2HVQA

Structure of adenylated full-length t4 rna ligase 2
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
329
structure length
316
Chain Sequence
SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFSEKKVELSEADNKLVGILACYVTLNRVNNVISKIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 37.6 kDa protein in Gp24-hoc intergenic region
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase
total genus 91
structure length 316
sequence length 329
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvqA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvqA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvqA01
1P16A 3GDEA 4PZ6A 3TY8A 2HIVA 4UCSA 3W5OA 5FPRA 1S68A 4PZ8A 1V9PA 4CC5A 4UCVA 3NBYB 1XDNA 4E6NA 3NC0B 1B04A 3BA8A 2CFMA 3JSLA 3TY5A 4CC6A 4UCUA 3PN1A 4EEQA 4UCOA 2Q2UA 1FVIA 1X9NA 2Q2TA 2HVRA 3BA9A 2HIXA 5DISC 3QWUA 3S24A 3VNNA 1CKOA 3GJXB 5D1OB 4EQ5A 3RR5A 5D1PA 5FPOA 4DRFA 3BAAA 4LH6A 3NBZB 4UCTA 4PZ7A 2OWOA 1CKNA 3L2PA 3RTXA 1TA8A 4UCRA 1DGSA 3KYHC 4GLXA 1TAEA 2HVQA 3GB8B 3JSNA 1XK5A 4EFEA 1P8LA 2VUGA 1VS0A 4LH7A 2HVSA 1CKNB 3BABA 1CKMA 3W1GA 1A0IA 3UQ8A 3TY9A 5D1OA 4UFZA 3W1BA 4EFBA
chains in the Genus database with same CATH superfamily
4Q48A 4ESJA 2VPSA 4G7HF 2YRWA 3GTGA 4BJ6C 2QSFX 3T5LA 2DLLA 3E6DA 1QBJA 2GXGA 5ICGA 4BACA 6PAXA 5TGTA 1PP8F 2ELHA 4M9UA 3J7AO 3KZYA 2NOJB 5ICEA 3CUOA 3UFXB 3WTTC 1J0RA 4M9SA 3RYRA 4L18B 5AIQA 2RKHA 1V9PA 1IC8A 2AGOA 2V1XA 3GFIA 5KFEA 2AGPA 2Y2ZA 3S15J 5DGIA 2DFHA 2LOOA 2O8XA 4DIMA 2QA4I 4EGQA 2CMPA 3OYCA 3BA8A 2CFMA 3HOTA 1S03G 1K4SA 3FMAA 3OL3A 2M4KA 1C30A 3J80K 1WGXA 1MSFC 3PN1A 2YWVA 5ILSA 2F2EA 1S10A 4X0GA 2ID3A 5F0CA 4XK4A 1MIJA 3WGIA 3JSPA 1YRNA 1I7LA 2CQKA 2B7EA 2W71A 2OH2A 4L9NA 1I1KA 5BMVF 2V1NA 3BR3A 1P6RA 1FYLA 2UU9H 1LPQA 2Q2EA 5FKNA 4IRIA 4EGZA 1JDBB 3KHRA 1KU7A 1WH5A 2IA2A 5CVVA 2CW7A 3ZXSA 1A48A 3BZCA 2IA1A 1V5GA 3PNTA 1B6SA 1S8NA 2E5NA 2KISA 1G3SA 5D1PA 4L9TA 1WVRA 1JE8A 2X1DA 2JA8G 2ZBKA 3KP6A 4RLQA 2LD5A 3BPXA 1R4MB 2FSWA 1B6AA 3DBLB 3FZVA 3TOAA 2DYRH 2ZB9A 2WAQN 4OMZA 2UVRA 3V42A 4JQFA 1RUNA 3COAC 3JSOA 2A1HA 4TV8F 4CKCA 3OY9A 5I5WA 5KG5A 2KLOA 3ABLH 3D5RC 1JKRC 4A5NA 1UAAA 3CDLA 4WXCA 2JUCA 2C00A 2JWTA 1HKTA 1DDNA 4LF8H 2EPFA 2X0LA 2VOOA 3ZR8X 3W2AA 2K4JA 3I0TA 3I71A 1JHHA 1B8IB 3JSNA 1PJRA 3GTLA 4IWYA 3QPLA 1VQ8I 3W3CA 4UUTA 1FJLA 5BYAA 4YP3A 3QRFF 1KONA 4JP0A 2DAAA 4GYIA 2L4AA 2WB1N 5LRSA 2GM4A 3E5UA 1IG7A 1T3NA 1Y8QB 1ODDA 4O7VA 1SAUA 4KFCA 4RB0A 1XDSA 2J5OA 1BJZA 2E2HJ 4A3LG 3F8FA 1X19A 2XGXA 3TINA 4O5VA 3ERMA 2MABA 2OTJI 3ABTA 1L3LA 5T14A 4PJLA 1E4EA 5KT7A 3A02A 4P1WA 5EWGA 2M8GX 3AL0B 3N41B 4Y17A 5HLGA 1D1CA 4L9VA 2J9GA 1E4FT 2I87A 5LD2C 1K1QA 3C0FB 4M9ZA 3RZOJ 1XNQH 4U7CA 4DYCA 1D8KA 2O7OA 3H9QA 2RNJA 2EBIA 3WWHA 4XOTA 1F4KA 3QWLA 1W7PD 4F4YA 4JX6A 4EATA 1KQ9A 4EGJA 5F0HA 1BIBA 4F4ZA 2ME6A 1ETQA 2P4WA 3H40A 3PW5A 4HNTA 2AQEA 5FPRA 3QU3A 1O75A 1I3AA 4WWCA 1IZ1A 2LKPA 2K4BA 2JA6G 3FM5A 3JRXA 2EA2A 3OWTA 1O3RA 1TWFJ 2A69F 2GWRA 2R7DA 3G8CA 1WHUA 2ZJQF 4JI3H 4LF6H 2Z99A 2CV2A 1ZGAA 1A0GA 2Y0SN 1NK3P 1ZAUA 2FB9A 5DG9A 2W8LA 5CVRA 4IRHA 3DEEA 3CCUI 1XGNA 1LJ9A 2E19A 3RKWA 1XD7A 3VB2A 4RGRA 5KFKA 4JI0H 1MBFA 2XPUA 4K2EA 1IN8A 1OR7C 2YZMA 4DAAA 2MSYA 4XRFA 5KFWA 3SZPA 1AWCA 2IT0A 2VXZA 3RUPA 2XC7A 4DR2H 1IOVA 2AS5F 3WTXC 1IRZA 1FVIA 3M9AA 4N4NB 5IP9J 4KISA 1M1EB 2VI6A 4MNUA 4AWXB 4DW6A 3SEZA 3FKIG 2ZFUA 1FWZA 4O3SA 5E18F 1QZEA 4LLGF 1W93A 2LF8A 1NHAA 1YI2I 4O4HF 2C2RA 2DA4A 1VQ6I 3BDDA 3JRWA 3KP3A 2J6UA 2V6CA 1QZYA 4C3JJ 5J1YA 4UUGA 3RR5A 3OYFA 4CHUA 3T5KA 1RIOH 4GCVA 4HF1A 1R6RA 3OOPA 4BAYA 1H9GA 1U5TB 1P7JA 2VBZA 3PW2A 1OKRA 2R92G 3BZKA 1ETKA 1FX7A 2QEXI 1G3WA 4BE0A 2Z3YA 1SC7A 4UCTA 3V8KA 2Y4RA 4PZ7A 3JRBA 4F52A 2Z33A 3WHBA 4J00A 1MNMC 2JA8J 4X6AJ 4RZQA 3EPGA 2R7LA 1MZBA 2M2EA 2RC4A 4BQAA 1WJ5A 1I6HJ 2VE8A 3ECHA 3GTKA 3BR5A 2C35B 4WK8F 3PJRA 4A3DG 4G9YA 3DTEA 3LFKA 3L2QA 4G7ZF 4P9FA 2HVQA 1I50J 2R86A 2EFQA 3RBEA 1R22A 3MZYA 4FE2A 5GADJ 5EWEA 3DTFA 2OCEA 2HHFB 2E5LH 4NQWA 1WZ2A 3MR2A 2MCTA 2GOXB 4N0BA 1F5TA 4XRSA 4FM9A 4JI6H 2M87A 3EETA 1Z3YA 1JTYA 2K9NA 3BR6A 3QOPA 1RZ4A 5GTIC 4LLLA 2HVSA 2LTPA 3J7ZI 1CKNB 4I50F 4IZOA 1Y1VA 4PSXA 4WF2A 5DS9A 1Y0UA 3CCEI 1WCMA 2FPIB 2V4RA 2RQPA 5DLFA 1GSHA 1FTZA 3PFFA 5C1OA 2FLNA 3OYBA 2HQNA 4XBFA 3KZIC 4A3LJ 3PW0A 3LMMA 1HCRA 2VQEH 2EWNA 5F08A 4ASNA 3G1LA 1IYDA 2CZGA 1QNTA 3PO2G 2GLTA 2ZMEB 1ZHSA 1TC3C 3S3NA 2H6CA 3K1NA 3WODF 1S5LC 5KG4A 3RPUD 1FPQA 4EBDA 5IOZA 2A07F 3KALA 1VQPI 1H0MA 2ZJTA 1X3WB 5E8GA 2AQFA 3DBHB 4ETSA 1GV2A 3B02A 2M9HA 3FF5A 3F21A 3LOCA 1Q1HA 4BXXJ 4I7HA 3RZDJ 1ZGJA 2A5WA 5KAIC 4MIMA 3LSMA 3BG5A 4BEHA 2DPUA 5EF6A 3T9BA 2DA7A 2ESHA 1B1BA 2J5PA 2Q7DA 1WSCA 1W4MA 2BVMA 2FLLA 2H94A 2E1CA 2VBYA 3OL4A 3BY6A 3H9GA 2WC2A 3P5JA 1SD5A 2GPSA 1KJJA 4MV4A 3CCQI 2YL2A 3SGIA 2JA2A 2QENA 1B04A 3JRHA 4A3MJ 2I8DA 3K4BA 3PQJA 4YAJB 3GTMA 1GVDA 1DV2A 1N25A 1RNLA 4IJAA 1U5TC 2DT6A 4M3BA 1GXPA 1QZZA 3I3LA 2GIVA 2L3DA 2GA2A 1HW5A 4EEQA 2ETHA 3BQ1A 2KDOA 3E6MA 5L3GA 2G0EA 1ERDA 4XQFA 1HNZH 4AIHA 1U78A 5KFIA 2JEIA 2DN0A 3I64A 2CH0A 2CO5A 2W82A 2HZTA 2WWYA 5KG0A 4P96A 1X1PA 3BA9A 1KU9A 4GC6A 2JUGA 3M3YJ 3ZQIA 1UG2A 1DPUA 1MBEA 3J7YJ 2DTRA 4IHJF 4EEYA 2QGUA 1U8BA 2XB5A 3FKIJ 5DGHA 4DV1H 1DGWY 4XLEA 3GJXB 1TQMA 5D1OB 1LUJB 2JVGA 5KNLA 1YLFA 4J9NA 4G6DA 4IPAA 4MFDA 1S9FA 2Z16A 3RJPA 3S1MJ 4DL7A 2VKDA 4ECYA 3CP8A 5LRRA 4OINF 4MTDA 3LSJA 5GAEJ 3V6KA 4LH6A 2VKEA 3KHHA 1IN7A 3PZPA 3L1PA 3EDPA 4A2UA 4GO1A 4DIQA 5CQEA 2IBKA 1WWXA 5GAHJ 3GTGJ 1KT8A 3CVZA 3MD2A 5KFZA 2R8IA 1RJQA 1HR0H 4RB1A 3ULQB 3L2PA 3WU2C 2W6MA 3Q0VA 4S04A 1XSVA 2YX4A 1DGRM 3Q0UA 3ELKA 3TP0A 1DP7P 4QW9A 4UCRA 3H4BA 2PBZA 3BR1A 1TAEA 4HN2A 4BY7J 2VC1A 2CJJA 3EUAA 5L3FA 2ZMEC 2DA2A 5D4SA 2IS4A 2W48A 4EVIA 3LQQA 4A3DJ 2IGOA 4LSXA 5KG1A 2HXIA 2Q8KA 1GLVA 2WTFA 2P8TA 2QKLB 2CWEA 3QODA 3ZMTA 4MV3A 2OQGA 2EFWA 2ISZA 4B8XA 3OHAA 5JLXA 2IP2A 1WJBA 2JSCA 4UVCA 3V7CA 2E1MB 4S0HB 4XX0B 3FHNA 1HW1A 2FQ3A 3T1BA 3BQ2A 4ED8A 4DV6H 2E34A 2KKOA 5A2QW 2X5RA 1MGTA 5IY5H 1Y39A 2V9KA 3N43B 1GLNA 1BGWA 2A6EF 3HTSB 3ETJA 1XTAA 3MWDA 3DTKA 2FUG2 4A3IJ 3M8EA 3VYTB 4XKWA 1BI0A 1A0IA 3IRQA 3MVPA 5KVRA 1ZR2A 4EJTA 4HF2A 2QK4A 2R7KA 2VJ5A 3KTMA 4I01A 1T36A 4U0VA 4DR7H 1P2FA 2F48A 1VF9A 3RQ4A 5JR3A 3JW4A 2OCCH 5H80A 2HIVA 5ILVA 2MLKA 3FXKA 2BQRA 1T08B 4RLFA 4U7DA 2OU2A 2KRCA 3E3VA 1KGSA 2DK8A 2JJ7A 1W0UA 1S68A 1E2XA 1HC8A 4O7LA 3T8RA 2KZGA 2RDIA 4IEJA 4ZDOA 4CXFA 3GIDA 5LXTF 1JUPA 4Q43A 3NGDA 3PFIA 2EFOA 4D9JA 3JREA 1FBSA 1V51A 3WTUC 1IN5A 2MA3A 3G8DA 2ACJA 1IJWC 5KG7A 3QZ8A 2LRDA 2CS3A 2WAQA 5E1WA 1R71A 1XGSA 1ZRDA 3Q0WA 4YB8B 1E17A 1S7EA 1X4OA 5JVDF 2NS0A 4QIWN 4FGRA 3HDDA 3UYYA 4HX7A 4XRSG 3GTLJ 4OAZA 3J80W 1JGSA 1D0YA 1X9NA 1Y1VG 3N6RA 3RDIA 4A0YA 2CNQA 3ZRGA 3V6HA 4A3BG 1WCMG 1W1WE 2F6CA 2P5VA 3LA7A 5I5SA 2X6XA 2OA4A 1DQUA 1S0MA 1LVAA 2EV0A 3CO7C 1VBHA 3DEUA 2WB1A 1V54H 3K4KA 3R0AA 2K86A 4LGWA 5J2UF 5DUIA 1Y6IA 1Y56A 3JRAA 2LH9A 2E35A 5BWUA 3DCFA 5I60A 2R7WA 1K6OA 1HSJA 1OCPA 4A69C 2COIA 4LF5H 4CCKA 3HUGA 1BI3A 1JGGA 1VQ5I 2HEOA 5FPOA 2P5LC 2D1HA 3RYPA 1T2KA 5CR5A 5L3CA 5E79C 3JRIA 1YQAA 2GAUA 3LULA 2YU3A 1U3EM 5EJCA 4CCLA 2VBXA 2UUCH 3KIOA 4OIRF 1W36D 2KHMA 1AHDP 3LFUA 1HA8A 2BGCA 5IYDG 1BW6A 4EEFG 2XCAA 4FFRA 3EPIA 3MZHA 3GQCA 1I2KA 3HOUG 4YJ3F 1O7LA 4KYWA 4LLNA 2BBYA 3KEOA 1X1AA 2VASA 4I02A 3WWIA 1MJBA 1Y14B 2XRNA 3SDGA 1U0JA 2VLAA 3F8NA 1F43A 3H5NA 2VPLA 4E7JA 2CFXA 2IXSA 1FZPB 4GYGA 2HOTA 5BPFA 3ZP5A 1IRXA 2E60A 1P8LA 2ZDGA 5C4XG 1A36A 2YR2A 3KYDB 3ZQCA 2FK1A 4HDUA 2IGMA 2R7FA 2Y0SA 3EPZA 4PJNA 1KJQA 1A6QA 5LL6b 5BWWA 2IS2A 1EJ9A 5KT4A 4DLKA 3IP4B 4M3FA 1WH7A 5CKTA 4HNUA 4I09A 4FFNA 1BW5A 3HRUA 1XC5A 4U0WA 3MFKA 4B3RH 2YCHA 3R23A 4RNNA 5EEGA 3HOSA 2R5YA 4A6DA 3ABMH 4EJUA 1VTNC 2W9CB 3KPHA 4ZZLA 3RQIA 3MJFA 2PG4A 1T0FA 3LQRA 3GTPA 3GBGA 2KFDA 2DI3A 3UQ8A 3DPUA 2YS7A 2KQRA 4J9RA 5KFCA 4Q4DA 1RK5A 3I55I 3JAMZ 3LSPA 1JIHA 2OJED 4KT6A 3OMYA 5I47A 1LKXA 1W36C 4NYEA 2IS6A 1FT9A 2Z5UA 1JKQC 3F6OA 3T99A 2C22A 1OPCA 3RIZA 2ZXWH 4CYDA 4Y7NJ 2R7MA 1R9TA 4O81A 4I6ZA 1AOYA 3HG9A 4Y52J 3DLAA 4YAKB 3CC2I 2G7HA 1WJDA 2M30A 5IT9Z 3I12A 2AO9A 5DD4A 2BY3A 1PUFA 3WG9A 4HDVA 4I76A 3GTKJ 1NG7A 4O2BF 4U87A 1ZG1A 4GLWA 4BDYA 3KP2A 1IYEA 4DR1H 2M8EA 2RAEA 4N4OB 2DAOA 4RAGA 3WTWC 4O7WA 5KFFA 3D5SC 3J81K 3DPLC 1XPXA 2VR1A 4LB6B 3AG4H 3R5HA 3DEWA 1YJNI 2R7TA 2DJNA 2QWWA 3LSKA 2XF6A 1KQ0A 3FXUA 2VT3A 3V4SA 4HYKA 2HHHH 5F64A 3CUQA 4Q8FA 3JRFA 4BE2A 1Y1VJ 3DU6A 2NVTJ 5I5XA 2HPIA 4O4LF 1HDDC 5E17F 3RGXA 4QWBA 4UVBA 5FFXA 2DQRA 3K4MA 1WCMJ 3TOBA 4A3BJ 2QYZA 5FNVF 5KFLA 1J5EH 2VA2A 4ZI7F 4S05A 4IL6C 3TW7A 1ZQ3P 4FFMA 4RZRA 2JEJA 5KFQA 3OR1C 5K1YA 5KFHA 2VQHA 2X1EA 1USSA 3K9TA 3HHHA 2FLPA 4UY8I 1LDKB 3F23A 2EJ2A 4MFEA 3WNZA 1SVMA 5KFDA 2BW3A 2X4HA 3I59B 2R5ZA 1FC3A 1BXRA 4PFOA 5EG0B 4XNFA 2CUZA 1ZH5A 4Y15A 1ZG3A 1QPMA 4KUMA 2WE6A 4RGXA 5I5UA 1V5EA 5LLQA 1FLIA 3EYIA 2P7VB 1I1MA 2R84A 1QO0D 1Z05A 3C1DA 1Z9CA 5K7ZA 3GFMA 5HOOA 5IYDJ 3JZ6A 2EA4A 4Y4RA 4LF4H 1TL8A 2ZDHA 4AC0A 3VMMA 5C44G 4C3IJ 2DDAA 4NHJA 3MWMA 3QYEA 3HOUJ 5DG8A 2BY0A 3RIRA 3SJMA 4B43A 1B72A 2WA0A 5J6XA 1IDZA 1XMOH 3L00A 5B3SH 5IYBG 2JT1A 4RAFA 4MV6A 1V4RA 3V4GA 4IXAA 2ZJRF 3GTMJ 2K27A 5JUMA 1FSEA 2KIFA 3I53A 3GIKA 5C4XJ 4ED3A 4XLCA 1M7JA 4BQQA 5KFRA 4KA4A 4ED0A 3GO5A 3RB6A 2V4QA 4U88A 2HI3A 4FBUA 2WAQE 1U8RA 2LP0A 3DTIA 5M3FJ 4BBRG 3NARA 1VQ9I 5HBRB 2IGKA 3ZN0A 2XAFA 2BYVE 1BJTA 3K5IA 1YX3A 3DV8A 2RN7A 4NC6A 3W6JB 4O4JF 5D5UB 1K83A 1CGPA 1YW8A 2R93A 2GQRA 3Q8PB 1MBHA 2BV6A 2X6OA 3SHFA 3OYAA 2EJ3A 2STTA 2A61A 3V4ZA 4PSWA 5JVTA 4YR3A 2E7WA 2H1LA 4B4CA 2LFBA 3W1BA 5F1RA 4U6PA 4CH7A 2F4MB 3PW4A 4YHHH 4BXUA 4PFPA 4C2MA 3CF2A 4DV2H 2LMDA 3QAHA 1CF7A 2WB1E 3LSHA 3X2QH 2FMLA 5D5VB 3HOXG 1R7JA 4FFOA 2CQQA 3CJRB 3I4PA 1R49A 1EHIA 3K5HA 3T9AA 4PWQA 1TNTA 1K6YA 2HYJA 3CDIA 1OCRH 3NQOA 3H0DA 3DQVC 1R23A 1NG6A 3MMYB 1UCRA 3S93A 5HDNA 4E7HA 1HXDA 4EM0B 4KNYA 1OMIA 3KZZA 3WTZA 1U9NA 3HGYA 3RV3A 2HQRA 5AIPA 3LA2A 3R9RA 4R7RA 3ABKH 3TY5A 5IP7J 4ZH4F 1M0WA 3MEXA 5K5OA 3S2DJ 2X48A 3VPCA 1DIKA 1VQ7I 2V4JC 2PMUA 4HZFA 2KJCA 2UXCH 1XMXA 2F5FA 5CVIA 1LE8B 3FBNB 3H3UA 5FKKA 1OFCX 1FIPA 1XSDA 4L5IA 1OLTA 1K61A 1GHCA 1ZETA 3PO3J 2P0WA 2O8KA 3I5UA 1SFUA 1ZG5A 3IKVA 3CJNA 3BQ0A 3FMQA 3TQNA 3CCLI 1SD4A 2EH3A 3QWUA 1L0OC 2RVCA 3REOA 5IT3A 1BC7C 5EGOA 2JQ7A 3G71I 5L1JA 4JYAH 2GIZA 2Y0SE 3D5LA 2K3FA 4DZJA 4DL5A 2L7ZA 2DJIA 2WTEA 1FKAH 5KT3A 4A0XA 3I4NG 1PVEA 4KN4X 1YRNB 2W9BA 2DMQA 2DYSH 3L4JA 1RRJA 5IP9G 1ZHFA 3M8FA 4JI5H 1IO2A 2F4OB 1HLVA 1KBLA 2MYSA 4O3MA 2B63A 2JK3A 3HSFA 5TISC 1NH3A 2JRMA 2Q2EB 1LNWA 3BG6A 3HO8A 2JPCA 1JTXA 4X66H 5J4VA 2ZNYA 3KCCA 1GSAA 4AQYH 4ECXA 3Q5FA 3JRCA 5CA1F 2Z2SB 2DK5A 1SEUA 2V59A 2E1OA 2R7NA 4IRCA 2Y9YA 4L1KA 4GKJH 1K7AA 1MH3A 5FD5A 3C2BA 5J8FA 1IXSB 1MNDA 3C7JA 1TW2A 5HV6A 2M05A 4BWSC 1F1ZA 2VC0A 3WHCA 3U9TA 3RCOA 5EZGA 1XK5A 3E6BA 4AU7A 4EQQA 4IX7A 4E7LA 1LQ1A 4M7EA 5FLXK 1IN4A 4WXDA 1STZA 1YOVB 5C44J 2PLYA 4O3NA 5D8DA 1HKSA 5FD6A 1XS9A 5E3OA 5L1KA 2W1OA 4DV5H 3EYYA 1F36A 2W00A 1DU6A 4JI8H 4NUBA 5IYBJ 3AX6A 2FOKA 5KG3A 5JQGF 3M4IA 5DYMA 1FOKA 1QRYA 2VL8A 4HYEA 3FISA 3ISPA 3OR2C 3FXMA 2L7MP 4QIWA 1A31A 2NU7B 2DMUA 4BBRJ 4IHWA 1X3ZB 4ECRA 1YG2A 1XX5A 1W7PB 1ZK8A 5FGMA 2R87A 2JPBA 3W1GA 1W96A 3F8MA 1N36H 3VA7A 3ZQGA 4G7OF 4CHIA 1ORKA 3M8JA 2DZDA 3Q8QB 3BJAA 3B73A 5E3LA 5M5WJ 2NNNA 1G6NA 3QU6A 3BG7A 3HTUA 5D4RA 1PX2A 3AFHA 3CCVI 2HXOA 4JOMA 3GX4X 2HQ5A 1EH8A 3W5OA 4HX8A 1BOBA 1YO5C 4DYQA 2ZXHA 3CDHA 3KP7A 3WTVC 2XSDC 3T9CA 2V9VA 2MD0A 3S1QJ 2ZGIA 2R7ZA 2EFNA 1WJCA 3BR0A 2E7XA 5ICFA 5JI6A 3HOXJ 4M3GA 4BNCA 2DWCA 5LGNA 4G3IA 2Y69H 3IH2A 2O3FA 4HPQA 4JK1X 5LEJA 2VQFH 4GC7A 5KT2A 5GPAA 3L9FA 2DA1A 3K3VA 3QZ7A 3Q3SA 4FISA 1WI9A 4UCUA 5TRDA 3HRTA 1B8IA 2JEGA 4Y33A 4BXXG 2IMWP 1I27A 2EZIA 3QQMA 4UCOA 2W7OA 1EKEA 1FOWA 2NVQJ 5JHFA 1H89C 5D5XB 5HODA 2DCEA 2R8HA 3OSGA 2E71A 3GZ5A 4N9HA 1FP1D 4OAYA 4RA2A 2DDBA 1DUXC 1Z2NX 3N4MA 1Y8RB 1SFOA 4RU9A 1JT0A 1HDPA 2HPMA 1EV7A 4A3MG 3CO6C 3HKZN 2CRGA 4L5JA 2NOGA 1R5ID 2VJ4A 1KJIA 2E36A 1USTA 2COBA 2R93G 4DL6A 2MH2A 2ECBA 2Z9OA 1POGA 2IPQX 1MNEA 3SDBA 2XRLA 3L7WA 5GONF 4CCOA 2E2IA 2K3PA 1I39A 2EV6A 3GTPJ 4ZTJA 3BAAA 5FFZA 3I4NJ 2HDWA 4XOPA 4KIBA 2R7SA 1A35A 5E25A 3KAJA 2C6YA 1YW7A 1MMDA 3CTAA 3T7AA 2DABA 1HKQA 2NU8B 3GV5B 4ED7A 2AQ4A 1SANA 2BE5F 1TA8A 2PX9A 3Q2OA 1ONVA 2V58A 3BJ6A 4M6YA 1R9TJ 1UZCA 3F22A 2ASDA 2AXLA 2CQYA 4HAMA 3IWZA 4DJAA 2Z04A 2CUJA 4PK4A 2GXAA 2L54A 5FRNA 1GSOA 4KN7X 2VB6A 2XGDA 9ANTA 2WV1A 2CG4A 5F9LA 4MGRA 4DR5H 1EUCB 3PIPF 3A2KA 3IH4A 3BG3A 3H9JA 2H8RA 1FNNA 4II2A 2JVHA 4A2AA 4BY7G 4F50A 2PN1A 2MC3A 1VKZA 1R5GA 1SFKA 3WU1B 3ZQLA 4B47A 4ZYGA 1HSTA 1HQCA 2HZDA 2GBYA 4GDFA 3I4MG 2FU4A 2LVSA 3LP8A 2D2WA 3VDXA 3TP3A 1XCBA 4BYYA 4EM1A 1WRVA 3CMEI 3HYIA 4J9PA 1Z7LA 4XORA 2DLNA 2CSOA 2COGA 2WDTA 2ZNZA 1UHWA 3IAM2 4M74A 3U9SA 2L5QA 3FIWA 3P9KA 2ZM6H 4ESFA 3GF2A 1BBYA 3KXYT 4ZQIA 5CVUA 2I10A 4EYHB 4QPQA 3CSWA 1TZLA 3AW8A 2VQGA 4BUPA 2B0LA 4A3IG 3KP5A 4PCQA 2LY1A 4LG0B 1BC8C 1KC7A 1XDNA 4DV7H 3ZMSA 5HS7A 3LQSA 4JXUA 3V8LA 4RUCA 2QUFA 2WBMA 2AU0A 5LHGA 1XGOA 2ICWG 3RPUA 5K5QA 1VQ4I 3HEFA 4IVNA 1A5JA 2VUMA 5GAGJ 5LOVF 4AD9A 4J01A 5A2QZ 1OCTC 1UC9A 4AIKA 2CGPA 2W6ZA 4WBNF 1EH6A 5J3LA 2QF7A 4RBOA 1G4DA 1ZAOA 3E97A 1BNCA 1GO3E 3RTRA 4JYKA 1QVTA 3K2AA 3OYNA 1YTYA 1UB9A 2YS9A 5FROA 2MFZA 2A3SA 3SYTA 3VPRA 1O3TA 2YW2A 2V6EA 5KS8A 2DMTA 3P7NA 2Q2TA 3J81W 4O2AF 4YJ2F 2ALZA 2C28A 3K4JA 1DV1A 4JV5H 3CLQA 1Z67A 4GKKH 2QQ8A 1Z6TA 3CMMA 4EJOA 1XMAA 1N32H 2W85A 1UC8A 3VOTA 1R5HA 3L2UA 1ET0A 4GGGA 4OMYA 3KYLA 2LLKA 4BJ5C 2JA5A 3GV7B 2G7UA 3V8JA 4Q4ZF 3CCYA 5DMXA 2L01A 4IF4A 1D3YA 2Y75A 3VYUB 3WE2A 4YBZB 2OPTA 1K83J 2R93J 2W6QA 2JA7A 3LAPA 2M0CA 3HSEA 1S29A 2JN6A 2FKLA 4M0JA 3A01B 5KFVA 3PFYA 2CNVA 4O3RA 5JLWA 4C2MJ 1IV8A 4WXHA 4A3EG 4JI1H 1YS7A 4IHXA 1I1LA 2XGQA 1LEAA 4I0BA 1HBXG 4GRIA 5FO5A 3T5XA 1FBQA 2MBFA 2VT2A 5B5EC 4DOZA 1I1SA 3RSNA 3AG1H 3GB8B 4AVPA 2EIYA 4NXNH 1V4YA 3J80Z 4XM3A 2CNUA 4UB6C 1WI3A 1TWHA 3SZGA 2E2JJ 4ENMA 2NVYA 4XLFA 1SEIA 3O3KA 3TDZC 4CZZA 4Q0YA 3R61A 4HLXA 3RF2A 2KIQA 5EZYF 5KG6A 1AUVA 5LGTA 5CYVA 3RKYA 5J2TF 2LKXA 4O3QA 5F9NA 2R8KA 3N05A 4UVAA 4DV3H 5HNFA 3GTOA 3VFZA 3S3OA 3S8PA 2UUZA 4W97A 2JRTA 2L9VA 1C3OA 1ZN2A 1B4AA 1KTAA 3TQ1A 4Z2YA 2F4VH 3OV8A 4BL0B 4BY1J 5GP9A 2M4GA 3ZMUA 1FBUA 3BTIA 2Z1DA 3IAS2 3JTGA 1M0TA 3GCMA 3C2HA 5D1OA 3E0JB 1TP4A 5CJ9A 3IC7A 5M5XJ 3I4MJ 2NRAC 2VOPA 4EBEA 3I9V2 4L0ZB 2VONA 1S0NA 2V1DA 2R85A 2UUBH 3K6GA 5CE8A 2BEOA 2PQ8A 3GLXA 4RGUA 2TDXA 4EGYA 2V7FA 2H27A 2BHYA 2KSWA 4HEA2 3GIIA 4W1UA 3GIMA 3S14J 3AYHB 3H3VK 1FTTA 2PMZN 2M7AA 4F91B 4FTHA 2B63J 4UV8A 2VQDA 3DTGA 3VPDA 1TWAA 2K40A 1ZRFA 3HB9A 3GEZA 1R36A 1YS6A 2XDVA 3DU5A 4LIVA 4M3DA 2YS6A 3NC0B 1P9QC 2PFBA 3M1CA 4XSZF 1XGMA 4BQOA 2RREA 5JFRA 2HGWA 1UELB 5IP6A 2BXZA 3N44B 5I5TA 2HR3A 1D5VA 5BWXA 4ZJZA 2WADA 4BHPA 1R1UA 2W57A 4OOIA 2DMNA 2LG4A 2Q2UA 3MFHA 4LIUA 5CPRB 2IW5A 2NNYA 3JCUC 3DBRB 3PNYA 1X1CA 4KMUX 4RM3A 3R60A 2VOBA 3RKQA 1OISA 4DV4H 1FJGH 1PP7U 3G3ZA 3VSKA 3HXLA 1IGNA 4MAMA 3QYFA 1Z1DA 3ZQ7A 2NUAB 2QB5A 3B6AA 1DU0A 3ASOH 2EZKA 2VXDA 3ZQHA 2X9DA 3WO1A 4X64H 3S24A 1J09A 3HL2A 1CKOA 2KP6A 3SZTA 4G12A 4B48A 3N8DA 4OWRB 2OLSA 2XC9A 3TDUC 4NZMA 2HTSA 3CZ6A 1S97A 4A12A 1L2ZA 1YYVA 1I3QA 3M1EA 1G3YA 4XZ3B 3ROUA 2AXTC 3CP2A 1E4GT 4LD5A 2COMA 1KU3A 1SYXB 5DG7A 3CLOA 2DMPA 4G6TB 3SE7A 4ZDLA 3KP4A 2OWOA 3A1YA 1MDMA 2IVMA 3ZCOA 1RI7A 4HSRA 1IW7F 2FRHA 2KL4A 3F9KA 4RS8A 4EYIB 4ECTA 2R8GA 3C18A 1X2MA 1MBJA 4RAZA 3ZPLA 3EQLF 3R0JA 3S32A 3E5NA 3HOWG 4A3EJ 2R7ZJ 3ORRA 2HDKA 5KFXA 1T98A 1MKMA 4CCMA 3RBDA 5LA6F 1FOYA 4FT8A 4PGHA 2YZNA 5K7FA 2ZO4A 5KFAA 2JEFA 4DL3A 1GDTA 3ZMVA 3G1OA 2QBYB 1ZQ7A 2VUMG 1Y1WA 4UV9A 2XAGA 4YFNF 4ZOLF 3PIOF 2MC4A 3RI4A 3MR6A 3N6XA 3KETA 1UHMA 3GW2A 1DPRA 1MD0A 2DA3A 4H0EA 1FEXA 5FLXW 2PJPA 1D0ZA 2XAQA 4HLYA 2GA1A 3BJOA 2ATLA 4D5CA 4NLGA 3EUHC 3U0GA 2PMHA 5BPIA 1IXCA 3TL4X 4F3QA 5J8CA 5D6FA 5LGUA 1D5YA 4UNOA 1K78B 3MKZA 2PJRB 3O8HA 4MQVA 1N34H 4MA5A 2H09A 4CGZA 4OX9H 1SFOJ 2DOAA 3RAQA 3HPHA 1EH7A 2FBIA 5GTHC 5IPAA 4HQMA 1ETXA 2L02A 2JA5G 2DXIA 2R82A 3DAAA 5CLSA 4IR9A 4EFBA 2J6SA 4BHCA 3HT5A 4X62H 4EV0A 3ORQA 2JA7G 3HZJA 4KICA 3GMEA 2X6YA 1UFMA 3C3WA 4TV7A 5DDGA 2L9NA 1W0TA 4ED6A 3OTOH 3HKZA 5FJ8J 2E2IJ 3FMSA 1YITI 2VODA 4IRDA 4Q47A 1T95A 3HHGA 3UR3C 1YHQI 1J5YA 2O9LA 2KMUA 3ZQQA 3JRGA 3CC7I 4HV5A 4OIOF 3T5HA 1IBMH 2L2OA 3I58A 2Y30A 1APLC 4UCVA 1V5FA 4A3KG 4DR3H 2ZJPF 4IRGA 5HDKA 1RK6A 2R8JA 3L2WA 1MSEC 5KFYA 2DTZA 4NNJA 3VSLA 4YY3H 4L9JA 1I1GA 3FXLA 3K2ZA 4H4KC 2ODTX 1ETYA 1MBGA 4DL2A 1GVJA 4ENNA 3V7RA 2M3AA 2HG8A 3MQ0A 1IAWA 1D1AA 1UMQA 4P5OA 1CQTA 3G4SI 1I7NA 4A3CG 1RYSA 1KJ8A 1K1SA 3HOZG 4YFKF 2K5CA 1RPWA 2Q1ZB 3K1MA 4CCNA 2CV1A 1YFHA 1OWTA 5L3DA 5DD8A 5BPHA 1PUFB 4KITB 1FMWA 1V3FA 1N48A 2R7OA 3DWLE 4ED1A 2JTVA 3K10A 3VNNA 2W9CA 5IP7G 4QWCA 1MBKA 2CQ7A 5DCMB 2V79A 3LSIA 2UUAH 1GXQA 4I99C 1O3SA 4MEXF 4O7YA 1P4AA 4QWQA 1FYMA 3GILA 5C5JA 4ECWA 2PVPA 3RB4A 2EIMH 3BP8A 4LK1F 4BJTA 2P0AA 4XN0A 1I6XA 1ZLJA 5C3EG 4PJMA 1XN7A 2M7BA 1T94A 3V6JA 1BR1A 5LMUH 1WPKA 3CUQB 1RUOA 4WCGA 3KREA 4TVIA 1NK2P 1HOMA 4FCYA 3PO3G 3BT9A 3LAJA 4D7NA 1R1VA 2WAFA 4R8UB 3BJYA 3Q9SA 3QOEA 1R00A 4MO7A 1M6VA 1YJ9I 1X4PA 4QLCU 3S2HJ 1FIAA 2Y48A 5DUKA 3H3VH 2W4SA 3CESA 1EKFA 2M34A 1P92A 4UUVA 5BWVA 4DQ2A 2MGQA 4QTRA 4JX5A 4QWEA 3HOWJ 1X1DA 2XF5A 1LB2A 3PSIA 1G8XA 1WRJA 3BLYA 3V7SA 3VYRB 1KQ8A 3OYHA 4CMFA 3KEYA 1WKMA 5HLIA 2VPQA 4HQ6A 2BW3B 5E1ZB 2HGSA 1G2WA 3A03A 1SAXA 2HU9A 1MMSA 2VUMJ 3E7LA 4IWXA 1AA7A 3FX3A 3H5AA 2XIGA 1N75A 4LFUA 4CICA 2QYOA 2ZCWA 2FA5A 3Q9VA 4IQ4A 2DQLA 3VOEA 1X3UA 2FE3A 3U2RA 1AKHA 3K1PA 4OIPF 3G6VA 2AGQA 2Y0MA 4A3JJ 4ECQA 3F72A 3BTLA 1SFEA 2G9WA 1T0FC 2BZTA 3KEQA 1JKPC 3OSPA 5FRMA 5B1BH 3UNGC 4ZC3A 4M3EA 4N9IA 2QZ8A 1TTYA 1OYIA 1W5SA 2XAUA 2UWMA 1SD6A 5ERIA 2VKHA 4UUSB 1KEEA 1MJAA 3OIPA 2FQ4A 2JA5J 2DFFA 1JUSA 4EJWA 2R0QC 4K0KH 5IWAH 4B1RA 4BKXA 2M5WA 3JRDA 5KHDA 1JLLB 5CVJA 1S0OA 2JA7J 3D0SA 1UJ8A 2F5VA 2Y31A 3HRMA 3I59A 5HDGA 3RGZA 1KZHA 4R79A 3GTQA 5EG0A 3B6CA 4QJFA 2FMAA 3NBYB 3R5XA 2HQAA 4ED2A 4A3GG 4E6NA 2DBBA 5JVGF 2BOLA 2EFPA 2DA5A 4A3KJ 4CYCA 5AONA 5CM0A 3HM5A 4GFBA 4B3XA 4HF0A 2ZFWA 3K69A 3CMAI 2DU9A 4CC6A 3CMYA 5IOYA 1OBGA 1QHHD 5IYCG 1CF7B 1Z6RA 1VZ0A 1Y1WG 1KU2A 2FJ1A 3ZN1A 2FBHA 3FK6A 1R58A 4M9XA 4A2BA 1KA8A 2TRTA 4J9QA 4J9MA 2JA6A 1TWHJ 3CUQC 2CQNA 2HYFA 2XGEA 4ITVA 4YG2F 2LY9A 4FFLA 3H36A 4B09A 2CUFA 4ZZDA 4A3CJ 4QSHA 2MLGA 5BR8H 2NVUB 3HOZJ 3OUUA 1Z3XA 5E1XA 3E1SA 5EZHA 1VFCA 4LOCA 4QWDA 3GFJA 2R4GA 5EOYA 3GTOJ 5DCFA 2DA6A 3GLLA 4XMYA 3PUFA 4A5MA 4JI2H 5KKNB 1Z21A 2X51A 1HW2A 4DNCA 5L3EA 3MWEA 4O7SA 2IBDA 1CQJB 3U21A 1C0WA 4I4TF 2F5CA 3CEBA 1RR7A 1U6GA 2HOSA 3PR5B 1ZKGA 1Z91A 2W6OA 3P9IA 5DGAA 4AUXA 1X58A 2LBFA 5C3EJ 4XYLB 4FX4A 4TQSA 2BQ3A 2RDPA 4Q4CA 4IHSA 4ANJA 2W8KA 1PUEE 3NWSA 3GUDA 1IUYA 1AUXA 2BY1A 2OD5A 4MEYF 4EJVA 3KHGA 1Z77A 3F3XA 2NYXA 4P55A 1AU7A 4WHXA 2JZYA 2LREA 2LK2A 2WV0A 4IHTA 2RNGA 3MZ8A 4DUYH 3RB3A 3HKZE 4ECUA 1I6UA 2RDJA 1TWAJ 2R92A 5BMZA 2W9BB 1GYFA 3ESWB 3KFWX 2XHKA 3RKXA 3TW6A 1EYZA 4Q5SF 2A5YB 2PMZA 3KAKA 1RKTA 5D6EA 4C3HJ 4LF7H 4J19A 1CQIB 3FMRA 3W6VA 4RGSA 1JKJB 1ON2A 4Q45A 5L1LA 2M45A 2NXNB 3D1NI 1LE8A 1KJ9A 2XV4S 3H3ZA 4O82A 2K7LA 1EKVA 4RMNA 3WG7H 1K4TA 4J9SA 1YIOA 4PJJA 3R4KA 4KIFA 4XR6A 4O6JA 2BHZA 2LR8A 1ON1A 3I54A 4BQNA 2QQAA 1ENHA 3A4CA 3CJTB 3NAUA 4G8XA 5H20A 5EEAA 1H88C 4IQJA 3Q8SB 1XMQH 2ABJA 3GIJA 2HOAA 3LSRA 2DFEA 3FK7A 3WTYC 2R7RA 2F5EA 1X2NA 4RDUA 2BQUA 4MV9A 1A04A 1PK8A 1FSHA 3TY8A 1BI1A 3T54A 4XYMB 3W2VA 4UCSA 3HIFA 2ZXJA 1I3QJ 3BCBA 4Y3OA 2YPRA 3BR2A 4DGWB 4M72A 2ZSHB 3FDYA 2M1BA 2CQXA 4A0ZA 3NRVA 2A68F 4YIFA 2EIJH 4XKVA 4DQNA 1O4XA 2VIXA 1O57A 5L1IA 1MH4A 1QQIA 4LJZF 3DF7A 4OU0A 1KUTA 2I8CA 5DAAA 3KHLA 2XROA 3A0BC 3BTCA 3ERED 1VQMI 1S72I 4HG2A 3W2WA 4A3GJ 3OUZA 2FOWA 2V5AA 3ETHA 5KFSA 4IZZA 5DEQA 3Q8RB 3FXRA 2EQRA 1MW7A 2IJLA 1VBGA 1T39A 4ZDPA 3CQZA 5ICCA 2IP4A 4JV1A 4O7ZA 2EJRA 5IYCJ 3T9FA 1OR7A 4CA0A 2LY2A 1UG0A 3GVAA 1A6IA 1Y1WJ 4HW0A 3OYLA 1ACIA 2LKSA 2OAZA 5FKMA 5KG2A 3GTJA 1E4EB 2I80A 4IRKA 5BWTA 3CCJI 5HNEA 4D0PA 2IA0A 1WSUA 1JJ8C 2CU7A 2RQQA 4RB3C 4O4IF 1TQPA 4FFPA 3QPTA 4DUZH 4MTEA 4AVZA 4KT5C 4NDLA 4Y8VB 1UNNC 2HGXA 1SVLA 5DLGA 3HOYG 4JBAA 2W7PA 2UXNA 4DBQA 4XL9A 3BQZA 4O7NA 5C8YF 1W7PA 2XAHA 1XDUA 2ID6A 4AYBN 3GV8B 4C2UA 1IN6A 4HR7A 4XN3A 4E4HA 3I56I 2WYOA 1R1TA 1WQ2A 4M71A 4B3AA 2HDCA 4DRFA 1LFPA 3GYHX 5DQGA 5CB4F 1LDJA 1BJAA 1OCZH 4QPOA 5K2MA 2FX0A 4V2GA 2HWVA 2LYCA 1LEBA 3KLNA 4JV0A 2YRXA 3TBIA 3IH3A 3TGNA 4YQWA 2EB7A 3CCRI 5LMNH 3K4LA 2KIMA 3F8BA 5LEKA 4RAYA 3SXYA 4UHTA 4O86A 2NVYJ 2X85A 4F93B 2R3SA 3IKTA 1IRGA 4Q8EA 4RM2A 3OYKA 2W25A 4LFCH 2PBIA 3RV4A 2VKVA 2P6TA 3SI8A 3PUBA 2FPPB 1TQIA 3PQKA 1ETOA 3J81Z 3HJEA 4ABZA 3M9NB 2YUSA 3VEPA 2D45A 3S17J 4CE5A 4IAJA 1TWCA 3BCAA 3BG9A 1VS0A 4QWAA 3OSFA 4LH7A 3LNQA 3G6EI 1O3QA 2D5VA 3ZQFA 3PW7A 2D1VA 1O7FA 3AG2H 4O84A 1BOAA 2YU9A 4LMYA 5KFBA 2XPVA 3FKJA 1T8IA 1RJRA 1RESA 1TNSA 5KX5F 3PM1A 3TEDA 2IAIA 1PYVA 1RYRA 2K9SA 1I94H 2I5UA 2PI0A 3K7AJ 1YX5A 2X1CA 2UXBH 3L2CA 4MA0A 4TM5A 2H1KA 3E6CC 3ML6A 4ENKA 2IS1A 3LL7A 2QCOA 3QQAA 3E5QA 1A9XA 5LHHA 4HNVA 4MV7A 3M9MB 4BHBA 2OV7A 3CCMI 5K5RA 3T5JA 4FE7A 5FKOA 3KE2A 2EINH 5HS8A 3UZOA 2DOFA 2MH9A 3ONQA 4NC8A 1E3HA 5LHIA 1P4XA 1TWGA 3U1KA 5FLMG 4YIIA 2VE9A 1P7IA 4LFBH 4PZ8A 2ECCA 2OC6A 5FB2A 1GGOA 4CC5A 4BY1G 3QP6A 3G6YA 2ASJA 1NTCA 1G3TA 1Q1VA 3CF5F 4IO9F 2A6TA 1HNWH 2CFOA 2HNHA 1QVUA 3NUAA 2F5DA 3U9GA 2OTLI 1UHSA 3KLOA 4NQWB 2R6FA 3FHZA 2LDUA 4DBRA 4U7BA 1VQLI 1R4NB 2LF7A 5J1RA 4TV9F 5J1UA 2LSOA 1IXRC 1TT5B 2K02A 2OUMA 2QQBA 2GXBA 5FR9A 3U54A 1H8AC 2UXDH 3NEUA 2ASLA 4EM2A 4CUGA 1U5TA 2P5KA 3OYGA 2KDZA 3H1CA 5EDWA 1JJ6C 3L09A 3JTHA 2B63G 3TIGA 1W5TA 4O7TA 2HKOA 2IEKA 5DISC 5I5VA 3MFIA 2ZXIA 5B66C 1SFXA 3HBLA 2KJBA 4LB5A 3AL0C 3BWGA 4JX4A 2PMZE 4G6QA 5E3NA 5KFMA 1S6LA 3GIQA 4IKFA 4XLNF 2NU9B 2W70A 1P4WA 3FXJA 4L5EA 2ZDQA 2QQ9A 5H6QA 4EQ5A 1JXLA 5DGBA 3M07A 5GPCA 5J4YA 3HOYJ 1JDEA 1ULZA 4E4TA 2KPMA 4NZOA 2V9PA 1DAAA 4C5AA 3H0GA 3JAMK 2HHFA 3IV5A 2FF4A 4BEHB 4NZNA 3RAXA 3JZIA 1LFBA 4RNOA 3QP5A 2FJZA 2NVXA 4FQGA 3UKGA 1J75A 5J40A 1CKNA 1Z7UA 2L7FP 3RTXA 2ZKZA 4CKEA 4ON0A 5JQWA 2W24A 3HOVG 1VQOI 3GWZA 3GTQJ 4LG0A 3FXOA 1T33A 4PDBA 1HF0A 3H92A 2XUBA 1BIAA 1IBKH 1BN5A 4O83A 2AHQA 2VJJA 5IT9K 2OBPA 5D8KB 4XKBA 2EZHA 4PDKA 5M3MJ 1QA6A 5LYJF 2ZMEA 5L3BA 2DT7B 4ZTFA 3BQYA 2Q0OA 3IL2A 3Q1KA 5KFUA 1ITYA 3DXJF 3LA3A 2RV8A 4X1EA 4QIWE 3AKZA 3LWBA 4R1HA 4I98B 2IA6A 1F9NA 2BXYA 3BC8A 2R7VA 3DF8A 2E1NA 3DKYA 3MKLA 2Z02A 4BGDA 2XD4A 5C4JJ 4NXMH 3QPSA 2YZLA 5DQHA 2CW8A 3T1YH 3T9DA 2JA6J 2R7ZG 3TKYA 1U9OA 4G94A 4HOBA 5F04A 3R6SA 1ZGWA 3FM3A 5KT6A 3OSNA 1JX4A 4I2OA 1B6RA 4ENJA 4ZYAA 1TBXA 1YJWI 3DP7A 3F0CA 3K4NA 1ZELA 3TY9A 4EG0A 3DLLF 2DPIA 1ZYRF 3QPHA 3GZ6A 4UFZA 5LBQA 3RFCA 1P16A 4DR4H 4KIGA 1BR2A 2VJIA 4PZ6A 4AIDA 1VAJA 2NU6B 1SCUB 2KZVA 5KT5A 2GOMA 2GQQA 3MN2A 5LFAA 2FBKA 2CW0F 2VQCA 4R8HA 4CCJA 2FK2A 3A01A 4WD3A 4PGGA 5FLMJ 3TQTA 5EDNA 5ED4A 3N97A 4KHPH 3LSGA 3PSFA 3NWTA 4A6EA 3CCSI 4BE1A 4IR1A 1V55H 3FXQA 4FBTA 2FPGB 3FBIB 4M6VA 2YZGA 1XG1A 4FS1A 5FLXZ 3BZ6A 1RC9A 4E7SA 2LC2A 5F27A 4ESBA 2OF7A 4HA8A 2FNAA 3K3PA 5FKLA 4A3FG 1WFXA 2R92J 3O8GA 5FJ8G 1SVOA 3AG3H 1MMNA 3WO0A 4B3SH 5JH7F 3PL8A 3TO6A 3OYJA 1WJAA 2BVLA 3U1DA 4D7MA 4PBCA 2DFIA 5DQIA 4E7ZA 3RPQA 3VODA 4IOAF 2HIXA 4XKCA 1ZR4A 3E5XA 4O3PA 1B59A 2NS7A 4I0AA 3K70D 4Z6YA 3LSTA 2UVUA 2FEZA 2O5RA 5KCMA 3UZBA 4C5BA 4V2FA 3QYBA 5DM6F 2FXAA 2QSGX 1IBLH 2VPRA 4RB2C 1S9HA 1W5CC 2FP4B 1T56A 1S3JA 3G2BA 5KAFC 4MHGA 1K79A 2O6GE 4LFAH 3WWJA 3OYDA 5F6FA 2HDDA 2EJ0A 1E0EA 3S1NJ 3EUKL 1EA3A 1XB4A 2FMYA 3AAFA 2CV0A 1OJLA 1MJ9A 4L0YB 3SNOA 4CO8A 2P81A 3O2PE 2CUEA 2IGNA 3DFGA 4DR6H 1VQKI 2WY7Q 2M0MA 3EUHA 5DV5A 2XAJA 1XCVA 2O61A 5LP6F 4HX4A 2RGVA 2GQSA 3GIPA 1MMAA 1QGPA 2HJWA 4BH9A 1GUUA 3MKYB 2P6SA 4FU0A 4ME6A 5D5WB 3M9OB 1BI2A 4BDZA 3HOVJ 1Z2PX 3PVXA 1AN7A 4F55A 3PO2J 3BOQA 4LITA 5KFNA 2X0SA 3H35A 3MKWB 2K9LA 4EFEA 2HS5A 5H6RA 2DPJA 2DT5A 1IUFA 2EIKH 4UB8C 4KJZA 5D8LB 2VBWA 2QKMB 3OYEA 2JMWA 4DL4A 3T9EA 4XRMA 5E3MA 1MDMB 1REPC 5BS6A 3TIIA 1KYWA 3K70C 5BQTA 3CQZJ 1QHGA 5JVLA 3K0LA 2ESNA 3SFZA 3BROA 4NC7A 2OQRA 2ZC2A 4LF9H 1CKMA 4HV6A 1D8JA 4EBCA 2ME0A 3GTJJ 1JHFA 5EWFA 2SCUB 3H5RA 3IUOA 4C5CA 1Y0NA 4B3MH 2VQLA 4BU2A 5FLVA 3TMOA 4M73A 3HUGB 4PZJA 5KK1A 4RCNA 5J47A 3WGHA 1GT0C 4FE4A 3DKXA 5F0FA 1WR2A 3HGGA 2OZUA 2ELKA 4J0MA 1HNXH 1XNRH 5L9XA 1WJEA 3GDEA 3CC4I 5TJJA 4C30A 4I55F 3H0GG 4LG3A 3W6KB 4B44A 3S1RJ 2RGRA 5EYRA 1H9TA 2COJA 2K9QA 1IRFA 5E8IA 1RETA 4A3JG 3GLKA 3S16J 4JI7H 2VA3A 1S7OA 4AYBA 4YEJA 4YFXF 3RB0A 4XSXF 1TLHB 3JZFA 3IWFA 2NAZA 1RJPA 4LK0F 1ZLKA 4YR0A 4XONA 3C2GA 2UV1A 4IIJF 3LMLA 4XLPF 3IRRA 1VQNI 3G6XA 4A93G 1OYWA 1JI8A 4XLAA 5DTDA 2E2HA 3K4CA 2QBYA 5CQGA 2L0KA 1N33H 4IHVA 2E1MC 1XSXA 2K9MA 5KFPA 2VN2A 1FMVA 2C2DA 2MG4A 4CDGA 5BPDA 2R7UA 2DODA 5H2FC 3OYMA 4A3FJ 3FDSA 3MR3A 2A05A 2STWA 3L4KA 1TWCJ 4ECVA 1TT0A 2EV5A 3IN5A 2ZSIB 3N42B 2HYGD 2R5YB 4FX0A 4M6XA 3OYIA 2N8GA 1U2WA 2W6PA 2CYYA 5K3WA 4EMSA 2YU9J 4MLOA 4P9UA 2PN6A 5F1JA 1K78A 2PJRA 1B9MA 3G73A 1BA5A 2HKXA 4YIRX 4FHTA 3HSRA 3ASNH 3M4OJ 2C2EA 4O7RA 1OQYA 5BYBA 2UVVA 2V1UA 4XICA 2XCLA 2UVWA 4ZYDA 4TQRA 3DKWA 5HLTA 4BBSG 3O6BB 3OIOA 4JV2A 4XIDA 4K6NA 3BPVA 4F4XA 4PUSA 1TWFA 5BWRA 4NB5A 4ECZA 2Y9ZA 4KMFA 2TCTA 1J7KA 5ILUA 1FOXA 1T38A 3T0YA 3PR4A 2XGCA 1TWGJ 3GFLA 3IHUA 4J9OA 2F4IA 2EZLA 4AIJA 1DGSA 2QVOA 3FWEA 3KYHC 3LWFA 3H4DA 1J2XA 3A0HC 1YIJI 2ADUA 1JKOC 3OHBA 5M5YJ 1WJFA 1E3PA 2HTJA 2EK5A 3SFIA 1E3OC 1LVKA 4DZPA 2XF7A 4CSWA 2V26A 2VUGA 1TW3A 3WGGA 2P7CB 5DM7F 5B1AH 1KYZA 3J7AK 2JSPA 2O03A 2QLZA 2YYAA 2KT0A 4F7ZA 1Z2OX 1BR4A 4HQEA 3BABA 2YSRA 1BL0A 4J9LA 1VNDA 1LDDA 1EKPA 1QU3A 2XVCA 2K85A 4WX9A 1YE9A 3HC7A 5HLHA 2ZJ2A 4ZHQF 4E7KA 1X1BA 2DPDA 1ETWA 2GLOA 4II3A 3KX2A 1D1BA 1OBDA 2HFHA 3L2VA 4F4WA 1CS0A 5KFTA 2W6NA 5CAEB 2J6TA 2A6HF 4FASD 4HBLA 1PDNC 1Z0XA 5DCMA 3R5FA 3RJ0A 3JR9A 1OYYA 4QW8A 2HGCA 5BOXA 1JXSA 1EZ1A 5KFJA 1I2LA 1JT6A 4J9KA 1RKWA 3SQNA 1G59A 2R5ZB 3ABUA 3OS1A 2UXXA 2EILH 3BTJA 4DYRA 4E6KG 4C2TA 4C9YA 1ZHQA 1AKHB 2L4MA 3CD6I 4IHYA 4FS2A 4ZYEA 4E70A 3H0GJ 2L9SA 3IG0A 1QPIA 4R8UA 3WE3A 1I50A 2X6WA 4V19K 4XLHA 4IOCF 3WU0A 4MQ9F 2LNBA 1YW9A 3MAJA 2NVXJ 1EF4A 4ECSA 1ZRCA 5CA0F 3F8CA 3JSLA 1B72B 5E20A 2DO7A 2W9AA 4LSAA 1T6SA 2ELJA 4A93J 3BACA 4MV1A 4CZCA 2DIKA 2XKOA 1EUDB 2L7KA 2BY2A 3ECOA 1OCOH 1IDYA 5HS9A 2R7QA 4PJ0C 1VI0A 2O0YA 3CJQB 3P9CA 4HSTA 1FYKA 4B3TH 2YX7A 2XGPA 5KFOA 2HVRA 5BNGA 2XCPA 4UXNA 1OCCH 5HVQC 4GXOA 4APMA 3S3MA 3HRSA 5I5YA 3G1MA 4JUZA 4CYCB 1SD7A 1MMGA 4F92B 2H6BA 4DV0H 2XB0X 2GPWA 5EEHA 4FETA 3MR5A 4CKBA 2MW8A 2DW4A 2E5ZA 1I5ZA 1LFUP 1SMYF 3TO9A 2FNPA 1N56A 3OIQA 1CE8A 3MCZA 4CMDA 2H8WA 1J59A 3F6VA 4UUSA 3GZNB 4YELA 1ZARA 3ZOBA 1ETVA 2R7XA 2IRFG 5HNHA 3N40P 2W7NA 2UZKA 3KYCB 4YR2A 3NBZB 4Q44A 3T1HH 4BBSJ 3GXOA 4YRVA 4NBQA 1A3GA 3L2RA 1N77A 5IYZF 3JAMW 2XSJC 3VYSB 2NS8A 1IOWA 4O3OA 4X65H 3OOUA 1ZREA 2V9WA 1B9NA 4MV8A 1JUMA 2KRHA 4U0YA 2GZWA 1XMKA 1J9IA 5JHUA 1BM9A 3OS2A 4GLXA 4E7IA 4JI4H 3DPTA 3WTSC 1FP2A 2RF4A 3PNVA 4D1QA 2KRFA 1ULYA 4Y13A 3T8TA 4OIQF 4TUYF 1GV5A 3VWBA 2XKPA 1DP3A 2BR0A 4BS9A 1ZTRA 4AYBE 3VPBA 1IF1A 5IT9W 5A2QK 2HOEA 3TEKA 3S2WA 2LBFB 3QFFA 3ZMDA 3HPGA 4RUAA 1G2HA 5KFGA 4RNMA 1RR8C 3J7AY 2FK3A 5K7HA 3U55A 4BXFA 2FD5A 2MD5A 2QSHX 2L9RA 3FKIA 2CKZB 1D0XA 2QM3A 4KDPA 1IV6A 1B33N 3TO7A 3SEQA 2W84A 4D5FA 5EGOB 2WY8Q 1S7AA 2XPWA 3M7GA 3ZGKA 4AM3A 1N78A 1FY7A 1WH2A 3ZMZA 5C1PA 3H20A 2ISYA 3OS0A 2XASA 1SMTA 2DOEA 4ZYHA 2WAEA 2OZ6A 2KIUA 2B9SA 4HRIA 2PEXA
chains in the Genus database with same CATH topology
2VPSA 4MV7A 4BJ6C 4KT6A 2OV7A 3OMYA 3I9V2 1LKXA 1W36C 2UUBH 4BACA 3K6GA 2IS6A 5TGTA 3ONQA 4NC8A 2V7FA 2KSWA 2NOJB 4HEA2 3RIZA 4LFBH 4PZ8A 1V9PA 2OC6A 2M7AA 4F91B 4CC5A 3HG9A 3DLAA 2A6TA 1HNWH 1WJDA 2CFOA 2HNHA 2XDVA 3DU5A 4LIVA 2LOOA 3NC0B 1P9QC 3M1CA 2CMPA 1NG7A 4U87A 2RREA 4NQWB 4BQOA 3OYCA 1UELB 3HOTA 2CFMA 3BA8A 4DBRA 4U7BA 3FMAA 3N44B 3OL3A 1S03G 4BDYA 2M4KA 4ZJZA 4DR1H 2OUMA 2WADA 4N4OB 3PN1A 2W57A 3D5SC 2UXDH 3DPLC 2LG4A 4CUGA 4X0GA 2Q2UA 4LIUA 5CPRB 3OYGA 3PNYA 2R7TA 1X1CA 4RM3A 3LSKA 2VOBA 2XF6A 2HHHH 4DV4H 1FJGH 2V1NA 2UU9H 4BE2A 3VSKA 3HXLA 3DU6A 5DISC 2HPIA 3QYFA 3RGXA 2ZXIA 3AL0C 3K4MA 1J5EH 2VXDA 4IKFA 4X64H 3S24A 1J09A 3HL2A 1CKOA 2KP6A 2CW7A 4EQ5A 4B48A 3ZXSA 4OWRB 3OR1C 2VQHA 2X1EA 1V5GA 3CZ6A 1L2ZA 3PNTA 2E5NA 1LDKB 2KPMA 5D1PA 3CP2A 2X1DA 1E4GT 4RLQA 4BEHB 1SYXB 2BW3A 4G6TB 4PFOA 4ZDLA 2OWOA 4XNFA 3V42A 4JQFA 3A1YA 2CUZA 1CKNA 3ZCOA 3OY9A 4HSRA 2KL4A 2KLOA 3F9KA 3RTXA 2WE6A 3D5RC 1V5EA 1UAAA 4RAZA 3S32A 4LF8H 4PDBA 4CCMA 5HOOA 1IBKH 3ZR8X 3W2AA 4Y4RA 2VJJA 4LF4H 4XKBA 3JSNA 1PJRA 3MWMA 3QYEA 2DT7B 3W3CA 4ZTFA 4B43A 2WA0A 1KONA 1XMOH 2MC4A 3N6XA 1SAUA 3AKZA 5FLXW 4XLCA 4RB0A 4BQQA 1D0ZA 3BC8A 2R7VA 1X19A 3DKYA 2MABA 4BGDA 3EUHC 3DTIA 4NXMH 4PJLA 2CW8A 3T1YH 4P1WA 3TL4X 2IGKA 4F3QA 1BJTA 1YX3A 3MKZA 2PJRB 3AL0B 3N41B 1D1CA 1E4FT 5LD2C 4ZYAA 3C0FB 1N34H 3K4NA 4OX9H 1XNQH 1ZELA 2DOAA 3HPHA 3H9QA 3OYAA 2DXIA 3TY9A 4PSWA 4XOTA 4UFZA 3W1BA 4EFBA 4EATA 1P16A 4CH7A 4DR4H 4X62H 4YHHH 1BR2A 2VJIA 4PFPA 4PZ6A 3CF2A 4HNTA 4DV2H 2X6YA 2AQEA 3LSHA 2KZVA 2L9NA 5FPRA 2GOMA 5LFAA 1O75A 3HKZA 3OTOH 2VQCA 1T95A 3CJRB 3UR3C 4CCJA 1IBMH 2KMUA 3ZQQA 1K6YA 3OWTA 2L2OA 3H0DA 3DQVC 1NG6A 4UCVA 1V5FA 3MMYB 3S93A 4DR3H 4JI3H 4E7HA 4LF6H 2CV2A 4KHPH 3LSGA 3PSFA 3NWTA 3L2WA 4BE1A 3DEEA 4NNJA 3VSLA 4YY3H 3FBIB 4R7RA 3TY5A 4H4KC 4E7SA 1M0WA 2LC2A 4JI0H 2M3AA 1OR7C 1D1AA 2VXZA 4P5OA 1WFXA 2V4JC 2XC7A 4DR2H 1MMNA 2UXCH 4B3SH 1FVIA 3FBNB 3PL8A 3OYJA 4N4NB 1WJAA 2BVLA 4KISA 1OLTA 2K5CA 4E7ZA 2Q1ZB 2CV1A 4CCNA 2HIXA 4XKCA 3SEZA 2P0WA 2ZFUA 3K70D 4KITB 1FMWA 2R7OA 2O5RA 5KCMA 3QWUA 3DWLE 4JYAH 3K10A 3VNNA 3QYBA 1IBLH 3D5LA 3LSIA 4RB2C 1S9HA 3RR5A 3OYFA 2UUAH 2DJIA 1R6RA 3G2BA 1FKAH 4LFAH 3OYDA 4BJTA 4XN0A 1E0EA 3L4JA 4PJMA 2M7BA 4BE0A 4JI5H 1BR1A 1EA3A 3EUKL 4UCTA 2MYSA 4PZ7A 5LMUH 4F52A 2Q2EB 4J00A 2CV0A 4RZQA 3BG6A 2WAFA 1MZBA 4X66H 4AQYH 3QOEA 2IGNA 1WJ5A 4DR6H 2WY7Q 1X4PA 2M0MA 2Z2SB 2RGVA 2W4SA 3PJRA 1MMAA 4GKJH 3CESA 3DTEA 3MKYB 3L2QA 5FD5A 2HVQA 4BDZA 1MNDA 1Z2PX 4BWSC 1X1DA 2XF5A 4F55A 1AN7A 3PSIA 1G8XA 3BLYA 4LITA 3RCOA 3VYRB 4AU7A 4IX7A 1XK5A 4E7LA 4M7EA 2E5LH 3H35A 3OYHA 3MKWB 2K9LA 3KEYA 2GOXB 4EFEA 2MCTA 4JI6H 4FM9A 2BW3B 2HGSA 1Z3YA 2HU9A 4KJZA 2QKMB 3OYEA 5FD6A 2W1OA 2HVSA 1CKNB 4DV5H 3EYYA 1AA7A 2W00A 4JI8H 3H5AA 4NUBA 2XIGA 1N75A 4PSXA 3K70C 1QHGA 4IQ4A 3M4IA 2FE3A 4NC7A 2VL8A 3OYBA 1CKMA 4LF9H 3OR2C 3LMMA 1T0FC 2VQEH 5FRMA 3UNGC 3H5RA 4ZC3A 3IUOA 1ZHSA 4B3MH 3W1GA 2VQLA 2XAUA 4BU2A 3S3NA 2UWMA 1N36H 3TMOA 2VKHA 3HUGB 3M8JA 3RPUD 3OIPA 3DKXA 3KALA 2ZJTA 4K0KH 4J0MA 1HNXH 1XNRH 2AQFA 3BG7A 1WJEA 3GDEA 4ETSA 3AFHA 5IWAH 4C30A 4JOMA 3W5OA 4LG3A 4B44A 4I7HA 1BOBA 2RGRA 5KHDA 2A5WA 3LSMA 2ZXHA 4BEHA 2F5VA 3RGZA 2MD0A 4R79A 4JI7H 1WJCA 4YEJA 4AYBA 2BVMA 3NBYB 2HQAA 3OL4A 3H9GA 4E6NA 2BOLA 2JA2A 4HPQA 1B04A 4XONA 2VQFH 2I8DA 3C2GA 3K4BA 2UV1A 3LMLA 4B3XA 3K3VA 1JI8A 4XLAA 4CC6A 4UCUA 1QHHD 2DT6A 3I3LA 3K4CA 4Y33A 1VZ0A 5CQGA 1N33H 4EEQA 4UCOA 2E1MC 2KDOA 1ERDA 2K9MA 4XQFA 4A2BA 5JHFA 1HNZH 1FMVA 2CH0A 2DCEA 2R7UA 4ITVA 2W82A 3OYMA 3L4KA 4OAYA 1Z2NX 1TT0A 3BA9A 5BR8H 2ZSIB 1Z3XA 3N42B 3E1SA 2JUGA 2HPMA 3OYIA 2R4GA 5EOYA 4MLOA 2PJRA 4DV1H 1DGWY 2VJ4A 4XMYA 4XLEA 3GJXB 4JI2H 1Z21A 2X51A 5D1OB 2JVGA 5KNLA 1MNEA 3SDBA 2Z16A 2VKDA 4CCOA 3U21A 2K3PA 5HLTA 3CP8A 4ZTJA 4MTDA 3BAAA 4PUSA 4LH6A 2HDWA 4XOPA 2R7SA 4DIQA 5CQEA 2LBFA 3CVZA 3KAJA 3MD2A 1HR0H 4RB1A 3L2PA 1MMDA 4ANJA 1DGRM 3NWSA 1TA8A 4UCRA 2F4IA 1DGSA 3KYHC 1TAEA 2LREA 3EUAA 2RNGA 4DUYH 1I6UA 2IS4A 4DJAA 1WJFA 2CUJA 2IGOA 4LSXA 1GYFA 4PK4A 5FRNA 1LVKA 2VB6A 2QKLB 2XF7A 2PMZA 3QODA 2V26A 4CSWA 2VUGA 3KAKA 4LF7H 1WJBA 3J7AK 2JSPA 2O03A 2E1MB 4DR5H 1Z2OX 3FHNA 1BR4A 3BABA 4DV6H 1QU3A 5A2QW 3A2KA 1YE9A 3HC7A 2V9KA 3H9JA 4RMNA 3N43B 4II2A 1GLNA 1X1BA 4E7KA 1BGWA 2JVHA 4A2AA 3DTKA 3KX2A 4II3A 1D1BA 4PJJA 2FUG2 4XR6A 1SFKA 3VYTB 3L2VA 4B47A 4XKWA 4BQNA 3A4CA 4IQJA 2HZDA 1A0IA 1XMQH 3VDXA 4FASD 2VJ5A 3RJ0A 4DR7H 2R7RA 1Z7LA 4XORA 4MV9A 3RQ4A 3TY8A 1G59A 2WDTA 2HIVA 3W2VA 3OS1A 3IAM2 4UCSA 4RLFA 4E6KG 4C2TA 4Y3OA 2L5QA 3BCBA 4C9YA 1ZHQA 2ZM6H 2KRCA 3KXYT 4DGWB 3IG0A 2L9SA 2ZSHB 3FDYA 4QPQA 1TZLA 1S68A 2VQGA 4BUPA 4XKVA 4ZDOA 2VIXA 2LY1A 2X6WA 4XLHA 1XDNA 4DV7H 3DF7A 2WBMA 4D9JA 4HG2A 3W2WA 3JSLA 2LRDA 2CS3A 2WAQA 4IZZA 4J01A 4LSAA 2ELJA 1MW7A 1X4OA 4ZDPA 4CZCA 2L7KA 3RTRA 4OAZA 4CA0A 3OYNA 2LY2A 1UG0A 3J80W 2R7QA 5FROA 1D0YA 2MFZA 1X9NA 3SYTA 3OYLA 3CJQB 4HSTA 2V6EA 2Q2TA 4B3TH 3J81W 4JV5H 2HVRA 3K4JA 3ZRGA 2F6CA 5HVQC 4APMA 2X6XA 3S3MA 1DQUA 2RQQA 4GKKH 4RB3C 3CMMA 1N32H 1MMGA 4F92B 4MTEA 2WB1A 4DUZH 4AVZA 4DV0H 3L2UA 3K4KA 4FETA 1Y6IA 1Y56A 4BJ5C 2E5ZA 2LH9A 3KYLA 4DBQA 4XL9A 2R7WA 3OIQA 3VYUB 4C2UA 4LF5H 4CCKA 4XN3A 4E4HA 2WYOA 4YELA 5FPOA 2R7XA 4DRFA 1LFPA 5HNHA 2W7NA 3N40P 3T1HH 3NBZB 4YRVA 4QPOA 3L2RA 1N77A 3JAMW 3PFYA 2LYCA 4CCLA 2XSJC 3VYSB 1W36D 2UUCH 4X65H 3TBIA 2KHMA 3OOUA 3LFUA 1HA8A 5LMNH 2KRHA 3K4LA 4JI1H 4RAYA 4GRIA 3OS2A 4GLXA 4E7IA 2X85A 4F93B 4JI4H 3DPTA 4RM2A 4DOZA 3OYKA 3RSNA 4LFCH 3PNVA 4D1QA 1X1AA 2VASA 3GB8B 4NXNH 4XM3A 3PUBA 1U0JA 2VLAA 3F8NA 3VWBA 3H5NA 2VPLA 4E7JA 4BS9A 3SZGA 1DP3A 2IXSA 4IAJA 1P8LA 1IRXA 2E60A 5IT9W 3BCAA 4XLFA 1VS0A 1SEIA 2LBFB 4LH7A 4Q0YA 3RF2A 3HPGA 2IGMA 2Y0SA 3EPZA 4PJNA 3J7AY 5LL6b 2IS2A 3N05A 4DV3H 4BXFA 3IP4B 5CKTA 5HNFA 4HNUA 4LMYA 1D0XA 3S3OA 3S8PA 3FKJA 2UUZA 3SEQA 2YCHA 4B3RH 1PYVA 3HOSA 2WY8Q 1I94H 2F4VH 3ZGKA 1YX5A 2X1CA 4BL0B 1N78A 2UXBH 1WH2A 2M4GA 3H20A 3OS0A 3GBGA 2IS1A 2Z1DA 3UQ8A 3DPUA 3IAS2 3LL7A 2KQRA 3C2HA 1M0TA 5D1OA 2WAEA 3E0JB 4HRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P16 A;  3GDE A;  4PZ6 A;  3TY8 A;  2HIV A;  4UCS A;  3W5O A;  5FPR A;  1S68 A;  4PZ8 A;  1V9P A;  4CC5 A;  4UCV A;  3NBY B;  1XDN A;  4E6N A;  3NC0 B;  1B04 A;  3BA8 A;  2CFM A;  3JSL A;  3TY5 A;  4CC6 A;  4UCU A;  3PN1 A;  4EEQ A;  4UCO A;  2Q2U A;  1FVI A;  1X9N A;  2Q2T A;  2HVR A;  3BA9 A;  2HIX A;  5DIS C;  3QWU A;  3S24 A;  3VNN A;  1CKO A;  3GJX B;  5D1O B;  4EQ5 A;  3RR5 A;  5D1P A;  5FPO A;  4DRF A;  3BAA A;  4LH6 A;  3NBZ B;  4UCT A;  4PZ7 A;  2OWO A;  1CKN A;  3L2P A;  3RTX A;  1TA8 A;  4UCR A;  1DGS A;  3KYH C;  4GLX A;  1TAE A;  2HVQ A;  3GB8 B;  3JSN A;  1XK5 A;  4EFE A;  1P8L A;  2VUG A;  1VS0 A;  4LH7 A;  2HVS A;  1CKN B;  3BAB A;  1CKM A;  3W1G A;  1A0I A;  3UQ8 A;  3TY9 A;  5D1O A;  4UFZ A;  3W1B A;  4EFB A; 
#chains in the Genus database with same CATH topology
 4Q48 A;  4ESJ A;  2VPS A;  4G7H F;  2YRW A;  3GTG A;  4BJ6 C;  2QSF X;  3T5L A;  2DLL A;  3E6D A;  1QBJ A;  2GXG A;  5ICG A;  4BAC A;  6PAX A;  5TGT A;  1PP8 F;  2ELH A;  4M9U A;  3J7A O;  3KZY A;  2NOJ B;  5ICE A;  3CUO A;  3UFX B;  3WTT C;  1J0R A;  4M9S A;  3RYR A;  4L18 B;  5AIQ A;  2RKH A;  1V9P A;  1IC8 A;  2AGO A;  2V1X A;  3GFI A;  5KFE A;  2AGP A;  2Y2Z A;  3S15 J;  5DGI A;  2DFH A;  2LOO A;  2O8X A;  4DIM A;  2QA4 I;  4EGQ A;  2CMP A;  3OYC A;  3BA8 A;  2CFM A;  3HOT A;  1S03 G;  1K4S A;  3FMA A;  3OL3 A;  2M4K A;  1C30 A;  3J80 K;  1WGX A;  1MSF C;  3PN1 A;  2YWV A;  5ILS A;  2F2E A;  1S10 A;  4X0G A;  2ID3 A;  5F0C A;  4XK4 A;  1MIJ A;  3WGI A;  3JSP A;  1YRN A;  1I7L A;  2CQK A;  2B7E A;  2W71 A;  2OH2 A;  4L9N A;  1I1K A;  5BMV F;  2V1N A;  3BR3 A;  1P6R A;  1FYL A;  2UU9 H;  1LPQ A;  2Q2E A;  5FKN A;  4IRI A;  4EGZ A;  1JDB B;  3KHR A;  1KU7 A;  1WH5 A;  2IA2 A;  5CVV A;  2CW7 A;  3ZXS A;  1A48 A;  3BZC A;  2IA1 A;  1V5G A;  3PNT A;  1B6S A;  1S8N A;  2E5N A;  2KIS A;  1G3S A;  5D1P A;  4L9T A;  1WVR A;  1JE8 A;  2X1D A;  2JA8 G;  2ZBK A;  3KP6 A;  4RLQ A;  2LD5 A;  3BPX A;  1R4M B;  2FSW A;  1B6A A;  3DBL B;  3FZV A;  3TOA A;  2DYR H;  2ZB9 A;  2WAQ N;  4OMZ A;  2UVR A;  3V42 A;  4JQF A;  1RUN A;  3COA C;  3JSO A;  2A1H A;  4TV8 F;  4CKC A;  3OY9 A;  5I5W A;  5KG5 A;  2KLO A;  3ABL H;  3D5R C;  1JKR C;  4A5N A;  1UAA A;  3CDL A;  4WXC A;  2JUC A;  2C00 A;  2JWT A;  1HKT A;  1DDN A;  4LF8 H;  2EPF A;  2X0L A;  2VOO A;  3ZR8 X;  3W2A A;  2K4J A;  3I0T A;  3I71 A;  1JHH A;  1B8I B;  3JSN A;  1PJR A;  3GTL A;  4IWY A;  3QPL A;  1VQ8 I;  3W3C A;  4UUT A;  1FJL A;  5BYA A;  4YP3 A;  3QRF F;  1KON A;  4JP0 A;  2DAA A;  4GYI A;  2L4A A;  2WB1 N;  5LRS A;  2GM4 A;  3E5U A;  1IG7 A;  1T3N A;  1Y8Q B;  1ODD A;  4O7V A;  1SAU A;  4KFC A;  4RB0 A;  1XDS A;  2J5O A;  1BJZ A;  2E2H J;  4A3L G;  3F8F A;  1X19 A;  2XGX A;  3TIN A;  4O5V A;  3ERM A;  2MAB A;  2OTJ I;  3ABT A;  1L3L A;  5T14 A;  4PJL A;  1E4E A;  5KT7 A;  3A02 A;  4P1W A;  5EWG A;  2M8G X;  3AL0 B;  3N41 B;  4Y17 A;  5HLG A;  1D1C A;  4L9V A;  2J9G A;  1E4F T;  2I87 A;  5LD2 C;  1K1Q A;  3C0F B;  4M9Z A;  3RZO J;  1XNQ H;  4U7C A;  4DYC A;  1D8K A;  2O7O A;  3H9Q A;  2RNJ A;  2EBI A;  3WWH A;  4XOT A;  1F4K A;  3QWL A;  1W7P D;  4F4Y A;  4JX6 A;  4EAT A;  1KQ9 A;  4EGJ A;  5F0H A;  1BIB A;  4F4Z A;  2ME6 A;  1ETQ A;  2P4W A;  3H40 A;  3PW5 A;  4HNT A;  2AQE A;  5FPR A;  3QU3 A;  1O75 A;  1I3A A;  4WWC A;  1IZ1 A;  2LKP A;  2K4B A;  2JA6 G;  3FM5 A;  3JRX A;  2EA2 A;  3OWT A;  1O3R A;  1TWF J;  2A69 F;  2GWR A;  2R7D A;  3G8C A;  1WHU A;  2ZJQ F;  4JI3 H;  4LF6 H;  2Z99 A;  2CV2 A;  1ZGA A;  1A0G A;  2Y0S N;  1NK3 P;  1ZAU A;  2FB9 A;  5DG9 A;  2W8L A;  5CVR A;  4IRH A;  3DEE A;  3CCU I;  1XGN A;  1LJ9 A;  2E19 A;  3RKW A;  1XD7 A;  3VB2 A;  4RGR A;  5KFK A;  4JI0 H;  1MBF A;  2XPU A;  4K2E A;  1IN8 A;  1OR7 C;  2YZM A;  4DAA A;  2MSY A;  4XRF A;  5KFW A;  3SZP A;  1AWC A;  2IT0 A;  2VXZ A;  3RUP A;  2XC7 A;  4DR2 H;  1IOV A;  2AS5 F;  3WTX C;  1IRZ A;  1FVI A;  3M9A A;  4N4N B;  5IP9 J;  4KIS A;  1M1E B;  2VI6 A;  4MNU A;  4AWX B;  4DW6 A;  3SEZ A;  3FKI G;  2ZFU A;  1FWZ A;  4O3S A;  5E18 F;  1QZE A;  4LLG F;  1W93 A;  2LF8 A;  1NHA A;  1YI2 I;  4O4H F;  2C2R A;  2DA4 A;  1VQ6 I;  3BDD A;  3JRW A;  3KP3 A;  2J6U A;  2V6C A;  1QZY A;  4C3J J;  5J1Y A;  4UUG A;  3RR5 A;  3OYF A;  4CHU A;  3T5K A;  1RIO H;  4GCV A;  4HF1 A;  1R6R A;  3OOP A;  4BAY A;  1H9G A;  1U5T B;  1P7J A;  2VBZ A;  3PW2 A;  1OKR A;  2R92 G;  3BZK A;  1ETK A;  1FX7 A;  2QEX I;  1G3W A;  4BE0 A;  2Z3Y A;  1SC7 A;  4UCT A;  3V8K A;  2Y4R A;  4PZ7 A;  3JRB A;  4F52 A;  2Z33 A;  3WHB A;  4J00 A;  1MNM C;  2JA8 J;  4X6A J;  4RZQ A;  3EPG A;  2R7L A;  1MZB A;  2M2E A;  2RC4 A;  4BQA A;  1WJ5 A;  1I6H J;  2VE8 A;  3ECH A;  3GTK A;  3BR5 A;  2C35 B;  4WK8 F;  3PJR A;  4A3D G;  4G9Y A;  3DTE A;  3LFK A;  3L2Q A;  4G7Z F;  4P9F A;  2HVQ A;  1I50 J;  2R86 A;  2EFQ A;  3RBE A;  1R22 A;  3MZY A;  4FE2 A;  5GAD J;  5EWE A;  3DTF A;  2OCE A;  2HHF B;  2E5L H;  4NQW A;  1WZ2 A;  3MR2 A;  2MCT A;  2GOX B;  4N0B A;  1F5T A;  4XRS A;  4FM9 A;  4JI6 H;  2M87 A;  3EET A;  1Z3Y A;  1JTY A;  2K9N A;  3BR6 A;  3QOP A;  1RZ4 A;  5GTI C;  4LLL A;  2HVS A;  2LTP A;  3J7Z I;  1CKN B;  4I50 F;  4IZO A;  1Y1V A;  4PSX A;  4WF2 A;  5DS9 A;  1Y0U A;  3CCE I;  1WCM A;  2FPI B;  2V4R A;  2RQP A;  5DLF A;  1GSH A;  1FTZ A;  3PFF A;  5C1O A;  2FLN A;  3OYB A;  2HQN A;  4XBF A;  3KZI C;  4A3L J;  3PW0 A;  3LMM A;  1HCR A;  2VQE H;  2EWN A;  5F08 A;  4ASN A;  3G1L A;  1IYD A;  2CZG A;  1QNT A;  3PO2 G;  2GLT A;  2ZME B;  1ZHS A;  1TC3 C;  3S3N A;  2H6C A;  3K1N A;  3WOD F;  1S5L C;  5KG4 A;  3RPU D;  1FPQ A;  4EBD A;  5IOZ A;  2A07 F;  3KAL A;  1VQP I;  1H0M A;  2ZJT A;  1X3W B;  5E8G A;  2AQF A;  3DBH B;  4ETS A;  1GV2 A;  3B02 A;  2M9H A;  3FF5 A;  3F21 A;  3LOC A;  1Q1H A;  4BXX J;  4I7H A;  3RZD J;  1ZGJ A;  2A5W A;  5KAI C;  4MIM A;  3LSM A;  3BG5 A;  4BEH A;  2DPU A;  5EF6 A;  3T9B A;  2DA7 A;  2ESH A;  1B1B A;  2J5P A;  2Q7D A;  1WSC A;  1W4M A;  2BVM A;  2FLL A;  2H94 A;  2E1C A;  2VBY A;  3OL4 A;  3BY6 A;  3H9G A;  2WC2 A;  3P5J A;  1SD5 A;  2GPS A;  1KJJ A;  4MV4 A;  3CCQ I;  2YL2 A;  3SGI A;  2JA2 A;  2QEN A;  1B04 A;  3JRH A;  4A3M J;  2I8D A;  3K4B A;  3PQJ A;  4YAJ B;  3GTM A;  1GVD A;  1DV2 A;  1N25 A;  1RNL A;  4IJA A;  1U5T C;  2DT6 A;  4M3B A;  1GXP A;  1QZZ A;  3I3L A;  2GIV A;  2L3D A;  2GA2 A;  1HW5 A;  4EEQ A;  2ETH A;  3BQ1 A;  2KDO A;  3E6M A;  5L3G A;  2G0E A;  1ERD A;  4XQF A;  1HNZ H;  4AIH A;  1U78 A;  5KFI A;  2JEI A;  2DN0 A;  3I64 A;  2CH0 A;  2CO5 A;  2W82 A;  2HZT A;  2WWY A;  5KG0 A;  4P96 A;  1X1P A;  3BA9 A;  1KU9 A;  4GC6 A;  2JUG A;  3M3Y J;  3ZQI A;  1UG2 A;  1DPU A;  1MBE A;  3J7Y J;  2DTR A;  4IHJ F;  4EEY A;  2QGU A;  1U8B A;  2XB5 A;  3FKI J;  5DGH A;  4DV1 H;  1DGW Y;  4XLE A;  3GJX B;  1TQM A;  5D1O B;  1LUJ B;  2JVG A;  5KNL A;  1YLF A;  4J9N A;  4G6D A;  4IPA A;  4MFD A;  1S9F A;  2Z16 A;  3RJP A;  3S1M J;  4DL7 A;  2VKD A;  4ECY A;  3CP8 A;  5LRR A;  4OIN F;  4MTD A;  3LSJ A;  5GAE J;  3V6K A;  4LH6 A;  2VKE A;  3KHH A;  1IN7 A;  3PZP A;  3L1P A;  3EDP A;  4A2U A;  4GO1 A;  4DIQ A;  5CQE A;  2IBK A;  1WWX A;  5GAH J;  3GTG J;  1KT8 A;  3CVZ A;  3MD2 A;  5KFZ A;  2R8I A;  1RJQ A;  1HR0 H;  4RB1 A;  3ULQ B;  3L2P A;  3WU2 C;  2W6M A;  3Q0V A;  4S04 A;  1XSV A;  2YX4 A;  1DGR M;  3Q0U A;  3ELK A;  3TP0 A;  1DP7 P;  4QW9 A;  4UCR A;  3H4B A;  2PBZ A;  3BR1 A;  1TAE A;  4HN2 A;  4BY7 J;  2VC1 A;  2CJJ A;  3EUA A;  5L3F A;  2ZME C;  2DA2 A;  5D4S A;  2IS4 A;  2W48 A;  4EVI A;  3LQQ A;  4A3D J;  2IGO A;  4LSX A;  5KG1 A;  2HXI A;  2Q8K A;  1GLV A;  2WTF A;  2P8T A;  2QKL B;  2CWE A;  3QOD A;  3ZMT A;  4MV3 A;  2OQG A;  2EFW A;  2ISZ A;  4B8X A;  3OHA A;  5JLX A;  2IP2 A;  1WJB A;  2JSC A;  4UVC A;  3V7C A;  2E1M B;  4S0H B;  4XX0 B;  3FHN A;  1HW1 A;  2FQ3 A;  3T1B A;  3BQ2 A;  4ED8 A;  4DV6 H;  2E34 A;  2KKO A;  5A2Q W;  2X5R A;  1MGT A;  5IY5 H;  1Y39 A;  2V9K A;  3N43 B;  1GLN A;  1BGW A;  2A6E F;  3HTS B;  3ETJ A;  1XTA A;  3MWD A;  3DTK A;  2FUG 2;  4A3I J;  3M8E A;  3VYT B;  4XKW A;  1BI0 A;  1A0I A;  3IRQ A;  3MVP A;  5KVR A;  1ZR2 A;  4EJT A;  4HF2 A;  2QK4 A;  2R7K A;  2VJ5 A;  3KTM A;  4I01 A;  1T36 A;  4U0V A;  4DR7 H;  1P2F A;  2F48 A;  1VF9 A;  3RQ4 A;  5JR3 A;  3JW4 A;  2OCC H;  5H80 A;  2HIV A;  5ILV A;  2MLK A;  3FXK A;  2BQR A;  1T08 B;  4RLF A;  4U7D A;  2OU2 A;  2KRC A;  3E3V A;  1KGS A;  2DK8 A;  2JJ7 A;  1W0U A;  1S68 A;  1E2X A;  1HC8 A;  4O7L A;  3T8R A;  2KZG A;  2RDI A;  4IEJ A;  4ZDO A;  4CXF A;  3GID A;  5LXT F;  1JUP A;  4Q43 A;  3NGD A;  3PFI A;  2EFO A;  4D9J A;  3JRE A;  1FBS A;  1V51 A;  3WTU C;  1IN5 A;  2MA3 A;  3G8D A;  2ACJ A;  1IJW C;  5KG7 A;  3QZ8 A;  2LRD A;  2CS3 A;  2WAQ A;  5E1W A;  1R71 A;  1XGS A;  1ZRD A;  3Q0W A;  4YB8 B;  1E17 A;  1S7E A;  1X4O A;  5JVD F;  2NS0 A;  4QIW N;  4FGR A;  3HDD A;  3UYY A;  4HX7 A;  4XRS G;  3GTL J;  4OAZ A;  3J80 W;  1JGS A;  1D0Y A;  1X9N A;  1Y1V G;  3N6R A;  3RDI A;  4A0Y A;  2CNQ A;  3ZRG A;  3V6H A;  4A3B G;  1WCM G;  1W1W E;  2F6C A;  2P5V A;  3LA7 A;  5I5S A;  2X6X A;  2OA4 A;  1DQU A;  1S0M A;  1LVA A;  2EV0 A;  3CO7 C;  1VBH A;  3DEU A;  2WB1 A;  1V54 H;  3K4K A;  3R0A A;  2K86 A;  4LGW A;  5J2U F;  5DUI A;  1Y6I A;  1Y56 A;  3JRA A;  2LH9 A;  2E35 A;  5BWU A;  3DCF A;  5I60 A;  2R7W A;  1K6O A;  1HSJ A;  1OCP A;  4A69 C;  2COI A;  4LF5 H;  4CCK A;  3HUG A;  1BI3 A;  1JGG A;  1VQ5 I;  2HEO A;  5FPO A;  2P5L C;  2D1H A;  3RYP A;  1T2K A;  5CR5 A;  5L3C A;  5E79 C;  3JRI A;  1YQA A;  2GAU A;  3LUL A;  2YU3 A;  1U3E M;  5EJC A;  4CCL A;  2VBX A;  2UUC H;  3KIO A;  4OIR F;  1W36 D;  2KHM A;  1AHD P;  3LFU A;  1HA8 A;  2BGC A;  5IYD G;  1BW6 A;  4EEF G;  2XCA A;  4FFR A;  3EPI A;  3MZH A;  3GQC A;  1I2K A;  3HOU G;  4YJ3 F;  1O7L A;  4KYW A;  4LLN A;  2BBY A;  3KEO A;  1X1A A;  2VAS A;  4I02 A;  3WWI A;  1MJB A;  1Y14 B;  2XRN A;  3SDG A;  1U0J A;  2VLA A;  3F8N A;  1F43 A;  3H5N A;  2VPL A;  4E7J A;  2CFX A;  2IXS A;  1FZP B;  4GYG A;  2HOT A;  5BPF A;  3ZP5 A;  1IRX A;  2E60 A;  1P8L A;  2ZDG A;  5C4X G;  1A36 A;  2YR2 A;  3KYD B;  3ZQC A;  2FK1 A;  4HDU A;  2IGM A;  2R7F A;  2Y0S A;  3EPZ A;  4PJN A;  1KJQ A;  1A6Q A;  5LL6 b;  5BWW A;  2IS2 A;  1EJ9 A;  5KT4 A;  4DLK A;  3IP4 B;  4M3F A;  1WH7 A;  5CKT A;  4HNU A;  4I09 A;  4FFN A;  1BW5 A;  3HRU A;  1XC5 A;  4U0W A;  3MFK A;  4B3R H;  2YCH A;  3R23 A;  4RNN A;  5EEG A;  3HOS A;  2R5Y A;  4A6D A;  3ABM H;  4EJU A;  1VTN C;  2W9C B;  3KPH A;  4ZZL A;  3RQI A;  3MJF A;  2PG4 A;  1T0F A;  3LQR A;  3GTP A;  3GBG A;  2KFD A;  2DI3 A;  3UQ8 A;  3DPU A;  2YS7 A;  2KQR A;  4J9R A;  5KFC A;  4Q4D A;  1RK5 A;  3I55 I;  3JAM Z;  3LSP A;  1JIH A;  2OJE D;  4KT6 A;  3OMY A;  5I47 A;  1LKX A;  1W36 C;  4NYE A;  2IS6 A;  1FT9 A;  2Z5U A;  1JKQ C;  3F6O A;  3T99 A;  2C22 A;  1OPC A;  3RIZ A;  2ZXW H;  4CYD A;  4Y7N J;  2R7M A;  1R9T A;  4O81 A;  4I6Z A;  1AOY A;  3HG9 A;  4Y52 J;  3DLA A;  4YAK B;  3CC2 I;  2G7H A;  1WJD A;  2M30 A;  5IT9 Z;  3I12 A;  2AO9 A;  5DD4 A;  2BY3 A;  1PUF A;  3WG9 A;  4HDV A;  4I76 A;  3GTK J;  1NG7 A;  4O2B F;  4U87 A;  1ZG1 A;  4GLW A;  4BDY A;  3KP2 A;  1IYE A;  4DR1 H;  2M8E A;  2RAE A;  4N4O B;  2DAO A;  4RAG A;  3WTW C;  4O7W A;  5KFF A;  3D5S C;  3J81 K;  3DPL C;  1XPX A;  2VR1 A;  4LB6 B;  3AG4 H;  3R5H A;  3DEW A;  1YJN I;  2R7T A;  2DJN A;  2QWW A;  3LSK A;  2XF6 A;  1KQ0 A;  3FXU A;  2VT3 A;  3V4S A;  4HYK A;  2HHH H;  5F64 A;  3CUQ A;  4Q8F A;  3JRF A;  4BE2 A;  1Y1V J;  3DU6 A;  2NVT J;  5I5X A;  2HPI A;  4O4L F;  1HDD C;  5E17 F;  3RGX A;  4QWB A;  4UVB A;  5FFX A;  2DQR A;  3K4M A;  1WCM J;  3TOB A;  4A3B J;  2QYZ A;  5FNV F;  5KFL A;  1J5E H;  2VA2 A;  4ZI7 F;  4S05 A;  4IL6 C;  3TW7 A;  1ZQ3 P;  4FFM A;  4RZR A;  2JEJ A;  5KFQ A;  3OR1 C;  5K1Y A;  5KFH A;  2VQH A;  2X1E A;  1USS A;  3K9T A;  3HHH A;  2FLP A;  4UY8 I;  1LDK B;  3F23 A;  2EJ2 A;  4MFE A;  3WNZ A;  1SVM A;  5KFD A;  2BW3 A;  2X4H A;  3I59 B;  2R5Z A;  1FC3 A;  1BXR A;  4PFO A;  5EG0 B;  4XNF A;  2CUZ A;  1ZH5 A;  4Y15 A;  1ZG3 A;  1QPM A;  4KUM A;  2WE6 A;  4RGX A;  5I5U A;  1V5E A;  5LLQ A;  1FLI A;  3EYI A;  2P7V B;  1I1M A;  2R84 A;  1QO0 D;  1Z05 A;  3C1D A;  1Z9C A;  5K7Z A;  3GFM A;  5HOO A;  5IYD J;  3JZ6 A;  2EA4 A;  4Y4R A;  4LF4 H;  1TL8 A;  2ZDH A;  4AC0 A;  3VMM A;  5C44 G;  4C3I J;  2DDA A;  4NHJ A;  3MWM A;  3QYE A;  3HOU J;  5DG8 A;  2BY0 A;  3RIR A;  3SJM A;  4B43 A;  1B72 A;  2WA0 A;  5J6X A;  1IDZ A;  1XMO H;  3L00 A;  5B3S H;  5IYB G;  2JT1 A;  4RAF A;  4MV6 A;  1V4R A;  3V4G A;  4IXA A;  2ZJR F;  3GTM J;  2K27 A;  5JUM A;  1FSE A;  2KIF A;  3I53 A;  3GIK A;  5C4X J;  4ED3 A;  4XLC A;  1M7J A;  4BQQ A;  5KFR A;  4KA4 A;  4ED0 A;  3GO5 A;  3RB6 A;  2V4Q A;  4U88 A;  2HI3 A;  4FBU A;  2WAQ E;  1U8R A;  2LP0 A;  3DTI A;  5M3F J;  4BBR G;  3NAR A;  1VQ9 I;  5HBR B;  2IGK A;  3ZN0 A;  2XAF A;  2BYV E;  1BJT A;  3K5I A;  1YX3 A;  3DV8 A;  2RN7 A;  4NC6 A;  3W6J B;  4O4J F;  5D5U B;  1K83 A;  1CGP A;  1YW8 A;  2R93 A;  2GQR A;  3Q8P B;  1MBH A;  2BV6 A;  2X6O A;  3SHF A;  3OYA A;  2EJ3 A;  2STT A;  2A61 A;  3V4Z A;  4PSW A;  5JVT A;  4YR3 A;  2E7W A;  2H1L A;  4B4C A;  2LFB A;  3W1B A;  5F1R A;  4U6P A;  4CH7 A;  2F4M B;  3PW4 A;  4YHH H;  4BXU A;  4PFP A;  4C2M A;  3CF2 A;  4DV2 H;  2LMD A;  3QAH A;  1CF7 A;  2WB1 E;  3LSH A;  3X2Q H;  2FML A;  5D5V B;  3HOX G;  1R7J A;  4FFO A;  2CQQ A;  3CJR B;  3I4P A;  1R49 A;  1EHI A;  3K5H A;  3T9A A;  4PWQ A;  1TNT A;  1K6Y A;  2HYJ A;  3CDI A;  1OCR H;  3NQO A;  3H0D A;  3DQV C;  1R23 A;  1NG6 A;  3MMY B;  1UCR A;  3S93 A;  5HDN A;  4E7H A;  1HXD A;  4EM0 B;  4KNY A;  1OMI A;  3KZZ A;  3WTZ A;  1U9N A;  3HGY A;  3RV3 A;  2HQR A;  5AIP A;  3LA2 A;  3R9R A;  4R7R A;  3ABK H;  3TY5 A;  5IP7 J;  4ZH4 F;  1M0W A;  3MEX A;  5K5O A;  3S2D J;  2X48 A;  3VPC A;  1DIK A;  1VQ7 I;  2V4J C;  2PMU A;  4HZF A;  2KJC A;  2UXC H;  1XMX A;  2F5F A;  5CVI A;  1LE8 B;  3FBN B;  3H3U A;  5FKK A;  1OFC X;  1FIP A;  1XSD A;  4L5I A;  1OLT A;  1K61 A;  1GHC A;  1ZET A;  3PO3 J;  2P0W A;  2O8K A;  3I5U A;  1SFU A;  1ZG5 A;  3IKV A;  3CJN A;  3BQ0 A;  3FMQ A;  3TQN A;  3CCL I;  1SD4 A;  2EH3 A;  3QWU A;  1L0O C;  2RVC A;  3REO A;  5IT3 A;  1BC7 C;  5EGO A;  2JQ7 A;  3G71 I;  5L1J A;  4JYA H;  2GIZ A;  2Y0S E;  3D5L A;  2K3F A;  4DZJ A;  4DL5 A;  2L7Z A;  2DJI A;  2WTE A;  1FKA H;  5KT3 A;  4A0X A;  3I4N G;  1PVE A;  4KN4 X;  1YRN B;  2W9B A;  2DMQ A;  2DYS H;  3L4J A;  1RRJ A;  5IP9 G;  1ZHF A;  3M8F A;  4JI5 H;  1IO2 A;  2F4O B;  1HLV A;  1KBL A;  2MYS A;  4O3M A;  2B63 A;  2JK3 A;  3HSF A;  5TIS C;  1NH3 A;  2JRM A;  2Q2E B;  1LNW A;  3BG6 A;  3HO8 A;  2JPC A;  1JTX A;  4X66 H;  5J4V A;  2ZNY A;  3KCC A;  1GSA A;  4AQY H;  4ECX A;  3Q5F A;  3JRC A;  5CA1 F;  2Z2S B;  2DK5 A;  1SEU A;  2V59 A;  2E1O A;  2R7N A;  4IRC A;  2Y9Y A;  4L1K A;  4GKJ H;  1K7A A;  1MH3 A;  5FD5 A;  3C2B A;  5J8F A;  1IXS B;  1MND A;  3C7J A;  1TW2 A;  5HV6 A;  2M05 A;  4BWS C;  1F1Z A;  2VC0 A;  3WHC A;  3U9T A;  3RCO A;  5EZG A;  1XK5 A;  3E6B A;  4AU7 A;  4EQQ A;  4IX7 A;  4E7L A;  1LQ1 A;  4M7E A;  5FLX K;  1IN4 A;  4WXD A;  1STZ A;  1YOV B;  5C44 J;  2PLY A;  4O3N A;  5D8D A;  1HKS A;  5FD6 A;  1XS9 A;  5E3O A;  5L1K A;  2W1O A;  4DV5 H;  3EYY A;  1F36 A;  2W00 A;  1DU6 A;  4JI8 H;  4NUB A;  5IYB J;  3AX6 A;  2FOK A;  5KG3 A;  5JQG F;  3M4I A;  5DYM A;  1FOK A;  1QRY A;  2VL8 A;  4HYE A;  3FIS A;  3ISP A;  3OR2 C;  3FXM A;  2L7M P;  4QIW A;  1A31 A;  2NU7 B;  2DMU A;  4BBR J;  4IHW A;  1X3Z B;  4ECR A;  1YG2 A;  1XX5 A;  1W7P B;  1ZK8 A;  5FGM A;  2R87 A;  2JPB A;  3W1G A;  1W96 A;  3F8M A;  1N36 H;  3VA7 A;  3ZQG A;  4G7O F;  4CHI A;  1ORK A;  3M8J A;  2DZD A;  3Q8Q B;  3BJA A;  3B73 A;  5E3L A;  5M5W J;  2NNN A;  1G6N A;  3QU6 A;  3BG7 A;  3HTU A;  5D4R A;  1PX2 A;  3AFH A;  3CCV I;  2HXO A;  4JOM A;  3GX4 X;  2HQ5 A;  1EH8 A;  3W5O A;  4HX8 A;  1BOB A;  1YO5 C;  4DYQ A;  2ZXH A;  3CDH A;  3KP7 A;  3WTV C;  2XSD C;  3T9C A;  2V9V A;  2MD0 A;  3S1Q J;  2ZGI A;  2R7Z A;  2EFN A;  1WJC A;  3BR0 A;  2E7X A;  5ICF A;  5JI6 A;  3HOX J;  4M3G A;  4BNC A;  2DWC A;  5LGN A;  4G3I A;  2Y69 H;  3IH2 A;  2O3F A;  4HPQ A;  4JK1 X;  5LEJ A;  2VQF H;  4GC7 A;  5KT2 A;  5GPA A;  3L9F A;  2DA1 A;  3K3V A;  3QZ7 A;  3Q3S A;  4FIS A;  1WI9 A;  4UCU A;  5TRD A;  3HRT A;  1B8I A;  2JEG A;  4Y33 A;  4BXX G;  2IMW P;  1I27 A;  2EZI A;  3QQM A;  4UCO A;  2W7O A;  1EKE A;  1FOW A;  2NVQ J;  5JHF A;  1H89 C;  5D5X B;  5HOD A;  2DCE A;  2R8H A;  3OSG A;  2E71 A;  3GZ5 A;  4N9H A;  1FP1 D;  4OAY A;  4RA2 A;  2DDB A;  1DUX C;  1Z2N X;  3N4M A;  1Y8R B;  1SFO A;  4RU9 A;  1JT0 A;  1HDP A;  2HPM A;  1EV7 A;  4A3M G;  3CO6 C;  3HKZ N;  2CRG A;  4L5J A;  2NOG A;  1R5I D;  2VJ4 A;  1KJI A;  2E36 A;  1UST A;  2COB A;  2R93 G;  4DL6 A;  2MH2 A;  2ECB A;  2Z9O A;  1POG A;  2IPQ X;  1MNE A;  3SDB A;  2XRL A;  3L7W A;  5GON F;  4CCO A;  2E2I A;  2K3P A;  1I39 A;  2EV6 A;  3GTP J;  4ZTJ A;  3BAA A;  5FFZ A;  3I4N J;  2HDW A;  4XOP A;  4KIB A;  2R7S A;  1A35 A;  5E25 A;  3KAJ A;  2C6Y A;  1YW7 A;  1MMD A;  3CTA A;  3T7A A;  2DAB A;  1HKQ A;  2NU8 B;  3GV5 B;  4ED7 A;  2AQ4 A;  1SAN A;  2BE5 F;  1TA8 A;  2PX9 A;  3Q2O A;  1ONV A;  2V58 A;  3BJ6 A;  4M6Y A;  1R9T J;  1UZC A;  3F22 A;  2ASD A;  2AXL A;  2CQY A;  4HAM A;  3IWZ A;  4DJA A;  2Z04 A;  2CUJ A;  4PK4 A;  2GXA A;  2L54 A;  5FRN A;  1GSO A;  4KN7 X;  2VB6 A;  2XGD A;  9ANT A;  2WV1 A;  2CG4 A;  5F9L A;  4MGR A;  4DR5 H;  1EUC B;  3PIP F;  3A2K A;  3IH4 A;  3BG3 A;  3H9J A;  2H8R A;  1FNN A;  4II2 A;  2JVH A;  4A2A A;  4BY7 G;  4F50 A;  2PN1 A;  2MC3 A;  1VKZ A;  1R5G A;  1SFK A;  3WU1 B;  3ZQL A;  4B47 A;  4ZYG A;  1HST A;  1HQC A;  2HZD A;  2GBY A;  4GDF A;  3I4M G;  2FU4 A;  2LVS A;  3LP8 A;  2D2W A;  3VDX A;  3TP3 A;  1XCB A;  4BYY A;  4EM1 A;  1WRV A;  3CME I;  3HYI A;  4J9P A;  1Z7L A;  4XOR A;  2DLN A;  2CSO A;  2COG A;  2WDT A;  2ZNZ A;  1UHW A;  3IAM 2;  4M74 A;  3U9S A;  2L5Q A;  3FIW A;  3P9K A;  2ZM6 H;  4ESF A;  3GF2 A;  1BBY A;  3KXY T;  4ZQI A;  5CVU A;  2I10 A;  4EYH B;  4QPQ A;  3CSW A;  1TZL A;  3AW8 A;  2VQG A;  4BUP A;  2B0L A;  4A3I G;  3KP5 A;  4PCQ A;  2LY1 A;  4LG0 B;  1BC8 C;  1KC7 A;  1XDN A;  4DV7 H;  3ZMS A;  5HS7 A;  3LQS A;  4JXU A;  3V8L A;  4RUC A;  2QUF A;  2WBM A;  2AU0 A;  5LHG A;  1XGO A;  2ICW G;  3RPU A;  5K5Q A;  1VQ4 I;  3HEF A;  4IVN A;  1A5J A;  2VUM A;  5GAG J;  5LOV F;  4AD9 A;  4J01 A;  5A2Q Z;  1OCT C;  1UC9 A;  4AIK A;  2CGP A;  2W6Z A;  4WBN F;  1EH6 A;  5J3L A;  2QF7 A;  4RBO A;  1G4D A;  1ZAO A;  3E97 A;  1BNC A;  1GO3 E;  3RTR A;  4JYK A;  1QVT A;  3K2A A;  3OYN A;  1YTY A;  1UB9 A;  2YS9 A;  5FRO A;  2MFZ A;  2A3S A;  3SYT A;  3VPR A;  1O3T A;  2YW2 A;  2V6E A;  5KS8 A;  2DMT A;  3P7N A;  2Q2T A;  3J81 W;  4O2A F;  4YJ2 F;  2ALZ A;  2C28 A;  3K4J A;  1DV1 A;  4JV5 H;  3CLQ A;  1Z67 A;  4GKK H;  2QQ8 A;  1Z6T A;  3CMM A;  4EJO A;  1XMA A;  1N32 H;  2W85 A;  1UC8 A;  3VOT A;  1R5H A;  3L2U A;  1ET0 A;  4GGG A;  4OMY A;  3KYL A;  2LLK A;  4BJ5 C;  2JA5 A;  3GV7 B;  2G7U A;  3V8J A;  4Q4Z F;  3CCY A;  5DMX A;  2L01 A;  4IF4 A;  1D3Y A;  2Y75 A;  3VYU B;  3WE2 A;  4YBZ B;  2OPT A;  1K83 J;  2R93 J;  2W6Q A;  2JA7 A;  3LAP A;  2M0C A;  3HSE A;  1S29 A;  2JN6 A;  2FKL A;  4M0J A;  3A01 B;  5KFV A;  3PFY A;  2CNV A;  4O3R A;  5JLW A;  4C2M J;  1IV8 A;  4WXH A;  4A3E G;  4JI1 H;  1YS7 A;  4IHX A;  1I1L A;  2XGQ A;  1LEA A;  4I0B A;  1HBX G;  4GRI A;  5FO5 A;  3T5X A;  1FBQ A;  2MBF A;  2VT2 A;  5B5E C;  4DOZ A;  1I1S A;  3RSN A;  3AG1 H;  3GB8 B;  4AVP A;  2EIY A;  4NXN H;  1V4Y A;  3J80 Z;  4XM3 A;  2CNU A;  4UB6 C;  1WI3 A;  1TWH A;  3SZG A;  2E2J J;  4ENM A;  2NVY A;  4XLF A;  1SEI A;  3O3K A;  3TDZ C;  4CZZ A;  4Q0Y A;  3R61 A;  4HLX A;  3RF2 A;  2KIQ A;  5EZY F;  5KG6 A;  1AUV A;  5LGT A;  5CYV A;  3RKY A;  5J2T F;  2LKX A;  4O3Q A;  5F9N A;  2R8K A;  3N05 A;  4UVA A;  4DV3 H;  5HNF A;  3GTO A;  3VFZ A;  3S3O A;  3S8P A;  2UUZ A;  4W97 A;  2JRT A;  2L9V A;  1C3O A;  1ZN2 A;  1B4A A;  1KTA A;  3TQ1 A;  4Z2Y A;  2F4V H;  3OV8 A;  4BL0 B;  4BY1 J;  5GP9 A;  2M4G A;  3ZMU A;  1FBU A;  3BTI A;  2Z1D A;  3IAS 2;  3JTG A;  1M0T A;  3GCM A;  3C2H A;  5D1O A;  3E0J B;  1TP4 A;  5CJ9 A;  3IC7 A;  5M5X J;  3I4M J;  2NRA C;  2VOP A;  4EBE A;  3I9V 2;  4L0Z B;  2VON A;  1S0N A;  2V1D A;  2R85 A;  2UUB H;  3K6G A;  5CE8 A;  2BEO A;  2PQ8 A;  3GLX A;  4RGU A;  2TDX A;  4EGY A;  2V7F A;  2H27 A;  2BHY A;  2KSW A;  4HEA 2;  3GII A;  4W1U A;  3GIM A;  3S14 J;  3AYH B;  3H3V K;  1FTT A;  2PMZ N;  2M7A A;  4F91 B;  4FTH A;  2B63 J;  4UV8 A;  2VQD A;  3DTG A;  3VPD A;  1TWA A;  2K40 A;  1ZRF A;  3HB9 A;  3GEZ A;  1R36 A;  1YS6 A;  2XDV A;  3DU5 A;  4LIV A;  4M3D A;  2YS6 A;  3NC0 B;  1P9Q C;  2PFB A;  3M1C A;  4XSZ F;  1XGM A;  4BQO A;  2RRE A;  5JFR A;  2HGW A;  1UEL B;  5IP6 A;  2BXZ A;  3N44 B;  5I5T A;  2HR3 A;  1D5V A;  5BWX A;  4ZJZ A;  2WAD A;  4BHP A;  1R1U A;  2W57 A;  4OOI A;  2DMN A;  2LG4 A;  2Q2U A;  3MFH A;  4LIU A;  5CPR B;  2IW5 A;  2NNY A;  3JCU C;  3DBR B;  3PNY A;  1X1C A;  4KMU X;  4RM3 A;  3R60 A;  2VOB A;  3RKQ A;  1OIS A;  4DV4 H;  1FJG H;  1PP7 U;  3G3Z A;  3VSK A;  3HXL A;  1IGN A;  4MAM A;  3QYF A;  1Z1D A;  3ZQ7 A;  2NUA B;  2QB5 A;  3B6A A;  1DU0 A;  3ASO H;  2EZK A;  2VXD A;  3ZQH A;  2X9D A;  3WO1 A;  4X64 H;  3S24 A;  1J09 A;  3HL2 A;  1CKO A;  2KP6 A;  3SZT A;  4G12 A;  4B48 A;  3N8D A;  4OWR B;  2OLS A;  2XC9 A;  3TDU C;  4NZM A;  2HTS A;  3CZ6 A;  1S97 A;  4A12 A;  1L2Z A;  1YYV A;  1I3Q A;  3M1E A;  1G3Y A;  4XZ3 B;  3ROU A;  2AXT C;  3CP2 A;  1E4G T;  4LD5 A;  2COM A;  1KU3 A;  1SYX B;  5DG7 A;  3CLO A;  2DMP A;  4G6T B;  3SE7 A;  4ZDL A;  3KP4 A;  2OWO A;  3A1Y A;  1MDM A;  2IVM A;  3ZCO A;  1RI7 A;  4HSR A;  1IW7 F;  2FRH A;  2KL4 A;  3F9K A;  4RS8 A;  4EYI B;  4ECT A;  2R8G A;  3C18 A;  1X2M A;  1MBJ A;  4RAZ A;  3ZPL A;  3EQL F;  3R0J A;  3S32 A;  3E5N A;  3HOW G;  4A3E J;  2R7Z J;  3ORR A;  2HDK A;  5KFX A;  1T98 A;  1MKM A;  4CCM A;  3RBD A;  5LA6 F;  1FOY A;  4FT8 A;  4PGH A;  2YZN A;  5K7F A;  2ZO4 A;  5KFA A;  2JEF A;  4DL3 A;  1GDT A;  3ZMV A;  3G1O A;  2QBY B;  1ZQ7 A;  2VUM G;  1Y1W A;  4UV9 A;  2XAG A;  4YFN F;  4ZOL F;  3PIO F;  2MC4 A;  3RI4 A;  3MR6 A;  3N6X A;  3KET A;  1UHM A;  3GW2 A;  1DPR A;  1MD0 A;  2DA3 A;  4H0E A;  1FEX A;  5FLX W;  2PJP A;  1D0Z A;  2XAQ A;  4HLY A;  2GA1 A;  3BJO A;  2ATL A;  4D5C A;  4NLG A;  3EUH C;  3U0G A;  2PMH A;  5BPI A;  1IXC A;  3TL4 X;  4F3Q A;  5J8C A;  5D6F A;  5LGU A;  1D5Y A;  4UNO A;  1K78 B;  3MKZ A;  2PJR B;  3O8H A;  4MQV A;  1N34 H;  4MA5 A;  2H09 A;  4CGZ A;  4OX9 H;  1SFO J;  2DOA A;  3RAQ A;  3HPH A;  1EH7 A;  2FBI A;  5GTH C;  5IPA A;  4HQM A;  1ETX A;  2L02 A;  2JA5 G;  2DXI A;  2R82 A;  3DAA A;  5CLS A;  4IR9 A;  4EFB A;  2J6S A;  4BHC A;  3HT5 A;  4X62 H;  4EV0 A;  3ORQ A;  2JA7 G;  3HZJ A;  4KIC A;  3GME A;  2X6Y A;  1UFM A;  3C3W A;  4TV7 A;  5DDG A;  2L9N A;  1W0T A;  4ED6 A;  3OTO H;  3HKZ A;  5FJ8 J;  2E2I J;  3FMS A;  1YIT I;  2VOD A;  4IRD A;  4Q47 A;  1T95 A;  3HHG A;  3UR3 C;  1YHQ I;  1J5Y A;  2O9L A;  2KMU A;  3ZQQ A;  3JRG A;  3CC7 I;  4HV5 A;  4OIO F;  3T5H A;  1IBM H;  2L2O A;  3I58 A;  2Y30 A;  1APL C;  4UCV A;  1V5F A;  4A3K G;  4DR3 H;  2ZJP F;  4IRG A;  5HDK A;  1RK6 A;  2R8J A;  3L2W A;  1MSE C;  5KFY A;  2DTZ A;  4NNJ A;  3VSL A;  4YY3 H;  4L9J A;  1I1G A;  3FXL A;  3K2Z A;  4H4K C;  2ODT X;  1ETY A;  1MBG A;  4DL2 A;  1GVJ A;  4ENN A;  3V7R A;  2M3A A;  2HG8 A;  3MQ0 A;  1IAW A;  1D1A A;  1UMQ A;  4P5O A;  1CQT A;  3G4S I;  1I7N A;  4A3C G;  1RYS A;  1KJ8 A;  1K1S A;  3HOZ G;  4YFK F;  2K5C A;  1RPW A;  2Q1Z B;  3K1M A;  4CCN A;  2CV1 A;  1YFH A;  1OWT A;  5L3D A;  5DD8 A;  5BPH A;  1PUF B;  4KIT B;  1FMW A;  1V3F A;  1N48 A;  2R7O A;  3DWL E;  4ED1 A;  2JTV A;  3K10 A;  3VNN A;  2W9C A;  5IP7 G;  4QWC A;  1MBK A;  2CQ7 A;  5DCM B;  2V79 A;  3LSI A;  2UUA H;  1GXQ A;  4I99 C;  1O3S A;  4MEX F;  4O7Y A;  1P4A A;  4QWQ A;  1FYM A;  3GIL A;  5C5J A;  4ECW A;  2PVP A;  3RB4 A;  2EIM H;  3BP8 A;  4LK1 F;  4BJT A;  2P0A A;  4XN0 A;  1I6X A;  1ZLJ A;  5C3E G;  4PJM A;  1XN7 A;  2M7B A;  1T94 A;  3V6J A;  1BR1 A;  5LMU H;  1WPK A;  3CUQ B;  1RUO A;  4WCG A;  3KRE A;  4TVI A;  1NK2 P;  1HOM A;  4FCY A;  3PO3 G;  3BT9 A;  3LAJ A;  4D7N A;  1R1V A;  2WAF A;  4R8U B;  3BJY A;  3Q9S A;  3QOE A;  1R00 A;  4MO7 A;  1M6V A;  1YJ9 I;  1X4P A;  4QLC U;  3S2H J;  1FIA A;  2Y48 A;  5DUK A;  3H3V H;  2W4S A;  3CES A;  1EKF A;  2M34 A;  1P92 A;  4UUV A;  5BWV A;  4DQ2 A;  2MGQ A;  4QTR A;  4JX5 A;  4QWE A;  3HOW J;  1X1D A;  2XF5 A;  1LB2 A;  3PSI A;  1G8X A;  1WRJ A;  3BLY A;  3V7S A;  3VYR B;  1KQ8 A;  3OYH A;  4CMF A;  3KEY A;  1WKM A;  5HLI A;  2VPQ A;  4HQ6 A;  2BW3 B;  5E1Z B;  2HGS A;  1G2W A;  3A03 A;  1SAX A;  2HU9 A;  1MMS A;  2VUM J;  3E7L A;  4IWX A;  1AA7 A;  3FX3 A;  3H5A A;  2XIG A;  1N75 A;  4LFU A;  4CIC A;  2QYO A;  2ZCW A;  2FA5 A;  3Q9V A;  4IQ4 A;  2DQL A;  3VOE A;  1X3U A;  2FE3 A;  3U2R A;  1AKH A;  3K1P A;  4OIP F;  3G6V A;  2AGQ A;  2Y0M A;  4A3J J;  4ECQ A;  3F72 A;  3BTL A;  1SFE A;  2G9W A;  1T0F C;  2BZT A;  3KEQ A;  1JKP C;  3OSP A;  5FRM A;  5B1B H;  3UNG C;  4ZC3 A;  4M3E A;  4N9I A;  2QZ8 A;  1TTY A;  1OYI A;  1W5S A;  2XAU A;  2UWM A;  1SD6 A;  5ERI A;  2VKH A;  4UUS B;  1KEE A;  1MJA A;  3OIP A;  2FQ4 A;  2JA5 J;  2DFF A;  1JUS A;  4EJW A;  2R0Q C;  4K0K H;  5IWA H;  4B1R A;  4BKX A;  2M5W A;  3JRD A;  5KHD A;  1JLL B;  5CVJ A;  1S0O A;  2JA7 J;  3D0S A;  1UJ8 A;  2F5V A;  2Y31 A;  3HRM A;  3I59 A;  5HDG A;  3RGZ A;  1KZH A;  4R79 A;  3GTQ A;  5EG0 A;  3B6C A;  4QJF A;  2FMA A;  3NBY B;  3R5X A;  2HQA A;  4ED2 A;  4A3G G;  4E6N A;  2DBB A;  5JVG F;  2BOL A;  2EFP A;  2DA5 A;  4A3K J;  4CYC A;  5AON A;  5CM0 A;  3HM5 A;  4GFB A;  4B3X A;  4HF0 A;  2ZFW A;  3K69 A;  3CMA I;  2DU9 A;  4CC6 A;  3CMY A;  5IOY A;  1OBG A;  1QHH D;  5IYC G;  1CF7 B;  1Z6R A;  1VZ0 A;  1Y1W G;  1KU2 A;  2FJ1 A;  3ZN1 A;  2FBH A;  3FK6 A;  1R58 A;  4M9X A;  4A2B A;  1KA8 A;  2TRT A;  4J9Q A;  4J9M A;  2JA6 A;  1TWH J;  3CUQ C;  2CQN A;  2HYF A;  2XGE A;  4ITV A;  4YG2 F;  2LY9 A;  4FFL A;  3H36 A;  4B09 A;  2CUF A;  4ZZD A;  4A3C J;  4QSH A;  2MLG A;  5BR8 H;  2NVU B;  3HOZ J;  3OUU A;  1Z3X A;  5E1X A;  3E1S A;  5EZH A;  1VFC A;  4LOC A;  4QWD A;  3GFJ A;  2R4G A;  5EOY A;  3GTO J;  5DCF A;  2DA6 A;  3GLL A;  4XMY A;  3PUF A;  4A5M A;  4JI2 H;  5KKN B;  1Z21 A;  2X51 A;  1HW2 A;  4DNC A;  5L3E A;  3MWE A;  4O7S A;  2IBD A;  1CQJ B;  3U21 A;  1C0W A;  4I4T F;  2F5C A;  3CEB A;  1RR7 A;  1U6G A;  2HOS A;  3PR5 B;  1ZKG A;  1Z91 A;  2W6O A;  3P9I A;  5DGA A;  4AUX A;  1X58 A;  2LBF A;  5C3E J;  4XYL B;  4FX4 A;  4TQS A;  2BQ3 A;  2RDP A;  4Q4C A;  4IHS A;  4ANJ A;  2W8K A;  1PUE E;  3NWS A;  3GUD A;  1IUY A;  1AUX A;  2BY1 A;  2OD5 A;  4MEY F;  4EJV A;  3KHG A;  1Z77 A;  3F3X A;  2NYX A;  4P55 A;  1AU7 A;  4WHX A;  2JZY A;  2LRE A;  2LK2 A;  2WV0 A;  4IHT A;  2RNG A;  3MZ8 A;  4DUY H;  3RB3 A;  3HKZ E;  4ECU A;  1I6U A;  2RDJ A;  1TWA J;  2R92 A;  5BMZ A;  2W9B B;  1GYF A;  3ESW B;  3KFW X;  2XHK A;  3RKX A;  3TW6 A;  1EYZ A;  4Q5S F;  2A5Y B;  2PMZ A;  3KAK A;  1RKT A;  5D6E A;  4C3H J;  4LF7 H;  4J19 A;  1CQI B;  3FMR A;  3W6V A;  4RGS A;  1JKJ B;  1ON2 A;  4Q45 A;  5L1L A;  2M45 A;  2NXN B;  3D1N I;  1LE8 A;  1KJ9 A;  2XV4 S;  3H3Z A;  4O82 A;  2K7L A;  1EKV A;  4RMN A;  3WG7 H;  1K4T A;  4J9S A;  1YIO A;  4PJJ A;  3R4K A;  4KIF A;  4XR6 A;  4O6J A;  2BHZ A;  2LR8 A;  1ON1 A;  3I54 A;  4BQN A;  2QQA A;  1ENH A;  3A4C A;  3CJT B;  3NAU A;  4G8X A;  5H20 A;  5EEA A;  1H88 C;  4IQJ A;  3Q8S B;  1XMQ H;  2ABJ A;  3GIJ A;  2HOA A;  3LSR A;  2DFE A;  3FK7 A;  3WTY C;  2R7R A;  2F5E A;  1X2N A;  4RDU A;  2BQU A;  4MV9 A;  1A04 A;  1PK8 A;  1FSH A;  3TY8 A;  1BI1 A;  3T54 A;  4XYM B;  3W2V A;  4UCS A;  3HIF A;  2ZXJ A;  1I3Q J;  3BCB A;  4Y3O A;  2YPR A;  3BR2 A;  4DGW B;  4M72 A;  2ZSH B;  3FDY A;  2M1B A;  2CQX A;  4A0Z A;  3NRV A;  2A68 F;  4YIF A;  2EIJ H;  4XKV A;  4DQN A;  1O4X A;  2VIX A;  1O57 A;  5L1I A;  1MH4 A;  1QQI A;  4LJZ F;  3DF7 A;  4OU0 A;  1KUT A;  2I8C A;  5DAA A;  3KHL A;  2XRO A;  3A0B C;  3BTC A;  3ERE D;  1VQM I;  1S72 I;  4HG2 A;  3W2W A;  4A3G J;  3OUZ A;  2FOW A;  2V5A A;  3ETH A;  5KFS A;  4IZZ A;  5DEQ A;  3Q8R B;  3FXR A;  2EQR A;  1MW7 A;  2IJL A;  1VBG A;  1T39 A;  4ZDP A;  3CQZ A;  5ICC A;  2IP4 A;  4JV1 A;  4O7Z A;  2EJR A;  5IYC J;  3T9F A;  1OR7 A;  4CA0 A;  2LY2 A;  1UG0 A;  3GVA A;  1A6I A;  1Y1W J;  4HW0 A;  3OYL A;  1ACI A;  2LKS A;  2OAZ A;  5FKM A;  5KG2 A;  3GTJ A;  1E4E B;  2I80 A;  4IRK A;  5BWT A;  3CCJ I;  5HNE A;  4D0P A;  2IA0 A;  1WSU A;  1JJ8 C;  2CU7 A;  2RQQ A;  4RB3 C;  4O4I F;  1TQP A;  4FFP A;  3QPT A;  4DUZ H;  4MTE A;  4AVZ A;  4KT5 C;  4NDL A;  4Y8V B;  1UNN C;  2HGX A;  1SVL A;  5DLG A;  3HOY G;  4JBA A;  2W7P A;  2UXN A;  4DBQ A;  4XL9 A;  3BQZ A;  4O7N A;  5C8Y F;  1W7P A;  2XAH A;  1XDU A;  2ID6 A;  4AYB N;  3GV8 B;  4C2U A;  1IN6 A;  4HR7 A;  4XN3 A;  4E4H A;  3I56 I;  2WYO A;  1R1T A;  1WQ2 A;  4M71 A;  4B3A A;  2HDC A;  4DRF A;  1LFP A;  3GYH X;  5DQG A;  5CB4 F;  1LDJ A;  1BJA A;  1OCZ H;  4QPO A;  5K2M A;  2FX0 A;  4V2G A;  2HWV A;  2LYC A;  1LEB A;  3KLN A;  4JV0 A;  2YRX A;  3TBI A;  3IH3 A;  3TGN A;  4YQW A;  2EB7 A;  3CCR I;  5LMN H;  3K4L A;  2KIM A;  3F8B A;  5LEK A;  4RAY A;  3SXY A;  4UHT A;  4O86 A;  2NVY J;  2X85 A;  4F93 B;  2R3S A;  3IKT A;  1IRG A;  4Q8E A;  4RM2 A;  3OYK A;  2W25 A;  4LFC H;  2PBI A;  3RV4 A;  2VKV A;  2P6T A;  3SI8 A;  3PUB A;  2FPP B;  1TQI A;  3PQK A;  1ETO A;  3J81 Z;  3HJE A;  4ABZ A;  3M9N B;  2YUS A;  3VEP A;  2D45 A;  3S17 J;  4CE5 A;  4IAJ A;  1TWC A;  3BCA A;  3BG9 A;  1VS0 A;  4QWA A;  3OSF A;  4LH7 A;  3LNQ A;  3G6E I;  1O3Q A;  2D5V A;  3ZQF A;  3PW7 A;  2D1V A;  1O7F A;  3AG2 H;  4O84 A;  1BOA A;  2YU9 A;  4LMY A;  5KFB A;  2XPV A;  3FKJ A;  1T8I A;  1RJR A;  1RES A;  1TNS A;  5KX5 F;  3PM1 A;  3TED A;  2IAI A;  1PYV A;  1RYR A;  2K9S A;  1I94 H;  2I5U A;  2PI0 A;  3K7A J;  1YX5 A;  2X1C A;  2UXB H;  3L2C A;  4MA0 A;  4TM5 A;  2H1K A;  3E6C C;  3ML6 A;  4ENK A;  2IS1 A;  3LL7 A;  2QCO A;  3QQA A;  3E5Q A;  1A9X A;  5LHH A;  4HNV A;  4MV7 A;  3M9M B;  4BHB A;  2OV7 A;  3CCM I;  5K5R A;  3T5J A;  4FE7 A;  5FKO A;  3KE2 A;  2EIN H;  5HS8 A;  3UZO A;  2DOF A;  2MH9 A;  3ONQ A;  4NC8 A;  1E3H A;  5LHI A;  1P4X A;  1TWG A;  3U1K A;  5FLM G;  4YII A;  2VE9 A;  1P7I A;  4LFB H;  4PZ8 A;  2ECC A;  2OC6 A;  5FB2 A;  1GGO A;  4CC5 A;  4BY1 G;  3QP6 A;  3G6Y A;  2ASJ A;  1NTC A;  1G3T A;  1Q1V A;  3CF5 F;  4IO9 F;  2A6T A;  1HNW H;  2CFO A;  2HNH A;  1QVU A;  3NUA A;  2F5D A;  3U9G A;  2OTL I;  1UHS A;  3KLO A;  4NQW B;  2R6F A;  3FHZ A;  2LDU A;  4DBR A;  4U7B A;  1VQL I;  1R4N B;  2LF7 A;  5J1R A;  4TV9 F;  5J1U A;  2LSO A;  1IXR C;  1TT5 B;  2K02 A;  2OUM A;  2QQB A;  2GXB A;  5FR9 A;  3U54 A;  1H8A C;  2UXD H;  3NEU A;  2ASL A;  4EM2 A;  4CUG A;  1U5T A;  2P5K A;  3OYG A;  2KDZ A;  3H1C A;  5EDW A;  1JJ6 C;  3L09 A;  3JTH A;  2B63 G;  3TIG A;  1W5T A;  4O7T A;  2HKO A;  2IEK A;  5DIS C;  5I5V A;  3MFI A;  2ZXI A;  5B66 C;  1SFX A;  3HBL A;  2KJB A;  4LB5 A;  3AL0 C;  3BWG A;  4JX4 A;  2PMZ E;  4G6Q A;  5E3N A;  5KFM A;  1S6L A;  3GIQ A;  4IKF A;  4XLN F;  2NU9 B;  2W70 A;  1P4W A;  3FXJ A;  4L5E A;  2ZDQ A;  2QQ9 A;  5H6Q A;  4EQ5 A;  1JXL A;  5DGB A;  3M07 A;  5GPC A;  5J4Y A;  3HOY J;  1JDE A;  1ULZ A;  4E4T A;  2KPM A;  4NZO A;  2V9P A;  1DAA A;  4C5A A;  3H0G A;  3JAM K;  2HHF A;  3IV5 A;  2FF4 A;  4BEH B;  4NZN A;  3RAX A;  3JZI A;  1LFB A;  4RNO A;  3QP5 A;  2FJZ A;  2NVX A;  4FQG A;  3UKG A;  1J75 A;  5J40 A;  1CKN A;  1Z7U A;  2L7F P;  3RTX A;  2ZKZ A;  4CKE A;  4ON0 A;  5JQW A;  2W24 A;  3HOV G;  1VQO I;  3GWZ A;  3GTQ J;  4LG0 A;  3FXO A;  1T33 A;  4PDB A;  1HF0 A;  3H92 A;  2XUB A;  1BIA A;  1IBK H;  1BN5 A;  4O83 A;  2AHQ A;  2VJJ A;  5IT9 K;  2OBP A;  5D8K B;  4XKB A;  2EZH A;  4PDK A;  5M3M J;  1QA6 A;  5LYJ F;  2ZME A;  5L3B A;  2DT7 B;  4ZTF A;  3BQY A;  2Q0O A;  3IL2 A;  3Q1K A;  5KFU A;  1ITY A;  3DXJ F;  3LA3 A;  2RV8 A;  4X1E A;  4QIW E;  3AKZ A;  3LWB A;  4R1H A;  4I98 B;  2IA6 A;  1F9N A;  2BXY A;  3BC8 A;  2R7V A;  3DF8 A;  2E1N A;  3DKY A;  3MKL A;  2Z02 A;  4BGD A;  2XD4 A;  5C4J J;  4NXM H;  3QPS A;  2YZL A;  5DQH A;  2CW8 A;  3T1Y H;  3T9D A;  2JA6 J;  2R7Z G;  3TKY A;  1U9O A;  4G94 A;  4HOB A;  5F04 A;  3R6S A;  1ZGW A;  3FM3 A;  5KT6 A;  3OSN A;  1JX4 A;  4I2O A;  1B6R A;  4ENJ A;  4ZYA A;  1TBX A;  1YJW I;  3DP7 A;  3F0C A;  3K4N A;  1ZEL A;  3TY9 A;  4EG0 A;  3DLL F;  2DPI A;  1ZYR F;  3QPH A;  3GZ6 A;  4UFZ A;  5LBQ A;  3RFC A;  1P16 A;  4DR4 H;  4KIG A;  1BR2 A;  2VJI A;  4PZ6 A;  4AID A;  1VAJ A;  2NU6 B;  1SCU B;  2KZV A;  5KT5 A;  2GOM A;  2GQQ A;  3MN2 A;  5LFA A;  2FBK A;  2CW0 F;  2VQC A;  4R8H A;  4CCJ A;  2FK2 A;  3A01 A;  4WD3 A;  4PGG A;  5FLM J;  3TQT A;  5EDN A;  5ED4 A;  3N97 A;  4KHP H;  3LSG A;  3PSF A;  3NWT A;  4A6E A;  3CCS I;  4BE1 A;  4IR1 A;  1V55 H;  3FXQ A;  4FBT A;  2FPG B;  3FBI B;  4M6V A;  2YZG A;  1XG1 A;  4FS1 A;  5FLX Z;  3BZ6 A;  1RC9 A;  4E7S A;  2LC2 A;  5F27 A;  4ESB A;  2OF7 A;  4HA8 A;  2FNA A;  3K3P A;  5FKL A;  4A3F G;  1WFX A;  2R92 J;  3O8G A;  5FJ8 G;  1SVO A;  3AG3 H;  1MMN A;  3WO0 A;  4B3S H;  5JH7 F;  3PL8 A;  3TO6 A;  3OYJ A;  1WJA A;  2BVL A;  3U1D A;  4D7M A;  4PBC A;  2DFI A;  5DQI A;  4E7Z A;  3RPQ A;  3VOD A;  4IOA F;  2HIX A;  4XKC A;  1ZR4 A;  3E5X A;  4O3P A;  1B59 A;  2NS7 A;  4I0A A;  3K70 D;  4Z6Y A;  3LST A;  2UVU A;  2FEZ A;  2O5R A;  5KCM A;  3UZB A;  4C5B A;  4V2F A;  3QYB A;  5DM6 F;  2FXA A;  2QSG X;  1IBL H;  2VPR A;  4RB2 C;  1S9H A;  1W5C C;  2FP4 B;  1T56 A;  1S3J A;  3G2B A;  5KAF C;  4MHG A;  1K79 A;  2O6G E;  4LFA H;  3WWJ A;  3OYD A;  5F6F A;  2HDD A;  2EJ0 A;  1E0E A;  3S1N J;  3EUK L;  1EA3 A;  1XB4 A;  2FMY A;  3AAF A;  2CV0 A;  1OJL A;  1MJ9 A;  4L0Y B;  3SNO A;  4CO8 A;  2P81 A;  3O2P E;  2CUE A;  2IGN A;  3DFG A;  4DR6 H;  1VQK I;  2WY7 Q;  2M0M A;  3EUH A;  5DV5 A;  2XAJ A;  1XCV A;  2O61 A;  5LP6 F;  4HX4 A;  2RGV A;  2GQS A;  3GIP A;  1MMA A;  1QGP A;  2HJW A;  4BH9 A;  1GUU A;  3MKY B;  2P6S A;  4FU0 A;  4ME6 A;  5D5W B;  3M9O B;  1BI2 A;  4BDZ A;  3HOV J;  1Z2P X;  3PVX A;  1AN7 A;  4F55 A;  3PO2 J;  3BOQ A;  4LIT A;  5KFN A;  2X0S A;  3H35 A;  3MKW B;  2K9L A;  4EFE A;  2HS5 A;  5H6R A;  2DPJ A;  2DT5 A;  1IUF A;  2EIK H;  4UB8 C;  4KJZ A;  5D8L B;  2VBW A;  2QKM B;  3OYE A;  2JMW A;  4DL4 A;  3T9E A;  4XRM A;  5E3M A;  1MDM B;  1REP C;  5BS6 A;  3TII A;  1KYW A;  3K70 C;  5BQT A;  3CQZ J;  1QHG A;  5JVL A;  3K0L A;  2ESN A;  3SFZ A;  3BRO A;  4NC7 A;  2OQR A;  2ZC2 A;  4LF9 H;  1CKM A;  4HV6 A;  1D8J A;  4EBC A;  2ME0 A;  3GTJ J;  1JHF A;  5EWF A;  2SCU B;  3H5R A;  3IUO A;  4C5C A;  1Y0N A;  4B3M H;  2VQL A;  4BU2 A;  5FLV A;  3TMO A;  4M73 A;  3HUG B;  4PZJ A;  5KK1 A;  4RCN A;  5J47 A;  3WGH A;  1GT0 C;  4FE4 A;  3DKX A;  5F0F A;  1WR2 A;  3HGG A;  2OZU A;  2ELK A;  4J0M A;  1HNX H;  1XNR H;  5L9X A;  1WJE A;  3GDE A;  3CC4 I;  5TJJ A;  4C30 A;  4I55 F;  3H0G G;  4LG3 A;  3W6K B;  4B44 A;  3S1R J;  2RGR A;  5EYR A;  1H9T A;  2COJ A;  2K9Q A;  1IRF A;  5E8I A;  1RET A;  4A3J G;  3GLK A;  3S16 J;  4JI7 H;  2VA3 A;  1S7O A;  4AYB A;  4YEJ A;  4YFX F;  3RB0 A;  4XSX F;  1TLH B;  3JZF A;  3IWF A;  2NAZ A;  1RJP A;  4LK0 F;  1ZLK A;  4YR0 A;  4XON A;  3C2G A;  2UV1 A;  4IIJ F;  3LML A;  4XLP F;  3IRR A;  1VQN I;  3G6X A;  4A93 G;  1OYW A;  1JI8 A;  4XLA A;  5DTD A;  2E2H A;  3K4C A;  2QBY A;  5CQG A;  2L0K A;  1N33 H;  4IHV A;  2E1M C;  1XSX A;  2K9M A;  5KFP A;  2VN2 A;  1FMV A;  2C2D A;  2MG4 A;  4CDG A;  5BPD A;  2R7U A;  2DOD A;  5H2F C;  3OYM A;  4A3F J;  3FDS A;  3MR3 A;  2A05 A;  2STW A;  3L4K A;  1TWC J;  4ECV A;  1TT0 A;  2EV5 A;  3IN5 A;  2ZSI B;  3N42 B;  2HYG D;  2R5Y B;  4FX0 A;  4M6X A;  3OYI A;  2N8G A;  1U2W A;  2W6P A;  2CYY A;  5K3W A;  4EMS A;  2YU9 J;  4MLO A;  4P9U A;  2PN6 A;  5F1J A;  1K78 A;  2PJR A;  1B9M A;  3G73 A;  1BA5 A;  2HKX A;  4YIR X;  4FHT A;  3HSR A;  3ASN H;  3M4O J;  2C2E A;  4O7R A;  1OQY A;  5BYB A;  2UVV A;  2V1U A;  4XIC A;  2XCL A;  2UVW A;  4ZYD A;  4TQR A;  3DKW A;  5HLT A;  4BBS G;  3O6B B;  3OIO A;  4JV2 A;  4XID A;  4K6N A;  3BPV A;  4F4X A;  4PUS A;  1TWF A;  5BWR A;  4NB5 A;  4ECZ A;  2Y9Z A;  4KMF A;  2TCT A;  1J7K A;  5ILU A;  1FOX A;  1T38 A;  3T0Y A;  3PR4 A;  2XGC A;  1TWG J;  3GFL A;  3IHU A;  4J9O A;  2F4I A;  2EZL A;  4AIJ A;  1DGS A;  2QVO A;  3FWE A;  3KYH C;  3LWF A;  3H4D A;  1J2X A;  3A0H C;  1YIJ I;  2ADU A;  1JKO C;  3OHB A;  5M5Y J;  1WJF A;  1E3P A;  2HTJ A;  2EK5 A;  3SFI A;  1E3O C;  1LVK A;  4DZP A;  2XF7 A;  4CSW A;  2V26 A;  2VUG A;  1TW3 A;  3WGG A;  2P7C B;  5DM7 F;  5B1A H;  1KYZ A;  3J7A K;  2JSP A;  2O03 A;  2QLZ A;  2YYA A;  2KT0 A;  4F7Z A;  1Z2O X;  1BR4 A;  4HQE A;  3BAB A;  2YSR A;  1BL0 A;  4J9L A;  1VND A;  1LDD A;  1EKP A;  1QU3 A;  2XVC A;  2K85 A;  4WX9 A;  1YE9 A;  3HC7 A;  5HLH A;  2ZJ2 A;  4ZHQ F;  4E7K A;  1X1B A;  2DPD A;  1ETW A;  2GLO A;  4II3 A;  3KX2 A;  1D1B A;  1OBD A;  2HFH A;  3L2V A;  4F4W A;  1CS0 A;  5KFT A;  2W6N A;  5CAE B;  2J6T A;  2A6H F;  4FAS D;  4HBL A;  1PDN C;  1Z0X A;  5DCM A;  3R5F A;  3RJ0 A;  3JR9 A;  1OYY A;  4QW8 A;  2HGC A;  5BOX A;  1JXS A;  1EZ1 A;  5KFJ A;  1I2L A;  1JT6 A;  4J9K A;  1RKW A;  3SQN A;  1G59 A;  2R5Z B;  3ABU A;  3OS1 A;  2UXX A;  2EIL H;  3BTJ A;  4DYR A;  4E6K G;  4C2T A;  4C9Y A;  1ZHQ A;  1AKH B;  2L4M A;  3CD6 I;  4IHY A;  4FS2 A;  4ZYE A;  4E70 A;  3H0G J;  2L9S A;  3IG0 A;  1QPI A;  4R8U A;  3WE3 A;  1I50 A;  2X6W A;  4V19 K;  4XLH A;  4IOC F;  3WU0 A;  4MQ9 F;  2LNB A;  1YW9 A;  3MAJ A;  2NVX J;  1EF4 A;  4ECS A;  1ZRC A;  5CA0 F;  3F8C A;  3JSL A;  1B72 B;  5E20 A;  2DO7 A;  2W9A A;  4LSA A;  1T6S A;  2ELJ A;  4A93 J;  3BAC A;  4MV1 A;  4CZC A;  2DIK A;  2XKO A;  1EUD B;  2L7K A;  2BY2 A;  3ECO A;  1OCO H;  1IDY A;  5HS9 A;  2R7Q A;  4PJ0 C;  1VI0 A;  2O0Y A;  3CJQ B;  3P9C A;  4HST A;  1FYK A;  4B3T H;  2YX7 A;  2XGP A;  5KFO A;  2HVR A;  5BNG A;  2XCP A;  4UXN A;  1OCC H;  5HVQ C;  4GXO A;  4APM A;  3S3M A;  3HRS A;  5I5Y A;  3G1M A;  4JUZ A;  4CYC B;  1SD7 A;  1MMG A;  4F92 B;  2H6B A;  4DV0 H;  2XB0 X;  2GPW A;  5EEH A;  4FET A;  3MR5 A;  4CKB A;  2MW8 A;  2DW4 A;  2E5Z A;  1I5Z A;  1LFU P;  1SMY F;  3TO9 A;  2FNP A;  1N56 A;  3OIQ A;  1CE8 A;  3MCZ A;  4CMD A;  2H8W A;  1J59 A;  3F6V A;  4UUS A;  3GZN B;  4YEL A;  1ZAR A;  3ZOB A;  1ETV A;  2R7X A;  2IRF G;  5HNH A;  3N40 P;  2W7N A;  2UZK A;  3KYC B;  4YR2 A;  3NBZ B;  4Q44 A;  3T1H H;  4BBS J;  3GXO A;  4YRV A;  4NBQ A;  1A3G A;  3L2R A;  1N77 A;  5IYZ F;  3JAM W;  2XSJ C;  3VYS B;  2NS8 A;  1IOW A;  4O3O A;  4X65 H;  3OOU A;  1ZRE A;  2V9W A;  1B9N A;  4MV8 A;  1JUM A;  2KRH A;  4U0Y A;  2GZW A;  1XMK A;  1J9I A;  5JHU A;  1BM9 A;  3OS2 A;  4GLX A;  4E7I A;  4JI4 H;  3DPT A;  3WTS C;  1FP2 A;  2RF4 A;  3PNV A;  4D1Q A;  2KRF A;  1ULY A;  4Y13 A;  3T8T A;  4OIQ F;  4TUY F;  1GV5 A;  3VWB A;  2XKP A;  1DP3 A;  2BR0 A;  4BS9 A;  1ZTR A;  4AYB E;  3VPB A;  1IF1 A;  5IT9 W;  5A2Q K;  2HOE A;  3TEK A;  3S2W A;  2LBF B;  3QFF A;  3ZMD A;  3HPG A;  4RUA A;  1G2H A;  5KFG A;  4RNM A;  1RR8 C;  3J7A Y;  2FK3 A;  5K7H A;  3U55 A;  4BXF A;  2FD5 A;  2MD5 A;  2QSH X;  2L9R A;  3FKI A;  2CKZ B;  1D0X A;  2QM3 A;  4KDP A;  1IV6 A;  1B33 N;  3TO7 A;  3SEQ A;  2W84 A;  4D5F A;  5EGO B;  2WY8 Q;  1S7A A;  2XPW A;  3M7G A;  3ZGK A;  4AM3 A;  1N78 A;  1FY7 A;  1WH2 A;  3ZMZ A;  5C1P A;  3H20 A;  2ISY A;  3OS0 A;  2XAS A;  1SMT A;  2DOE A;  4ZYH A;  2WAE A;  2OZ6 A;  2KIU A;  2B9S A;  4HRI A;  2PEX A; 
#chains in the Genus database with same CATH homology
 2VPS A;  4MV7 A;  4BJ6 C;  4KT6 A;  2OV7 A;  3OMY A;  3I9V 2;  1LKX A;  1W36 C;  2UUB H;  4BAC A;  3K6G A;  2IS6 A;  5TGT A;  3ONQ A;  4NC8 A;  2V7F A;  2KSW A;  2NOJ B;  4HEA 2;  3RIZ A;  4LFB H;  4PZ8 A;  1V9P A;  2OC6 A;  2M7A A;  4F91 B;  4CC5 A;  3HG9 A;  3DLA A;  2A6T A;  1HNW H;  1WJD A;  2CFO A;  2HNH A;  2XDV A;  3DU5 A;  4LIV A;  2LOO A;  3NC0 B;  1P9Q C;  3M1C A;  2CMP A;  1NG7 A;  4U87 A;  2RRE A;  4NQW B;  4BQO A;  3OYC A;  1UEL B;  3HOT A;  2CFM A;  3BA8 A;  4DBR A;  4U7B A;  3FMA A;  3N44 B;  3OL3 A;  1S03 G;  4BDY A;  2M4K A;  4ZJZ A;  4DR1 H;  2OUM A;  2WAD A;  4N4O B;  3PN1 A;  2W57 A;  3D5S C;  2UXD H;  3DPL C;  2LG4 A;  4CUG A;  4X0G A;  2Q2U A;  4LIU A;  5CPR B;  3OYG A;  3PNY A;  2R7T A;  1X1C A;  4RM3 A;  3LSK A;  2VOB A;  2XF6 A;  2HHH H;  4DV4 H;  1FJG H;  2V1N A;  2UU9 H;  4BE2 A;  3VSK A;  3HXL A;  3DU6 A;  5DIS C;  2HPI A;  3QYF A;  3RGX A;  2ZXI A;  3AL0 C;  3K4M A;  1J5E H;  2VXD A;  4IKF A;  4X64 H;  3S24 A;  1J09 A;  3HL2 A;  1CKO A;  2KP6 A;  2CW7 A;  4EQ5 A;  4B48 A;  3ZXS A;  4OWR B;  3OR1 C;  2VQH A;  2X1E A;  1V5G A;  3CZ6 A;  1L2Z A;  3PNT A;  2E5N A;  1LDK B;  2KPM A;  5D1P A;  3CP2 A;  2X1D A;  1E4G T;  4RLQ A;  4BEH B;  1SYX B;  2BW3 A;  4G6T B;  4PFO A;  4ZDL A;  2OWO A;  4XNF A;  3V42 A;  4JQF A;  3A1Y A;  2CUZ A;  1CKN A;  3ZCO A;  3OY9 A;  4HSR A;  2KL4 A;  2KLO A;  3F9K A;  3RTX A;  2WE6 A;  3D5R C;  1V5E A;  1UAA A;  4RAZ A;  3S32 A;  4LF8 H;  4PDB A;  4CCM A;  5HOO A;  1IBK H;  3ZR8 X;  3W2A A;  4Y4R A;  2VJJ A;  4LF4 H;  4XKB A;  3JSN A;  1PJR A;  3MWM A;  3QYE A;  2DT7 B;  3W3C A;  4ZTF A;  4B43 A;  2WA0 A;  1KON A;  1XMO H;  2MC4 A;  3N6X A;  1SAU A;  3AKZ A;  5FLX W;  4XLC A;  4RB0 A;  4BQQ A;  1D0Z A;  3BC8 A;  2R7V A;  1X19 A;  3DKY A;  2MAB A;  4BGD A;  3EUH C;  3DTI A;  4NXM H;  4PJL A;  2CW8 A;  3T1Y H;  4P1W A;  3TL4 X;  2IGK A;  4F3Q A;  1BJT A;  1YX3 A;  3MKZ A;  2PJR B;  3AL0 B;  3N41 B;  1D1C A;  1E4F T;  5LD2 C;  4ZYA A;  3C0F B;  1N34 H;  3K4N A;  4OX9 H;  1XNQ H;  1ZEL A;  2DOA A;  3HPH A;  3H9Q A;  3OYA A;  2DXI A;  3TY9 A;  4PSW A;  4XOT A;  4UFZ A;  3W1B A;  4EFB A;  4EAT A;  1P16 A;  4CH7 A;  4DR4 H;  4X62 H;  4YHH H;  1BR2 A;  2VJI A;  4PFP A;  4PZ6 A;  3CF2 A;  4HNT A;  4DV2 H;  2X6Y A;  2AQE A;  3LSH A;  2KZV A;  2L9N A;  5FPR A;  2GOM A;  5LFA A;  1O75 A;  3HKZ A;  3OTO H;  2VQC A;  1T95 A;  3CJR B;  3UR3 C;  4CCJ A;  1IBM H;  2KMU A;  3ZQQ A;  1K6Y A;  3OWT A;  2L2O A;  3H0D A;  3DQV C;  1NG6 A;  4UCV A;  1V5F A;  3MMY B;  3S93 A;  4DR3 H;  4JI3 H;  4E7H A;  4LF6 H;  2CV2 A;  4KHP H;  3LSG A;  3PSF A;  3NWT A;  3L2W A;  4BE1 A;  3DEE A;  4NNJ A;  3VSL A;  4YY3 H;  3FBI B;  4R7R A;  3TY5 A;  4H4K C;  4E7S A;  1M0W A;  2LC2 A;  4JI0 H;  2M3A A;  1OR7 C;  1D1A A;  2VXZ A;  4P5O A;  1WFX A;  2V4J C;  2XC7 A;  4DR2 H;  1MMN A;  2UXC H;  4B3S H;  1FVI A;  3FBN B;  3PL8 A;  3OYJ A;  4N4N B;  1WJA A;  2BVL A;  4KIS A;  1OLT A;  2K5C A;  4E7Z A;  2Q1Z B;  2CV1 A;  4CCN A;  2HIX A;  4XKC A;  3SEZ A;  2P0W A;  2ZFU A;  3K70 D;  4KIT B;  1FMW A;  2R7O A;  2O5R A;  5KCM A;  3QWU A;  3DWL E;  4JYA H;  3K10 A;  3VNN A;  3QYB A;  1IBL H;  3D5L A;  3LSI A;  4RB2 C;  1S9H A;  3RR5 A;  3OYF A;  2UUA H;  2DJI A;  1R6R A;  3G2B A;  1FKA H;  4LFA H;  3OYD A;  4BJT A;  4XN0 A;  1E0E A;  3L4J A;  4PJM A;  2M7B A;  4BE0 A;  4JI5 H;  1BR1 A;  1EA3 A;  3EUK L;  4UCT A;  2MYS A;  4PZ7 A;  5LMU H;  4F52 A;  2Q2E B;  4J00 A;  2CV0 A;  4RZQ A;  3BG6 A;  2WAF A;  1MZB A;  4X66 H;  4AQY H;  3QOE A;  2IGN A;  1WJ5 A;  4DR6 H;  2WY7 Q;  1X4P A;  2M0M A;  2Z2S B;  2RGV A;  2W4S A;  3PJR A;  1MMA A;  4GKJ H;  3CES A;  3DTE A;  3MKY B;  3L2Q A;  5FD5 A;  2HVQ A;  4BDZ A;  1MND A;  1Z2P X;  4BWS C;  1X1D A;  2XF5 A;  4F55 A;  1AN7 A;  3PSI A;  1G8X A;  3BLY A;  4LIT A;  3RCO A;  3VYR B;  4AU7 A;  4IX7 A;  1XK5 A;  4E7L A;  4M7E A;  2E5L H;  3H35 A;  3OYH A;  3MKW B;  2K9L A;  3KEY A;  2GOX B;  4EFE A;  2MCT A;  4JI6 H;  4FM9 A;  2BW3 B;  2HGS A;  1Z3Y A;  2HU9 A;  4KJZ A;  2QKM B;  3OYE A;  5FD6 A;  2W1O A;  2HVS A;  1CKN B;  4DV5 H;  3EYY A;  1AA7 A;  2W00 A;  4JI8 H;  3H5A A;  4NUB A;  2XIG A;  1N75 A;  4PSX A;  3K70 C;  1QHG A;  4IQ4 A;  3M4I A;  2FE3 A;  4NC7 A;  2VL8 A;  3OYB A;  1CKM A;  4LF9 H;  3OR2 C;  3LMM A;  1T0F C;  2VQE H;  5FRM A;  3UNG C;  3H5R A;  4ZC3 A;  3IUO A;  1ZHS A;  4B3M H;  3W1G A;  2VQL A;  2XAU A;  4BU2 A;  3S3N A;  2UWM A;  1N36 H;  3TMO A;  2VKH A;  3HUG B;  3M8J A;  3RPU D;  3OIP A;  3DKX A;  3KAL A;  2ZJT A;  4K0K H;  4J0M A;  1HNX H;  1XNR H;  2AQF A;  3BG7 A;  1WJE A;  3GDE A;  4ETS A;  3AFH A;  5IWA H;  4C30 A;  4JOM A;  3W5O A;  4LG3 A;  4B44 A;  4I7H A;  1BOB A;  2RGR A;  5KHD A;  2A5W A;  3LSM A;  2ZXH A;  4BEH A;  2F5V A;  3RGZ A;  2MD0 A;  4R79 A;  4JI7 H;  1WJC A;  4YEJ A;  4AYB A;  2BVM A;  3NBY B;  2HQA A;  3OL4 A;  3H9G A;  4E6N A;  2BOL A;  2JA2 A;  4HPQ A;  1B04 A;  4XON A;  2VQF H;  2I8D A;  3C2G A;  3K4B A;  2UV1 A;  3LML A;  4B3X A;  3K3V A;  1JI8 A;  4XLA A;  4CC6 A;  4UCU A;  1QHH D;  2DT6 A;  3I3L A;  3K4C A;  4Y33 A;  1VZ0 A;  5CQG A;  1N33 H;  4EEQ A;  4UCO A;  2E1M C;  2KDO A;  1ERD A;  2K9M A;  4XQF A;  4A2B A;  5JHF A;  1HNZ H;  1FMV A;  2CH0 A;  2DCE A;  2R7U A;  4ITV A;  2W82 A;  3OYM A;  3L4K A;  4OAY A;  1Z2N X;  1TT0 A;  3BA9 A;  5BR8 H;  2ZSI B;  1Z3X A;  3N42 B;  3E1S A;  2JUG A;  2HPM A;  3OYI A;  2R4G A;  5EOY A;  4MLO A;  2PJR A;  4DV1 H;  1DGW Y;  2VJ4 A;  4XMY A;  4XLE A;  3GJX B;  4JI2 H;  1Z21 A;  2X51 A;  5D1O B;  2JVG A;  5KNL A;  1MNE A;  3SDB A;  2Z16 A;  2VKD A;  4CCO A;  3U21 A;  2K3P A;  5HLT A;  3CP8 A;  4ZTJ A;  4MTD A;  3BAA A;  4PUS A;  4LH6 A;  2HDW A;  4XOP A;  2R7S A;  4DIQ A;  5CQE A;  2LBF A;  3CVZ A;  3KAJ A;  3MD2 A;  1HR0 H;  4RB1 A;  3L2P A;  1MMD A;  4ANJ A;  1DGR M;  3NWS A;  1TA8 A;  4UCR A;  2F4I A;  1DGS A;  3KYH C;  1TAE A;  2LRE A;  3EUA A;  2RNG A;  4DUY H;  1I6U A;  2IS4 A;  4DJA A;  1WJF A;  2CUJ A;  2IGO A;  4LSX A;  1GYF A;  4PK4 A;  5FRN A;  1LVK A;  2VB6 A;  2QKL B;  2XF7 A;  2PMZ A;  3QOD A;  2V26 A;  4CSW A;  2VUG A;  3KAK A;  4LF7 H;  1WJB A;  3J7A K;  2JSP A;  2O03 A;  2E1M B;  4DR5 H;  1Z2O X;  3FHN A;  1BR4 A;  3BAB A;  4DV6 H;  1QU3 A;  5A2Q W;  3A2K A;  1YE9 A;  3HC7 A;  2V9K A;  3H9J A;  4RMN A;  3N43 B;  4II2 A;  1GLN A;  1X1B A;  4E7K A;  1BGW A;  2JVH A;  4A2A A;  3DTK A;  3KX2 A;  4II3 A;  1D1B A;  4PJJ A;  2FUG 2;  4XR6 A;  1SFK A;  3VYT B;  3L2V A;  4B47 A;  4XKW A;  4BQN A;  3A4C A;  4IQJ A;  2HZD A;  1A0I A;  1XMQ H;  3VDX A;  4FAS D;  2VJ5 A;  3RJ0 A;  4DR7 H;  2R7R A;  1Z7L A;  4XOR A;  4MV9 A;  3RQ4 A;  3TY8 A;  1G59 A;  2WDT A;  2HIV A;  3W2V A;  3OS1 A;  3IAM 2;  4UCS A;  4RLF A;  4E6K G;  4C2T A;  4Y3O A;  2L5Q A;  3BCB A;  4C9Y A;  1ZHQ A;  2ZM6 H;  2KRC A;  3KXY T;  4DGW B;  3IG0 A;  2L9S A;  2ZSH B;  3FDY A;  4QPQ A;  1TZL A;  1S68 A;  2VQG A;  4BUP A;  4XKV A;  4ZDO A;  2VIX A;  2LY1 A;  2X6W A;  4XLH A;  1XDN A;  4DV7 H;  3DF7 A;  2WBM A;  4D9J A;  4HG2 A;  3W2W A;  3JSL A;  2LRD A;  2CS3 A;  2WAQ A;  4IZZ A;  4J01 A;  4LSA A;  2ELJ A;  1MW7 A;  1X4O A;  4ZDP A;  4CZC A;  2L7K A;  3RTR A;  4OAZ A;  4CA0 A;  3OYN A;  2LY2 A;  1UG0 A;  3J80 W;  2R7Q A;  5FRO A;  1D0Y A;  2MFZ A;  1X9N A;  3SYT A;  3OYL A;  3CJQ B;  4HST A;  2V6E A;  2Q2T A;  4B3T H;  3J81 W;  4JV5 H;  2HVR A;  3K4J A;  3ZRG A;  2F6C A;  5HVQ C;  4APM A;  2X6X A;  3S3M A;  1DQU A;  2RQQ A;  4GKK H;  4RB3 C;  3CMM A;  1N32 H;  1MMG A;  4F92 B;  4MTE A;  2WB1 A;  4DUZ H;  4AVZ A;  4DV0 H;  3L2U A;  3K4K A;  4FET A;  1Y6I A;  1Y56 A;  4BJ5 C;  2E5Z A;  2LH9 A;  3KYL A;  4DBQ A;  4XL9 A;  2R7W A;  3OIQ A;  3VYU B;  4C2U A;  4LF5 H;  4CCK A;  4XN3 A;  4E4H A;  2WYO A;  4YEL A;  5FPO A;  2R7X A;  4DRF A;  1LFP A;  5HNH A;  2W7N A;  3N40 P;  3T1H H;  3NBZ B;  4YRV A;  4QPO A;  3L2R A;  1N77 A;  3JAM W;  3PFY A;  2LYC A;  4CCL A;  2XSJ C;  3VYS B;  1W36 D;  2UUC H;  4X65 H;  3TBI A;  2KHM A;  3OOU A;  3LFU A;  1HA8 A;  5LMN H;  2KRH A;  3K4L A;  4JI1 H;  4RAY A;  4GRI A;  3OS2 A;  4GLX A;  4E7I A;  2X85 A;  4F93 B;  4JI4 H;  3DPT A;  4RM2 A;  4DOZ A;  3OYK A;  3RSN A;  4LFC H;  3PNV A;  4D1Q A;  1X1A A;  2VAS A;  3GB8 B;  4NXN H;  4XM3 A;  3PUB A;  1U0J A;  2VLA A;  3F8N A;  3VWB A;  3H5N A;  2VPL A;  4E7J A;  4BS9 A;  3SZG A;  1DP3 A;  2IXS A;  4IAJ A;  1P8L A;  1IRX A;  2E60 A;  5IT9 W;  3BCA A;  4XLF A;  1VS0 A;  1SEI A;  2LBF B;  4LH7 A;  4Q0Y A;  3RF2 A;  3HPG A;  2IGM A;  2Y0S A;  3EPZ A;  4PJN A;  3J7A Y;  5LL6 b;  2IS2 A;  3N05 A;  4DV3 H;  4BXF A;  3IP4 B;  5CKT A;  5HNF A;  4HNU A;  4LMY A;  1D0X A;  3S3O A;  3S8P A;  3FKJ A;  2UUZ A;  3SEQ A;  2YCH A;  4B3R H;  1PYV A;  3HOS A;  2WY8 Q;  1I94 H;  2F4V H;  3ZGK A;  1YX5 A;  2X1C A;  4BL0 B;  1N78 A;  2UXB H;  1WH2 A;  2M4G A;  3H20 A;  3OS0 A;  3GBG A;  2IS1 A;  2Z1D A;  3UQ8 A;  3DPU A;  3IAS 2;  3LL7 A;  2KQR A;  3C2H A;  1M0T A;  5D1O A;  2WAE A;  3E0J B;  4HRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...