3JPRA 1N32K 4FJIA 4E98A 4DV6J 2DWQA 5KG7A 2RRDA 4HH0A 2DH8A 2F8LA 1UVIA 4ECWA 3ZDAA 5HBMA 4WU3A 3ZZUA 1RAGB 4HVJA 3KG4A 7ICLA 5F9NA 3ZFVA 4FLTA 4UOCA 3PR4A 6AT1B 2DIUA 1U4BA 5I3QA 4EWTA 1SGGA 4FK0A 4JV5J 1HWIA 4OYWA 4DX6A 3AY0A 3G8QA 4NLZA 2KI2A 2HBMA 2M3DA 2XMJA 3FUYA 3NH2A 1NLVA 1BDGA 3NMUA 4KHMA 2VF3A 1SH2A 1PG5B 2W01A 5IQ6A 4LFAK 3A12A 5D3GA 1JIHA 3FCHA 4CD3A 2KH9A 1JRPA 4IOAQ 4YQWA 1RT3A 2YKQA 1WELA 4LVNP 1RT7A 2M0NA 5B5EU 1UWAA 3WNGA 3SI8A 3NGTA 2A1BA 3MR6A 1KVCA 5F41A 3RRKA 3ZZZA 3W8PA 1U48A 3UQSA 3QU4A 4LRBA 4Z6CA 5AKXA 3AXKA 3KJFB 1WWVA 1MNEA 3TNVA 3UDEA 3R6MA 1B0VA 4OX9K 4OX8A 4I27A 3OXGA 4FLYA 1HEKA 2W42A 2ZIWA 4PKDB 2O3DA 3BGOP 1GMWD 3MZIA 3QERA 1NKBA 2P2CB 4Q0BA 5HR6A 1FHTA 4JV0A 5C2GA 5IOLA 2P9PA 3D2FB 5J2DA 3AEVA 5HMWA 3MM9B 1U09A 2G4BA 4JI6K 1HQUA 2M52A 2ZC3A 4WU2A 5LJ5Y 1F5AA 3QYPA 2NSCA 2CNNB 3NFAA 3CD7A 4ERDA 2NRTA 3UMCA 3MX5A 2R7QA 5J2GA 4A8EA 4C11A 2Z2MA 1XERA 3T1HF 5C7PA 5KG1A 4G6VB 5HSPA 1AB8A 5C12A 4XUSA 2ZG6A 1MA7A 5E41A 2ZBRA 2CPRA 3VV2B 1REGX 1PYSB 4LF5F 1DXSA 4F8RA 4MKVA 2ZGYA 4PPZA 4FJJA 2AF6A 1B9DA 1YWXA 4JI2F 5GAEU 5A8KA 2CQ1A 1Q18A 1SWVA 2I6XA 4WXOA 1UA1A 2QLTA 1FVQA 2VKRA 1SL1A 4A4JA 2UUAJ 4A57A 5AKIA 1ZQBA 2B3TB 3R5GA 1FE4A 2DF4B 2YN4A 1BPDA 1YVUA 4QZ9A 1KLNA 4EBDA 4XA5A 3MWBA 1KFDA 2DNYA 4TY8A 4MO4A 3SV3A 4GKKK 2KFNA 5H1SV 1BVSA 4CZIA 4NCBA 1J9AA 4CHQA 3UKRA 3MAHA 1EQ0A 4G1IA 1HNWJ 3OT9A 1XHXA 4FPAA 4QZFA 4CBWA 5LMUK 3OJUA 4RT3A 1AXQA 3JSMA 4MTPA 2CRXA 3QZ7A 1OS5A 3LZIA 3DDKA 4JK8A 4ICLA 4USHA 1ICEB 4U96A 4YN4A 4XO0A 2BX6A 4DS5A 3M2VB 4KAIA 4NMXA 2BW7A 1Y11A 3GIJA 2Z1HA 4ZLLA 2NPIA 1DK3A 4YDXA 2OTJS 2X74A 1QQCA 1FD8A 4UY85 2FY8A 2BHNA 5C10A 3VOVA 4NRTA 4NLDA 1S57A 1OYDA 3MWTA 2BW2A 4KKOA 4YMEA 3LPUA 4JKCA 4IDKA 2Y8YA 3CJKA 1COKA 2O8DB 4PPDA 1XMQK 4CF8A 3DLKB 2KVSA 2FHOB 3AMZA 3TQ1A 3HFZB 2DO4A 4NLXA 2BE2A 1ATSA 2Z1IA 2Y1IA 4MFAA 3MM7A 3E0FA 4JYAJ 4CEDA 1DLOA 2WVCA 4ZPBA 5LT5A 4MK8A 5CZ1A 4KMOB 1VIXA 1V4SA 1HNXK 1LFPA 4C48A 3W63A 3VGLA 2ZJPL 1J2NA 3VAMA 3M8SA 5KTQA 2KIVA 5AQGA 9ICUA 3OSNA 3FZ2A 4CLUA 4M6WB 5KQ8A 4BE1A 1D8ZA 3CIZA 2P9SB 3QGIA 4DV0J 1S1WA 2XS5A 2DFFA 4JKAA 2Q97A 1YHQN 2GQ2A 3QRQA 1JNRB 7FDRA 4DV2J 1SXDA 3BEGB 1N36K 4YY3K 1RYUA 3I9ZA 2MKHA 2MB0B 4JI8F 8ICIA 1ZQRA 3D6TB 4DUYJ 2Y3YA 2DBYA 3HWTA 4DTXA 3MWPA 4Y2JA 1VS3A 4UTGA 2X1AA 2WW4A 4NXMJ 4FWSA 3A5NC 1X4AA 4DTNA 2MLYA 2ZM6F 1NUEA 3CIMA 4AL7A 1WTBA 3M6VA 4ZP8A 3K1ZA 4EIAA 2E5SA 1X4EA 2WTUA 4F4ZA 3IC1A 1D09B 5LMNJ 1HL6A 9RUBA 4JI4K 4BRIA 4EZ9A 2CGLA 2E5LF 1SQEA 5CJ7A 3NOCA 3NL0A 4LH5A 3LPTA 2K1RB 1U8SA 1SV5B 5ALTA 1FTRA 3O2IA 3O8WA 3T69A 3M9OB 2ZH4A 1Y64A 3K1RB 1HI1A 4RWTA 2JL9A 3EXYA 2AXTU 2KG5A 3TPQA 4FZNA 2G0JA 5BREA 3BH6B 4FWOA 1VQPN 1WG8A 2E1EA 3GPAA 1QS4A 5KFUA 1AQ6A 2M2BA 2PBDA 4I2EA 2LXFA 2IDOA 1UT8A 4DLEA 3MMAB 3CJ9A 2XICA 1X4HA 4C97A 2CADA 1GLAG 1ZBFA 4TYBA 3E9PA 3EICA 4IS7A 3ZSQA 3NG8A 4DR4F 2KKVA 2DITA 3HKZF 2DD8S 2X3DA 3KJNB 1NHKL 4OPJA 4AXIA 1RBTA 4OZJA 3I28A 1RBLA 1R6YA 1LWEA 2IM3A 3GDXA 3H8YA 1WI6A 3CNHA 4BC9A 2HVHA 3DDNA 5AJ3K 3M2RB 5G4DA 2CWXA 2WF5A 3CCQS 4M9LA 4Z6EA 1SUQA 2PEHA 3LDAA 4PUOB 3HHDA 4N41A 4A61A 4I6AA 4H5VA 2OPPA 1WWUA 1VBXA 5AQRA 2F1FA 3UMBA 3OXLA 3NUQA 3CJ0A 3LDOA 4EHTA 4OYZA 1SIJA 5BN8A 4AHRA 4K4IA 2AYEA 3FNNA 2Y9UA 3WKAA 2FI1A 2MZJA 1N2XA 3B0XA 4XDDA 3EPGA 2MKKA 2XNQA 4CZJA 4P9SA 2GQQA 3CP8A 4K4HA 1ED1A 1FXRA 2YPZA 2HBRB 3RB6A 3I96A 2W4CA 5ETPA 5A2QO 4ECSA 3AVAA 1RZTA 3OTOF 1J6ZA 3WIVA 4X64F 2LU1A 3JXUA 2FD2A 4WZQA 1RT4B 5DKWA 2KVQE 4LF9F 1ZQKA 2G5IB 1NGHA 3TAMB 5FLXY 4FCYA 1NI3A 2AKWB 3LM2A 4N56A 2YMQA 4CJSA 2OYYA 2DJWA 2JLFA 2DKOB 1WHWA 4JKDA 4WCEQ 1C7YA 5J1PA 3MD1A 2ZF5O 2FYXA 2ADBA 1BU6O 2YQ3A 1VSLA 1X9JA 5EOZA 3MECB 3BGRA 3Q2TC 2HQFA 2XI9A 4KN4A 2HIYA 4O0NA 1RHJB 2H3VA 2OELA 1NMNA 3I1YA 3C14B 2CN1A 4U9RA 1QUPA 4FOEA 2Q31A 4BVPA 3CJ4A 4DFDA 2DNQA 1R7IA 2RQ5A 4I1TA 3VAKA 1QSYA 4Q5VA 1U1QA 5KL1B 3OR2A 3H5YA 2H4WB 4G1QB 2DNKA 4B3SF 1L6NA 4G65A 4FLVA 1X40A 3FLCO 3KHGA 1T3NA 2YKOA 3H2LA 1EQYA 5LL6d 1HMVA 4IQMA 2HBLA 1UW9A 2XY5A 3QNOA 2E5GA 4LRAA 2K8CB 5D4LA 2Z57B 4X4OA