2HVKC

Crystal structure of the kcsa-fab-tba complex in high k+
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab heavy chain
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hvkC00
4HYOA 3STZC 3SYPA 2HVJC 4MTGA 4MVQA 1J95A 3AG2C 4OXSA 3STLC 3JYCA 4MVRA 2HJFC 3E8HA 4I9WA 2K1EA 4MVZA 5B1BC 5BZBA 3ABMC 2WLHA 3T1CA 5IY5C 4QE9A 3RVZA 2WLKA 2QKSA 3LDCA 4G27B 3SPGA 3ASNC 4BW5A 2EIMC 3K0GA 4GX2A 4P2ZA 4RUEA 5B1AC 5CBFA 3OR7C 3RBZA 4F4LA 3FB8C 4MTOA 2EIJC 3E8FA 4LP8A 3IFXA 4JTAB 2ATKC 2BOBC 2A9HA 2DWDC 3FB5C 5EBLC 3T4DA 3X2QC 5B3SC 2WLIA 2NLJC 2HG5C 5KUKA 1OCCC 2Q69A 2WLJA 3EFFK 3IGAC 3RW0A 4JTCB 4WFFA 3OUFA 1OCOC 5CBHA 2A79B 2EINC 2HVKC 4GX1A 4PDLA 4RUFA 3UKMA 3LNMB 3K08A 3K0DA 2ZD9A 4MS2A 4CBCA 3OR6C 1XL4A 4PDVA 2X6AA 2X6CA 3T4ZA 2WLLB 2DYSC 4MSWC 1M57C 2QTOA 4G28B 1XL6A 3E86A 2EIKC 2W0FC 3SPJA 3R65A 4KFMA 3HPLC 3FB7C 3ZJZA 3SYOA 2HFEC 2ZXWC 3TCUA 2BOCC 4WFHA 3E8BA 2OCCC 5EC1C 3SPCA 4LCUC 2ITDC 4RO2A 1KKDA 3K03A 3ABKC 4QE7A 1QLEC 4MVUA 2IH3C 2H8PC 2ITCC 3E89A 3SJQC 4MW8A 5EK0A 2EILC 3SYAA 3AG4C 3GB7C 1BL8A 4WFEA 4MVOA 4MTFA 1V55C 3OGCC 1R3LC 4PA6A 1M56C 2DYRC 2JK5C 2WLLA 3VOUA 4H37A 4MW3A 1G4YB 4GX0A 1R3JC 2R9RB 3OUSA 4MVMA 4DXWA 4PA3A 1OCZC 3F5WC 2AHZA 4R7CA 1ZWIC 5EBMC 4X88A 4P9PA 1ORQC 1R3KC 3FB6C 3LUTB 2KB1A 4H33A 4PA9A 1K4CC 3SPHA 3F7YC 3K04A 3ZRSA 3BEHA 4RAIA 3E8GA 4GX5A 5EBWC 3T2MA 2AHYA 1LNQA 2YEVA 2WLMA 4JTDB 3ABLC 2WLNA 2X6BA 1JVMA 1R3IC 2P7TC 4LBEC 4R8CA 4J9YB 4XDKA 4R6ZA 3LDDA 2WLIB 3LDEA 3E83A 4XDJA 5E1AC 4X89A 3RVYA 2IH1C 3UM7A 4XDLA 3SPIA 4X8AA 3SYQA 1V54C 4P30A 3K06A 1S5HC 4PA7A 1K4DC 3TETA 4PDMA 3WG7C 3PJSK 2DWEC 4MVSA 4WFGA 5J9PC 2Y69C 2Q68A 5KUMA 4PDRA 1P7BA 3AG1C 4EKWA 3ASOC 4ZBMA 4PA4A 4R50A 4HZ3A 4TWKA 2A0LA 2Q6AA 4P9OA 4UUJC 1OCRC 3SYCA 3AG3C 5EC2C 3F7VC 4J9ZB 2Q67A 5CBGA 4QNHB 3KG2A
chains in the Genus database with same CATH superfamily
2ADPA 3CCUV 4X65B 2OCHA 3CCJV 4B3MB 4O2BA 3T1CA 1OV9A 5KHHA 4PI0A 4FLZA 3ASNC 2YI8A 4QJFB 1CEZA 4P2ZA 3JD0A 4X1YB 2YIDA 3ZMSA 3CX5F 4UXNA 2ZDIC 1VMGA 2CTPA 1B06A 3K9AA 2V7QG 3CCSV 5BMVA 1TA8A 3ZRWA 2A79B 4RUFA 1W0KG 2BSKB 3IAYA 4N21A 1KYOF 3OR6C 3T4ZA 4LH6A 3RYCB 3LSQA 1SZTA 2EX3A 3DXRB 1VQ6V 2PTMA 4GT1A 2WPDG 1U97A 4I50B 2ITDC 3UQ8A 2Q8VA 4QE7A 1VQ7V 4N23A 3DC5A 2RJZA 2JGDA 5EK0A 2GHYA 1V54B 1H2KA 2OYQA 2QKCA 3W7UA 1AB3A 3QVNA 3F7YC 1E1QG 2ILMA 1BT8A 5FPOA 1Q90D 3UO3A 4U3JA 4LF5O 3OMNB 5FNVB 4XDKA 1FXKC 3C90A 3AK3A 4RQFA 4CC5A 3VQXA 3H1JH 1NZ6A 3ASOC 1H2NA 1R6NA 4P9OA 5DM6V 4FLVA 3LSSA 1SZXA 2LGQA 2ZR3A 4I5SA 1FXKA 3ZHRA 2OIEA 3AG2C 1VIBA 4KUMA 3JD2A 1DGSA 4RWUA 5FL7G 3KCYA 2CH7B 3L71H 3ABMC 1R6KA 1AI7A 2R9IA 5AG2A 1SQBH 3SPGA 1H38A 4BW5A 1XNQB 5IJ0B 1KKCA 3ZEDA 4UVBA 4ZHQB 4KP4A 3ZBHA 5FPRA 1K5QA 4MTOA 1AROP 2DQ3A 1Z2GA 3CC4V 1X59A 2DWDC 2E76B 2G38A 1THZA 3CPWU 2Y0PA 1OCCC 2WLJA 3C3TA 2UUCB 5EZYB 2AW9A 3KCXA 5DECA 5CBHA 2EZPA 4JAAA 1UPGA 3BFRA 2X6AA 2OIGA 1PNLA 1NT2B 3VQVA 2IBZH 3K9SA 2ZXWC 1SC5B 2BOCC 5JCOC 5LP6B 4LCUC 3THOA 1N32B 4O4LB 4D7SA 5GONB 1FFXA 1QLEC 4EFBA 1GM8A 3SYAA 2YEVB 5LHIA 1WAZA 3ZHUA 5JQGB 4IT5A 4DK0A 3H1HH 3APOA 4U7NA 3H1IH 3G6BA 3P3PA 4NYKA 5JCOA 5CA0B 2PI5A 3TGUH 3SPHA 1RSOB 1CXZB 5LA6B 4X62B 1JFFA 4DUYB 3MDSA 1VF6A 4GKKO 3HKCB 4B7EA 3N2KB 1N34B 4LFBO 3K06A 2Q5ZA 4DV6O 5J9PC 3J81N 4WFGA 3N2GB 1MMMA 5IJ9A 3W7XA 4CH3A 2EIMB 1HP8A 1BCCH 4KXRA 4TWKA 1SQPH 3ABTA 4F6RA 4O4HA 3QG5A 1VQLV 2IU3A 1XMOB 1EN6A 2HP8A 4AQYO 2HHHO 2E75B 3ABUA 4IIJB 2VQFO 1EN5A 4DR2B 5B1BC 2QDOA 1JR9A 4G27B 4JI7B 1P49A 1YEWA 4X64B 3OE7G 2Q7HA 2IJJA 3DGEA 1IBLO 3FB8C 4LP8A 4WBNB 3H1LH 4LF6B 3BRCA 2GTAA 3X2QC 1Q7YW 2CAZC 3PN1A 5C8YA 4DV1B 3LNNA 3RW0A 1XILA 2JVDA 1F4NA 1Y66A 1D2DA 2QJ1A 1IBMB 1K8AW 4LF4O 4D6TH 4DR7O 2LW7A 1XEQA 1IBKO 4JI0O 4GZRB 4KFMA 1F7YA 3CP1A 1HR0O 4ZI7A 5JJJB 4IHJA 1DLBA 3E35A 2ITCC 3FAVB 3E89A 1NI8A 3RFRA 3W7SA 1MZFA 3ML0A 3OGCC 1ZLZA 3WB2A 4IYIA 1M93A 2R9RB 5B1OA 2JEUA 3JASA 2NNUA 3L70H 4W4LA 2WA3A 2QEXV 3L73H 3K04A 2XAGA 5EBWC 1SERA 1BSMA 3TK1A 4LBEC 4LFCO 5LYJA 1MG1A 4NVPA 1LUVA 4O2AB 5BMVB 4DV0B 1YJWV 1OJHA 2IJHA 4EKWA 2UU9O 4HZ3A 2R72A 2L35A 2Q6AA 3CRMA 4HYOA 5LXTB 2ZQMA 3CJHA 3HKEB 3STLC 2JGDB 1GKFA 5BZBA 2UUAB 1GM9A 4X1KA 5IY5C 2UXBO 1MSDA 2VQEO 4YJ2A 5LHGA 4DV5O 1K92A 3RWRD 1Q86W 1GAXA 2XAQA 4JASA 1YSCA 2JRIA 2HG5C 4JAVA 1GMGA 2GV9A 1B6QA 2Q69A 1NR1A 1AR4A 2EINC 1RPOA 2QE7G 1VQPV 1FJGO 2M7WA 1HNWO 4G28B 3ETQA 2W0FC 1CPYA 5J2UB 3WU2Z 5BXZA 2JS5A 1XMQO 4DR1O 4YY3B 3UT5A 4X66B 3FX7A 2IH3C 1EN4A 4FFBB 1FXKB 1I5YA 3MHHC 4WFEA 1V55C 1S5LZ 3VOUA 4DR3B 4DUZB 3GWKC 1QBZA 1SQQH 4JI6O 3ASOB 3F5WC 4X88A 4GYCB 4NKGB 1K4CC 1PPJH 2UXNA 1NJIW 1FXVA 4LF9O 2ZNIA 4GCZA 2XOKG 2DOSA 4E4EA 3AG2B 4WF9V 4HNAB 5E1AC 3SPIA 1S0VA 3ETDA 3ABMB 4JI8O 1X4TA 1QR8A 3PJSK 3T1YO 2OT5A 1RM1B 1RP3B 1MNGA 1YJ9V 4B7KA 1AP6A 3D36C 5DN6G 4NTXA 4B3SB 3SJAC 1N36B 1XBLA 1OCCB 4LF8B 1K73W 3CMEV 3B2EE 2X0LA 5KX5A 2WLKA 3D36A 2EJ7A 1KP2A 1VF5B 2ZE6A 5B1AC 3OGIB 1HNXB 1VQNV 1Y74A 2ARHA 4JPRA 2CK3G 1QLEB 4DRXA 2ATKC 3T4DA 2BTOA 3HKDA 4I4TA 3K58A 3AG7A 4OPHA 3F5TA 4K0KB 4J41A 1GO3F 4MS2A 3W7TA 2DYSC 5JWPA 4BR6A 1A32A 1XL6A 4JF3A 3R65A 4JV5B 5CA3A 3RYIA 2OCCC 3SPCA 2FKXA 4RO2A 1KKDA 2LGWA 5LHHA 1YCIA 2GSMB 5GTHZ 3O9OA 3T1HO 3GB7C 5H6QA 4A5UB 1WLEA 1KU9A 1R3LC 1M5IA 1WA8A 3OTOO 4DR5B 2DE0X 2EULA 2P90A 1OCZC 3ZHQA 4B3RB 4LF7B 3LUTB 4CS3A 3CC2V 1VARA 3JD1A 4UV8A 5CMUA 5A9GA 2QSAA 4K3AA 4KHPO 4J80A 3ABLC 1R3IC 3S3WA 1H2LA 5D5QA 4DR4O 1WPXA 2Q73A 2IU0A 1ZL8B 5B1BB 1R1BA 3WG7C 2DWEC 3MAQA 1QLNA 3P30A 2Y69C 5GW7A 1KECA 1YHQV 4DV4B 1FXHA 2B9ZA 2LW1A 3JALB 4O4JB 1OCRC 3BHPA 3X2QB 4QNHB 3E22B 1VQ8V 4UCTA 2RNBA 3ZCCA 4MVZA 4J7JA 3CS5A 1JQ0A 2Y4TA 1XQ8A 2QKSA 3LDCA 2F4VB 2KG7B 3OEHG 3CEIA 2QR4A 3KKYA 2EJRA 4I55A 3OW2U 5KA6A 4CZZA 2IW5A 5B3SC 2JDIG 2YIBD 4GX1A 4LC1A 3Q4HA 4QPJA 5JH7B 5H9CA 3OFNG 1M57C 2QTOA 1XNRB 5IWAB 3JSLA 4DR6B 2WSSG 4LWSB 1WB7A 2PGGA 5BY1A 3A0BZ 3K03A 1D5NA 2IJKA 1JJOA 5EIBC 1M56B 1SA0B 4I0XB 1TVKB 3DTUB 1ZSPA 4FMTA 4X1KB 4B3TO 5D5PA 4P9PA 3FB6C 1V9PA 4H33A 1MABG 4EEQA 1WJZA 2P6JA 1UJWB 3BCCH 1MSWD 5LMUB 4EB6A 3L9DA 3VQYA 3G4SV 4XDJA 4X8AA 1JA8A 5IY5B 1FAFA 4X20B 4O4IB 3TXSA 1SESA 3HKBA 2A7WA 2F1MA 1MZEA 1J5EO 2XAHA 5ITZA 5LOVB 4TQFA 1K33A 3AK2A 1J95A 5KHGA 1H2MA 3JCUZ 4QPKA 3JYCA 2PYJA 4YHHB 2JS3A 4F6EA 5JVDB 1IURA 3JAKA 1I08A 2QTSA 1QCEA 4F4LA 3CCMV 5KLVH 4JTAB 1TUBB 2NLJC 4NTWA 1YF2A 2XT9A 4TQDA 1V55B 2QWOB 1N32O 1HDJA 3ICXA 2HLDG 1S76D 4JYAO 1ROPA 5KMGA 3HPLC 2YXLA 1PD3A 1T5EA 1VQ4V 3BY6A 4NXMO 5LMNB 3CSXA 3LSUA 4TV8B 3ABKC 4JI1O 1EBOA 2HKOA 1PNMA 2FB5A 2JK5C 1AJQA 1TUEB 2RQ6A 4LF5B 4GX0A 1Y76A 2H94A 3B8NA 4CH6A 4R7CA 4JI3O 2KB1A 1FS0G 4ZOLB 4TOIA 4U7OA 3A2FA 2AHYA 5CB4A 2V1DA 4JYYA 4DRXB 4UB6Z 3LDDA 4WFBV 4H0LB 1NS1A 1AI5A 5K1XA 3ZRXA 1SQFA 1K4DC 1SQGA 1VF6C 2X7RB 4PDMA 1VQMV 1YIJV 2F93B 1P7BA 4CH4A 4DV3O 5B1AB 4FLUA 1M9NA 3M8AA 2EZOA 3K5NA 3E2EA 1NKDA 2AZ0A 4X64O 5EIBD 3RGBA 4FZ1A 3JD4A 5IYZA 2BTQB 1PM9A 1YJNV 2OCCB 2QWQB 3H9VA 1L0LH 4BIZA 1BQ0A 3CRRA 2UXCO 1W2BU 1NU1H 2B1GA 3IGAC 3UO2A 1K3EA 3QTCA 4CBCA 3EXAA 1XL4A 1EZJA 3CMAV 1OCZB 2WLLB 1HNZO 1SF9A 2KKWA 4JI2O 3WB0A 3E86A 5KHIA 1QVFU 1JCHA 2CE4A 2YSUB 3TCUA 4LNUA 2KQXA 1ENVA 3E8BA 2F95B 3CWBH 4JZ2A 2ZIOA 4PHZA 4TUYB 3CD6V 1N0NA 5H6RA 3WG7B 4H13B 2Y69B 2VS0A 5J2TB 4GKKB 1ORQC 5H5NA 4DV6B 1PV0A 5BR8B 1Q8IA 3FKSG 3RYFB 3L72H 2Q0AA 3JD3A 4JYCA 1AJPA 3CYOA 4PA7A 4E2LA 4QGPA 1GRJA 4AQYB 2HHHB 1GN6A 3Q4HB 1I94B 4O2BB 2VQFB 2VWJA 3A0RA 4Z2WA 4J42A 3D8CA 4DW1A 2P06A 3AG3B 5EC2C 2Q67A 4MTXA 1AVMA 5E79Z 5B3SB 3WB1A 1S3JA 1EZVH 2AZ2A 1Q43A 4UV9A 4U3FH 1IBLB 1IDSA 2KSDA 4YJ3A 3ZMZA 5K1PA 3BA9A 3ZRWB 1D5AA 1M57B 4DV7O 3ASNB 4RUEA 1R73A 4B08A 2P5OA 3OR7C 3EVKA 2ZT9B 3IFXA 4LF4B 2A9HA 5H2FZ 4DR7B 2OTJV 2XUMA 4JI0B 1HR0B 4EB6B 4FZ0A 3K5MA 3OUFA 1OCOC 3B40A 3RN4A 2ADQB 1EM1A 1H8HG 1S72V 1SQXH 2CGOA 2UXDB 3SYOA 3CCLV 1DF5A 3K57A 2ZE5A 2QM8A 4MW8A 2QM4A 5ITZB 4U3JB 5HFLA 3VBBA 1JJ2U 4UCVA 1B04A 1N0JA 2W0XA 3H1KH 2R70A 3RYCA 3DXRA 1W0JG 1CP9A 4TSFG 4JI4O 2LFSA 4FVMA 1BMFG 4IGGA 3GWOA 4I50A 1BZKA 3N27A 1VQOV 3T2MA 4CC6A 3FYIB 3K5OA 2UU9B 3LDEA 2PYLA 1Q3EA 4P30A 4CH5A 3TETA 1FD9A 4PV1B 2L6LA 2ZR2A 4K35A 3FYEB 4LF8O 2ZKOA 4I9QA 1SETA 1WN7A 1QU7A 1P84F 4J7ZA 4J9ZB 4C7UA 1F51A 5FNVA 2VQEB 5JJEB 2V4DA 4DV5B 1JX9A 5KA5A 4I9WA 1XHZA 2WLHA 4FLTA 1GM7A 4AHCA 3CB2A 1QVGU 1NQTA 3ZRVA 1FJGB 3ABKB 4DK1A 2DMXA 3FB5C 1HNWB 4DV2O 2PY5A 1P4RA 1FFXB 2JGUA 2CDYA 2CH7A 1G1XB 4WFFA 3QNEA 1XMQB 4DR1B 2E5LB 1EFRG 1FFTB 2PZSA 1NTMH 3C3SA 2X6CA 3OD4A 5IJ0A 4ZHQA 3AK1A 2XASA 1WB8A 1AJNA 2ZXWB 1BS3A 5IYBO 4DR5O 1YVWA 4JI6B 3ZMUA 5HFMA 4PJ0Z 2W6IG 3B09A 1JFFB 5EZYA 4NXNO 4PD4F 3AEIA 1BL8A 4LF9B 2DYRC 4H37A 5L3DA 4MW3A 4JI5B 5IDJA 1R3JC 3JAWA 1YTFD 1K5SA 2XTAA 3OEEG 5LP6A 1YDXA 3VQWA 5IJ9B 1COWG 1K34A 5GONA 3E8GA 3T1YB 2EBOA 3SR2C 3U10A 4LFAB 3ETEA 2YEVA 1ZTEA 4F6RB 4O4HB 3HB3B 2JJ1G 2P7TC 4KL1A 1N33B 5KHJA 1OZ0A 4J9YB 1KBHA 3RVYA 5JQGA 2Z3YA 4BIOA 4GKJO 2PF4E 3SJCC 2M6YA 3ZIAG 5CA0A 5KAFZ 1RSOA 3S3XA 5LA6A 2GTSA 4DO2A 1KP3A 3CXCU 4PA4A 1M1KW 3IC9A 1GH6A 4K8XA 2D3OW 2ZM6O 4YIOA 4UCRA 2ZNJA 1JOYA 2FMLA 4MVQA 4ZIBA 4OXSA 5L3BA 5C8YB 4MVRA 2HJFC 4OX9O 3N2GA 4X1IA 4FLWA 2LFRA 3ZS8C 4PI2A 1LR1A 2P4KA 2FYUH 2AGAA 4GX2A 5LGTA 4X65O 3BABA 1BE3H 3ETGA 2XHBA 4ZI7B 3OM3B 4B3MO 3APQA 3B4SA 4IIJA 2WLIA 4BAYA 2ZE8A 1OHHG 4IHJB 2N05A 1NH2D 2OWOA 2DJVA 2XAFA 2Y4UA 3T1HB 1BQZA 5B66Z 2EIKC 3K79A 3RYHA 4OPAA 4WBNA 3QO5A 4NTYA 3JASB 2HFEC 2D2CB 3IC7A 4FFKA 2JEXA 1I0HA 2WAMA 3CRAA 5CA1A 2H8PC 1XREA 2EILC 4FLXA 1PNKA 3NXSA 1WP7A 2UXXA 5LYJB 1GN2A 1GK9A 4KHPB 3JATA 3CE2A 4L8JA 3BA8A 2YUAA 5EBMC 4DR4B 2GUZA 4I7ZB 3BEHA 3FAVA 1LNQA 2XNDG 1F4MA 2BE3A 2LO1A 2YI9A 4G2KA 2FL4A 4FLYA 3CJHB 3I55V 1YTFB 2UUBB 3AG1C 2JIZG 3BAAA 1VQKV 4ZBMA 1W59A 4YJ2B 4YHHO 2A3QA 5CBGA 3R66A 2W6JG 3A0HZ 3STZC 1M90W 3K3WA 4O2AA 1GN3A 2LJ2A 3OMAB 5L3EA 2Q7EA 1OCOB 3OAAG 1B3QA 1DF4A 2F66C 3E8HA 4HBNA 3U0ZA 3BVOA 2O57A 1K97A 2GBOA 2B1IA 3K0GA 5CBFA 2ZDIA 3BPZA 1VQ5V 5LXTA 2EIJC 3QO7A 2Z0AA 3HKEA 2C2AA 3UT5B 5KUKA 4Q6GA 5LL6Y 1XHXA 3GVMA 1XNQO 4ABMA 2EINB 4WCEV 5LMNO 3K08A 1PP9H 3JCZA 1IZ3A 4MSWC 1N4CA 1Q6IA 2LQTA 3SPJA 3ZJZA 2UUCO 2ETNA 4B3TB 3SJQC 3AG4C 1NH2B 4MVOA 3L74H 4PA6A 3JSNA 3OTFA 3SGIA 1Z5WA 1L0NH 3OUSA 4MVMA 2RCVA 5J2UA 5LGUA 1K7DA 4RAIA 1SS3A 4FFBA 3ZX6A 4JTDB 3FD9A 3CCVV 1AI4A 2Q7GA 4TV9A 5TISZ 3U11A 4X62O 4XBFA 1J5EB 4DUYO 5LBQA 5EYPA 4PDRA 3TXQA 1RM1C 1Q81W 5KX5B 4R50A 4GLXA 2A0LA 1QNMA 1N34O 5F2VO 1FYJA 4HNAA 1Y74B 4MT8A 2ZE7A 1DK1A 3HKDB 4I4TB 3NR7A 3I56V 2DN9A 4QE9A 3J80N 2P67A 1XMOO 3JAWB 1IXMA 4ASUG 3TJTA 2QWPB 1MOFA 2XAJA 1YI2V 2LP7A 1O9GA 2IJIA 4DR2O 2BOBC 5IYCO 5EBLC 3RYIB 4JYAB 4Q20A 3CC7V 4JI7O 5IE9A 5L3CA 2R9AA 2DYRB 4NXMB 1H2SB 1H2GA 2HVKC 3ZHTA 2Z5UA 2ZD9A 5CN0A 4LF6O 1URFA 1WA8B 2DYSB 4JI1B 2Y0IA 1Z5VA 4DV1O 2Q4PA 2VRZA 4ICGA 1HWYA 4EFEA 2HEPA 4WFAV 4ZKIA 5EC1C 1ZAUA 1U96A 3DSQA 1IBMO 2F43G 4JI3B 2OTLV 4BWAA 4TT3G 1GN4A 4UCOA 5BR8O 1G4YB 4PELA 4OGQB 1PL4A 4PA3A 3JARA 1G6UA 4X1IB 1ZWIC 4JZGA 4FM2A 3SDLA 4UVCA 3ZRSA 1RFYA 4DV3B 3ABLB 1AI6A 1I94O 4J7KA 1NBMG 2WLIB 4BIUA 3UM7A 2P22C 1S5JA 1WP8A 3CXHF 1I5XA 2NR5A 3EHBB 1IXBA 2GDSA 1E79G 1KB9F 2RDCA 4Z1MG 5GTIZ 1M4UA 5L3FA 1BHAA 4LFBB 1OCRB 3RYHB 2PI4A 5LGNA 4RQEA 5L3GA 2MK3A 4DV0O 5JJNB 1Y6XA 4I55B 1ZL8A 5CA1B 1L8DA 3B8MA 4W4KA 1FKAO 2UXCB 2DQ0A 1H8EG 1AR5A 3JALA 3JATB 2EIKB 4O4JA 1RPRA 2ZINA 3CRQA 3M99B 1F23A 1Y4MA 2A06H 4YIPA 2GUZB 3RBZA 3G67A 3E22A 2B5UA 5DEDA 5FLXN 2UUAO 1HNZB 4JI2B 3K5LA 2N04A 1NTKH 2EILB 3J7AU 2ODMA 4IYHA 2UXDO 1KUQA 4PDLA 2HR3A 2KG7A 1UFIA 3LNMB 1Y67A 1NR7A 3K0DA 2CTRA 2YIAA 1ZUQA 2ZCEA 4DW0A 1VQ9V 3CRCA 3G6EV 1XUQA 3JAMN 3CCEV 4MVUA 1IBKB 4MTFA 1M56C 3L75H 4LH7A 5JH7A 4FM1A 4YY3O 3D3IA 3WFVA 5B5EZ 3AG1B 1IVSA 4X66O 1XI1A 2K9PA 1R3KC 4LWSA 4X1YA 2QM7A 2MW2B 1E1RG 1XDCA 4DR3O 4K8ZA 5C93A 1JMKC 4DUZO 4X9QA 3H01A 3HKBB 4J10A 2WLNA 1G8MA 1JVMA 2IM9A 3E83A 1SA0A 4JAUA 2IH1C 4I0XA 1V54C 1TVKA 2BSKA 3QF7A 4HAMA 4LFCB 3P32A 1N8RW 2N74A 2EIJB 2YICA 4FPPA 3JAKB 4DV7B 4YXWG 3D3QA 1K9MW 2HVJC 1TGOA 4MTGA 2RMKB 3MHSC 2K1EA 4B3SO 4X20A 4O4IA 2QGNA 1N36O 2YXYA 2HJDA 1SKVA 4UCSA 2YDEA 2DW4A 1KMIZ 3RT3C 2E5LO 1LUWA 5KMGB 5LOVA 1NTZH 1Q6HA 2UXBB 4NB5A 1US6A 3AG4B 2QA4V 3EFFK 1HNXO 3UKMA 4TV9B 3K59A 4NR1A 5KHKA 4FIPC 5JVDA 4FK5C 1Y76B 3MD0A 5EYPB 1VEWA 1TUBA 4K0KO 3W7WA 4JI5O 3OT7A 2Y48A 1NVPD 1SRYA 3M7MX 5B1NA 3OMIB 4JI4B 2WA4A 2CUGA 3UCSC 3ZMTA 3O65A 5CB4B 1MA1A 2JJ2G 3CCRV 1TAEA 4FJCC 4JV5O 2RN9A 4LFAO 1I7FA 1QQCA 4DXWA 2QWRB 1N33O 1Q5OA 1YZBA 1HW7A 4PA9A 1GTOA 2YXHA 4TV8A 4GX5A 1IX9A 3HR0A 5LP6C 2YIBA 3ZHVA 2X6BA 3SYQA 4R8CA 1YITV 4R6ZA 5IYDO 3G80A 1R6TA 4X89A 4LF7O 1VF7A 4B3RO 3B77A 5IT9N 1S5HC 2Q68A 5KUMA 2QWNB 4LR3A 4ZOLA 3ZMVA 4CS2A 5IYZB 4UUJC 2VWKA 1KD1W 3SYCA 4O4LA 4L87A 2CTQA 3F7VC 4JI8B 1SQVH 1YXBA 2FTKA 3ZN1A 4AI8A 4DYLA 3SYPA 4CS4A 4FM0A 4DV4O 4UFZA 2NN4A 4QIWF 1Q6UA 4AILC 1BHBA 1QHTA 3RVZA 4DV2B 3DC6A 3P3NA 2E3CA 2E74B 2EIMC 3JARB 1P7GA 3I5DA 2BCCH 3A8TA 3E8FA 3CHXA 3SJBC 4LNUB 4Z1VA 3HKCA 4IL6Z 2F4VO 3N2KA 4BW9A 4JGSA 4JTCB 2P4VA 2BTQA 1PL0A 2YC0A 4PDVA 4GUNA 4NXNB 1XOUA 3FB7C 2Q0OC 4WFHA 1KQSU 2CTWA 3G71V 1BGYH 2AXTZ 1XNRO 1QR9A 5IWAO 3ZN0A 5A2QN 1WPBA 3IJ4A 2WLLA 4H44B 4DR6O 3ZHSA 1S77D 1PKXA 2H3OA 3KZIZ 4UCUA 2AHZA 4JYBA 1AR1B 4GKJB 1Q82W 1VP7A 3OTOB 1O9HA 3QO8A 1KC8W 4J11A 1FPOA 2YS8A 1NVPB 4TUYA 2WLMA 2UUBO 1JPXA 2CGNA 2PUSA 2QKAA 4XDLA 5J2TA 1AP5A 1DTOA 4MVSA 1ZX3A 4UVAA 2ZM6B 2ZIMA 4YJ3B 2Q9LA 3FFQA 3CCQV 5LMUO 1L1FA 2WWWA 4OX9B 2F23A 3AG3C 1AILA 4UB8Z 4D7TA 1WNSA 5KAIZ 3RYFA 3KG2A
chains in the Genus database with same CATH topology
1S3JA 4MT8A 1OCCB 3CCUV 4UV9A 1K73W 3I56V 3CMEV 2X0LA 3CCJV 3ZMZA 3T1CA 4QE9A 3ZRWB 2P67A 2WLKA 1M57B 3D36A 3ASNB 3ASNC 1IXMA 4ASUG 4QJFB 1KP2A 1CEZA 4P2ZA 4RUEA 5B1AC 1R73A 1MOFA 3JD0A 2XAJA 3OR7C 1YI2V 1VQNV 2LP7A 4JPRA 2IJIA 3IFXA 3ZMSA 2CK3G 1QLEB 2ATKC 2BOBC 2A9HA 3T4DA 5IYCO 5EBLC 2OTJV 4UXNA 2ZDIC 4Q20A 3CC7V 5L3CA 3K9AA 2V7QG 3CCSV 2DYRB 3OUFA 1OCOC 3ZRWA 2A79B 1GO3F 1H2GA 1W0KG 2HVKC 4RUFA 2Z5UA 4N21A 2ZD9A 4MS2A 5CN0A 3OR6C 3W7TA 1H8HG 1S72V 3T4ZA 2DYSB 2DYSC 3LSQA 1SZTA 1XL6A 1VQ6V 4JF3A 3R65A 4GT1A 1HWYA 3SYOA 4WFAV 4ZKIA 3CCLV 2WPDG 1DF5A 3SPCA 2OCCC 5EC1C 5CA3A 2ITDC 4RO2A 1KKDA 5LHHA 4QE7A 2GSMB 2F43G 2QM8A 4N23A 1VQ7V 2OTLV 4MW8A 5EK0A 5HFLA 3VBBA 1JJ2U 2GHYA 1V54B 3GB7C 5H6QA 1WLEA 1R3LC 4TT3G 1G4YB 4PELA 1W0JG 2P90A 1CP9A 4TSFG 4PA3A 1OCZC 1ZWIC 2LFSA 3W7UA 1BMFG 3GWOA 3LUTB 3CC2V 3F7YC 3JD1A 4UV8A 5CMUA 4UVCA 1E1QG 3ZRSA 1VQOV 3T2MA 3OMNB 3ABLB 1AI6A 3ABLC 3FYIB 1R3IC 4XDKA 1NBMG 2WLIB 3LDEA 4BIUA 3UM7A 1WPXA 1FXKC 2IU0A 4P30A 5B1BB 4RQFA 3TETA 3WG7C 1I5XA 2DWEC 1QLNA 3P30A 2ZR2A 3EHBB 2Y69C 5GW7A 1KECA 1YHQV 1E79G 3FYEB 1FXHA 3ASOC 4Z1MG 1SETA 5L3FA 1BHAA 1R6NA 1OCRB 1OCRC 4P9OA 5DM6V 2PI4A 4J9ZB 5LGNA 1F51A 4RQEA 5L3GA 3X2QB 4QNHB 3LSSA 2MK3A 2ZR3A 4I5SA 1FXKA 1VQ8V 3B8MA 3AG2C 1JX9A 4KUMA 5KA5A 3JD2A 4I9WA 5FL7G 3ZCCA 4MVZA 3ABMC 2WLHA 2DQ0A 1JQ0A 1H8EG 1R6KA 1GM7A 2QKSA 3LDCA 1AI7A 2R9IA 2EIKB 3SPGA 1H38A 1RPRA 3M99B 4BW5A 1F23A 1Y4MA 3OEHG 1QVGU 1NQTA 4UVBA 3ZRVA 4KP4A 3RBZA 1K5QA 4MTOA 2B5UA 1AROP 2DQ3A 2EJRA 3OW2U 3CC4V 3ABKB 5KA6A 3FB5C 4CZZA 2DWDC 2IW5A 5B3SC 1THZA 2JDIG 2EILB 1P4RA 3CPWU 1OCCC 2WLJA 4WFFA 3QNEA 5CBHA 1EFRG 4GX1A 2EZPA 4PDLA 2HR3A 1FFTB 3LNMB 4LC1A 1NR7A 3K0DA 2X6AA 4QPJA 2X6CA 1PNLA 5H9CA 3OFNG 1M57C 2QTOA 2XASA 1VQ9V 1AJNA 2ZXWB 2ZXWC 5IYBO 2BOCC 2WSSG 3ZMUA 4LCUC 3G6EV 5HFMA 2W6IG 3K03A 3CCEV 1QLEC 4MVUA 1GM8A 2IJKA 3SYAA 2YEVB 5LHIA 3AEIA 1BL8A 4MTFA 1M56B 1M56C 2DYRC 4H37A 5L3DA 4MW3A 5IDJA 3D3IA 1R3JC 3DTUB 3WFVA 1YTFD 3AG1B 4FMTA 1K5SA 3OEEG 4U7NA 4P9PA 1R3KC 3FB6C 2PI5A 4H33A 2QM7A 3SPHA 1COWG 1K34A 1MABG 1E1RG 3E8GA 2P6JA 2EBOA 1UJWB 5C93A 3ETEA 1MSWD 2YEVA 3H01A 2WLNA 3HB3B 1G8MA 1JVMA 2JJ1G 2P7TC 1OZ0A 4J9YB 3G4SV 4XDJA 3E83A 4JAUA 3RVYA 2IH1C 2Z3YA 4X8AA 1V54C 3K06A 5IY5B 3ZIAG 5J9PC 4WFGA 4HAMA 3W7XA 2EIMB 3P32A 3CXCU 4DO2A 1N8RW 1KP3A 1M1KW 4PA4A 4TWKA 2EIJB 3ABTA 4FPPA 1SESA 1VQLV 2IU3A 2XAHA 4YXWG 2D3OW 1K9MW 2HVJC 1K33A 1JOYA 4MTGA 4MVQA 1J95A 3ABUA 4OXSA 5L3BA 3MHSC 4QPKA 3JYCA 4MVRA 2HJFC 2K1EA 5B1BC 2LFRA 4G27B 3OE7G 4GX2A 5LGTA 2DW4A 2IJJA 3DGEA 4F4LA 1QCEA 3FB8C 4LP8A 3ETGA 4JTAB 3CCMV 3OM3B 3X2QC 2WLIA 2NLJC 4BAYA 1Q7YW 1OHHG 3AG4B 2QA4V 3EFFK 3RW0A 1V55B 1NH2D 1F4NA 1Y66A 3UKMA 1K8AW 4FIPC 2XAFA 4FK5C 2HLDG 1S76D 3MD0A 2EIKC 3K79A 1ROPA 4KFMA 3HPLC 3CP1A 3QO5A 2HFEC 1PD3A 1VQ4V 3BY6A 3IC7A 3W7WA 2Y48A 2JEXA 1DLBA 2WAMA 3ABKC 1NVPD 1SRYA 3E35A 3OMIB 5B1NA 2H8PC 2ITCC 3E89A 2EILC 1EBOA 3ZMTA 3W7SA 1PNKA 3NXSA 2HKOA 3ML0A 2JJ2G 3CCRV 1PNMA 3OGCC 2JK5C 1AJQA 1TUEB 4FJCC 2UXXA 1GK9A 4GX0A 2R9RB 5B1OA 2H94A 2JEUA 3B8NA 4DXWA 4R7CA 5EBMC 2NNUA 2KB1A 4PA9A 2QEXV 1GTOA 1FS0G 3K04A 4U7OA 2XAGA 3BEHA 4GX5A 5EBWC 2AHYA 1LNQA 1SERA 2XNDG 2V1DA 1F4MA 3TK1A 2X6BA 3SYQA 4LBEC 4R8CA 1YITV 4R6ZA 3LDDA 5IYDO 4WFBV 4G2KA 4X89A 3B77A 1MG1A 1AI5A 3ZRXA 1S5HC 1K4DC 3I55V 2X7RB 1VQMV 4PDMA 1YIJV 1YTFB 1YJWV 2Q68A 2IJHA 5KUMA 1P7BA 3AG1C 4EKWA 2JIZG 3ZMVA 1VQKV 4ZBMA 5B1AB 1M9NA 4HZ3A 2Q6AA 2EZOA 4UUJC 1KD1W 3SYCA 4L87A 3F7VC 5CBGA 2FTKA 3ZN1A 2W6JG 3E2EA 4HYOA 3STZC 1NKDA 3SYPA 2ZQMA 1M90W 3K3WA 3OMAB 5L3EA 3STLC 1OCOB 3OAAG 1GKFA 1DF4A 3E8HA 4QIWF 5BZBA 1BHBA 1GM9A 3JD4A 5IY5C 1K97A 3RVZA 5LHGA 2EIMC 1K92A 2B1IA 3K0GA 1Q86W 1YJNV 5CBFA 2OCCB 2ZDIA 1VQ5V 2EIJC 3E8FA 3QO7A 4BIZA 2XAQA 4JASA 1YSCA 2C2AA 2HG5C 4JAVA 1GMGA 1W2BU 5KUKA 1B6QA 2Q69A 2B1GA 1NR1A 3IGAC 4JGSA 1K3EA 4JTCB 2EINB 2EINC 4WCEV 1RPOA 2QE7G 3K08A 1VQPV 4CBCA 1PL0A 1XL4A 1EZJA 4PDVA 3CMAV 1OCZB 3JCZA 2WLLB 4MSWC 2M7WA 4G28B 3E86A 2W0FC 3SPJA 1CPYA 1QVFU 1JCHA 2YSUB 3FB7C 3ZJZA 3TCUA 4WFHA 1ENVA 3E8BA 1KQSU 3G71V 2IH3C 3SJQC 3CD6V 1QR9A 3AG4C 1FXKB 5H6RA 3ZN0A 1NH2B 1I5YA 3MHHC 4MVOA 4WFEA 1V55C 4PA6A 3WG7B 2WLLA 3VOUA 1QBZA 2Y69B 1PKXA 1S77D 3OUSA 4MVMA 3ASOB 5LGUA 3F5WC 2AHZA 4JYBA 1AR1B 4X88A 1ORQC 1K7DA 1Q82W 1K4CC 2UXNA 1NJIW 1FXVA 3QO8A 4RAIA 1KC8W 4GCZA 2XOKG 1NVPB 2WLMA 4JTDB 3FKSG 3AG2B 1JPXA 4WF9V 3JD3A 5E1AC 3CCVV 4XDLA 1AI4A 3SPIA 4JYCA 1S0VA 1AJPA 3CYOA 4PA7A 3ETDA 3ABMB 4E2LA 4XBFA 1DTOA 1QR8A 3PJSK 4MVSA 5LBQA 2OT5A 4UVAA 4PDRA 1RM1B 1RM1C 3CCQV 1Q81W 1L1FA 1YJ9V 4R50A 3A0RA 2WWWA 2A0LA 5DN6G 3AG3B 3AG3C 5EC2C 2Q67A 4MTXA 5B3SB 3KG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYO A;  3STZ C;  3SYP A;  2HVJ C;  4MTG A;  4MVQ A;  1J95 A;  3AG2 C;  4OXS A;  3STL C;  3JYC A;  4MVR A;  2HJF C;  3E8H A;  4I9W A;  2K1E A;  4MVZ A;  5B1B C;  5BZB A;  3ABM C;  2WLH A;  3T1C A;  5IY5 C;  4QE9 A;  3RVZ A;  2WLK A;  2QKS A;  3LDC A;  4G27 B;  3SPG A;  3ASN C;  4BW5 A;  2EIM C;  3K0G A;  4GX2 A;  4P2Z A;  4RUE A;  5B1A C;  5CBF A;  3OR7 C;  3RBZ A;  4F4L A;  3FB8 C;  4MTO A;  2EIJ C;  3E8F A;  4LP8 A;  3IFX A;  4JTA B;  2ATK C;  2BOB C;  2A9H A;  2DWD C;  3FB5 C;  5EBL C;  3T4D A;  3X2Q C;  5B3S C;  2WLI A;  2NLJ C;  2HG5 C;  5KUK A;  1OCC C;  2Q69 A;  2WLJ A;  3EFF K;  3IGA C;  3RW0 A;  4JTC B;  4WFF A;  3OUF A;  1OCO C;  5CBH A;  2A79 B;  2EIN C;  2HVK C;  4GX1 A;  4PDL A;  4RUF A;  3UKM A;  3LNM B;  3K08 A;  3K0D A;  2ZD9 A;  4MS2 A;  4CBC A;  3OR6 C;  1XL4 A;  4PDV A;  2X6A A;  2X6C A;  3T4Z A;  2WLL B;  2DYS C;  4MSW C;  1M57 C;  2QTO A;  4G28 B;  1XL6 A;  3E86 A;  2EIK C;  2W0F C;  3SPJ A;  3R65 A;  4KFM A;  3HPL C;  3FB7 C;  3ZJZ A;  3SYO A;  2HFE C;  2ZXW C;  3TCU A;  2BOC C;  4WFH A;  3E8B A;  2OCC C;  5EC1 C;  3SPC A;  4LCU C;  2ITD C;  4RO2 A;  1KKD A;  3K03 A;  3ABK C;  4QE7 A;  1QLE C;  4MVU A;  2IH3 C;  2H8P C;  2ITC C;  3E89 A;  3SJQ C;  4MW8 A;  5EK0 A;  2EIL C;  3SYA A;  3AG4 C;  3GB7 C;  1BL8 A;  4WFE A;  4MVO A;  4MTF A;  1V55 C;  3OGC C;  1R3L C;  4PA6 A;  1M56 C;  2DYR C;  2JK5 C;  2WLL A;  3VOU A;  4H37 A;  4MW3 A;  1G4Y B;  4GX0 A;  1R3J C;  2R9R B;  3OUS A;  4MVM A;  4DXW A;  4PA3 A;  1OCZ C;  3F5W C;  2AHZ A;  4R7C A;  1ZWI C;  5EBM C;  4X88 A;  4P9P A;  1ORQ C;  1R3K C;  3FB6 C;  3LUT B;  2KB1 A;  4H33 A;  4PA9 A;  1K4C C;  3SPH A;  3F7Y C;  3K04 A;  3ZRS A;  3BEH A;  4RAI A;  3E8G A;  4GX5 A;  5EBW C;  3T2M A;  2AHY A;  1LNQ A;  2YEV A;  2WLM A;  4JTD B;  3ABL C;  2WLN A;  2X6B A;  1JVM A;  1R3I C;  2P7T C;  4LBE C;  4R8C A;  4J9Y B;  4XDK A;  4R6Z A;  3LDD A;  2WLI B;  3LDE A;  3E83 A;  4XDJ A;  5E1A C;  4X89 A;  3RVY A;  2IH1 C;  3UM7 A;  4XDL A;  3SPI A;  4X8A A;  3SYQ A;  1V54 C;  4P30 A;  3K06 A;  1S5H C;  4PA7 A;  1K4D C;  3TET A;  4PDM A;  3WG7 C;  3PJS K;  2DWE C;  4MVS A;  4WFG A;  5J9P C;  2Y69 C;  2Q68 A;  5KUM A;  4PDR A;  1P7B A;  3AG1 C;  4EKW A;  3ASO C;  4ZBM A;  4PA4 A;  4R50 A;  4HZ3 A;  4TWK A;  2A0L A;  2Q6A A;  4P9O A;  4UUJ C;  1OCR C;  3SYC A;  3AG3 C;  5EC2 C;  3F7V C;  4J9Z B;  2Q67 A;  5CBG A;  4QNH B;  3KG2 A; 
#chains in the Genus database with same CATH topology
 2ADP A;  3CCU V;  4X65 B;  2OCH A;  3CCJ V;  4B3M B;  4O2B A;  3T1C A;  1OV9 A;  5KHH A;  4PI0 A;  4FLZ A;  3ASN C;  2YI8 A;  4QJF B;  1CEZ A;  4P2Z A;  3JD0 A;  4X1Y B;  2YID A;  3ZMS A;  3CX5 F;  4UXN A;  2ZDI C;  1VMG A;  2CTP A;  1B06 A;  3K9A A;  2V7Q G;  3CCS V;  5BMV A;  1TA8 A;  3ZRW A;  2A79 B;  4RUF A;  1W0K G;  2BSK B;  3IAY A;  4N21 A;  1KYO F;  3OR6 C;  3T4Z A;  4LH6 A;  3RYC B;  3LSQ A;  1SZT A;  2EX3 A;  3DXR B;  1VQ6 V;  2PTM A;  4GT1 A;  2WPD G;  1U97 A;  4I50 B;  2ITD C;  3UQ8 A;  2Q8V A;  4QE7 A;  1VQ7 V;  4N23 A;  3DC5 A;  2RJZ A;  2JGD A;  5EK0 A;  2GHY A;  1V54 B;  1H2K A;  2OYQ A;  2QKC A;  3W7U A;  1AB3 A;  3QVN A;  3F7Y C;  1E1Q G;  2ILM A;  1BT8 A;  5FPO A;  1Q90 D;  3UO3 A;  4U3J A;  4LF5 O;  3OMN B;  5FNV B;  4XDK A;  1FXK C;  3C90 A;  3AK3 A;  4RQF A;  4CC5 A;  3VQX A;  3H1J H;  1NZ6 A;  3ASO C;  1H2N A;  1R6N A;  4P9O A;  5DM6 V;  4FLV A;  3LSS A;  1SZX A;  2LGQ A;  2ZR3 A;  4I5S A;  1FXK A;  3ZHR A;  2OIE A;  3AG2 C;  1VIB A;  4KUM A;  3JD2 A;  1DGS A;  4RWU A;  5FL7 G;  3KCY A;  2CH7 B;  3L71 H;  3ABM C;  1R6K A;  1AI7 A;  2R9I A;  5AG2 A;  1SQB H;  3SPG A;  1H38 A;  4BW5 A;  1XNQ B;  5IJ0 B;  1KKC A;  3ZED A;  4UVB A;  4ZHQ B;  4KP4 A;  3ZBH A;  5FPR A;  1K5Q A;  4MTO A;  1ARO P;  2DQ3 A;  1Z2G A;  3CC4 V;  1X59 A;  2DWD C;  2E76 B;  2G38 A;  1THZ A;  3CPW U;  2Y0P A;  1OCC C;  2WLJ A;  3C3T A;  2UUC B;  5EZY B;  2AW9 A;  3KCX A;  5DEC A;  5CBH A;  2EZP A;  4JAA A;  1UPG A;  3BFR A;  2X6A A;  2OIG A;  1PNL A;  1NT2 B;  3VQV A;  2IBZ H;  3K9S A;  2ZXW C;  1SC5 B;  2BOC C;  5JCO C;  5LP6 B;  4LCU C;  3THO A;  1N32 B;  4O4L B;  4D7S A;  5GON B;  1FFX A;  1QLE C;  4EFB A;  1GM8 A;  3SYA A;  2YEV B;  5LHI A;  1WAZ A;  3ZHU A;  5JQG B;  4IT5 A;  4DK0 A;  3H1H H;  3APO A;  4U7N A;  3H1I H;  3G6B A;  3P3P A;  4NYK A;  5JCO A;  5CA0 B;  2PI5 A;  3TGU H;  3SPH A;  1RSO B;  1CXZ B;  5LA6 B;  4X62 B;  1JFF A;  4DUY B;  3MDS A;  1VF6 A;  4GKK O;  3HKC B;  4B7E A;  3N2K B;  1N34 B;  4LFB O;  3K06 A;  2Q5Z A;  4DV6 O;  5J9P C;  3J81 N;  4WFG A;  3N2G B;  1MMM A;  5IJ9 A;  3W7X A;  4CH3 A;  2EIM B;  1HP8 A;  1BCC H;  4KXR A;  4TWK A;  1SQP H;  3ABT A;  4F6R A;  4O4H A;  3QG5 A;  1VQL V;  2IU3 A;  1XMO B;  1EN6 A;  2HP8 A;  4AQY O;  2HHH O;  2E75 B;  3ABU A;  4IIJ B;  2VQF O;  1EN5 A;  4DR2 B;  5B1B C;  2QDO A;  1JR9 A;  4G27 B;  4JI7 B;  1P49 A;  1YEW A;  4X64 B;  3OE7 G;  2Q7H A;  2IJJ A;  3DGE A;  1IBL O;  3FB8 C;  4LP8 A;  4WBN B;  3H1L H;  4LF6 B;  3BRC A;  2GTA A;  3X2Q C;  1Q7Y W;  2CAZ C;  3PN1 A;  5C8Y A;  4DV1 B;  3LNN A;  3RW0 A;  1XIL A;  2JVD A;  1F4N A;  1Y66 A;  1D2D A;  2QJ1 A;  1IBM B;  1K8A W;  4LF4 O;  4D6T H;  4DR7 O;  2LW7 A;  1XEQ A;  1IBK O;  4JI0 O;  4GZR B;  4KFM A;  1F7Y A;  3CP1 A;  1HR0 O;  4ZI7 A;  5JJJ B;  4IHJ A;  1DLB A;  3E35 A;  2ITC C;  3FAV B;  3E89 A;  1NI8 A;  3RFR A;  3W7S A;  1MZF A;  3ML0 A;  3OGC C;  1ZLZ A;  3WB2 A;  4IYI A;  1M93 A;  2R9R B;  5B1O A;  2JEU A;  3JAS A;  2NNU A;  3L70 H;  4W4L A;  2WA3 A;  2QEX V;  3L73 H;  3K04 A;  2XAG A;  5EBW C;  1SER A;  1BSM A;  3TK1 A;  4LBE C;  4LFC O;  5LYJ A;  1MG1 A;  4NVP A;  1LUV A;  4O2A B;  5BMV B;  4DV0 B;  1YJW V;  1OJH A;  2IJH A;  4EKW A;  2UU9 O;  4HZ3 A;  2R72 A;  2L35 A;  2Q6A A;  3CRM A;  4HYO A;  5LXT B;  2ZQM A;  3CJH A;  3HKE B;  3STL C;  2JGD B;  1GKF A;  5BZB A;  2UUA B;  1GM9 A;  4X1K A;  5IY5 C;  2UXB O;  1MSD A;  2VQE O;  4YJ2 A;  5LHG A;  4DV5 O;  1K92 A;  3RWR D;  1Q86 W;  1GAX A;  2XAQ A;  4JAS A;  1YSC A;  2JRI A;  2HG5 C;  4JAV A;  1GMG A;  2GV9 A;  1B6Q A;  2Q69 A;  1NR1 A;  1AR4 A;  2EIN C;  1RPO A;  2QE7 G;  1VQP V;  1FJG O;  2M7W A;  1HNW O;  4G28 B;  3ETQ A;  2W0F C;  1CPY A;  5J2U B;  3WU2 Z;  5BXZ A;  2JS5 A;  1XMQ O;  4DR1 O;  4YY3 B;  3UT5 A;  4X66 B;  3FX7 A;  2IH3 C;  1EN4 A;  4FFB B;  1FXK B;  1I5Y A;  3MHH C;  4WFE A;  1V55 C;  1S5L Z;  3VOU A;  4DR3 B;  4DUZ B;  3GWK C;  1QBZ A;  1SQQ H;  4JI6 O;  3ASO B;  3F5W C;  4X88 A;  4GYC B;  4NKG B;  1K4C C;  1PPJ H;  2UXN A;  1NJI W;  1FXV A;  4LF9 O;  2ZNI A;  4GCZ A;  2XOK G;  2DOS A;  4E4E A;  3AG2 B;  4WF9 V;  4HNA B;  5E1A C;  3SPI A;  1S0V A;  3ETD A;  3ABM B;  4JI8 O;  1X4T A;  1QR8 A;  3PJS K;  3T1Y O;  2OT5 A;  1RM1 B;  1RP3 B;  1MNG A;  1YJ9 V;  4B7K A;  1AP6 A;  3D36 C;  5DN6 G;  4NTX A;  4B3S B;  3SJA C;  1N36 B;  1XBL A;  1OCC B;  4LF8 B;  1K73 W;  3CME V;  3B2E E;  2X0L A;  5KX5 A;  2WLK A;  3D36 A;  2EJ7 A;  1KP2 A;  1VF5 B;  2ZE6 A;  5B1A C;  3OGI B;  1HNX B;  1VQN V;  1Y74 A;  2ARH A;  4JPR A;  2CK3 G;  1QLE B;  4DRX A;  2ATK C;  3T4D A;  2BTO A;  3HKD A;  4I4T A;  3K58 A;  3AG7 A;  4OPH A;  3F5T A;  4K0K B;  4J41 A;  1GO3 F;  4MS2 A;  3W7T A;  2DYS C;  5JWP A;  4BR6 A;  1A32 A;  1XL6 A;  4JF3 A;  3R65 A;  4JV5 B;  5CA3 A;  3RYI A;  2OCC C;  3SPC A;  2FKX A;  4RO2 A;  1KKD A;  2LGW A;  5LHH A;  1YCI A;  2GSM B;  5GTH Z;  3O9O A;  3T1H O;  3GB7 C;  5H6Q A;  4A5U B;  1WLE A;  1KU9 A;  1R3L C;  1M5I A;  1WA8 A;  3OTO O;  4DR5 B;  2DE0 X;  2EUL A;  2P90 A;  1OCZ C;  3ZHQ A;  4B3R B;  4LF7 B;  3LUT B;  4CS3 A;  3CC2 V;  1VAR A;  3JD1 A;  4UV8 A;  5CMU A;  5A9G A;  2QSA A;  4K3A A;  4KHP O;  4J80 A;  3ABL C;  1R3I C;  3S3W A;  1H2L A;  5D5Q A;  4DR4 O;  1WPX A;  2Q73 A;  2IU0 A;  1ZL8 B;  5B1B B;  1R1B A;  3WG7 C;  2DWE C;  3MAQ A;  1QLN A;  3P30 A;  2Y69 C;  5GW7 A;  1KEC A;  1YHQ V;  4DV4 B;  1FXH A;  2B9Z A;  2LW1 A;  3JAL B;  4O4J B;  1OCR C;  3BHP A;  3X2Q B;  4QNH B;  3E22 B;  1VQ8 V;  4UCT A;  2RNB A;  3ZCC A;  4MVZ A;  4J7J A;  3CS5 A;  1JQ0 A;  2Y4T A;  1XQ8 A;  2QKS A;  3LDC A;  2F4V B;  2KG7 B;  3OEH G;  3CEI A;  2QR4 A;  3KKY A;  2EJR A;  4I55 A;  3OW2 U;  5KA6 A;  4CZZ A;  2IW5 A;  5B3S C;  2JDI G;  2YIB D;  4GX1 A;  4LC1 A;  3Q4H A;  4QPJ A;  5JH7 B;  5H9C A;  3OFN G;  1M57 C;  2QTO A;  1XNR B;  5IWA B;  3JSL A;  4DR6 B;  2WSS G;  4LWS B;  1WB7 A;  2PGG A;  5BY1 A;  3A0B Z;  3K03 A;  1D5N A;  2IJK A;  1JJO A;  5EIB C;  1M56 B;  1SA0 B;  4I0X B;  1TVK B;  3DTU B;  1ZSP A;  4FMT A;  4X1K B;  4B3T O;  5D5P A;  4P9P A;  3FB6 C;  1V9P A;  4H33 A;  1MAB G;  4EEQ A;  1WJZ A;  2P6J A;  1UJW B;  3BCC H;  1MSW D;  5LMU B;  4EB6 A;  3L9D A;  3VQY A;  3G4S V;  4XDJ A;  4X8A A;  1JA8 A;  5IY5 B;  1FAF A;  4X20 B;  4O4I B;  3TXS A;  1SES A;  3HKB A;  2A7W A;  2F1M A;  1MZE A;  1J5E O;  2XAH A;  5ITZ A;  5LOV B;  4TQF A;  1K33 A;  3AK2 A;  1J95 A;  5KHG A;  1H2M A;  3JCU Z;  4QPK A;  3JYC A;  2PYJ A;  4YHH B;  2JS3 A;  4F6E A;  5JVD B;  1IUR A;  3JAK A;  1I08 A;  2QTS A;  1QCE A;  4F4L A;  3CCM V;  5KLV H;  4JTA B;  1TUB B;  2NLJ C;  4NTW A;  1YF2 A;  2XT9 A;  4TQD A;  1V55 B;  2QWO B;  1N32 O;  1HDJ A;  3ICX A;  2HLD G;  1S76 D;  4JYA O;  1ROP A;  5KMG A;  3HPL C;  2YXL A;  1PD3 A;  1T5E A;  1VQ4 V;  3BY6 A;  4NXM O;  5LMN B;  3CSX A;  3LSU A;  4TV8 B;  3ABK C;  4JI1 O;  1EBO A;  2HKO A;  1PNM A;  2FB5 A;  2JK5 C;  1AJQ A;  1TUE B;  2RQ6 A;  4LF5 B;  4GX0 A;  1Y76 A;  2H94 A;  3B8N A;  4CH6 A;  4R7C A;  4JI3 O;  2KB1 A;  1FS0 G;  4ZOL B;  4TOI A;  4U7O A;  3A2F A;  2AHY A;  5CB4 A;  2V1D A;  4JYY A;  4DRX B;  4UB6 Z;  3LDD A;  4WFB V;  4H0L B;  1NS1 A;  1AI5 A;  5K1X A;  3ZRX A;  1SQF A;  1K4D C;  1SQG A;  1VF6 C;  2X7R B;  4PDM A;  1VQM V;  1YIJ V;  2F93 B;  1P7B A;  4CH4 A;  4DV3 O;  5B1A B;  4FLU A;  1M9N A;  3M8A A;  2EZO A;  3K5N A;  3E2E A;  1NKD A;  2AZ0 A;  4X64 O;  5EIB D;  3RGB A;  4FZ1 A;  3JD4 A;  5IYZ A;  2BTQ B;  1PM9 A;  1YJN V;  2OCC B;  2QWQ B;  3H9V A;  1L0L H;  4BIZ A;  1BQ0 A;  3CRR A;  2UXC O;  1W2B U;  1NU1 H;  2B1G A;  3IGA C;  3UO2 A;  1K3E A;  3QTC A;  4CBC A;  3EXA A;  1XL4 A;  1EZJ A;  3CMA V;  1OCZ B;  2WLL B;  1HNZ O;  1SF9 A;  2KKW A;  4JI2 O;  3WB0 A;  3E86 A;  5KHI A;  1QVF U;  1JCH A;  2CE4 A;  2YSU B;  3TCU A;  4LNU A;  2KQX A;  1ENV A;  3E8B A;  2F95 B;  3CWB H;  4JZ2 A;  2ZIO A;  4PHZ A;  4TUY B;  3CD6 V;  1N0N A;  5H6R A;  3WG7 B;  4H13 B;  2Y69 B;  2VS0 A;  5J2T B;  4GKK B;  1ORQ C;  5H5N A;  4DV6 B;  1PV0 A;  5BR8 B;  1Q8I A;  3FKS G;  3RYF B;  3L72 H;  2Q0A A;  3JD3 A;  4JYC A;  1AJP A;  3CYO A;  4PA7 A;  4E2L A;  4QGP A;  1GRJ A;  4AQY B;  2HHH B;  1GN6 A;  3Q4H B;  1I94 B;  4O2B B;  2VQF B;  2VWJ A;  3A0R A;  4Z2W A;  4J42 A;  3D8C A;  4DW1 A;  2P06 A;  3AG3 B;  5EC2 C;  2Q67 A;  4MTX A;  1AVM A;  5E79 Z;  5B3S B;  3WB1 A;  1S3J A;  1EZV H;  2AZ2 A;  1Q43 A;  4UV9 A;  4U3F H;  1IBL B;  1IDS A;  2KSD A;  4YJ3 A;  3ZMZ A;  5K1P A;  3BA9 A;  3ZRW B;  1D5A A;  1M57 B;  4DV7 O;  3ASN B;  4RUE A;  1R73 A;  4B08 A;  2P5O A;  3OR7 C;  3EVK A;  2ZT9 B;  3IFX A;  4LF4 B;  2A9H A;  5H2F Z;  4DR7 B;  2OTJ V;  2XUM A;  4JI0 B;  1HR0 B;  4EB6 B;  4FZ0 A;  3K5M A;  3OUF A;  1OCO C;  3B40 A;  3RN4 A;  2ADQ B;  1EM1 A;  1H8H G;  1S72 V;  1SQX H;  2CGO A;  2UXD B;  3SYO A;  3CCL V;  1DF5 A;  3K57 A;  2ZE5 A;  2QM8 A;  4MW8 A;  2QM4 A;  5ITZ B;  4U3J B;  5HFL A;  3VBB A;  1JJ2 U;  4UCV A;  1B04 A;  1N0J A;  2W0X A;  3H1K H;  2R70 A;  3RYC A;  3DXR A;  1W0J G;  1CP9 A;  4TSF G;  4JI4 O;  2LFS A;  4FVM A;  1BMF G;  4IGG A;  3GWO A;  4I50 A;  1BZK A;  3N27 A;  1VQO V;  3T2M A;  4CC6 A;  3FYI B;  3K5O A;  2UU9 B;  3LDE A;  2PYL A;  1Q3E A;  4P30 A;  4CH5 A;  3TET A;  1FD9 A;  4PV1 B;  2L6L A;  2ZR2 A;  4K35 A;  3FYE B;  4LF8 O;  2ZKO A;  4I9Q A;  1SET A;  1WN7 A;  1QU7 A;  1P84 F;  4J7Z A;  4J9Z B;  4C7U A;  1F51 A;  5FNV A;  2VQE B;  5JJE B;  2V4D A;  4DV5 B;  1JX9 A;  5KA5 A;  4I9W A;  1XHZ A;  2WLH A;  4FLT A;  1GM7 A;  4AHC A;  3CB2 A;  1QVG U;  1NQT A;  3ZRV A;  1FJG B;  3ABK B;  4DK1 A;  2DMX A;  3FB5 C;  1HNW B;  4DV2 O;  2PY5 A;  1P4R A;  1FFX B;  2JGU A;  2CDY A;  2CH7 A;  1G1X B;  4WFF A;  3QNE A;  1XMQ B;  4DR1 B;  2E5L B;  1EFR G;  1FFT B;  2PZS A;  1NTM H;  3C3S A;  2X6C A;  3OD4 A;  5IJ0 A;  4ZHQ A;  3AK1 A;  2XAS A;  1WB8 A;  1AJN A;  2ZXW B;  1BS3 A;  5IYB O;  4DR5 O;  1YVW A;  4JI6 B;  3ZMU A;  5HFM A;  4PJ0 Z;  2W6I G;  3B09 A;  1JFF B;  5EZY A;  4NXN O;  4PD4 F;  3AEI A;  1BL8 A;  4LF9 B;  2DYR C;  4H37 A;  5L3D A;  4MW3 A;  4JI5 B;  5IDJ A;  1R3J C;  3JAW A;  1YTF D;  1K5S A;  2XTA A;  3OEE G;  5LP6 A;  1YDX A;  3VQW A;  5IJ9 B;  1COW G;  1K34 A;  5GON A;  3E8G A;  3T1Y B;  2EBO A;  3SR2 C;  3U10 A;  4LFA B;  3ETE A;  2YEV A;  1ZTE A;  4F6R B;  4O4H B;  3HB3 B;  2JJ1 G;  2P7T C;  4KL1 A;  1N33 B;  5KHJ A;  1OZ0 A;  4J9Y B;  1KBH A;  3RVY A;  5JQG A;  2Z3Y A;  4BIO A;  4GKJ O;  2PF4 E;  3SJC C;  2M6Y A;  3ZIA G;  5CA0 A;  5KAF Z;  1RSO A;  3S3X A;  5LA6 A;  2GTS A;  4DO2 A;  1KP3 A;  3CXC U;  4PA4 A;  1M1K W;  3IC9 A;  1GH6 A;  4K8X A;  2D3O W;  2ZM6 O;  4YIO A;  4UCR A;  2ZNJ A;  1JOY A;  2FML A;  4MVQ A;  4ZIB A;  4OXS A;  5L3B A;  5C8Y B;  4MVR A;  2HJF C;  4OX9 O;  3N2G A;  4X1I A;  4FLW A;  2LFR A;  3ZS8 C;  4PI2 A;  1LR1 A;  2P4K A;  2FYU H;  2AGA A;  4GX2 A;  5LGT A;  4X65 O;  3BAB A;  1BE3 H;  3ETG A;  2XHB A;  4ZI7 B;  3OM3 B;  4B3M O;  3APQ A;  3B4S A;  4IIJ A;  2WLI A;  4BAY A;  2ZE8 A;  1OHH G;  4IHJ B;  2N05 A;  1NH2 D;  2OWO A;  2DJV A;  2XAF A;  2Y4U A;  3T1H B;  1BQZ A;  5B66 Z;  2EIK C;  3K79 A;  3RYH A;  4OPA A;  4WBN A;  3QO5 A;  4NTY A;  3JAS B;  2HFE C;  2D2C B;  3IC7 A;  4FFK A;  2JEX A;  1I0H A;  2WAM A;  3CRA A;  5CA1 A;  2H8P C;  1XRE A;  2EIL C;  4FLX A;  1PNK A;  3NXS A;  1WP7 A;  2UXX A;  5LYJ B;  1GN2 A;  1GK9 A;  4KHP B;  3JAT A;  3CE2 A;  4L8J A;  3BA8 A;  2YUA A;  5EBM C;  4DR4 B;  2GUZ A;  4I7Z B;  3BEH A;  3FAV A;  1LNQ A;  2XND G;  1F4M A;  2BE3 A;  2LO1 A;  2YI9 A;  4G2K A;  2FL4 A;  4FLY A;  3CJH B;  3I55 V;  1YTF B;  2UUB B;  3AG1 C;  2JIZ G;  3BAA A;  1VQK V;  4ZBM A;  1W59 A;  4YJ2 B;  4YHH O;  2A3Q A;  5CBG A;  3R66 A;  2W6J G;  3A0H Z;  3STZ C;  1M90 W;  3K3W A;  4O2A A;  1GN3 A;  2LJ2 A;  3OMA B;  5L3E A;  2Q7E A;  1OCO B;  3OAA G;  1B3Q A;  1DF4 A;  2F66 C;  3E8H A;  4HBN A;  3U0Z A;  3BVO A;  2O57 A;  1K97 A;  2GBO A;  2B1I A;  3K0G A;  5CBF A;  2ZDI A;  3BPZ A;  1VQ5 V;  5LXT A;  2EIJ C;  3QO7 A;  2Z0A A;  3HKE A;  2C2A A;  3UT5 B;  5KUK A;  4Q6G A;  5LL6 Y;  1XHX A;  3GVM A;  1XNQ O;  4ABM A;  2EIN B;  4WCE V;  5LMN O;  3K08 A;  1PP9 H;  3JCZ A;  1IZ3 A;  4MSW C;  1N4C A;  1Q6I A;  2LQT A;  3SPJ A;  3ZJZ A;  2UUC O;  2ETN A;  4B3T B;  3SJQ C;  3AG4 C;  1NH2 B;  4MVO A;  3L74 H;  4PA6 A;  3JSN A;  3OTF A;  3SGI A;  1Z5W A;  1L0N H;  3OUS A;  4MVM A;  2RCV A;  5J2U A;  5LGU A;  1K7D A;  4RAI A;  1SS3 A;  4FFB A;  3ZX6 A;  4JTD B;  3FD9 A;  3CCV V;  1AI4 A;  2Q7G A;  4TV9 A;  5TIS Z;  3U11 A;  4X62 O;  4XBF A;  1J5E B;  4DUY O;  5LBQ A;  5EYP A;  4PDR A;  3TXQ A;  1RM1 C;  1Q81 W;  5KX5 B;  4R50 A;  4GLX A;  2A0L A;  1QNM A;  1N34 O;  5F2V O;  1FYJ A;  4HNA A;  1Y74 B;  4MT8 A;  2ZE7 A;  1DK1 A;  3HKD B;  4I4T B;  3NR7 A;  3I56 V;  2DN9 A;  4QE9 A;  3J80 N;  2P67 A;  1XMO O;  3JAW B;  1IXM A;  4ASU G;  3TJT A;  2QWP B;  1MOF A;  2XAJ A;  1YI2 V;  2LP7 A;  1O9G A;  2IJI A;  4DR2 O;  2BOB C;  5IYC O;  5EBL C;  3RYI B;  4JYA B;  4Q20 A;  3CC7 V;  4JI7 O;  5IE9 A;  5L3C A;  2R9A A;  2DYR B;  4NXM B;  1H2S B;  1H2G A;  2HVK C;  3ZHT A;  2Z5U A;  2ZD9 A;  5CN0 A;  4LF6 O;  1URF A;  1WA8 B;  2DYS B;  4JI1 B;  2Y0I A;  1Z5V A;  4DV1 O;  2Q4P A;  2VRZ A;  4ICG A;  1HWY A;  4EFE A;  2HEP A;  4WFA V;  4ZKI A;  5EC1 C;  1ZAU A;  1U96 A;  3DSQ A;  1IBM O;  2F43 G;  4JI3 B;  2OTL V;  4BWA A;  4TT3 G;  1GN4 A;  4UCO A;  5BR8 O;  1G4Y B;  4PEL A;  4OGQ B;  1PL4 A;  4PA3 A;  3JAR A;  1G6U A;  4X1I B;  1ZWI C;  4JZG A;  4FM2 A;  3SDL A;  4UVC A;  3ZRS A;  1RFY A;  4DV3 B;  3ABL B;  1AI6 A;  1I94 O;  4J7K A;  1NBM G;  2WLI B;  4BIU A;  3UM7 A;  2P22 C;  1S5J A;  1WP8 A;  3CXH F;  1I5X A;  2NR5 A;  3EHB B;  1IXB A;  2GDS A;  1E79 G;  1KB9 F;  2RDC A;  4Z1M G;  5GTI Z;  1M4U A;  5L3F A;  1BHA A;  4LFB B;  1OCR B;  3RYH B;  2PI4 A;  5LGN A;  4RQE A;  5L3G A;  2MK3 A;  4DV0 O;  5JJN B;  1Y6X A;  4I55 B;  1ZL8 A;  5CA1 B;  1L8D A;  3B8M A;  4W4K A;  1FKA O;  2UXC B;  2DQ0 A;  1H8E G;  1AR5 A;  3JAL A;  3JAT B;  2EIK B;  4O4J A;  1RPR A;  2ZIN A;  3CRQ A;  3M99 B;  1F23 A;  1Y4M A;  2A06 H;  4YIP A;  2GUZ B;  3RBZ A;  3G67 A;  3E22 A;  2B5U A;  5DED A;  5FLX N;  2UUA O;  1HNZ B;  4JI2 B;  3K5L A;  2N04 A;  1NTK H;  2EIL B;  3J7A U;  2ODM A;  4IYH A;  2UXD O;  1KUQ A;  4PDL A;  2HR3 A;  2KG7 A;  1UFI A;  3LNM B;  1Y67 A;  1NR7 A;  3K0D A;  2CTR A;  2YIA A;  1ZUQ A;  2ZCE A;  4DW0 A;  1VQ9 V;  3CRC A;  3G6E V;  1XUQ A;  3JAM N;  3CCE V;  4MVU A;  1IBK B;  4MTF A;  1M56 C;  3L75 H;  4LH7 A;  5JH7 A;  4FM1 A;  4YY3 O;  3D3I A;  3WFV A;  5B5E Z;  3AG1 B;  1IVS A;  4X66 O;  1XI1 A;  2K9P A;  1R3K C;  4LWS A;  4X1Y A;  2QM7 A;  2MW2 B;  1E1R G;  1XDC A;  4DR3 O;  4K8Z A;  5C93 A;  1JMK C;  4DUZ O;  4X9Q A;  3H01 A;  3HKB B;  4J10 A;  2WLN A;  1G8M A;  1JVM A;  2IM9 A;  3E83 A;  1SA0 A;  4JAU A;  2IH1 C;  4I0X A;  1V54 C;  1TVK A;  2BSK A;  3QF7 A;  4HAM A;  4LFC B;  3P32 A;  1N8R W;  2N74 A;  2EIJ B;  2YIC A;  4FPP A;  3JAK B;  4DV7 B;  4YXW G;  3D3Q A;  1K9M W;  2HVJ C;  1TGO A;  4MTG A;  2RMK B;  3MHS C;  2K1E A;  4B3S O;  4X20 A;  4O4I A;  2QGN A;  1N36 O;  2YXY A;  2HJD A;  1SKV A;  4UCS A;  2YDE A;  2DW4 A;  1KMI Z;  3RT3 C;  2E5L O;  1LUW A;  5KMG B;  5LOV A;  1NTZ H;  1Q6H A;  2UXB B;  4NB5 A;  1US6 A;  3AG4 B;  2QA4 V;  3EFF K;  1HNX O;  3UKM A;  4TV9 B;  3K59 A;  4NR1 A;  5KHK A;  4FIP C;  5JVD A;  4FK5 C;  1Y76 B;  3MD0 A;  5EYP B;  1VEW A;  1TUB A;  4K0K O;  3W7W A;  4JI5 O;  3OT7 A;  2Y48 A;  1NVP D;  1SRY A;  3M7M X;  5B1N A;  3OMI B;  4JI4 B;  2WA4 A;  2CUG A;  3UCS C;  3ZMT A;  3O65 A;  5CB4 B;  1MA1 A;  2JJ2 G;  3CCR V;  1TAE A;  4FJC C;  4JV5 O;  2RN9 A;  4LFA O;  1I7F A;  1QQC A;  4DXW A;  2QWR B;  1N33 O;  1Q5O A;  1YZB A;  1HW7 A;  4PA9 A;  1GTO A;  2YXH A;  4TV8 A;  4GX5 A;  1IX9 A;  3HR0 A;  5LP6 C;  2YIB A;  3ZHV A;  2X6B A;  3SYQ A;  4R8C A;  1YIT V;  4R6Z A;  5IYD O;  3G80 A;  1R6T A;  4X89 A;  4LF7 O;  1VF7 A;  4B3R O;  3B77 A;  5IT9 N;  1S5H C;  2Q68 A;  5KUM A;  2QWN B;  4LR3 A;  4ZOL A;  3ZMV A;  4CS2 A;  5IYZ B;  4UUJ C;  2VWK A;  1KD1 W;  3SYC A;  4O4L A;  4L87 A;  2CTQ A;  3F7V C;  4JI8 B;  1SQV H;  1YXB A;  2FTK A;  3ZN1 A;  4AI8 A;  4DYL A;  3SYP A;  4CS4 A;  4FM0 A;  4DV4 O;  4UFZ A;  2NN4 A;  4QIW F;  1Q6U A;  4AIL C;  1BHB A;  1QHT A;  3RVZ A;  4DV2 B;  3DC6 A;  3P3N A;  2E3C A;  2E74 B;  2EIM C;  3JAR B;  1P7G A;  3I5D A;  2BCC H;  3A8T A;  3E8F A;  3CHX A;  3SJB C;  4LNU B;  4Z1V A;  3HKC A;  4IL6 Z;  2F4V O;  3N2K A;  4BW9 A;  4JGS A;  4JTC B;  2P4V A;  2BTQ A;  1PL0 A;  2YC0 A;  4PDV A;  4GUN A;  4NXN B;  1XOU A;  3FB7 C;  2Q0O C;  4WFH A;  1KQS U;  2CTW A;  3G71 V;  1BGY H;  2AXT Z;  1XNR O;  1QR9 A;  5IWA O;  3ZN0 A;  5A2Q N;  1WPB A;  3IJ4 A;  2WLL A;  4H44 B;  4DR6 O;  3ZHS A;  1S77 D;  1PKX A;  2H3O A;  3KZI Z;  4UCU A;  2AHZ A;  4JYB A;  1AR1 B;  4GKJ B;  1Q82 W;  1VP7 A;  3OTO B;  1O9H A;  3QO8 A;  1KC8 W;  4J11 A;  1FPO A;  2YS8 A;  1NVP B;  4TUY A;  2WLM A;  2UUB O;  1JPX A;  2CGN A;  2PUS A;  2QKA A;  4XDL A;  5J2T A;  1AP5 A;  1DTO A;  4MVS A;  1ZX3 A;  4UVA A;  2ZM6 B;  2ZIM A;  4YJ3 B;  2Q9L A;  3FFQ A;  3CCQ V;  5LMU O;  1L1F A;  2WWW A;  4OX9 B;  2F23 A;  3AG3 C;  1AIL A;  4UB8 Z;  4D7T A;  1WNS A;  5KAI Z;  3RYF A;  3KG2 A; 
#chains in the Genus database with same CATH homology
 1S3J A;  4MT8 A;  1OCC B;  3CCU V;  4UV9 A;  1K73 W;  3I56 V;  3CME V;  2X0L A;  3CCJ V;  3ZMZ A;  3T1C A;  4QE9 A;  3ZRW B;  2P67 A;  2WLK A;  1M57 B;  3D36 A;  3ASN B;  3ASN C;  1IXM A;  4ASU G;  4QJF B;  1KP2 A;  1CEZ A;  4P2Z A;  4RUE A;  5B1A C;  1R73 A;  1MOF A;  3JD0 A;  2XAJ A;  3OR7 C;  1YI2 V;  1VQN V;  2LP7 A;  4JPR A;  2IJI A;  3IFX A;  3ZMS A;  2CK3 G;  1QLE B;  2ATK C;  2BOB C;  2A9H A;  3T4D A;  5IYC O;  5EBL C;  2OTJ V;  4UXN A;  2ZDI C;  4Q20 A;  3CC7 V;  5L3C A;  3K9A A;  2V7Q G;  3CCS V;  2DYR B;  3OUF A;  1OCO C;  3ZRW A;  2A79 B;  1GO3 F;  1H2G A;  1W0K G;  2HVK C;  4RUF A;  2Z5U A;  4N21 A;  2ZD9 A;  4MS2 A;  5CN0 A;  3OR6 C;  3W7T A;  1H8H G;  1S72 V;  3T4Z A;  2DYS B;  2DYS C;  3LSQ A;  1SZT A;  1XL6 A;  1VQ6 V;  4JF3 A;  3R65 A;  4GT1 A;  1HWY A;  3SYO A;  4WFA V;  4ZKI A;  3CCL V;  2WPD G;  1DF5 A;  3SPC A;  2OCC C;  5EC1 C;  5CA3 A;  2ITD C;  4RO2 A;  1KKD A;  5LHH A;  4QE7 A;  2GSM B;  2F43 G;  2QM8 A;  4N23 A;  1VQ7 V;  2OTL V;  4MW8 A;  5EK0 A;  5HFL A;  3VBB A;  1JJ2 U;  2GHY A;  1V54 B;  3GB7 C;  5H6Q A;  1WLE A;  1R3L C;  4TT3 G;  1G4Y B;  4PEL A;  1W0J G;  2P90 A;  1CP9 A;  4TSF G;  4PA3 A;  1OCZ C;  1ZWI C;  2LFS A;  3W7U A;  1BMF G;  3GWO A;  3LUT B;  3CC2 V;  3F7Y C;  3JD1 A;  4UV8 A;  5CMU A;  4UVC A;  1E1Q G;  3ZRS A;  1VQO V;  3T2M A;  3OMN B;  3ABL B;  1AI6 A;  3ABL C;  3FYI B;  1R3I C;  4XDK A;  1NBM G;  2WLI B;  3LDE A;  4BIU A;  3UM7 A;  1WPX A;  1FXK C;  2IU0 A;  4P30 A;  5B1B B;  4RQF A;  3TET A;  3WG7 C;  1I5X A;  2DWE C;  1QLN A;  3P30 A;  2ZR2 A;  3EHB B;  2Y69 C;  5GW7 A;  1KEC A;  1YHQ V;  1E79 G;  3FYE B;  1FXH A;  3ASO C;  4Z1M G;  1SET A;  5L3F A;  1BHA A;  1R6N A;  1OCR B;  1OCR C;  4P9O A;  5DM6 V;  2PI4 A;  4J9Z B;  5LGN A;  1F51 A;  4RQE A;  5L3G A;  3X2Q B;  4QNH B;  3LSS A;  2MK3 A;  2ZR3 A;  4I5S A;  1FXK A;  1VQ8 V;  3B8M A;  3AG2 C;  1JX9 A;  4KUM A;  5KA5 A;  3JD2 A;  4I9W A;  5FL7 G;  3ZCC A;  4MVZ A;  3ABM C;  2WLH A;  2DQ0 A;  1JQ0 A;  1H8E G;  1R6K A;  1GM7 A;  2QKS A;  3LDC A;  1AI7 A;  2R9I A;  2EIK B;  3SPG A;  1H38 A;  1RPR A;  3M99 B;  4BW5 A;  1F23 A;  1Y4M A;  3OEH G;  1QVG U;  1NQT A;  4UVB A;  3ZRV A;  4KP4 A;  3RBZ A;  1K5Q A;  4MTO A;  2B5U A;  1ARO P;  2DQ3 A;  2EJR A;  3OW2 U;  3CC4 V;  3ABK B;  5KA6 A;  3FB5 C;  4CZZ A;  2DWD C;  2IW5 A;  5B3S C;  1THZ A;  2JDI G;  2EIL B;  1P4R A;  3CPW U;  1OCC C;  2WLJ A;  4WFF A;  3QNE A;  5CBH A;  1EFR G;  4GX1 A;  2EZP A;  4PDL A;  2HR3 A;  1FFT B;  3LNM B;  4LC1 A;  1NR7 A;  3K0D A;  2X6A A;  4QPJ A;  2X6C A;  1PNL A;  5H9C A;  3OFN G;  1M57 C;  2QTO A;  2XAS A;  1VQ9 V;  1AJN A;  2ZXW B;  2ZXW C;  5IYB O;  2BOC C;  2WSS G;  3ZMU A;  4LCU C;  3G6E V;  5HFM A;  2W6I G;  3K03 A;  3CCE V;  1QLE C;  4MVU A;  1GM8 A;  2IJK A;  3SYA A;  2YEV B;  5LHI A;  3AEI A;  1BL8 A;  4MTF A;  1M56 B;  1M56 C;  2DYR C;  4H37 A;  5L3D A;  4MW3 A;  5IDJ A;  3D3I A;  1R3J C;  3DTU B;  3WFV A;  1YTF D;  3AG1 B;  4FMT A;  1K5S A;  3OEE G;  4U7N A;  4P9P A;  1R3K C;  3FB6 C;  2PI5 A;  4H33 A;  2QM7 A;  3SPH A;  1COW G;  1K34 A;  1MAB G;  1E1R G;  3E8G A;  2P6J A;  2EBO A;  1UJW B;  5C93 A;  3ETE A;  1MSW D;  2YEV A;  3H01 A;  2WLN A;  3HB3 B;  1G8M A;  1JVM A;  2JJ1 G;  2P7T C;  1OZ0 A;  4J9Y B;  3G4S V;  4XDJ A;  3E83 A;  4JAU A;  3RVY A;  2IH1 C;  2Z3Y A;  4X8A A;  1V54 C;  3K06 A;  5IY5 B;  3ZIA G;  5J9P C;  4WFG A;  4HAM A;  3W7X A;  2EIM B;  3P32 A;  3CXC U;  4DO2 A;  1N8R W;  1KP3 A;  1M1K W;  4PA4 A;  4TWK A;  2EIJ B;  3ABT A;  4FPP A;  1SES A;  1VQL V;  2IU3 A;  2XAH A;  4YXW G;  2D3O W;  1K9M W;  2HVJ C;  1K33 A;  1JOY A;  4MTG A;  4MVQ A;  1J95 A;  3ABU A;  4OXS A;  5L3B A;  3MHS C;  4QPK A;  3JYC A;  4MVR A;  2HJF C;  2K1E A;  5B1B C;  2LFR A;  4G27 B;  3OE7 G;  4GX2 A;  5LGT A;  2DW4 A;  2IJJ A;  3DGE A;  4F4L A;  1QCE A;  3FB8 C;  4LP8 A;  3ETG A;  4JTA B;  3CCM V;  3OM3 B;  3X2Q C;  2WLI A;  2NLJ C;  4BAY A;  1Q7Y W;  1OHH G;  3AG4 B;  2QA4 V;  3EFF K;  3RW0 A;  1V55 B;  1NH2 D;  1F4N A;  1Y66 A;  3UKM A;  1K8A W;  4FIP C;  2XAF A;  4FK5 C;  2HLD G;  1S76 D;  3MD0 A;  2EIK C;  3K79 A;  1ROP A;  4KFM A;  3HPL C;  3CP1 A;  3QO5 A;  2HFE C;  1PD3 A;  1VQ4 V;  3BY6 A;  3IC7 A;  3W7W A;  2Y48 A;  2JEX A;  1DLB A;  2WAM A;  3ABK C;  1NVP D;  1SRY A;  3E35 A;  3OMI B;  5B1N A;  2H8P C;  2ITC C;  3E89 A;  2EIL C;  1EBO A;  3ZMT A;  3W7S A;  1PNK A;  3NXS A;  2HKO A;  3ML0 A;  2JJ2 G;  3CCR V;  1PNM A;  3OGC C;  2JK5 C;  1AJQ A;  1TUE B;  4FJC C;  2UXX A;  1GK9 A;  4GX0 A;  2R9R B;  5B1O A;  2H94 A;  2JEU A;  3B8N A;  4DXW A;  4R7C A;  5EBM C;  2NNU A;  2KB1 A;  4PA9 A;  2QEX V;  1GTO A;  1FS0 G;  3K04 A;  4U7O A;  2XAG A;  3BEH A;  4GX5 A;  5EBW C;  2AHY A;  1LNQ A;  1SER A;  2XND G;  2V1D A;  1F4M A;  3TK1 A;  2X6B A;  3SYQ A;  4LBE C;  4R8C A;  1YIT V;  4R6Z A;  3LDD A;  5IYD O;  4WFB V;  4G2K A;  4X89 A;  3B77 A;  1MG1 A;  1AI5 A;  3ZRX A;  1S5H C;  1K4D C;  3I55 V;  2X7R B;  1VQM V;  4PDM A;  1YIJ V;  1YTF B;  1YJW V;  2Q68 A;  2IJH A;  5KUM A;  1P7B A;  3AG1 C;  4EKW A;  2JIZ G;  3ZMV A;  1VQK V;  4ZBM A;  5B1A B;  1M9N A;  4HZ3 A;  2Q6A A;  2EZO A;  4UUJ C;  1KD1 W;  3SYC A;  4L87 A;  3F7V C;  5CBG A;  2FTK A;  3ZN1 A;  2W6J G;  3E2E A;  4HYO A;  3STZ C;  1NKD A;  3SYP A;  2ZQM A;  1M90 W;  3K3W A;  3OMA B;  5L3E A;  3STL C;  1OCO B;  3OAA G;  1GKF A;  1DF4 A;  3E8H A;  4QIW F;  5BZB A;  1BHB A;  1GM9 A;  3JD4 A;  5IY5 C;  1K97 A;  3RVZ A;  5LHG A;  2EIM C;  1K92 A;  2B1I A;  3K0G A;  1Q86 W;  1YJN V;  5CBF A;  2OCC B;  2ZDI A;  1VQ5 V;  2EIJ C;  3E8F A;  3QO7 A;  4BIZ A;  2XAQ A;  4JAS A;  1YSC A;  2C2A A;  2HG5 C;  4JAV A;  1GMG A;  1W2B U;  5KUK A;  1B6Q A;  2Q69 A;  2B1G A;  1NR1 A;  3IGA C;  4JGS A;  1K3E A;  4JTC B;  2EIN B;  2EIN C;  4WCE V;  1RPO A;  2QE7 G;  3K08 A;  1VQP V;  4CBC A;  1PL0 A;  1XL4 A;  1EZJ A;  4PDV A;  3CMA V;  1OCZ B;  3JCZ A;  2WLL B;  4MSW C;  2M7W A;  4G28 B;  3E86 A;  2W0F C;  3SPJ A;  1CPY A;  1QVF U;  1JCH A;  2YSU B;  3FB7 C;  3ZJZ A;  3TCU A;  4WFH A;  1ENV A;  3E8B A;  1KQS U;  3G71 V;  2IH3 C;  3SJQ C;  3CD6 V;  1QR9 A;  3AG4 C;  1FXK B;  5H6R A;  3ZN0 A;  1NH2 B;  1I5Y A;  3MHH C;  4MVO A;  4WFE A;  1V55 C;  4PA6 A;  3WG7 B;  2WLL A;  3VOU A;  1QBZ A;  2Y69 B;  1PKX A;  1S77 D;  3OUS A;  4MVM A;  3ASO B;  5LGU A;  3F5W C;  2AHZ A;  4JYB A;  1AR1 B;  4X88 A;  1ORQ C;  1K7D A;  1Q82 W;  1K4C C;  2UXN A;  1NJI W;  1FXV A;  3QO8 A;  4RAI A;  1KC8 W;  4GCZ A;  2XOK G;  1NVP B;  2WLM A;  4JTD B;  3FKS G;  3AG2 B;  1JPX A;  4WF9 V;  3JD3 A;  5E1A C;  3CCV V;  4XDL A;  1AI4 A;  3SPI A;  4JYC A;  1S0V A;  1AJP A;  3CYO A;  4PA7 A;  3ETD A;  3ABM B;  4E2L A;  4XBF A;  1DTO A;  1QR8 A;  3PJS K;  4MVS A;  5LBQ A;  2OT5 A;  4UVA A;  4PDR A;  1RM1 B;  1RM1 C;  3CCQ V;  1Q81 W;  1L1F A;  1YJ9 V;  4R50 A;  3A0R A;  2WWW A;  2A0L A;  5DN6 G;  3AG3 B;  3AG3 C;  5EC2 C;  2Q67 A;  4MTX A;  5B3S B;  3KG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...