2HVKC

Crystal structure of the kcsa-fab-tba complex in high k+
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab heavy chain
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hvkC00
3R65A 2EINC 1S5HC 3F7YC 2P7TC 4PDVA 3SPCA 5B3SC 4PA4A 1J95A 2X6CA 4MVZA 4GX1A 2WLIB 2DWEC 4ZBMA 3RVZA 3STLC 2R9RB 1R3JC 2WLJA 2YEVA 5J9PC 4MS2A 4P2ZA 3K0GA 4MW8A 3SPJA 4R6ZA 1OCCC 4PA7A 2ZXWC 4X8AA 3K06A 4EKWA 3K0DA 3OR7C 3T2MA 4HYOA 4MVOA 4PDRA 3SYPA 5CBGA 1ORQC 3K03A 2K1EA 1QLEC 2EIJC 3EFFK 1R3IC 3AG3C 4GX2A 2WLNA 4TWKA 1XL6A 3WG7C 5KUKA 4RUFA 3SYQA 2NLJC 3ABLC 3FB6C 4MTGA 4R8CA 1OCZC 5IY5C 4P9PA 1R3LC 5E1AC 3ZJZA 4MW3A 4H37A 4F4LA 3RVYA 1ZWIC 2OCCC 4UUJC 1BL8A 2X6AA 4XDLA 3UM7A 1G4YB 3SPIA 3K04A 2ITDC 3E89A 2Q6AA 2IH3C 4MTOA 2DYRC 3IFXA 2WLLB 1OCOC 4PA9A 4WFEA 3LNMB 2A79B 4JTCB 5KUMA 4J9ZB 3SPHA 4WFGA 3ASOC 2HVKC 4MSWC 3LDEA 2A0LA 4P30A 1JVMA 2Q68A 3E86A 4G28B 4MVSA 4CBCA 4RAIA 3ZRSA 5EBMC 3FB8C 5B1AC 2IH1C 4WFFA 3PJSK 3JYCA 1K4DC 2BOCC 3K08A 4H33A 2ATKC 3E8FA 3F5WC 3GB7C 1LNQA 3TCUA 3KG2A 3SYAA 4QE7A 3UKMA 2BOBC 3OUFA 4PA3A 3FB5C 4OXSA 3BEHA 3OGCC 5EBWC 4G27B 3E8GA 3IGAC 4HZ3A 1R3KC 4P9OA 4QNHB 1V55C 4RUEA 2DYSC 2HG5C 2DWDC 3SPGA 1K4CC 3SYOA 4MVQA 2QTOA 4JTAB 1M57C 3TETA 5B1BC 2WLIA 4RO2A 3OR6C 5EC2C 2KB1A 2WLMA 4MTFA 3HPLC 2X6BA 5EC1C 4J9YB 3RBZA 4PA6A 2HVJC 1V54C 4LCUC 4X89A 2EIKC 1XL4A 4X88A 3T4DA 1P7BA 2EIMC 3E8BA 2W0FC 3AG2C 2HFEC 2ZD9A 4XDJA 5EBLC 5EK0A 2WLHA 4QE9A 3SJQC 4LP8A 5CBFA 2QKSA 1OCRC 3AG4C 3LDDA 2ITCC 2Q69A 2JK5C 3ABMC 3E83A 2AHZA 2H8PC 4R50A 4XDKA 3E8HA 5BZBA 3FB7C 3LUTB 4BW5A 2Y69C 4DXWA 4GX0A 3X2QC 5CBHA 2EILC 3ABKC 3LDCA 3F7VC 4I9WA 4MVRA 2HJFC 4PDLA 3RW0A 1KKDA 4MVUA 3T4ZA 3SYCA 3VOUA 3ASNC 3OUSA 4R7CA 4PDMA 3STZC 4JTDB 2WLLA 4WFHA 2AHYA 1M56C 4GX5A 4KFMA 4MVMA 3AG1C 2Q67A 2WLKA 3T1CA 2A9HA 4LBEC
chains in the Genus database with same CATH superfamily
1S5HC 1QCEA 4MVZA 3JD4A 2Y4TA 1BMFG 3W7XA 2B9ZA 1HW7A 2JGDA 1QLEC 3WG7C 1R3IC 2ZCEA 1K33A 5J2TA 1N8RW 3ASOB 3ZJZA 3ZCCA 1GMGA 3QF7A 4L87A 4D7SA 2OCCC 3MHHC 5HFLA 1VF6C 2EIMB 4O4HA 5KHKA 1W59A 4OPHA 4DV6O 4DR4B 4TV9A 5LBQA 1T5EA 2QA4V 1FFXB 1JVMA 2ARHA 1VEWA 2VQFB 1RM1C 2HP8A 2DQ3A 4DW1A 2LP7A 1PKXA 5H9CA 1LNQA 2AZ2A 3WFVA 1SA0A 4OXSA 1XMOB 1R3KC 4DV7B 4U7NA 1GO3F 1YTFB 4DR1B 4X64O 3B8MA 5TISZ 4EB6B 4JAVA 5KMGB 1P7BA 1SC5B 4TV8A 1NS1A 1YJ9V 4J80A 1QLEB 3WG7B 5LOVB 4UCVA 1Q5OA 2Y0PA 1OCRC 2IJKA 1GM9A 2H8PC 1MABG 1Q82W 2OCCB 4GX0A 4LFAB 1RPRA 2V1DA 4J41A 1GTOA 3CRQA 1KKDA 3HKEA 3SYCA 3OW2U 4NXMO 1OCCB 1FAFA 2QWRB 4JI3B 4O4LB 4E2LA 2WLKA 1YSCA 2CH7A 2QE7G 4YIPA 1WJZA 3CCRV 1J95A 1HP8A 1SF9A 1HNWB 3FX7A 2RMKB 2R9RB 3APQA 2IU3A 2YEVA 5FPRA 2PYLA 3L71H 4TOIA 2Z3YA 1B06A 4EKWA 4LF9B 3WB1A 4ASUG 3E35A 1NH2B 2BTOA 3ML0A 3CEIA 2QR4A 1FFTB 3CXCU 3H1JH 2PZSA 1XL6A 4X66O 5LYJA 1N32B 2KSDA 1R3LC 4NTWA 4UUJC 1AJPA 1F23A 4IGGA 4DV5O 4F6RA 5L3BA 5CA3A 3L75H 4WFEA 1OCRB 3DC6A 2VRZA 3E86A 3IJ4A 3P3NA 4CBCA 1EZJA 1NVPD 5EYPA 1R73A 1Z5VA 4X20A 1QBZA 4KHPO 3ZN0A 1DTOA 2E76B 2PUSA 3GVMA 4GYCB 5CA0B 1XUQA 2XOKG 2JEXA 3P30A 3ZEDA 3ZN1A 4FM1A 1KYOF 2G38A 2VWKA 5B1BC 1K3EA 1F7YA 5EC1C 4AILC 5KX5B 4PA6A 5DEDA 4X88A 1H8EG 2Q73A 4QPJA 4DR6O 1I94B 4QE9A 1NR7A 4LP8A 4FM2A 4GUNA 4G2KA 4FPPA 3E83A 2QKCA 2F43G 3G67A 4FLVA 5DM6V 2GBOA 1IBKO 4KUMA 5ITZA 4JYAB 3JARB 4JAUA 4KP4A 4WFHA 2AHYA 2GTSA 3DSQA 2ATKC 3MD0A 5BY1A 3FKSG 3T1HB 3R65A 2EINC 3SDLA 2YDEA 3JAKA 2XT9A 4MW8A 2X0LA 1N4CA 1QU7A 2YI9A 4HNAA 4W4LA 3OR7C 1DGSA 5LHHA 5IYZB 4UVCA 2P6JA 2EIJC 5KUKA 4DV0B 5B1BB 1AI7A 4HAMA 5LP6C 4X62B 2MW2B 3E2EA 4F4LA 3ZRWB 4UFZA 3LSQA 1G4YB 3BVOA 3U0ZA 2A3QA 3ZHTA 1XDCA 5BXZA 4NR1A 1TVKB 1N36B 1QR9A 4YY3O 3TXSA 1LR1A 4B3TB 4GT1A 4Z1MG 2YS8A 3PJSK 1I08A 1KB9F 2R70A 5IYCO 2W0XA 1I5YA 4IYIA 4QE7A 1W2BU 5KAFZ 3TJTA 2EINB 2LW7A 3IGAC 3RFRA 4MVQA 3H1HH 2JIZG 2QJ1A 3Q4HB 3JAWB 5B1NA 3S3WA 4JYBA 1TUEB 2XTAA 5EIBC 1BGYH 2FYUH 3RN4A 3L72H 3H1KH 1H2MA 5CB4B 4QPKA 1CXZB 3CCVV 4E4EA 2ZM6B 1PL4A 2IBZH 2VQFO 1M56B 2Q69A 5LP6B 3E8HA 2C2AA 5JVDB 2OTJV 3X2QC 3OTOB 3L74H 4O2BA 2UU9O 5JQGA 3ASNC 4R7CA 1J5EB 4YJ3B 4DV7O 5B66Z 2UUAO 1TGOA 4KFMA 4DR1O 4MVMA 4LF8B 3U11A 1MZEA 2BCCH 1SZTA 1IXBA 3OMNB 3HKDA 2R9IA 1AROP 1FXKA 3L9DA 1QVFU 3SPJA 4Q6GA 4I0XB 3ZMVA 1Q81W 4JI4B 2ILMA 2NNUA 3UO2A 1XI1A 2A7WA 2IU0A 1G8MA 4NTXA 2F23A 4H37A 2X6AA 3OM3B 4UXNA 4X65B 4XBFA 5LXTB 1BHAA 2ADPA 2Q6AA 2QM8A 4IIJA 3LNMB 1WPBA 4I4TB 5JJJB 1HNWO 2RCVA 4UVAA 2AGAA 5EZYA 4JI0B 4O4IA 5KA5A 4J7ZA 4BR6A 4K8XA 1D5NA 1V9PA 3B2EE 2ZE6A 3L70H 4PA3A 1YHQV 1N32O 3D36A 4P9OA 4RUEA 3M7MX 3SPGA 2YI8A 4YIOA 3LSSA 3CRRA 1NVPB 2WLMA 1GN6A 2P90A 4J9YB 3RBZA 4FLZA 4CC6A 1YTFD 4X89A 1XL4A 3T4DA 1LUVA 5JH7A 4WFAV 1I0HA 3K9SA 1WNSA 3KCYA 3CMEV 4LF7O 1B6QA 4U3JB 1AVMA 1URFA 1D2DA 3OFNG 2AHZA 2VS0A 4J7JA 3HKCA 1M4UA 4YJ2B 2Y69C 3N27A 1OHHG 4QGPA 2YXLA 3CSXA 3ABKC 1E1QG 4O4JA 3GWOA 1K92A 2QWQB 4JTDB 4J10A 3ETQA 1KQSU 3VQVA 4WBNA 2GV9A 3JAMN 2WWWA 3JALB 4LBEC 1H2LA 2DQ0A 1QLNA 1U97A 1AJNA 3ABLB 1YXBA 3B77A 2VWJA 1XBLA 2EULA 3CJHA 2Q7HA 3OTFA 1OJHA 3BA8A 2JJ1G 3CYOA 2GTAA 4JI8O 5GONB 1ORQC 3OMIB 2OYQA 2JVDA 1FS0G 1BHBA 1NH2D 3ZMSA 4O2AA 4JYAO 3ZHSA 3UT5A 1BL8A 3B40A 4JI1B 1SZXA 4LNUA 3K9AA 3T1HO 4LFCB 1YJNV 4PA9A 2XASA 4ZOLB 2A79B 3FYIB 4JTCB 3HB3B 1KD1W 5KUMA 3SPHA 2YIAA 2D3OW 4MVSA 2P4VA 4ZHQB 2BTQA 2UUCO 3ABKB 4YXWG 3CPWU 4JI7B 1WAZA 2GUZB 1PP9H 4DW0A 3TCUA 1V54B 4DV4O 3OUFA 2RDCA 4PV1B 4HZ3A 4X62O 2HG5C 2P06A 2RN9A 3AG4B 4DV3B 2QSAA 4J11A 4X1YA 3TGUH 1GM8A 2ADQB 5JJNB 1FFXA 1N36O 2ODMA 2DE0X 1H2GA 2IJJA 4R50A 1WN7A 2HJFC 1Y74B 2WA4A 3OUSA 5BMVB 1JPXA 1M5IA 4GX5A 4HBNA 1P84F 2OIGA 2A9HA 3CWBH 2HHHB 2P7TC 4PDVA 4EB6A 5B3SC 1S0VA 1WPXA 1SERA 1RPOA 2DWEC 2WLIB 3A0HZ 3RYHB 3RGBA 2UUBB 4LF4O 3BFRA 1Z2GA 3G6EV 2ZXWC 1DF5A 1Y76B 3K06A 1P7GA 4UCTA 1HNZB 4U3FH 2E5LB 1MZFA 1VQ8V 1JFFB 2WAMA 3AG3C 1XHXA 3CHXA 1OCZC 3ETDA 1AILA 1FXVA 2Q0OC 4B3RO 5LMNB 4X1KB 3K5LA 2FMLA 4GKKB 3CC4V 2JDIG 2F4VB 4RAIA 5LA6A 1Q6IA 3CC2V 1F4MA 5KHGA 2LFRA 3B09A 1K73W 3JCUZ 3F5WC 1OZ0A 1BQZA 3GB7C 2R72A 1BT8A 1EM1A 3DC5A 3CC7V 5B3SB 4UVBA 4X65O 2GHYA 5IWAO 2N05A 2ZE7A 1GN4A 1L0NH 1NTZH 1H2NA 4TT3G 1F4NA 2W0FC 3ZMUA 4JI0O 3AG3B 1KC8W 1BQ0A 1OCZB 3AG1B 4JZ2A 3ABTA 1W0KG 1AI6A 1OV9A 3UO3A 2H3OA 4PDLA 4DV2B 1KECA 3K79A 1SQGA 4CS3A 4FLXA 4DRXB 1NBMG 2WLLA 3CRCA 5LGTA 4FLYA 5J2UB 3CCSV 1NR1A 4GX1A 1XMQB 1GRJA 3BABA 2CTWA 4DR2O 3WB0A 1H2SB 2Y0IA 2N04A 4EEQA 2PF4E 5H6QA 2ZINA 3T1YB 3T2MA 3TXQA 4PDRA 1NTKH 3CS5A 5CBGA 1VP7A 1IURA 1N0NA 1HNXB 2O57A 3MDSA 4MW3A 1GN2A 1B04A 1NZ6A 4B3SB 1SETA 1RM1B 2UXDB 3E89A 2IH3C 4MTOA 5EIBD 2DYRC 1E1RG 3N2GB 3S3XA 4PI2A 3VQWA 4WFGA 3AEIA 4UCSA 2ZT9B 3RWRD 4LF6B 4X1IB 3W7WA 5DN6G 3FB8C 1KUQA 3JYCA 4LH6A 5IJ9A 2IJHA 3J81N 4DR7B 2CDYA 1PV0A 1S5LZ 4AQYB 2JGDB 3IC9A 3C90A 1K4CC 1QVGU 1NT2B 2UXXA 4JI6B 1XNQB 2YC0A 4JI1O 4LFCO 1GK9A 2B1IA 3ETGA 4LH7A 4O4HB 1K5QA 2EIKC 1O9GA 2OT5A 4TV9B 1SS3A 4I50A 3ABMC 3J7AU 1X4TA 1JR9A 1VQ5V 1VQLV 4JGSA 2XHBA 1QQCA 5CBHA 2OWOA 3F7VC 3L73H 2QGNA 1JJ2U 2Q7GA 2QM4A 5GTIZ 1X59A 3JAWA 2Q67A 4DV3O 1TUBB 4K0KB 2ZNJA 3RVZA 2YIBD 3STLC 4NXNO 3JASA 3LSUA 1TAEA 5CB4A 1PD3A 1SQBH 1WB8A 5D5QA 3ZRXA 4TV8B 2EJRA 4PHZA 2XAQA 2UXBB 3SYPA 1ZAUA 5JVDA 3SR2C 3FB6C 4B7KA 4R8CA 3H01A 4P9PA 1VQ6V 4J7KA 4JASA 4TUYA 1NTMH 4YJ3A 4TQDA 1I5XA 2WPDG 1SQFA 3BY6A 4KL1A 3AK2A 2XAFA 3ABMB 4BIZA 4I0XA 5B1AC 1HNZO 4WFFA 4CH6A 1YI2V 4JI2B 1IX9A 5CA1A 4DV1B 1Q90D 3QTCA 1DK1A 4H44B 1M9NA 2H94A 1XEQA 3N2KB 1AR4A 4BAYA 4H0LB 4AI8A 3KKYA 1GN3A 2QDOA 4CH3A 4BIUA 1XILA 3A0RA 1PM9A 1PPJH 2LGQA 4L8JA 2HVJC 1XNRB 3HKBA 2Q8VA 4F6RB 2CTRA 1N34B 1WA8A 3LDDA 2BSKB 4D7TA 1AI5A 1O9HA 3RYIA 2JS5A 4X20B 3KCXA 3H1IH 1Y67A 4DR5B 3FFQA 5L3DA 3M99B 5C8YB 1FD9A 3G80A 4MTXA 3IAYA 2LW1A 4DR4O 5E79Z 1R6NA 1FJGB 2EIJB 2KG7A 2LQTA 1YITV 5J9PC 4JV5B 1NJIW 4DUZB 3JD0A 1XMOO 4EFBA 1EN5A 4CZZA 4IHJA 2DW4A 3ZHUA 4GKJB 1EN4A 3AK1A 1GM7A 2R9AA 1IBMB 2FKXA 2QTSA 1PNMA 3OD4A 2UXCB 5ITZB 4YHHB 5LHGA 4WF9V 4FVMA 2B5UA 5FNVB 3ABUA 1XMQO 5B1OA 3NR7A 1IZ3A 3I55V 4J9ZB 2HVKC 1NI8A 4G28B 1B3QA 4CS2A 2JJ2G 4LFAO 4UCRA 5LMUB 2CGOA 4HNAB 1JJOA 5GONA 1AP5A 3KG2A 3SYAA 3PN1A 1HNXO 4JI3O 1A32A 5JCOA 3OGCC 5IT9N 3K5OA 3UCSC 2EX3A 2DWDC 3SYOA 2AXTZ 4CS4A 1BE3H 4K3AA 2X6BA 3DTUB 2HR3A 2PTMA 1MA1A 1R1BA 1Q6HA 4LCUC 1VIBA 3X2QB 4LF9O 5KLVH 3EXAA 1VQMV 4DV6B 4JAAA 5IYBO 3IC7A 1K5SA 3ASNB 4LF6O 4LWSA 4IYHA 3RYFA 2ZKOA 2GUZA 1FXKC 2QWOB 3VQYA 2ZIMA 3QO5A 4I9WA 4X9QA 3T4ZA 2XAHA 4AQYO 3AK3A 2RJZA 4JI6O 4DR3B 1MSWD 1WLEA 4X64B 4P2ZA 3JD3A 4BW9A 3K0DA 4TSFG 2ZE8A 4MVOA 2ZR2A 4H13B 1IXMA 1AP6A 4NYKA 2Y48A 3O9OA 2EZOA 2NLJC 2CGNA 1W0JG 2V7QG 2BE3A 5IE9A 1HR0B 3UM7A 4A5UB 3ZIAG 5JQGB 3SPIA 3K04A 4NXMB 3SJCC 5JWPA 4ZI7A 1ZL8B 5C93A 1I94O 5A2QN 4K0KO 1SKVA 3D36C 1YEWA 2JGUA 3LDEA 2YXHA 3HKDB 1FXKB 1Y76A 3A8TA 5EBMC 1NQTA 5DECA 3P3PA 1MG1A 1VQOV 1WP8A 3BEHA 2ZDIA 3FAVB 4DO2A 1V55C 4X66B 3W7TA 5LGNA 4GLXA 4JTAB 3TETA 2WSSG 4RO2A 3OR6C 4N21A 2Y69B 1VQ7V 3E8BA 2ZR3A 4DV5B 1YVWA 3AG2C 2HFEC 5F2VO 2ZD9A 4I55B 1RSOB 5EK0A 1FXHA 1BSMA 4JI5B 5EZYB 4DV0O 1AR5A 1YIJV 4DXWA 2N74A 5CN0A 2B1GA 3RW0A 4EFEA 4MVRA 4KHPB 2Z0AA 3JSLA 1BZKA 3ZMZA 1VMGA 3VOUA 4PDMA 3RYCB 3BHPA 2YSUB 1FYJA 1VF7A 3KZIZ 4LF5B 5KHIA 4PD4F 1KP3A 2CK3G 2F95B 4PA4A 2EBOA 3DXRB 3GWKC 2WLJA 2OCHA 3ZX6A 1F51A 4B3TO 1H38A 1AJQA 4R6ZA 5FPOA 1Q6UA 1N34O 5JH7B 1ZLZA 1L0LH 4ICGA 1PNKA 3K03A 1D5AA 3HKCB 4DR5O 3CRMA 1NU1H 3SJAC 1KKCA 2QM7A 1IBLB 3ZHVA 1H2KA 2NN4A 2GSMB 1IBKB 2YUAA 3VQXA 1R6KA 3A0BZ 5KMGA 1KMIZ 2IJIA 5J2UA 2IM9A 1U96A 4CC5A 4GCZA 5LOVA 1DLBA 2ZM6O 1DF4A 1HWYA 1QR8A 3M8AA 2E3CA 5IJ0B 3ASOC 1GAXA 4P30A 1JX9A 4JV5O 3ZBHA 4ABMA 2ETNA 2DN9A 3K57A 3BCCH 3OTOO 2VQEB 3B8NA 1VF6A 4DUZO 2BOCC 3E8FA 4QJFB 3CJHB 4NKGB 4Z1VA 5H6RA 3LNNA 1J5EO 4RQEA 3K58A 3FB5C 4WCEV 5EBWC 2FTKA 4LF8O 4G27B 3E8GA 4O4LA 4GKJO 4FFBB 4UB8Z 4DK1A 4FMTA 2CTPA 4O2AB 2L6LA 3H9VA 4YHHO 3N2GA 1GKFA 1AI4A 4LNUB 4JI4O 3JATB 3E22B 2QKSA 4X1IA 2ITCC 5LMUO 1E79G 3HR0A 4YY3B 4UV9A 2BTQB 1XREA 3UQ8A 5A9GA 1M90W 2XAJA 1RFYA 4JPRA 2QEXV 3CCUV 2ZXWB 3QO8A 1PNLA 2Z5UA 1K7DA 1L1FA 4W4KA 1RP3B 1ZSPA 1UJWB 3K0GA 1SQPH 1JCHA 1OCCC 2P22C 4RQFA 4X1YB 1EBOA 4FFKA 4HYOA 5CA0A 3U10A 3CE2A 4K35A 4JYCA 4UCUA 4GX2A 5AG2A 3QG5A 1P4RA 1Q43A 1Y4MA 1JQ0A 1XQ8A 5FL7G 5L3CA 5KX5A 2HLDG 2YICA 2UU9B 4UB6Z 3APOA 3W7SA 4DR3O 1JA8A 1OCOC 1ZUQA 2UUAB 3D8CA 1TUBA 3WB2A 5H2FZ 1XHZA 2IH1C 1Y66A 5LL6Y 2F1MA 1N0JA 3CCMV 1YCIA 2JRIA 3JARA 1ZX3A 2DYSC 2JS3A 1HR0O 2ZE5A 1M57C 1K8AW 4MTFA 1TA8A 1EN6A 3CCQV 1KU9A 4JYYA 4LC1A 1VQNV 2DOSA 5EBLC 4XDJA 5IYZA 4I9QA 2Q5ZA 3CCJV 1G1XB 5IYDO 5LA6B 4B3MB 2HJDA 1VQ9V 3SGIA 3ZRWA 2NR5A 3LDCA 3N2KA 5J2TB 1VF5B 2QKAA 4ZIBA 1OCOB 2PGGA 5D5PA 1YZBA 4F6EA 1TVKA 3F7YC 2EJ7A 2X6CA 2HKOA 3MAQA 3OT7A 1N33B 3D3QA 4JI7O 3CXHF 1SQQH 3CCLV 1WB7A 1VQKV 4JI5O 2QWNB 1THZA 1QHTA 1BCCH 1SESA 2Q0AA 2CAZC 4LF7B 2BSKA 2DYSB 2DYRB 1M57B 3K5MA 1SA0B 3MHSC 4MTGA 1BS3A 5L3GA 1Q3EA 3Q4HA 5C8YA 3RVYA 4LF5O 2CTQA 2DMXA 4FM0A 2XAGA 3IFXA 2WLLB 4OPAA 2AW9A 3K59A 4OX9B 5IDJA 2ZQMA 2E74B 1GH6A 4BIOA 5LP6A 2Y4UA 4LFBB 2AZ0A 1CP9A 4DK0A 3W7UA 2EIKB 4DYLA 5KA6A 4JI8B 1P49A 3HKEB 1IBLO 3JSNA 3QO7A 3RT3C 4QNHB 4I5SA 2HHHO 4RWUA 2CH7B 1JMKC 5EC2C 2UUBO 2XUMA 5JJEB 5FNVA 4NTYA 3K5NA 2DJVA 2YEVB 2PY5A 2E5LO 2K9PA 2GDSA 2QWPB 2JK5C 1EFRG 4FIPC 2VQEO 5GW7A 5K1PA 4DUYB 2UUCB 1YJWV 5LYJB 2EILC 2M7WA 5LXTA 5IJ9B 5KHJA 1YF2A 3FD9A 4C7UA 4DV4B 3BAAA 1M56C 4I4TA 5LMNO 3R66A 4GKKO 1S5JA 3A2FA 4ZBMA 2F4VO 5FLXN 1IDSA 3OEHG 2FL4A 2KKWA 5EYPB 1AR1B 4I50B 4TWKA 2WLNA 4RUFA 3FYEB 3SYQA 3QNEA 2L35A 1MMMA 4FZ0A 4Q20A 2OTLV 3ZHQA 3CP1A 1PL0A 5B1AB 3ICXA 2FB5A 3P32A 4D6TH 1M1KW 5BR8B 2UXNA 3G6BA 1US6A 5H5NA 4U3JA 1ENVA 1M93A 4JZGA 2A0LA 4YJ2A 1ZTEA 3JASB 3CB2A 2EILB 4LF4B 1SQVH 1MOFA 4DV2O 3G4SV 2LO1A 1VQPV 2YIBA 3ZMTA 2P5OA 4J42A 3JALA 4FK5C 3OAAG 2QTOA 2Q4PA 3B4SA 4AHCA 2KB1A 3H1LH 4TUYB 5L3FA 3BPZA 3JD1A 1ZL8A 1Y6XA 3I56V 3JAKB 3T1YO 3F5TA 2Q7EA 4B3RB 2WLHA 4GZRB 4FLWA 2LGWA 1FKAO 4KXRA 4LR3A 2A06H 2HEPA 5BZBA 3FB7C 3LUTB 2CUGA 1Q7YW 1Z5WA 4B3SO 1KBHA 3VBBA 5CA1B 2YXYA 1MSDA 3O65A 2UXDO 3FAVA 4WFBV 3G71V 2KQXA 4ZOLA 1KP2A 3T1CA 4FLUA 3SPCA 4ZHQA 2LJ2A 3I5DA 4FZ1A 5IWAB 1QNMA 1S77D 4I55A 3J80N 1RSOA 4PA7A 4X8AA 4N23A 3HKBB 4DR7O 5L3EA 2P4KA 2E75B 1Q8IA 1WA8B 4B3MO 2PI5A 2IW5A 3ABLC 1G6UA 3RYIB 5IY5C 4NB5A 1XNQO 2JEUA 2D2CB 2WA3A 1XOUA 1MNGA 1ZWIC 5B5EZ 3RYCA 4XDLA 2ZIOA 2ITDC 1NKDA 3QVNA 1S72V 5CMUA 3DXRA 1S3JA 5KAIZ 5JCOC 1N33O 1FPOA 4MSWC 4B7EA 2Q68A 2KG7B 1VQ4V 4DR2B 1K9MW 3K08A 4H33A 1Y74A 1K34A 1R6TA 4QIWF 5BMVA 3UKMA 4O2BB 1SQXH 4IHJB 4MT8A 4NVPA 4CH5A 2CE4A 4CH4A 2WLIA 1H8HG 3RYHA 3C3TA 3HPLC 5K1XA 1V54C 4UCOA 4OX9O 3THOA 5IJ0A 2UXBO 5CBFA 1L8DA 4LFBO 1JFFA 3AG4C 2M6YA 1K97A 4XDKA 5IY5B 3CX5F 2P67A 1VARA 3ZHRA 3ETEA 3DGEA 3NXSA 1I7FA 4MVUA 3BRCA 4FFBA 3STZC 2W6JG 3JD2A 4PI0A 2V4DA 4X1KA 4IIJB 4IT5A 3OMAB 1R3JC 3SJBC 1Q86W 1WP7A 3OEEG 2RQ6A 4MS2A 4O4IB 3JATA 4JI2O 3CMAV 4PELA 4DV1O 5KHHA 3JCZA 3E22A 5LHIA 2F66C 4U7OA 2F93B 3C3SA 2K1EA 4LWSB 3EFFK 4DUYO 2Q9LA 4IL6Z 3RYFB 5GTHZ 5HFMA 1UPGA 1JOYA 5E1AC 1AB3A 2PI4A 1COWG 2OIEA 1XNRO 2PYJA 3TK1A 4B08A 4UV8A 3ZS8C 4PJ0Z 2MK3A 1LUWA 2ZDIC 4BWAA 4DR6B 3D3IA 1S76D 1V55B 4NXNB 1K4DC 4ZKIA 2RNBA 1CEZA 4DRXA 4TQFA 4O4JB 2BOBC 3CRAA 3EVKA 3AG2B 3CD6V 5LGUA 4JF3A 4OGQB 4WBNB 1CPYA 3AG7A 1SRYA 4FLTA 1FJGO 1YDXA 3BA9A 2LFSA 1UFIA 5BR8O 1HDJA 2EIMC 4ZI7B 2ZNIA 4I7ZB 3CCEV 3SJQC 1ROPA 2XNDG 3OE7G 2W6IG 4Z2WA 4BW5A 3OGIB 1IBMO 2X7RB 2EZPA 2UXCO 3WU2Z 4FJCC 3ZRVA 4K8ZA 3UT5B 2YIDA 1EZVH 3K3WA 3AG1C 1IVSA 3ZRSA 3EHBB
chains in the Genus database with same CATH topology
2DQ0A 1QLNA 1S5HC 1QCEA 3F7YC 2X6CA 4MVZA 2EIJB 3JD4A 2HKOA 1AJNA 1YITV 3ABLB 5J9PC 3B77A 3CCLV 1BMFG 1NJIW 1VQKV 1THZA 2JJ1G 3W7XA 3CYOA 1SESA 2DYSB 1ORQC 2DYRB 3JD0A 3OMIB 1QLEC 3WG7C 1R3IC 4CZZA 1M57B 1FS0G 2DW4A 1BHBA 3MHSC 4MTGA 1K33A 3ZMSA 1NH2D 5L3GA 1N8RW 3ASOB 3ZJZA 1GM7A 3ZCCA 1GMGA 4L87A 3RVYA 2OCCC 1BL8A 1PNMA 3MHHC 5HFLA 2EIMB 2XAGA 3K9AA 5LHGA 3IFXA 4WF9V 2WLLB 1YJNV 2B5UA 4PA9A 3ABUA 2XASA 2A79B 3FYIB 4JTCB 3HB3B 5B1OA 5IDJA 5LBQA 1KD1W 5KUMA 4J9ZB 2ZQMA 3SPHA 3I55V 2QA4V 2HVKC 2D3OW 1JVMA 4G28B 4MVSA 2JJ2G 3ABKB 4YXWG 3CPWU 1RM1C 1CP9A 2DQ3A 2LP7A 1PKXA 5H9CA 1LNQA 3TCUA 3KG2A 1V54B 3SYAA 3W7UA 3WFVA 2EIKB 5KA6A 3OUFA 4OXSA 3OGCC 4HZ3A 3QO7A 1R3KC 4QNHB 4I5SA 2HG5C 2DWDC 4U7NA 1GO3F 3SYOA 1YTFB 3AG4B 3B8MA 5EC2C 2X6BA 3DTUB 4JAVA 2HR3A 4LCUC 3X2QB 2YEVB 1P7BA 1GM8A 1VQMV 5IYBO 3IC7A 1YJ9V 1K5SA 1QLEB 3ASNB 3WG7B 1OCRC 2IJKA 1GM9A 2JK5C 1EFRG 2H8PC 1H2GA 4FIPC 2IJJA 4R50A 1MABG 1Q82W 5GW7A 2OCCB 4GX0A 1FXKC 1RPRA 1YJWV 2V1DA 2EILC 1GTOA 3QO5A 4I9WA 2HJFC 1KKDA 2M7WA 3T4ZA 3SYCA 2XAHA 3OW2U 3OUSA 1OCCB 1JPXA 1M56C 4GX5A 4E2LA 2WLKA 1YSCA 2A9HA 1MSWD 2QE7G 1WLEA 2P7TC 4PDVA 5B3SC 1S0VA 3CCRV 1J95A 1WPXA 1SERA 1RPOA 2DWEC 2WLIB 4ZBMA 2R9RB 2IU3A 2YEVA 3OEHG 4P2ZA 3JD3A 3G6EV 2ZXWC 1DF5A 2Z3YA 3K06A 4LBEC 4EKWA 3K0DA 4TSFG 4ASUG 3E35A 4MVOA 1NH2B 2ZR2A 1AR1B 1IXMA 3ML0A 1VQ8V 2Y48A 1FFTB 2WAMA 3CXCU 3AG3C 4TWKA 2WLNA 1XL6A 2EZOA 4RUFA 3FYEB 2NLJC 3SYQA 3QNEA 1W0JG 1OCZC 2V7QG 3ETDA 1R3LC 1FXVA 4Q20A 2OTLV 4UUJC 3UM7A 1AJPA 1F23A 3CP1A 3ZIAG 1PL0A 5B1AB 3K04A 3SPIA 3P32A 1M1KW 5C93A 5L3BA 5CA3A 4WFEA 2UXNA 1OCRB 1ENVA 3CC4V 3LDEA 2A0LA 2JDIG 3E86A 4CBCA 1FXKB 4RAIA 5EBMC 1NQTA 3CC2V 2EILB 1EZJA 1F4MA 1NVPD 2LFRA 1R73A 1K73W 1MOFA 1QBZA 1MG1A 3ZN0A 3F5WC 1DTOA 1OZ0A 3G4SV 1VQPV 3GB7C 1VQOV 3CC7V 3BEHA 2ZDIA 3ZMTA 2XOKG 2JEXA 4DO2A 1V55C 4UVBA 3P30A 5B3SB 4FK5C 3ZN1A 3W7TA 5LGNA 3OAAG 2QTOA 4JTAB 3TETA 2GHYA 5B1BC 2WSSG 4RO2A 3OR6C 4N21A 2KB1A 1K3EA 5EC1C 5L3FA 3JD1A 4PA6A 2Y69B 4TT3G 4X88A 1VQ7V 1H8EG 1F4NA 3E8BA 2ZR3A 3I56V 4QPJA 2W0FC 3AG2C 2HFEC 3ZMUA 2ZD9A 5EK0A 1FXHA 2WLHA 4QE9A 1NR7A 4LP8A 3AG3B 4G2KA 4FPPA 1KC8W 3E83A 1OCZB 3AG1B 1YIJV 3ABTA 5BZBA 3FB7C 3LUTB 4DXWA 1W0KG 1Q7YW 2F43G 5CN0A 2B1GA 1AI6A 5DM6V 3RW0A 4PDLA 4MVRA 4KUMA 3VBBA 1KECA 3K79A 3ZMZA 3VOUA 1NBMG 4PDMA 4WFBV 2YSUB 4JAUA 4KP4A 3G71V 2WLLA 4WFHA 2AHYA 5LGTA 2ATKC 1KP2A 1KP3A 3MD0A 3FKSG 3T1CA 3CCSV 2CK3G 1NR1A 3R65A 2EINC 3SPCA 4PA4A 2EBOA 4GX1A 2WLJA 1S77D 1F51A 1H38A 1AJQA 2X0LA 4MW8A 4R6ZA 4PA7A 4X8AA 5H6QA 4N23A 3OR7C 3T2MA 5L3EA 5LHHA 4UVCA 4PDRA 5CBGA 1PNKA 3K03A 2P6JA 2EIJC 2PI5A 5KUKA 2IW5A 3ABLC 5B1BB 1AI7A 4HAMA 2QM7A 5IY5C 2JEUA 4MW3A 3E2EA 4F4LA 1ZWIC 3ZRWB 2GSMB 4XDLA 1SETA 3LSQA 1G4YB 1RM1B 1R6KA 2ITDC 3E89A 1NKDA 2IJIA 2IH3C 4MTOA 2DYRC 1S72V 1E1RG 5CMUA 4GCZA 1DLBA 1S3JA 1DF4A 1HWYA 1QR8A 4WFGA 3ASOC 4MSWC 3AEIA 4P30A 1JX9A 2Q68A 1QR9A 1VQ4V 3W7WA 5DN6G 3FB8C 4GT1A 4Z1MG 3PJSK 3JYCA 3B8NA 2BOCC 3K08A 4H33A 3E8FA 4QJFB 5IYCO 1K9MW 1I5YA 2IJHA 5H6RA 1K34A 4QIWF 4QE7A 3UKMA 4RQEA 1W2BU 3FB5C 4WCEV 5EBWC 2FTKA 4G27B 3E8GA 2EINB 3IGAC 4FMTA 1K4CC 4MT8A 4MVQA 1QVGU 2JIZG 2UXXA 5B1NA 2WLIA 1H8HG 4JYBA 3HPLC 1TUEB 1GK9A 2B1IA 3ETGA 1V54C 1K5QA 1GKFA 1AI4A 2EIKC 2OT5A 4QPKA 3CCVV 5CBFA 2QKSA 3AG4C 2ITCC 1M56B 2Q69A 3ABMC 1E79G 1K97A 4XDKA 5IY5B 4UV9A 3E8HA 2C2AA 2P67A 1VQ5V 1VQLV 4JGSA 2OTJV 3X2QC 5CBHA 3ETEA 3DGEA 3NXSA 3F7VC 1M90W 4MVUA 2XAJA 4JPRA 3ASNC 4R7CA 1JJ2U 2QEXV 3STZC 3CCUV 2W6JG 2ZXWB 3JD2A 3QO8A 4KFMA 4MVMA 2Q67A 1PNLA 2Z5UA 1K7DA 1SZTA 3OMNB 1L1FA 3OMAB 3RVZA 3STLC 2R9IA 1AROP 1FXKA 1R3JC 1Q86W 3OEEG 1QVFU 1PD3A 4MS2A 1UJWB 3K0GA 3CMAV 1JCHA 4PELA 1OCCC 3SPJA 4RQFA 3JCZA 3ZMVA 3ZRXA 1EBOA 1Q81W 2EJRA 5LHIA 4HYOA 2NNUA 2XAQA 4U7OA 3SYPA 4JYCA 2K1EA 3EFFK 4GX2A 2IU0A 3FB6C 5HFMA 4R8CA 3H01A 1P4RA 1G8MA 1Y4MA 1JOYA 4P9PA 1JQ0A 5E1AC 1VQ6V 5FL7G 5L3CA 4H37A 4JASA 2X6AA 3OM3B 4UXNA 2PI4A 1COWG 2HLDG 1I5XA 4XBFA 1BHAA 2WPDG 3BY6A 3W7SA 2Q6AA 3TK1A 1OCOC 2QM8A 4UV8A 3LNMB 2XAFA 2MK3A 2ZDIC 3ABMB 4BIZA 4UVAA 5KA5A 3D3IA 1S76D 1V55B 5B1AC 2IH1C 4WFFA 1YI2V 1K4DC 1Y66A 4ZKIA 3CCMV 1CEZA 1M9NA 2H94A 2BOBC 4PA3A 4BAYA 1YHQV 3AG2B 3D36A 4P9OA 4RUEA 2DYSC 3CD6V 3SPGA 5LGUA 4JF3A 4BIUA 1M57C 1CPYA 1SRYA 3A0RA 3LSSA 1NVPB 1K8AW 2WLMA 4MTFA 2LFSA 2P90A 4J9YB 3RBZA 2HVJC 3CCQV 1YTFD 4X89A 4LC1A 1XL4A 3T4DA 2EIMC 1VQNV 4WFAV 5EBLC 4XDJA 3CCEV 3SJQC 1ROPA 3CMEV 2XNDG 1B6QA 3OE7G 3LDDA 3CCJV 3OFNG 2AHZA 2W6IG 5IYDO 1AI5A 4BW5A 2Y69C 1OHHG 1VQ9V 2X7RB 2EZPA 3ZRWA 3ABKC 3LDCA 1E1QG 5L3DA 3M99B 4FJCC 3ZRVA 3GWOA 4MTXA 1K92A 1OCOB 4JTDB 1KQSU 1R6NA 3K3WA 3AG1C 3ZRSA 2WWWA 3EHBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R65 A;  2EIN C;  1S5H C;  3F7Y C;  2P7T C;  4PDV A;  3SPC A;  5B3S C;  4PA4 A;  1J95 A;  2X6C A;  4MVZ A;  4GX1 A;  2WLI B;  2DWE C;  4ZBM A;  3RVZ A;  3STL C;  2R9R B;  1R3J C;  2WLJ A;  2YEV A;  5J9P C;  4MS2 A;  4P2Z A;  3K0G A;  4MW8 A;  3SPJ A;  4R6Z A;  1OCC C;  4PA7 A;  2ZXW C;  4X8A A;  3K06 A;  4EKW A;  3K0D A;  3OR7 C;  3T2M A;  4HYO A;  4MVO A;  4PDR A;  3SYP A;  5CBG A;  1ORQ C;  3K03 A;  2K1E A;  1QLE C;  2EIJ C;  3EFF K;  1R3I C;  3AG3 C;  4GX2 A;  2WLN A;  4TWK A;  1XL6 A;  3WG7 C;  5KUK A;  4RUF A;  3SYQ A;  2NLJ C;  3ABL C;  3FB6 C;  4MTG A;  4R8C A;  1OCZ C;  5IY5 C;  4P9P A;  1R3L C;  5E1A C;  3ZJZ A;  4MW3 A;  4H37 A;  4F4L A;  3RVY A;  1ZWI C;  2OCC C;  4UUJ C;  1BL8 A;  2X6A A;  4XDL A;  3UM7 A;  1G4Y B;  3SPI A;  3K04 A;  2ITD C;  3E89 A;  2Q6A A;  2IH3 C;  4MTO A;  2DYR C;  3IFX A;  2WLL B;  1OCO C;  4PA9 A;  4WFE A;  3LNM B;  2A79 B;  4JTC B;  5KUM A;  4J9Z B;  3SPH A;  4WFG A;  3ASO C;  2HVK C;  4MSW C;  3LDE A;  2A0L A;  4P30 A;  1JVM A;  2Q68 A;  3E86 A;  4G28 B;  4MVS A;  4CBC A;  4RAI A;  3ZRS A;  5EBM C;  3FB8 C;  5B1A C;  2IH1 C;  4WFF A;  3PJS K;  3JYC A;  1K4D C;  2BOC C;  3K08 A;  4H33 A;  2ATK C;  3E8F A;  3F5W C;  3GB7 C;  1LNQ A;  3TCU A;  3KG2 A;  3SYA A;  4QE7 A;  3UKM A;  2BOB C;  3OUF A;  4PA3 A;  3FB5 C;  4OXS A;  3BEH A;  3OGC C;  5EBW C;  4G27 B;  3E8G A;  3IGA C;  4HZ3 A;  1R3K C;  4P9O A;  4QNH B;  1V55 C;  4RUE A;  2DYS C;  2HG5 C;  2DWD C;  3SPG A;  1K4C C;  3SYO A;  4MVQ A;  2QTO A;  4JTA B;  1M57 C;  3TET A;  5B1B C;  2WLI A;  4RO2 A;  3OR6 C;  5EC2 C;  2KB1 A;  2WLM A;  4MTF A;  3HPL C;  2X6B A;  5EC1 C;  4J9Y B;  3RBZ A;  4PA6 A;  2HVJ C;  1V54 C;  4LCU C;  4X89 A;  2EIK C;  1XL4 A;  4X88 A;  3T4D A;  1P7B A;  2EIM C;  3E8B A;  2W0F C;  3AG2 C;  2HFE C;  2ZD9 A;  4XDJ A;  5EBL C;  5EK0 A;  2WLH A;  4QE9 A;  3SJQ C;  4LP8 A;  5CBF A;  2QKS A;  1OCR C;  3AG4 C;  3LDD A;  2ITC C;  2Q69 A;  2JK5 C;  3ABM C;  3E83 A;  2AHZ A;  2H8P C;  4R50 A;  4XDK A;  3E8H A;  5BZB A;  3FB7 C;  3LUT B;  4BW5 A;  2Y69 C;  4DXW A;  4GX0 A;  3X2Q C;  5CBH A;  2EIL C;  3ABK C;  3LDC A;  3F7V C;  4I9W A;  4MVR A;  2HJF C;  4PDL A;  3RW0 A;  1KKD A;  4MVU A;  3T4Z A;  3SYC A;  3VOU A;  3ASN C;  3OUS A;  4R7C A;  4PDM A;  3STZ C;  4JTD B;  2WLL A;  4WFH A;  2AHY A;  1M56 C;  4GX5 A;  4KFM A;  4MVM A;  3AG1 C;  2Q67 A;  2WLK A;  3T1C A;  2A9H A;  4LBE C; 
#chains in the Genus database with same CATH topology
 1S5H C;  1QCE A;  4MVZ A;  3JD4 A;  2Y4T A;  1BMF G;  3W7X A;  2B9Z A;  1HW7 A;  2JGD A;  1QLE C;  3WG7 C;  1R3I C;  2ZCE A;  1K33 A;  5J2T A;  1N8R W;  3ASO B;  3ZJZ A;  3ZCC A;  1GMG A;  3QF7 A;  4L87 A;  4D7S A;  2OCC C;  3MHH C;  5HFL A;  1VF6 C;  2EIM B;  4O4H A;  5KHK A;  1W59 A;  4OPH A;  4DV6 O;  4DR4 B;  4TV9 A;  5LBQ A;  1T5E A;  2QA4 V;  1FFX B;  1JVM A;  2ARH A;  1VEW A;  2VQF B;  1RM1 C;  2HP8 A;  2DQ3 A;  4DW1 A;  2LP7 A;  1PKX A;  5H9C A;  1LNQ A;  2AZ2 A;  3WFV A;  1SA0 A;  4OXS A;  1XMO B;  1R3K C;  4DV7 B;  4U7N A;  1GO3 F;  1YTF B;  4DR1 B;  4X64 O;  3B8M A;  5TIS Z;  4EB6 B;  4JAV A;  5KMG B;  1P7B A;  1SC5 B;  4TV8 A;  1NS1 A;  1YJ9 V;  4J80 A;  1QLE B;  3WG7 B;  5LOV B;  4UCV A;  1Q5O A;  2Y0P A;  1OCR C;  2IJK A;  1GM9 A;  2H8P C;  1MAB G;  1Q82 W;  2OCC B;  4GX0 A;  4LFA B;  1RPR A;  2V1D A;  4J41 A;  1GTO A;  3CRQ A;  1KKD A;  3HKE A;  3SYC A;  3OW2 U;  4NXM O;  1OCC B;  1FAF A;  2QWR B;  4JI3 B;  4O4L B;  4E2L A;  2WLK A;  1YSC A;  2CH7 A;  2QE7 G;  4YIP A;  1WJZ A;  3CCR V;  1J95 A;  1HP8 A;  1SF9 A;  1HNW B;  3FX7 A;  2RMK B;  2R9R B;  3APQ A;  2IU3 A;  2YEV A;  5FPR A;  2PYL A;  3L71 H;  4TOI A;  2Z3Y A;  1B06 A;  4EKW A;  4LF9 B;  3WB1 A;  4ASU G;  3E35 A;  1NH2 B;  2BTO A;  3ML0 A;  3CEI A;  2QR4 A;  1FFT B;  3CXC U;  3H1J H;  2PZS A;  1XL6 A;  4X66 O;  5LYJ A;  1N32 B;  2KSD A;  1R3L C;  4NTW A;  4UUJ C;  1AJP A;  1F23 A;  4IGG A;  4DV5 O;  4F6R A;  5L3B A;  5CA3 A;  3L75 H;  4WFE A;  1OCR B;  3DC6 A;  2VRZ A;  3E86 A;  3IJ4 A;  3P3N A;  4CBC A;  1EZJ A;  1NVP D;  5EYP A;  1R73 A;  1Z5V A;  4X20 A;  1QBZ A;  4KHP O;  3ZN0 A;  1DTO A;  2E76 B;  2PUS A;  3GVM A;  4GYC B;  5CA0 B;  1XUQ A;  2XOK G;  2JEX A;  3P30 A;  3ZED A;  3ZN1 A;  4FM1 A;  1KYO F;  2G38 A;  2VWK A;  5B1B C;  1K3E A;  1F7Y A;  5EC1 C;  4AIL C;  5KX5 B;  4PA6 A;  5DED A;  4X88 A;  1H8E G;  2Q73 A;  4QPJ A;  4DR6 O;  1I94 B;  4QE9 A;  1NR7 A;  4LP8 A;  4FM2 A;  4GUN A;  4G2K A;  4FPP A;  3E83 A;  2QKC A;  2F43 G;  3G67 A;  4FLV A;  5DM6 V;  2GBO A;  1IBK O;  4KUM A;  5ITZ A;  4JYA B;  3JAR B;  4JAU A;  4KP4 A;  4WFH A;  2AHY A;  2GTS A;  3DSQ A;  2ATK C;  3MD0 A;  5BY1 A;  3FKS G;  3T1H B;  3R65 A;  2EIN C;  3SDL A;  2YDE A;  3JAK A;  2XT9 A;  4MW8 A;  2X0L A;  1N4C A;  1QU7 A;  2YI9 A;  4HNA A;  4W4L A;  3OR7 C;  1DGS A;  5LHH A;  5IYZ B;  4UVC A;  2P6J A;  2EIJ C;  5KUK A;  4DV0 B;  5B1B B;  1AI7 A;  4HAM A;  5LP6 C;  4X62 B;  2MW2 B;  3E2E A;  4F4L A;  3ZRW B;  4UFZ A;  3LSQ A;  1G4Y B;  3BVO A;  3U0Z A;  2A3Q A;  3ZHT A;  1XDC A;  5BXZ A;  4NR1 A;  1TVK B;  1N36 B;  1QR9 A;  4YY3 O;  3TXS A;  1LR1 A;  4B3T B;  4GT1 A;  4Z1M G;  2YS8 A;  3PJS K;  1I08 A;  1KB9 F;  2R70 A;  5IYC O;  2W0X A;  1I5Y A;  4IYI A;  4QE7 A;  1W2B U;  5KAF Z;  3TJT A;  2EIN B;  2LW7 A;  3IGA C;  3RFR A;  4MVQ A;  3H1H H;  2JIZ G;  2QJ1 A;  3Q4H B;  3JAW B;  5B1N A;  3S3W A;  4JYB A;  1TUE B;  2XTA A;  5EIB C;  1BGY H;  2FYU H;  3RN4 A;  3L72 H;  3H1K H;  1H2M A;  5CB4 B;  4QPK A;  1CXZ B;  3CCV V;  4E4E A;  2ZM6 B;  1PL4 A;  2IBZ H;  2VQF O;  1M56 B;  2Q69 A;  5LP6 B;  3E8H A;  2C2A A;  5JVD B;  2OTJ V;  3X2Q C;  3OTO B;  3L74 H;  4O2B A;  2UU9 O;  5JQG A;  3ASN C;  4R7C A;  1J5E B;  4YJ3 B;  4DV7 O;  5B66 Z;  2UUA O;  1TGO A;  4KFM A;  4DR1 O;  4MVM A;  4LF8 B;  3U11 A;  1MZE A;  2BCC H;  1SZT A;  1IXB A;  3OMN B;  3HKD A;  2R9I A;  1ARO P;  1FXK A;  3L9D A;  1QVF U;  3SPJ A;  4Q6G A;  4I0X B;  3ZMV A;  1Q81 W;  4JI4 B;  2ILM A;  2NNU A;  3UO2 A;  1XI1 A;  2A7W A;  2IU0 A;  1G8M A;  4NTX A;  2F23 A;  4H37 A;  2X6A A;  3OM3 B;  4UXN A;  4X65 B;  4XBF A;  5LXT B;  1BHA A;  2ADP A;  2Q6A A;  2QM8 A;  4IIJ A;  3LNM B;  1WPB A;  4I4T B;  5JJJ B;  1HNW O;  2RCV A;  4UVA A;  2AGA A;  5EZY A;  4JI0 B;  4O4I A;  5KA5 A;  4J7Z A;  4BR6 A;  4K8X A;  1D5N A;  1V9P A;  3B2E E;  2ZE6 A;  3L70 H;  4PA3 A;  1YHQ V;  1N32 O;  3D36 A;  4P9O A;  4RUE A;  3M7M X;  3SPG A;  2YI8 A;  4YIO A;  3LSS A;  3CRR A;  1NVP B;  2WLM A;  1GN6 A;  2P90 A;  4J9Y B;  3RBZ A;  4FLZ A;  4CC6 A;  1YTF D;  4X89 A;  1XL4 A;  3T4D A;  1LUV A;  5JH7 A;  4WFA V;  1I0H A;  3K9S A;  1WNS A;  3KCY A;  3CME V;  4LF7 O;  1B6Q A;  4U3J B;  1AVM A;  1URF A;  1D2D A;  3OFN G;  2AHZ A;  2VS0 A;  4J7J A;  3HKC A;  1M4U A;  4YJ2 B;  2Y69 C;  3N27 A;  1OHH G;  4QGP A;  2YXL A;  3CSX A;  3ABK C;  1E1Q G;  4O4J A;  3GWO A;  1K92 A;  2QWQ B;  4JTD B;  4J10 A;  3ETQ A;  1KQS U;  3VQV A;  4WBN A;  2GV9 A;  3JAM N;  2WWW A;  3JAL B;  4LBE C;  1H2L A;  2DQ0 A;  1QLN A;  1U97 A;  1AJN A;  3ABL B;  1YXB A;  3B77 A;  2VWJ A;  1XBL A;  2EUL A;  3CJH A;  2Q7H A;  3OTF A;  1OJH A;  3BA8 A;  2JJ1 G;  3CYO A;  2GTA A;  4JI8 O;  5GON B;  1ORQ C;  3OMI B;  2OYQ A;  2JVD A;  1FS0 G;  1BHB A;  1NH2 D;  3ZMS A;  4O2A A;  4JYA O;  3ZHS A;  3UT5 A;  1BL8 A;  3B40 A;  4JI1 B;  1SZX A;  4LNU A;  3K9A A;  3T1H O;  4LFC B;  1YJN V;  4PA9 A;  2XAS A;  4ZOL B;  2A79 B;  3FYI B;  4JTC B;  3HB3 B;  1KD1 W;  5KUM A;  3SPH A;  2YIA A;  2D3O W;  4MVS A;  2P4V A;  4ZHQ B;  2BTQ A;  2UUC O;  3ABK B;  4YXW G;  3CPW U;  4JI7 B;  1WAZ A;  2GUZ B;  1PP9 H;  4DW0 A;  3TCU A;  1V54 B;  4DV4 O;  3OUF A;  2RDC A;  4PV1 B;  4HZ3 A;  4X62 O;  2HG5 C;  2P06 A;  2RN9 A;  3AG4 B;  4DV3 B;  2QSA A;  4J11 A;  4X1Y A;  3TGU H;  1GM8 A;  2ADQ B;  5JJN B;  1FFX A;  1N36 O;  2ODM A;  2DE0 X;  1H2G A;  2IJJ A;  4R50 A;  1WN7 A;  2HJF C;  1Y74 B;  2WA4 A;  3OUS A;  5BMV B;  1JPX A;  1M5I A;  4GX5 A;  4HBN A;  1P84 F;  2OIG A;  2A9H A;  3CWB H;  2HHH B;  2P7T C;  4PDV A;  4EB6 A;  5B3S C;  1S0V A;  1WPX A;  1SER A;  1RPO A;  2DWE C;  2WLI B;  3A0H Z;  3RYH B;  3RGB A;  2UUB B;  4LF4 O;  3BFR A;  1Z2G A;  3G6E V;  2ZXW C;  1DF5 A;  1Y76 B;  3K06 A;  1P7G A;  4UCT A;  1HNZ B;  4U3F H;  2E5L B;  1MZF A;  1VQ8 V;  1JFF B;  2WAM A;  3AG3 C;  1XHX A;  3CHX A;  1OCZ C;  3ETD A;  1AIL A;  1FXV A;  2Q0O C;  4B3R O;  5LMN B;  4X1K B;  3K5L A;  2FML A;  4GKK B;  3CC4 V;  2JDI G;  2F4V B;  4RAI A;  5LA6 A;  1Q6I A;  3CC2 V;  1F4M A;  5KHG A;  2LFR A;  3B09 A;  1K73 W;  3JCU Z;  3F5W C;  1OZ0 A;  1BQZ A;  3GB7 C;  2R72 A;  1BT8 A;  1EM1 A;  3DC5 A;  3CC7 V;  5B3S B;  4UVB A;  4X65 O;  2GHY A;  5IWA O;  2N05 A;  2ZE7 A;  1GN4 A;  1L0N H;  1NTZ H;  1H2N A;  4TT3 G;  1F4N A;  2W0F C;  3ZMU A;  4JI0 O;  3AG3 B;  1KC8 W;  1BQ0 A;  1OCZ B;  3AG1 B;  4JZ2 A;  3ABT A;  1W0K G;  1AI6 A;  1OV9 A;  3UO3 A;  2H3O A;  4PDL A;  4DV2 B;  1KEC A;  3K79 A;  1SQG A;  4CS3 A;  4FLX A;  4DRX B;  1NBM G;  2WLL A;  3CRC A;  5LGT A;  4FLY A;  5J2U B;  3CCS V;  1NR1 A;  4GX1 A;  1XMQ B;  1GRJ A;  3BAB A;  2CTW A;  4DR2 O;  3WB0 A;  1H2S B;  2Y0I A;  2N04 A;  4EEQ A;  2PF4 E;  5H6Q A;  2ZIN A;  3T1Y B;  3T2M A;  3TXQ A;  4PDR A;  1NTK H;  3CS5 A;  5CBG A;  1VP7 A;  1IUR A;  1N0N A;  1HNX B;  2O57 A;  3MDS A;  4MW3 A;  1GN2 A;  1B04 A;  1NZ6 A;  4B3S B;  1SET A;  1RM1 B;  2UXD B;  3E89 A;  2IH3 C;  4MTO A;  5EIB D;  2DYR C;  1E1R G;  3N2G B;  3S3X A;  4PI2 A;  3VQW A;  4WFG A;  3AEI A;  4UCS A;  2ZT9 B;  3RWR D;  4LF6 B;  4X1I B;  3W7W A;  5DN6 G;  3FB8 C;  1KUQ A;  3JYC A;  4LH6 A;  5IJ9 A;  2IJH A;  3J81 N;  4DR7 B;  2CDY A;  1PV0 A;  1S5L Z;  4AQY B;  2JGD B;  3IC9 A;  3C90 A;  1K4C C;  1QVG U;  1NT2 B;  2UXX A;  4JI6 B;  1XNQ B;  2YC0 A;  4JI1 O;  4LFC O;  1GK9 A;  2B1I A;  3ETG A;  4LH7 A;  4O4H B;  1K5Q A;  2EIK C;  1O9G A;  2OT5 A;  4TV9 B;  1SS3 A;  4I50 A;  3ABM C;  3J7A U;  1X4T A;  1JR9 A;  1VQ5 V;  1VQL V;  4JGS A;  2XHB A;  1QQC A;  5CBH A;  2OWO A;  3F7V C;  3L73 H;  2QGN A;  1JJ2 U;  2Q7G A;  2QM4 A;  5GTI Z;  1X59 A;  3JAW A;  2Q67 A;  4DV3 O;  1TUB B;  4K0K B;  2ZNJ A;  3RVZ A;  2YIB D;  3STL C;  4NXN O;  3JAS A;  3LSU A;  1TAE A;  5CB4 A;  1PD3 A;  1SQB H;  1WB8 A;  5D5Q A;  3ZRX A;  4TV8 B;  2EJR A;  4PHZ A;  2XAQ A;  2UXB B;  3SYP A;  1ZAU A;  5JVD A;  3SR2 C;  3FB6 C;  4B7K A;  4R8C A;  3H01 A;  4P9P A;  1VQ6 V;  4J7K A;  4JAS A;  4TUY A;  1NTM H;  4YJ3 A;  4TQD A;  1I5X A;  2WPD G;  1SQF A;  3BY6 A;  4KL1 A;  3AK2 A;  2XAF A;  3ABM B;  4BIZ A;  4I0X A;  5B1A C;  1HNZ O;  4WFF A;  4CH6 A;  1YI2 V;  4JI2 B;  1IX9 A;  5CA1 A;  4DV1 B;  1Q90 D;  3QTC A;  1DK1 A;  4H44 B;  1M9N A;  2H94 A;  1XEQ A;  3N2K B;  1AR4 A;  4BAY A;  4H0L B;  4AI8 A;  3KKY A;  1GN3 A;  2QDO A;  4CH3 A;  4BIU A;  1XIL A;  3A0R A;  1PM9 A;  1PPJ H;  2LGQ A;  4L8J A;  2HVJ C;  1XNR B;  3HKB A;  2Q8V A;  4F6R B;  2CTR A;  1N34 B;  1WA8 A;  3LDD A;  2BSK B;  4D7T A;  1AI5 A;  1O9H A;  3RYI A;  2JS5 A;  4X20 B;  3KCX A;  3H1I H;  1Y67 A;  4DR5 B;  3FFQ A;  5L3D A;  3M99 B;  5C8Y B;  1FD9 A;  3G80 A;  4MTX A;  3IAY A;  2LW1 A;  4DR4 O;  5E79 Z;  1R6N A;  1FJG B;  2EIJ B;  2KG7 A;  2LQT A;  1YIT V;  5J9P C;  4JV5 B;  1NJI W;  4DUZ B;  3JD0 A;  1XMO O;  4EFB A;  1EN5 A;  4CZZ A;  4IHJ A;  2DW4 A;  3ZHU A;  4GKJ B;  1EN4 A;  3AK1 A;  1GM7 A;  2R9A A;  1IBM B;  2FKX A;  2QTS A;  1PNM A;  3OD4 A;  2UXC B;  5ITZ B;  4YHH B;  5LHG A;  4WF9 V;  4FVM A;  2B5U A;  5FNV B;  3ABU A;  1XMQ O;  5B1O A;  3NR7 A;  1IZ3 A;  3I55 V;  4J9Z B;  2HVK C;  1NI8 A;  4G28 B;  1B3Q A;  4CS2 A;  2JJ2 G;  4LFA O;  4UCR A;  5LMU B;  2CGO A;  4HNA B;  1JJO A;  5GON A;  1AP5 A;  3KG2 A;  3SYA A;  3PN1 A;  1HNX O;  4JI3 O;  1A32 A;  5JCO A;  3OGC C;  5IT9 N;  3K5O A;  3UCS C;  2EX3 A;  2DWD C;  3SYO A;  2AXT Z;  4CS4 A;  1BE3 H;  4K3A A;  2X6B A;  3DTU B;  2HR3 A;  2PTM A;  1MA1 A;  1R1B A;  1Q6H A;  4LCU C;  1VIB A;  3X2Q B;  4LF9 O;  5KLV H;  3EXA A;  1VQM V;  4DV6 B;  4JAA A;  5IYB O;  3IC7 A;  1K5S A;  3ASN B;  4LF6 O;  4LWS A;  4IYH A;  3RYF A;  2ZKO A;  2GUZ A;  1FXK C;  2QWO B;  3VQY A;  2ZIM A;  3QO5 A;  4I9W A;  4X9Q A;  3T4Z A;  2XAH A;  4AQY O;  3AK3 A;  2RJZ A;  4JI6 O;  4DR3 B;  1MSW D;  1WLE A;  4X64 B;  4P2Z A;  3JD3 A;  4BW9 A;  3K0D A;  4TSF G;  2ZE8 A;  4MVO A;  2ZR2 A;  4H13 B;  1IXM A;  1AP6 A;  4NYK A;  2Y48 A;  3O9O A;  2EZO A;  2NLJ C;  2CGN A;  1W0J G;  2V7Q G;  2BE3 A;  5IE9 A;  1HR0 B;  3UM7 A;  4A5U B;  3ZIA G;  5JQG B;  3SPI A;  3K04 A;  4NXM B;  3SJC C;  5JWP A;  4ZI7 A;  1ZL8 B;  5C93 A;  1I94 O;  5A2Q N;  4K0K O;  1SKV A;  3D36 C;  1YEW A;  2JGU A;  3LDE A;  2YXH A;  3HKD B;  1FXK B;  1Y76 A;  3A8T A;  5EBM C;  1NQT A;  5DEC A;  3P3P A;  1MG1 A;  1VQO V;  1WP8 A;  3BEH A;  2ZDI A;  3FAV B;  4DO2 A;  1V55 C;  4X66 B;  3W7T A;  5LGN A;  4GLX A;  4JTA B;  3TET A;  2WSS G;  4RO2 A;  3OR6 C;  4N21 A;  2Y69 B;  1VQ7 V;  3E8B A;  2ZR3 A;  4DV5 B;  1YVW A;  3AG2 C;  2HFE C;  5F2V O;  2ZD9 A;  4I55 B;  1RSO B;  5EK0 A;  1FXH A;  1BSM A;  4JI5 B;  5EZY B;  4DV0 O;  1AR5 A;  1YIJ V;  4DXW A;  2N74 A;  5CN0 A;  2B1G A;  3RW0 A;  4EFE A;  4MVR A;  4KHP B;  2Z0A A;  3JSL A;  1BZK A;  3ZMZ A;  1VMG A;  3VOU A;  4PDM A;  3RYC B;  3BHP A;  2YSU B;  1FYJ A;  1VF7 A;  3KZI Z;  4LF5 B;  5KHI A;  4PD4 F;  1KP3 A;  2CK3 G;  2F95 B;  4PA4 A;  2EBO A;  3DXR B;  3GWK C;  2WLJ A;  2OCH A;  3ZX6 A;  1F51 A;  4B3T O;  1H38 A;  1AJQ A;  4R6Z A;  5FPO A;  1Q6U A;  1N34 O;  5JH7 B;  1ZLZ A;  1L0L H;  4ICG A;  1PNK A;  3K03 A;  1D5A A;  3HKC B;  4DR5 O;  3CRM A;  1NU1 H;  3SJA C;  1KKC A;  2QM7 A;  1IBL B;  3ZHV A;  1H2K A;  2NN4 A;  2GSM B;  1IBK B;  2YUA A;  3VQX A;  1R6K A;  3A0B Z;  5KMG A;  1KMI Z;  2IJI A;  5J2U A;  2IM9 A;  1U96 A;  4CC5 A;  4GCZ A;  5LOV A;  1DLB A;  2ZM6 O;  1DF4 A;  1HWY A;  1QR8 A;  3M8A A;  2E3C A;  5IJ0 B;  3ASO C;  1GAX A;  4P30 A;  1JX9 A;  4JV5 O;  3ZBH A;  4ABM A;  2ETN A;  2DN9 A;  3K57 A;  3BCC H;  3OTO O;  2VQE B;  3B8N A;  1VF6 A;  4DUZ O;  2BOC C;  3E8F A;  4QJF B;  3CJH B;  4NKG B;  4Z1V A;  5H6R A;  3LNN A;  1J5E O;  4RQE A;  3K58 A;  3FB5 C;  4WCE V;  5EBW C;  2FTK A;  4LF8 O;  4G27 B;  3E8G A;  4O4L A;  4GKJ O;  4FFB B;  4UB8 Z;  4DK1 A;  4FMT A;  2CTP A;  4O2A B;  2L6L A;  3H9V A;  4YHH O;  3N2G A;  1GKF A;  1AI4 A;  4LNU B;  4JI4 O;  3JAT B;  3E22 B;  2QKS A;  4X1I A;  2ITC C;  5LMU O;  1E79 G;  3HR0 A;  4YY3 B;  4UV9 A;  2BTQ B;  1XRE A;  3UQ8 A;  5A9G A;  1M90 W;  2XAJ A;  1RFY A;  4JPR A;  2QEX V;  3CCU V;  2ZXW B;  3QO8 A;  1PNL A;  2Z5U A;  1K7D A;  1L1F A;  4W4K A;  1RP3 B;  1ZSP A;  1UJW B;  3K0G A;  1SQP H;  1JCH A;  1OCC C;  2P22 C;  4RQF A;  4X1Y B;  1EBO A;  4FFK A;  4HYO A;  5CA0 A;  3U10 A;  3CE2 A;  4K35 A;  4JYC A;  4UCU A;  4GX2 A;  5AG2 A;  3QG5 A;  1P4R A;  1Q43 A;  1Y4M A;  1JQ0 A;  1XQ8 A;  5FL7 G;  5L3C A;  5KX5 A;  2HLD G;  2YIC A;  2UU9 B;  4UB6 Z;  3APO A;  3W7S A;  4DR3 O;  1JA8 A;  1OCO C;  1ZUQ A;  2UUA B;  3D8C A;  1TUB A;  3WB2 A;  5H2F Z;  1XHZ A;  2IH1 C;  1Y66 A;  5LL6 Y;  2F1M A;  1N0J A;  3CCM V;  1YCI A;  2JRI A;  3JAR A;  1ZX3 A;  2DYS C;  2JS3 A;  1HR0 O;  2ZE5 A;  1M57 C;  1K8A W;  4MTF A;  1TA8 A;  1EN6 A;  3CCQ V;  1KU9 A;  4JYY A;  4LC1 A;  1VQN V;  2DOS A;  5EBL C;  4XDJ A;  5IYZ A;  4I9Q A;  2Q5Z A;  3CCJ V;  1G1X B;  5IYD O;  5LA6 B;  4B3M B;  2HJD A;  1VQ9 V;  3SGI A;  3ZRW A;  2NR5 A;  3LDC A;  3N2K A;  5J2T B;  1VF5 B;  2QKA A;  4ZIB A;  1OCO B;  2PGG A;  5D5P A;  1YZB A;  4F6E A;  1TVK A;  3F7Y C;  2EJ7 A;  2X6C A;  2HKO A;  3MAQ A;  3OT7 A;  1N33 B;  3D3Q A;  4JI7 O;  3CXH F;  1SQQ H;  3CCL V;  1WB7 A;  1VQK V;  4JI5 O;  2QWN B;  1THZ A;  1QHT A;  1BCC H;  1SES A;  2Q0A A;  2CAZ C;  4LF7 B;  2BSK A;  2DYS B;  2DYR B;  1M57 B;  3K5M A;  1SA0 B;  3MHS C;  4MTG A;  1BS3 A;  5L3G A;  1Q3E A;  3Q4H A;  5C8Y A;  3RVY A;  4LF5 O;  2CTQ A;  2DMX A;  4FM0 A;  2XAG A;  3IFX A;  2WLL B;  4OPA A;  2AW9 A;  3K59 A;  4OX9 B;  5IDJ A;  2ZQM A;  2E74 B;  1GH6 A;  4BIO A;  5LP6 A;  2Y4U A;  4LFB B;  2AZ0 A;  1CP9 A;  4DK0 A;  3W7U A;  2EIK B;  4DYL A;  5KA6 A;  4JI8 B;  1P49 A;  3HKE B;  1IBL O;  3JSN A;  3QO7 A;  3RT3 C;  4QNH B;  4I5S A;  2HHH O;  4RWU A;  2CH7 B;  1JMK C;  5EC2 C;  2UUB O;  2XUM A;  5JJE B;  5FNV A;  4NTY A;  3K5N A;  2DJV A;  2YEV B;  2PY5 A;  2E5L O;  2K9P A;  2GDS A;  2QWP B;  2JK5 C;  1EFR G;  4FIP C;  2VQE O;  5GW7 A;  5K1P A;  4DUY B;  2UUC B;  1YJW V;  5LYJ B;  2EIL C;  2M7W A;  5LXT A;  5IJ9 B;  5KHJ A;  1YF2 A;  3FD9 A;  4C7U A;  4DV4 B;  3BAA A;  1M56 C;  4I4T A;  5LMN O;  3R66 A;  4GKK O;  1S5J A;  3A2F A;  4ZBM A;  2F4V O;  5FLX N;  1IDS A;  3OEH G;  2FL4 A;  2KKW A;  5EYP B;  1AR1 B;  4I50 B;  4TWK A;  2WLN A;  4RUF A;  3FYE B;  3SYQ A;  3QNE A;  2L35 A;  1MMM A;  4FZ0 A;  4Q20 A;  2OTL V;  3ZHQ A;  3CP1 A;  1PL0 A;  5B1A B;  3ICX A;  2FB5 A;  3P32 A;  4D6T H;  1M1K W;  5BR8 B;  2UXN A;  3G6B A;  1US6 A;  5H5N A;  4U3J A;  1ENV A;  1M93 A;  4JZG A;  2A0L A;  4YJ2 A;  1ZTE A;  3JAS B;  3CB2 A;  2EIL B;  4LF4 B;  1SQV H;  1MOF A;  4DV2 O;  3G4S V;  2LO1 A;  1VQP V;  2YIB A;  3ZMT A;  2P5O A;  4J42 A;  3JAL A;  4FK5 C;  3OAA G;  2QTO A;  2Q4P A;  3B4S A;  4AHC A;  2KB1 A;  3H1L H;  4TUY B;  5L3F A;  3BPZ A;  3JD1 A;  1ZL8 A;  1Y6X A;  3I56 V;  3JAK B;  3T1Y O;  3F5T A;  2Q7E A;  4B3R B;  2WLH A;  4GZR B;  4FLW A;  2LGW A;  1FKA O;  4KXR A;  4LR3 A;  2A06 H;  2HEP A;  5BZB A;  3FB7 C;  3LUT B;  2CUG A;  1Q7Y W;  1Z5W A;  4B3S O;  1KBH A;  3VBB A;  5CA1 B;  2YXY A;  1MSD A;  3O65 A;  2UXD O;  3FAV A;  4WFB V;  3G71 V;  2KQX A;  4ZOL A;  1KP2 A;  3T1C A;  4FLU A;  3SPC A;  4ZHQ A;  2LJ2 A;  3I5D A;  4FZ1 A;  5IWA B;  1QNM A;  1S77 D;  4I55 A;  3J80 N;  1RSO A;  4PA7 A;  4X8A A;  4N23 A;  3HKB B;  4DR7 O;  5L3E A;  2P4K A;  2E75 B;  1Q8I A;  1WA8 B;  4B3M O;  2PI5 A;  2IW5 A;  3ABL C;  1G6U A;  3RYI B;  5IY5 C;  4NB5 A;  1XNQ O;  2JEU A;  2D2C B;  2WA3 A;  1XOU A;  1MNG A;  1ZWI C;  5B5E Z;  3RYC A;  4XDL A;  2ZIO A;  2ITD C;  1NKD A;  3QVN A;  1S72 V;  5CMU A;  3DXR A;  1S3J A;  5KAI Z;  5JCO C;  1N33 O;  1FPO A;  4MSW C;  4B7E A;  2Q68 A;  2KG7 B;  1VQ4 V;  4DR2 B;  1K9M W;  3K08 A;  4H33 A;  1Y74 A;  1K34 A;  1R6T A;  4QIW F;  5BMV A;  3UKM A;  4O2B B;  1SQX H;  4IHJ B;  4MT8 A;  4NVP A;  4CH5 A;  2CE4 A;  4CH4 A;  2WLI A;  1H8H G;  3RYH A;  3C3T A;  3HPL C;  5K1X A;  1V54 C;  4UCO A;  4OX9 O;  3THO A;  5IJ0 A;  2UXB O;  5CBF A;  1L8D A;  4LFB O;  1JFF A;  3AG4 C;  2M6Y A;  1K97 A;  4XDK A;  5IY5 B;  3CX5 F;  2P67 A;  1VAR A;  3ZHR A;  3ETE A;  3DGE A;  3NXS A;  1I7F A;  4MVU A;  3BRC A;  4FFB A;  3STZ C;  2W6J G;  3JD2 A;  4PI0 A;  2V4D A;  4X1K A;  4IIJ B;  4IT5 A;  3OMA B;  1R3J C;  3SJB C;  1Q86 W;  1WP7 A;  3OEE G;  2RQ6 A;  4MS2 A;  4O4I B;  3JAT A;  4JI2 O;  3CMA V;  4PEL A;  4DV1 O;  5KHH A;  3JCZ A;  3E22 A;  5LHI A;  2F66 C;  4U7O A;  2F93 B;  3C3S A;  2K1E A;  4LWS B;  3EFF K;  4DUY O;  2Q9L A;  4IL6 Z;  3RYF B;  5GTH Z;  5HFM A;  1UPG A;  1JOY A;  5E1A C;  1AB3 A;  2PI4 A;  1COW G;  2OIE A;  1XNR O;  2PYJ A;  3TK1 A;  4B08 A;  4UV8 A;  3ZS8 C;  4PJ0 Z;  2MK3 A;  1LUW A;  2ZDI C;  4BWA A;  4DR6 B;  3D3I A;  1S76 D;  1V55 B;  4NXN B;  1K4D C;  4ZKI A;  2RNB A;  1CEZ A;  4DRX A;  4TQF A;  4O4J B;  2BOB C;  3CRA A;  3EVK A;  3AG2 B;  3CD6 V;  5LGU A;  4JF3 A;  4OGQ B;  4WBN B;  1CPY A;  3AG7 A;  1SRY A;  4FLT A;  1FJG O;  1YDX A;  3BA9 A;  2LFS A;  1UFI A;  5BR8 O;  1HDJ A;  2EIM C;  4ZI7 B;  2ZNI A;  4I7Z B;  3CCE V;  3SJQ C;  1ROP A;  2XND G;  3OE7 G;  2W6I G;  4Z2W A;  4BW5 A;  3OGI B;  1IBM O;  2X7R B;  2EZP A;  2UXC O;  3WU2 Z;  4FJC C;  3ZRV A;  4K8Z A;  3UT5 B;  2YID A;  1EZV H;  3K3W A;  3AG1 C;  1IVS A;  3ZRS A;  3EHB B; 
#chains in the Genus database with same CATH homology
 2DQ0 A;  1QLN A;  1S5H C;  1QCE A;  3F7Y C;  2X6C A;  4MVZ A;  2EIJ B;  3JD4 A;  2HKO A;  1AJN A;  1YIT V;  3ABL B;  5J9P C;  3B77 A;  3CCL V;  1BMF G;  1NJI W;  1VQK V;  1THZ A;  2JJ1 G;  3W7X A;  3CYO A;  1SES A;  2DYS B;  1ORQ C;  2DYR B;  3JD0 A;  3OMI B;  1QLE C;  3WG7 C;  1R3I C;  4CZZ A;  1M57 B;  1FS0 G;  2DW4 A;  1BHB A;  3MHS C;  4MTG A;  1K33 A;  3ZMS A;  1NH2 D;  5L3G A;  1N8R W;  3ASO B;  3ZJZ A;  1GM7 A;  3ZCC A;  1GMG A;  4L87 A;  3RVY A;  2OCC C;  1BL8 A;  1PNM A;  3MHH C;  5HFL A;  2EIM B;  2XAG A;  3K9A A;  5LHG A;  3IFX A;  4WF9 V;  2WLL B;  1YJN V;  2B5U A;  4PA9 A;  3ABU A;  2XAS A;  2A79 B;  3FYI B;  4JTC B;  3HB3 B;  5B1O A;  5IDJ A;  5LBQ A;  1KD1 W;  5KUM A;  4J9Z B;  2ZQM A;  3SPH A;  3I55 V;  2QA4 V;  2HVK C;  2D3O W;  1JVM A;  4G28 B;  4MVS A;  2JJ2 G;  3ABK B;  4YXW G;  3CPW U;  1RM1 C;  1CP9 A;  2DQ3 A;  2LP7 A;  1PKX A;  5H9C A;  1LNQ A;  3TCU A;  3KG2 A;  1V54 B;  3SYA A;  3W7U A;  3WFV A;  2EIK B;  5KA6 A;  3OUF A;  4OXS A;  3OGC C;  4HZ3 A;  3QO7 A;  1R3K C;  4QNH B;  4I5S A;  2HG5 C;  2DWD C;  4U7N A;  1GO3 F;  3SYO A;  1YTF B;  3AG4 B;  3B8M A;  5EC2 C;  2X6B A;  3DTU B;  4JAV A;  2HR3 A;  4LCU C;  3X2Q B;  2YEV B;  1P7B A;  1GM8 A;  1VQM V;  5IYB O;  3IC7 A;  1YJ9 V;  1K5S A;  1QLE B;  3ASN B;  3WG7 B;  1OCR C;  2IJK A;  1GM9 A;  2JK5 C;  1EFR G;  2H8P C;  1H2G A;  4FIP C;  2IJJ A;  4R50 A;  1MAB G;  1Q82 W;  5GW7 A;  2OCC B;  4GX0 A;  1FXK C;  1RPR A;  1YJW V;  2V1D A;  2EIL C;  1GTO A;  3QO5 A;  4I9W A;  2HJF C;  1KKD A;  2M7W A;  3T4Z A;  3SYC A;  2XAH A;  3OW2 U;  3OUS A;  1OCC B;  1JPX A;  1M56 C;  4GX5 A;  4E2L A;  2WLK A;  1YSC A;  2A9H A;  1MSW D;  2QE7 G;  1WLE A;  2P7T C;  4PDV A;  5B3S C;  1S0V A;  3CCR V;  1J95 A;  1WPX A;  1SER A;  1RPO A;  2DWE C;  2WLI B;  4ZBM A;  2R9R B;  2IU3 A;  2YEV A;  3OEH G;  4P2Z A;  3JD3 A;  3G6E V;  2ZXW C;  1DF5 A;  2Z3Y A;  3K06 A;  4LBE C;  4EKW A;  3K0D A;  4TSF G;  4ASU G;  3E35 A;  4MVO A;  1NH2 B;  2ZR2 A;  1AR1 B;  1IXM A;  3ML0 A;  1VQ8 V;  2Y48 A;  1FFT B;  2WAM A;  3CXC U;  3AG3 C;  4TWK A;  2WLN A;  1XL6 A;  2EZO A;  4RUF A;  3FYE B;  2NLJ C;  3SYQ A;  3QNE A;  1W0J G;  1OCZ C;  2V7Q G;  3ETD A;  1R3L C;  1FXV A;  4Q20 A;  2OTL V;  4UUJ C;  3UM7 A;  1AJP A;  1F23 A;  3CP1 A;  3ZIA G;  1PL0 A;  5B1A B;  3K04 A;  3SPI A;  3P32 A;  1M1K W;  5C93 A;  5L3B A;  5CA3 A;  4WFE A;  2UXN A;  1OCR B;  1ENV A;  3CC4 V;  3LDE A;  2A0L A;  2JDI G;  3E86 A;  4CBC A;  1FXK B;  4RAI A;  5EBM C;  1NQT A;  3CC2 V;  2EIL B;  1EZJ A;  1F4M A;  1NVP D;  2LFR A;  1R73 A;  1K73 W;  1MOF A;  1QBZ A;  1MG1 A;  3ZN0 A;  3F5W C;  1DTO A;  1OZ0 A;  3G4S V;  1VQP V;  3GB7 C;  1VQO V;  3CC7 V;  3BEH A;  2ZDI A;  3ZMT A;  2XOK G;  2JEX A;  4DO2 A;  1V55 C;  4UVB A;  3P30 A;  5B3S B;  4FK5 C;  3ZN1 A;  3W7T A;  5LGN A;  3OAA G;  2QTO A;  4JTA B;  3TET A;  2GHY A;  5B1B C;  2WSS G;  4RO2 A;  3OR6 C;  4N21 A;  2KB1 A;  1K3E A;  5EC1 C;  5L3F A;  3JD1 A;  4PA6 A;  2Y69 B;  4TT3 G;  4X88 A;  1VQ7 V;  1H8E G;  1F4N A;  3E8B A;  2ZR3 A;  3I56 V;  4QPJ A;  2W0F C;  3AG2 C;  2HFE C;  3ZMU A;  2ZD9 A;  5EK0 A;  1FXH A;  2WLH A;  4QE9 A;  1NR7 A;  4LP8 A;  3AG3 B;  4G2K A;  4FPP A;  1KC8 W;  3E83 A;  1OCZ B;  3AG1 B;  1YIJ V;  3ABT A;  5BZB A;  3FB7 C;  3LUT B;  4DXW A;  1W0K G;  1Q7Y W;  2F43 G;  5CN0 A;  2B1G A;  1AI6 A;  5DM6 V;  3RW0 A;  4PDL A;  4MVR A;  4KUM A;  3VBB A;  1KEC A;  3K79 A;  3ZMZ A;  3VOU A;  1NBM G;  4PDM A;  4WFB V;  2YSU B;  4JAU A;  4KP4 A;  3G71 V;  2WLL A;  4WFH A;  2AHY A;  5LGT A;  2ATK C;  1KP2 A;  1KP3 A;  3MD0 A;  3FKS G;  3T1C A;  3CCS V;  2CK3 G;  1NR1 A;  3R65 A;  2EIN C;  3SPC A;  4PA4 A;  2EBO A;  4GX1 A;  2WLJ A;  1S77 D;  1F51 A;  1H38 A;  1AJQ A;  2X0L A;  4MW8 A;  4R6Z A;  4PA7 A;  4X8A A;  5H6Q A;  4N23 A;  3OR7 C;  3T2M A;  5L3E A;  5LHH A;  4UVC A;  4PDR A;  5CBG A;  1PNK A;  3K03 A;  2P6J A;  2EIJ C;  2PI5 A;  5KUK A;  2IW5 A;  3ABL C;  5B1B B;  1AI7 A;  4HAM A;  2QM7 A;  5IY5 C;  2JEU A;  4MW3 A;  3E2E A;  4F4L A;  1ZWI C;  3ZRW B;  2GSM B;  4XDL A;  1SET A;  3LSQ A;  1G4Y B;  1RM1 B;  1R6K A;  2ITD C;  3E89 A;  1NKD A;  2IJI A;  2IH3 C;  4MTO A;  2DYR C;  1S72 V;  1E1R G;  5CMU A;  4GCZ A;  1DLB A;  1S3J A;  1DF4 A;  1HWY A;  1QR8 A;  4WFG A;  3ASO C;  4MSW C;  3AEI A;  4P30 A;  1JX9 A;  2Q68 A;  1QR9 A;  1VQ4 V;  3W7W A;  5DN6 G;  3FB8 C;  4GT1 A;  4Z1M G;  3PJS K;  3JYC A;  3B8N A;  2BOC C;  3K08 A;  4H33 A;  3E8F A;  4QJF B;  5IYC O;  1K9M W;  1I5Y A;  2IJH A;  5H6R A;  1K34 A;  4QIW F;  4QE7 A;  3UKM A;  4RQE A;  1W2B U;  3FB5 C;  4WCE V;  5EBW C;  2FTK A;  4G27 B;  3E8G A;  2EIN B;  3IGA C;  4FMT A;  1K4C C;  4MT8 A;  4MVQ A;  1QVG U;  2JIZ G;  2UXX A;  5B1N A;  2WLI A;  1H8H G;  4JYB A;  3HPL C;  1TUE B;  1GK9 A;  2B1I A;  3ETG A;  1V54 C;  1K5Q A;  1GKF A;  1AI4 A;  2EIK C;  2OT5 A;  4QPK A;  3CCV V;  5CBF A;  2QKS A;  3AG4 C;  2ITC C;  1M56 B;  2Q69 A;  3ABM C;  1E79 G;  1K97 A;  4XDK A;  5IY5 B;  4UV9 A;  3E8H A;  2C2A A;  2P67 A;  1VQ5 V;  1VQL V;  4JGS A;  2OTJ V;  3X2Q C;  5CBH A;  3ETE A;  3DGE A;  3NXS A;  3F7V C;  1M90 W;  4MVU A;  2XAJ A;  4JPR A;  3ASN C;  4R7C A;  1JJ2 U;  2QEX V;  3STZ C;  3CCU V;  2W6J G;  2ZXW B;  3JD2 A;  3QO8 A;  4KFM A;  4MVM A;  2Q67 A;  1PNL A;  2Z5U A;  1K7D A;  1SZT A;  3OMN B;  1L1F A;  3OMA B;  3RVZ A;  3STL C;  2R9I A;  1ARO P;  1FXK A;  1R3J C;  1Q86 W;  3OEE G;  1QVF U;  1PD3 A;  4MS2 A;  1UJW B;  3K0G A;  3CMA V;  1JCH A;  4PEL A;  1OCC C;  3SPJ A;  4RQF A;  3JCZ A;  3ZMV A;  3ZRX A;  1EBO A;  1Q81 W;  2EJR A;  5LHI A;  4HYO A;  2NNU A;  2XAQ A;  4U7O A;  3SYP A;  4JYC A;  2K1E A;  3EFF K;  4GX2 A;  2IU0 A;  3FB6 C;  5HFM A;  4R8C A;  3H01 A;  1P4R A;  1G8M A;  1Y4M A;  1JOY A;  4P9P A;  1JQ0 A;  5E1A C;  1VQ6 V;  5FL7 G;  5L3C A;  4H37 A;  4JAS A;  2X6A A;  3OM3 B;  4UXN A;  2PI4 A;  1COW G;  2HLD G;  1I5X A;  4XBF A;  1BHA A;  2WPD G;  3BY6 A;  3W7S A;  2Q6A A;  3TK1 A;  1OCO C;  2QM8 A;  4UV8 A;  3LNM B;  2XAF A;  2MK3 A;  2ZDI C;  3ABM B;  4BIZ A;  4UVA A;  5KA5 A;  3D3I A;  1S76 D;  1V55 B;  5B1A C;  2IH1 C;  4WFF A;  1YI2 V;  1K4D C;  1Y66 A;  4ZKI A;  3CCM V;  1CEZ A;  1M9N A;  2H94 A;  2BOB C;  4PA3 A;  4BAY A;  1YHQ V;  3AG2 B;  3D36 A;  4P9O A;  4RUE A;  2DYS C;  3CD6 V;  3SPG A;  5LGU A;  4JF3 A;  4BIU A;  1M57 C;  1CPY A;  1SRY A;  3A0R A;  3LSS A;  1NVP B;  1K8A W;  2WLM A;  4MTF A;  2LFS A;  2P90 A;  4J9Y B;  3RBZ A;  2HVJ C;  3CCQ V;  1YTF D;  4X89 A;  4LC1 A;  1XL4 A;  3T4D A;  2EIM C;  1VQN V;  4WFA V;  5EBL C;  4XDJ A;  3CCE V;  3SJQ C;  1ROP A;  3CME V;  2XND G;  1B6Q A;  3OE7 G;  3LDD A;  3CCJ V;  3OFN G;  2AHZ A;  2W6I G;  5IYD O;  1AI5 A;  4BW5 A;  2Y69 C;  1OHH G;  1VQ9 V;  2X7R B;  2EZP A;  3ZRW A;  3ABK C;  3LDC A;  1E1Q G;  5L3D A;  3M99 B;  4FJC C;  3ZRV A;  3GWO A;  4MTX A;  1K92 A;  1OCO B;  4JTD B;  1KQS U;  1R6N A;  3K3W A;  3AG1 C;  3ZRS A;  2WWW A;  3EHB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...