2HVQA

Structure of adenylated full-length t4 rna ligase 2
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
329
structure length
316
Chain Sequence
b'SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFSEKKVELSEADNKLVGILACYVTLNRVNNVISKIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 37.6 kDa protein in Gp24-hoc intergenic region
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase
total genus 91
structure length 316
sequence length 329
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvqA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvqA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvqA01
1XK5A 5D1PA 4E6NA 4PZ8A 1CKMA 3BABA 4EEQA 4PZ7A 4UCTA 2OWOA 1XDNA 1CKNB 3RTXA 4UCVA 4UCSA 1P16A 3KYHC 3NBYB 4UCOA 1P8LA 3W1BA 3BAAA 5DISC 2HIVA 1VS0A 1X9NA 3GDEA 3NBZB 3TY8A 4PZ6A 4EFBA 4LH7A 4GLXA 2Q2UA 1V9PA 5D1OB 4UCUA 5D1OA 3BA8A 3TY9A 1CKNA 3PN1A 5FPOA 1A0IA 3VNNA 2HIXA 4LH6A 3BA9A 4CC5A 2HVQA 3W5OA 3UQ8A 1B04A 3TY5A 3QWUA 4UFZA 2HVRA 3S24A 2HVSA 2VUGA 2CFMA 5FPRA 3RR5A 1S68A 1CKOA 1FVIA 3JSLA 1TAEA 4EQ5A 3W1GA 2Q2TA 1TA8A 4UCRA 4CC6A 3JSNA 3L2PA 4DRFA 1DGSA 3NC0B 4EFEA 3GB8B 3GJXB
chains in the Genus database with same CATH superfamily
4PK4A 4QWQA 3V4ZA 3WTUC 1G8XA 3RFCA 3H0GG 2UUBH 1KC7A 5KT3A 5CVRA 5HS8A 2XF7A 3BZKA 1OCRH 3E6MA 4LK1F 4EM1A 3KP5A 1JKJB 4L1KA 1FOWA 2FUG2 4E7HA 2HOTA 4JI7H 1QO0D 3PJRA 4XMYA 1G3YA 2XGEA 2P7VB 2VKDA 3BC8A 3NWSA 4XLPF 1KJJA 4HA8A 4M3GA 5C5JA 5KT4A 1LDKB 3GTKA 2E19A 5BS6A 3TO6A 3KEQA 2QCOA 1W36C 2IS4A 2JA6A 2UXBH 5CA0F 2BVMA 4A3MG 4ZZLA 3MQ0A 3T9BA 3KYDB 4O6JA 3Q8RB 4TQSA 3GV7B 2DLLA 2E34A 2MABA 3JW4A 1WSUA 4J0MA 1I39A 5F64A 1FP1D 4CICA 4EGYA 3OYFA 3RJPA 1R49A 4ME6A 5BYBA 2EFNA 2F6CA 5L9XA 1MMAA 4WXCA 1JX4A 1RI7A 4OMZA 3J81Z 1J9IA 1LE8A 3HSEA 2BXYA 3L00A 3KX2A 3BQ2A 1ZR4A 4FGRA 2FEZA 2LBFA 5TGTA 2CV1A 2FBIA 2LD5A 2R7VA 4FFNA 3DEUA 4GC6A 4QLCU 3VPDA 4I01A 4C9YA 2KIUA 4CGZA 1FYLA 1R7JA 3OYAA 5JH7F 4KJZA 4YEJA 4YR0A 2FA5A 2LY1A 2EZHA 4DW6A 1SVLA 2Z5UA 2F4IA 4NXMH 2X6OA 5FD5A 2KLOA 1N25A 5C4XG 1XGOA 4HEA2 3SGIA 2NAZA 3IKTA 2RC4A 2FSWA 5B66C 3BA9A 3MKYB 1K83A 1I7NA 4FE7A 5GPAA 4ENMA 4A3JG 2LSOA 2ODTX 5T14A 2MYSA 2R84A 4MV4A 4YR3A 1T0FC 1WWXA 3QZ8A 4QIWN 1UG0A 4CZCA 3OHAA 4CKCA 4II2A 5LEJA 2MLKA 4BHPA 2J6UA 3K4CA 3RYRA 4BE0A 1LQ1A 1RYSA 1OBDA 2B63A 4CMFA 1M7JA 4GLWA 1H0MA 1BNCA 4DV5H 1OCZH 5KFXA 1QPMA 4BGDA 2HHFA 1GVDA 2VB6A 4B1RA 1MDMA 2CV2A 2BY3A 3WU1B 3SJMA 1A35A 3FMQA 4YP3A 4OX9H 3S2WA 1NG7A 2LH9A 1VQKI 1LNWA 3QU3A 3OSFA 2KZVA 1S29A 4S0HB 3BJAA 4QWAA 4YELA 4G3IA 4N4OB 1KYZA 1TWGA 1QBJA 4NYEA 4O2AF 2NU6B 3GFJA 3H9JA 3K9TA 3SHFA 5L3EA 2K9QA 5E8IA 3IG0A 1TT0A 4IHXA 4Q0YA 2QSHX 1S5LC 1O3QA 2XD4A 2Z02A 3U21A 4PFPA 4B3SH 1SFOA 5B1AH 2GXBA 1ZLKA 2WY7Q 3A2KA 2Z1DA 1OMIA 2HKOA 1W0UA 1S0MA 4LF7H 3CTAA 1Z05A 3C2GA 4A0YA 2SCUB 4FASD 3S3NA 4J9KA 4EEYA 2BBYA 1VQ4I 2ASLA 1D8JA 3HTSB 1Z3XA 4I2OA 2OTLI 4HOBA 1LJ9A 2VBXA 1DIKA 4DV0H 3A4CA 4DL4A 3O8GA 2E5LH 3QODA 2WV1A 1RUNA 5KCMA 3JRIA 4TV7A 4RLFA 4XOPA 3QU6A 2M3AA 3CDIA 4NXNH 2G7HA 4U87A 4OOIA 1XMQH 4EBEA 3PM1A 2I87A 5EDWA 4BY7J 4I4TF 4K2EA 5HOOA 4PZ7A 3R60A 2FOWA 1Z2PX 2VQCA 2ME0A 4A69C 4HBLA 1XDUA 3FX3A 2LREA 4KICA 3UR3C 1A9XA 3N4MA 1ZQ7A 4XKCA 2D1VA 1HKTA 4LLNA 2B7EA 1VQPI 5KG6A 3OS1A 4IZZA 4B3RH 3S17J 2RN7A 1ITYA 1SANA 2HNHA 5LHHA 1Z2NX 1RK6A 3ECOA 3QPSA 2YU9J 2OCEA 3HOWG 4DR4H 5CQEA 4UUSB 3JRGA 1TT5B 3GDEA 3LSIA 1OKRA 1OLTA 2LP0A 3QPHA 4ON0A 1VKZA 2ID6A 1Y1WJ 4O4HF 1SD5A 1W7PD 4XK4A 4G12A 3MWEA 3RBDA 2HDWA 5IOZA 4RGSA 2KRHA 2QYOA 4M3FA 4QSHA 2C35B 1IN7A 4FFRA 4Q48A 3P9CA 2HEOA 2ZXJA 1WJCA 1TQIA 1JTXA 2K4BA 2R7ZJ 1HF0A 3VPCA 1R36A 3LSRA 2OJED 4AUXA 1IXRC 3H1CA 2R93G 3ASNH 5DUKA 3TO9A 1OPCA 1ZH5A 3RYPA 1YQAA 4LH6A 2HXOA 2WAQN 5E25A 5LMNH 4A3CG 2P0AA 4HDVA 3HM5A 1U8BA 1O3RA 1V5FA 3MEXA 1HDPA 4M6XA 1YTYA 2WAFA 2CGPA 2Q7DA 5KFZA 4A0ZA 4A3DG 2FBKA 4N4NB 4FCYA 1B04A 1VI0A 2QENA 4ASNA 4FHTA 3I12A 4RZRA 5JQGF 1K79A 3HRUA 1HQCA 5ERIA 2J5OA 3CUQC 3GFLA 3HOYG 3F8NA 3EUAA 3L09A 1Z67A 4HYEA 3ZQ7A 1GSHA 5KK1A 3Q2OA 5LGNA 3GTOA 2R82A 1A6IA 2BVLA 3DF8A 2WE6A 2NU8B 4HX4A 4LLGF 3CUQA 3GTGA 1C0WA 1QU3A 3BG3A 2W6ZA 2FK3A 2XPVA 3O3KA 1NHAA 3P5JA 3PFIA 2Z33A 5DGAA 3R0JA 4DQ2A 2ESNA 3S16J 3ORRA 2E71A 3WTYC 3H0GJ 4XBFA 5CM0A 3K4BA 5KVRA 4HLXA 3V6JA 3OYBA 5KFFA 1P92A 5FD6A 2ZGIA 3LQSA 1YJWI 2DWCA 2W9BA 2KHMA 5E3OA 3WTSC 3U1DA 3E6BA 4ECTA 4O3QA 4BAYA 5FO5A 3ZQQA 1FJLA 2XB0X 5I5YA 2IGNA 3VA7A 4DUYH 5D5VB 4QPQA 1GSOA 5KFSA 2EJRA 3TDUC 4YIFA 4A3MJ 5FLXK 2H1LA 3QOEA 4QW8A 1EH7A 2XF6A 4BYYA 4CCNA 1B59A 4GFBA 4AYBN 3GTQJ 5GADJ 2CNUA 1VQ7I 3SFIA 4RCNA 3U54A 4FETA 2LG4A 3PQJA 5BPDA 2LF8A 5D5WB 2M7BA 3VDXA 2X5RA 2MD0A 1EKEA 2W00A 4NZMA 5DGHA 2OBPA 1J5YA 1E17A 3JRBA 5FJ8G 1GT0C 3BACA 1PVEA 4O5VA 1Z3YA 4GYIA 4XSXF 2L0KA 4UVBA 3SDGA 3CCRI 4M9SA 2LF7A 2VUMA 2YZNA 4AC0A 3LMLA 3JAMK 4O3RA 2PN6A 4NLGA 5LEKA 1BC7C 1GDTA 4DV7H 2HGXA 2HTJA 5IYBG 4L5EA 2WAEA 1ZG3A 3I71A 3JCUC 5HLGA 4RA2A 2VIXA 1YO5C 4C2TA 2W85A 4PUSA 1EHIA 4FS1A 5C4XJ 2JA8G 3M8FA 2EILH 4RDUA 3W6JB 1JHFA 1J5EH 1QPIA 2GOMA 2ZDHA 5JVDF 4J9QA 3ONQA 4XRSA 3D5SC 2C2DA 4A3JJ 3DTEA 3ZOBA 2JA5G 4LG3A 4PFOA 4CDGA 2GIVA 2HYFA 2HS5A 4M6YA 3TQ1A 1H89C 5IYDG 1LVKA 2UV1A 3RJ0A 4OIQF 2GA2A 2PBZA 3LULA 5E1ZB 4TV8F 1R22A 2BQRA 5IY5H 4QIWA 3VNNA 4PJMA 3G1OA 1XPXA 3EPZA 4PGGA 2DJIA 1W5TA 3FIWA 5CJ9A 1MKMA 1XS9A 2DJNA 3UQ8A 2R7UA 4L9TA 4HQEA 2R7NA 1WH2A 4F50A 1FIPA 2HDDA 1BI2A 3U9GA 2M4GA 2DBBA 1R5GA 3GZ6A 1RK5A 5L1IA 3JR9A 1LFBA 2LDUA 3SEZA 1LPQA 2JSCA 4NHJA 2A61A 2JT1A 3ZMVA 3RZOJ 1W96A 1BW5A 4MEYF 4UUVA 1XD7A 4M3BA 1WSCA 5KFWA 1T33A 1P2FA 4E7SA 4LOCA 1OYIA 2PN1A 3FXRA 2I8CA 3BTCA 3K4MA 2RQPA 1S03G 2ZFUA 2HPMA 3OY9A 2EIJH 1MJAA 2O0YA 1I3QJ 1NG6A 3I4PA 3JRXA 4L9NA 1GO3E 5L3CA 4KN7X 4AVZA 2HJWA 4BHBA 1JDBB 5L3FA 1RR7A 2UUZA 3WTTC 4C30A 4O7ZA 4DZJA 5BOXA 5C1PA 1B4AA 1ZHFA 2C6YA 3N6XA 5DEQA 3QP6A 4AD9A 3CD6I 3DPLC 1QVTA 3JTHA 5JUMA 2P5VA 2V6CA 3WTWC 3H0DA 4CA0A 4CC6A 4J9RA 2DA2A 5F9LA 2HKXA 4UXNA 3CEBA 2IMWP 2ZM6H 4EGZA 1S10A 1CF7A 5LL6b 1A48A 5I60A 1Y14B 1XC5A 1JKOC 2VKHA 2Y69H 1W0TA 3C2HA 3E7LA 4RGRA 4O4JF 4CKBA 2M9HA 3H36A 3P7NA 1LKXA 2OU2A 2XGCA 3ABKH 3T0YA 1O4XA 4HX8A 5J4YA 1GLNA 3RPUA 4MV9A 1J7KA 2ZXIA 1QZEA 2LTPA 2Q2EA 2V4QA 4U7CA 3BPVA 5K7FA 1RJPA 2JRMA 3L2RA 1A5JA 1IV6A 3MWMA 3HOWJ 2ZSHB 4MA0A 3GMEA 1PUFB 4A3BG 2GXAA 3A02A 5J1RA 3GFMA 3IL2A 4F93B 1IGNA 1X3ZB 5CVVA 2DT7B 4PBCA 2E2HA 2D2WA 1P16A 3RIZA 4NZNA 3RB4A 2V1NA 4FFLA 1I7LA 2CW8A 4EJOA 4GGGA 1P8LA 5KFTA 5F6FA 2Y75A 3BOQA 1W36D 3K3PA 5BQTA 4HQ6A 5IWAH 3FKIG 3ZP5A 3ESWB 3ZMZA 4YQWA 2HHHH 2FMYA 4IOAF 4HZFA 5HV6A 1Z2OX 1WH7A 4Q43A 4OIPF 2Z9OA 1BJTA 2DOFA 2GOXB 2JPBA 2MFZA 1K83J 4MHGA 3O2PE 2R93J 3LNQA 5KG2A 4XRSG 3OSNA 4XKVA 1WJAA 1V9PA 5D1OB 5D6FA 4RU9A 1ETKA 2P5LC 1PUFA 3DEEA 3WNZA 1GVJA 3IWFA 4ZJZA 5DS9A 4IRIA 2VN2A 3TY9A 4ED0A 2B63J 1W7PB 1K78B 4F4YA 1IO2A 2CFXA 2RAEA 3Q9SA 4JI3H 1V5EA 2DA5A 1YS7A 2BHZA 2WAQA 3EUHA 3W3CA 2P4WA 3WE3A 3M9AA 1MNMC 4DV2H 2IBKA 5GTHC 2KPMA 3PIOF 4ZYGA 3FKJA 3JTGA 1FEXA 1P6RA 3ABMH 1VBHA 1IN6A 4XIDA 1CS0A 2HQNA 2X1EA 5ICFA 2BOLA 2R7LA 3BQ0A 1DAAA 2KISA 1BOAA 4FE2A 2ESHA 1SCUB 2HTSA 4KYWA 3BR3A 1TWGJ 3QPTA 3RCOA 4RM2A 1N77A 5BR8H 2LLKA 2HGWA 3WHBA 3GILA 2AGQA 4EQQA 3L2UA 4Y3OA 1BR2A 1V55H 3FHZA 3PUBA 1SFOJ 5I5VA 3B73A 1Z21A 4F55A 2FNAA 2RQQA 5DUIA 2Z04A 4JYAH 2L7KA 3ABUA 1S68A 3S15J 1B6RA 2ELKA 4NZOA 4QWBA 5ICEA 2V9VA 2KQRA 2QM3A 2JJ7A 5DLFA 4IPAA 4MQ9F 4U7BA 5KT5A 1W5SA 2E5NA 4KUMA 3J81W 3EUKL 1JGSA 4A3KG 1USSA 4B3AA 1WRVA 4M73A 4AIDA 3FXJA 4P55A 4XONA 2O5RA 3QYFA 4RGUA 1VTNC 2YX7A 4DYRA 2M34A 3S1RJ 1ZAOA 1Y8RB 2IA1A 1FBQA 3K0LA 2MCTA 5DYMA 2GPWA 4LFUA 1YOVB 2BZTA 2DLNA 3HOVG 1R4NB 4IWYA 4DL5A 2Z99A 4AWXB 1RZ4A 2ICWG 2IT0A 3HRMA 3RUPA 2DA4A 3VMMA 3S3OA 2CJJA 1IF1A 3PSIA 5K5OA 5L1LA 1XGNA 2C22A 2YU3A 3EQLF 4Y8VB 3F8CA 1XMKA 2K9LA 4AYBA 2A5YB 4Y4RA 4EFEA 1DGRM 1OJLA 5FJ8J 4CE5A 1EV7A 3IP4B 1BL0A 3GTLA 3LAJA 3QAHA 3DLLF 3TEDA 4L0ZB 4MV1A 1Z91A 3RDIA 2Y9ZA 2FOKA 3SXYA 3MMYB 4R7RA 2H6BA 1E3HA 2DZDA 2CQNA 1I1SA 5IYBJ 2R7XA 4BQOA 4FFMA 3GVAA 1XDNA 4UCVA 4JX4A 3BDDA 5KKNB 3LQRA 3OUUA 3BQZA 2JA8J 2O8XA 1HKSA 3NAUA 5CVIA 1WCMG 3HPHA 1G3TA 4C2MJ 1W93A 3WWHA 3NBYB 4HYKA 1ZK8A 1TC3C 4O3PA 3MAJA 1XMOH 3FDYA 3ZQCA 2K7LA 1WR2A 2JA5J 4EGJA 3CCMI 3DTGA 1KYWA 4JK1X 1T2KA 2X6YA 2YS7A 1TTYA 3WO0A 5AIPA 4I99C 3GTJJ 1VS0A 4IRGA 3UFXB 1E2XA 3NRVA 3I4NJ 2F5CA 2Z16A 5KX5F 3CJTB 2F5VA 4GDFA 1R1VA 1B1BA 1UJ8A 2EV5A 2EFPA 4NQWB 3MJFA 2EV0A 2M2EA 1BI1A 1U0JA 1I94H 2BGCA 2HYJA 1LEBA 1KA8A 3HOSA 2WV0A 4I0BA 3MKWB 5LMUH 1TWHJ 3BY6A 3HGGA 3S93A 2EZLA 3ZMUA 1IBMH 2R0QC 3AFHA 1R9TA 2YCHA 4M71A 4KNYA 1WJEA 2CV0A 4LD5A 3Q0VA 5BMVF 3GTMA 1T6SA 4ZI7F 1X4PA 3B6AA 1BM9A 2ZJRF 5KFMA 2UXCH 2W84A 4O7TA 2IBDA 3GTOJ 2QQ8A 3OYLA 2HIXA 5CR5A 3TOAA 4DV1H 2VA3A 1VQNI 4FBUA 3A01A 2ZC2A 1OFCX 1HNWH 4O7LA 2P0WA 3GTGJ 2JN6A 3I59A 2WA0A 4XKBA 2KZGA 2BY2A 2VJJA 3T1BA 5M3MJ 4LB5A 1IYEA 3V4SA 3N42B 3K3VA 5L3DA 4ESBA 5J2UF 3SFZA 2KDZA 3BG9A 1E4GT 3C2BA 2VODA 3DTKA 3T7AA 4N0BA 2HI3A 4ECQA 3OYDA 2JSPA 4Q47A 4ECUA 2JPCA 4HX7A 3L9FA 3QYEA 1PK8A 2OZUA 1YE9A 3FXKA 3K4JA 2H6CA 4ECWA 3SZTA 2MG4A 4DZPA 2WDTA 5KFDA 1X1CA 2Y31A 1Y1WG 1OYYA 1G3WA 2M0CA 3HRTA 4J00A 3PVXA 3OWTA 3W2VA 1EUCB 1X1DA 4JOMA 1I2KA 1XNQH 3PNVA 1Y0UA 1RJRA 1BI3A 2C2RA 2ECCA 2W6PA 5JR3A 1ETWA 1S7OA 3CF2A 1IOWA 1MD0A 3LSKA 3CCQI 3ZMSA 3S2DJ 2OAZA 3A03A 2VXDA 2R7ZG 2A6TA 3BLYA 1JTYA 4XLCA 4A6EA 4ZTFA 2BW3A 2L9SA 3ZMDA 4ED1A 1UCRA 1R23A 1RR8C 2W7PA 3COAC 2VC1A 2DPJA 1W1WE 4A3BJ 1C30A 3FHNA 2DPDA 4MV8A 4FX4A 2ASJA 4B09A 3GLLA 3T5LA 1B9NA 4H0EA 2VUMJ 3LA3A 1TW2A 2KIMA 1XK5A 4I02A 3GLXA 2A05A 3G71I 5KFPA 2W9AA 3NQOA 4O3OA 1BW6A 2V58A 4TQRA 2NOGA 4JXUA 3G4SI 3LSPA 1Z1DA 3G8CA 4AQYH 1TW3A 3QP5A 1AN7A 4XICA 2OC6A 1D1AA 4O7NA 3FKIJ 5C8YF 2CQYA 1UC8A 1RC9A 2D5VA 4PJLA 4XN3A 1ZREA 2AGOA 4WCGA 3OUZA 2CNQA 5F27A 3T9FA 1HOMA 2HZDA 3VYSB 5JVTA 2FLNA 3GIDA 1IN8A 2RDJA 4J19A 4ZC3A 3M9OB 1SMTA 2DT5A 3DCFA 2EJ3A 3LWBA 3F8MA 5K5QA 5D8DA 4WWCA 2W8KA 1ULYA 1BJZA 3DTFA 1IRGA 3WTXC 1JXLA 2B0LA 4XOTA 3A1YA 3CQZA 3VOEA 1HLVA 4KIBA 1WKMA 3KIOA 3LSTA 3MZYA 1R6RA 1T08B 1JIHA 2I8DA 2VPSA 2K4JA 2JQ7A 3R23A 1D3YA 5DCFA 1LE8B 4CCKA 5JHUA 4EFBA 2VQEH 5K2MA 4GLXA 1OCOH 2CW0F 2OPTA 2CG4A 2JRTA 2LBFB 3FMAA 5DG7A 3HC7A 1ULZA 3RQ4A 2Y48A 3I64A 3N41B 1TL8A 4B8XA 3K1PA 1S97A 3OSGA 2V5AA 4DGWB 2DMUA 3PN1A 2FPPB 2K9NA 5KG0A 4JI6H 4G6QA 4QIWE 1JT0A 3VODA 1FWZA 3RBEA 3IUOA 3CC7I 5CQGA 3QZ7A 3JZIA 5C44G 1SFEA 5GAHJ 3HIFA 1TWAA 2F2EA 4UB8C 1R1UA 2TDXA 2K40A 5ICGA 9ANTA 1FLIA 2DPUA 3BCBA 2MA3A 2A69F 2J5PA 2QQBA 1STZA 4IKFA 3CO7C 4JV1A 1AUVA 4A3KJ 3MZHA 3CP8A 3S1MJ 1AWCA 1FKAH 2A1HA 4EJVA 3D1NI 1DV1A 2A6HF 2PQ8A 5BWRA 2GQRA 4K0KH 2FQ3A 2FKLA 1PUEE 2JVGA 4A6DA 2HHFB 3ROUA 3K70D 5KT2A 4Z6YA 3L7WA 2IS6A 4UV8A 1MDMB 2Y2ZA 1KJ9A 3NWTA 5GONF 2DK8A 3B02A 3KETA 1N56A 3GEZA 5KNLA 3OL3A 3HOVJ 2QF7A 4O3SA 2H8WA 2HR3A 5IOYA 2X0SA 1X19A 4UUGA 4F4WA 1KU9A 2BXZA 1U9NA 3FF5A 3P9KA 4FT8A 4BDZA 3G1LA 1ETXA 1G6NA 4DL7A 1X2NA 2DDAA 2JEIA 5KFCA 1KJQA 4XZ3B 3Q8PB 2VL8A 2KMUA 2R7DA 2Q1ZB 4J9PA 4DYQA 5CVUA 3S32A 2NS0A 3HOZJ 3H4BA 3D5LA 4B47A 3HKZN 2IJLA 4ED8A 2VOBA 2W71A 4K6NA 3GF2A 1OCPA 3OYCA 2XUBA 3FXOA 4Y7NJ 5BWTA 1ETQA 3M1EA 2AU0A 2STTA 3H3VH 4HPQA 1R5ID 4UUTA 1Y8QB 3E5UA 1R71A 2K3PA 1WCMJ 5JLWA 5GP9A 5EYRA 3G8DA 2DYSH 1YYVA 1ZELA 4BXFA 4EV0A 4P1WA 2H1KA 4G6DA 1RNLA 4WXDA 1SVMA 4HN2A 1M0WA 4I0AA 5L3GA 5EGOA 3T9CA 4UCTA 4ESFA 2VQDA 1WVRA 2X1DA 2L54A 2HOEA 3FWEA 2JMWA 2L5QA 2V6EA 1IN5A 2CRGA 1O3SA 2ZMEA 4A3EJ 3KAKA 3IH3A 2J9GA 1JUMA 3BAAA 1MJBA 2LK2A 1KUTA 4DL3A 3I9V2 1RRJA 1LDJA 4HG2A 3DXJF 3RKYA 2FLPA 3VWBA 4D5CA 1XSDA 5F1RA 2ABJA 5KFBA 5H80A 3DBRB 2AHQA 3S3MA 1JKQC 2BEOA 1JUSA 2FB9A 2EJ2A 2ACJA 2JEGA 3WU0A 4O7VA 5DGBA 4I76A 2XF5A 1IC8A 1ZLJA 2NYXA 3K2AA 2HGSA 5KFVA 5IYZF 2WAQE 3CESA 2C28A 3E1SA 5E1WA 2MW8A 2JA6G 1HBXG 1VNDA 4YHHH 3WG9A 3WHCA 3BR6A 3KP2A 3ZR8X 1F1ZA 3AAFA 3GX4X 4EYHB 4BQAA 4HV6A 4KA4A 3OIOA 4LFCH 2XRLA 5H20A 4KT6A 1OYWA 5F1JA 4MTDA 1MH3A 4M7EA 4YBZB 5HVQC 1XTAA 1ONVA 4KN4X 3PIPF 2DAOA 2M8EA 3HOTA 5D4SA 1JXSA 4X66H 3J81K 1ET0A 2QB5A 2XCLA 4Q44A 1A6QA 5GAGJ 2O9LA 5DCMA 4RMNA 2WB1N 5I5TA 3ERMA 1NTCA 4QJFA 3G6VA 2M7AA 1IRFA 2DFHA 3ORQA 5LXTF 3K2ZA 1IDYA 2HYGD 2RDIA 1RIOH 1TWCA 3S24A 3PNYA 4XLNF 4A3LJ 2H27A 1XSXA 1D8KA 3TQNA 1TNSA 2PJRA 4BBSG 2HGCA 4E7IA 2YL2A 5DQGA 1K6OA 4BKXA 3E6DA 4JP0A 2F5FA 2CQKA 5EEGA 4C5AA 4DV4H 4BL0B 3V6KA 3CMYA 1TQMA 3OYEA 5JQWA 3F9KA 3R5HA 3BJYA 2EIYA 2HZTA 2XAQA 3O6BB 1E4EA 2JUCA 3U9SA 2QKLB 3N40P 3EDPA 4RB3C 1PJRA 3HOUJ 2V1UA 3CUQB 2W6MA 2CU7A 3MR3A 2K02A 4MV3A 2XB5A 3RAQA 2VA2A 3GTLJ 3WWJA 3CMAI 4BBRG 1SFUA 1ZGWA 2EIKH 2XAHA 4S05A 1MMSA 3MR6A 2MGQA 2VQGA 3HB9A 1MSFC 1OBGA 4FM9A 2B63G 1N32H 3V7RA 4BHCA 2ISYA 2IXSA 4RB0A 3VOTA 4DR6H 4EVIA 2Q2TA 2X6WA 3RB3A 4XLEA 1YW9A 2R5YB 2IS2A 2FPIB 2W9BB 3CCSI 2H09A 3ISPA 5HNEA 3CF5F 2E2IJ 4AYBE 2M4KA 1PP7U 1LB2A 4KITB 2MSYA 3HUGA 4IOCF 1U8RA 2R86A 1DGSA 2ZO4A 2DTZA 4UVAA 4LF9H 2NVXA 1REPC 1HSJA 2AGPA 5FROA 3GW2A 4OIOF 4QWCA 3R61A 1DDNA 3NEUA 2V4RA 1C3OA 1RPWA 2VQLA 1HA8A 2RNJA 3HZJA 1G2WA 1K6YA 4ED7A 5E18F 2W8LA 3KLOA 1A36A 1FBSA 3LSHA 4CZZA 1CGPA 2WTFA 1YIJI 3SZGA 1J0RA 5E3MA 1P4XA 2COBA 2W1OA 1MJ9A 4JX5A 3RGXA 1Z77A 3FXLA 3K7AJ 3CO6C 2OQGA 2PLYA 2E1CA 2YS6A 2NS8A 1AA7A 1OR7C 2QLZA 2R5YA 1VFCA 2VKVA 3LA2A 1HXDA 3F22A 5CKTA 2E5ZA 4Q45A 4L5IA 4GKJH 5HS7A 1XN7A 2QVOA 5LBQA 2NOJB 3BTIA 3I55I 4RB1A 2HDCA 3BR1A 1JE8A 4KMFA 4DR1H 2BQUA 4ZYEA 4DLKA 4OAYA 1K7AA 3TW7A 4RUAA 1WJBA 1USTA 2M0MA 4IVNA 1Z7UA 2CQQA 2COIA 2W24A 1OR7A 1FX7A 2CMPA 1U5TB 3DPUA 5E8GA 1GXQA 1OCTC 3OYGA 3VPBA 2RNGA 4GC7A 1EUDB 5FLMG 4CHIA 5C44J 2XAJA 2L7ZA 1G2HA 4Y15A 4JV5H 5KS8A 2LY9A 2VKEA 3S2HJ 4I7HA 2FP4B 1FMVA 3GQCA 2PMZN 4CYDA 1JJ6C 3MR5A 2KP6A 3VEPA 2VT2A 1ZGAA 2FMAA 3UZOA 3JRHA 3P9IA 1U5TC 2WADA 3GIJA 4Q4ZF 4Q8FA 4MIMA 2G7UA 6PAXA 3ZN0A 1E0EA 4FU0A 4PWQA 2DQRA 2CH0A 2KFDA 1KU2A 2DQLA 1SAUA 5BWXA 3ZXSA 2K5CA 3K4NA 1J2XA 3K5IA 2XVCA 2JWTA 2AQ4A 3KHHA 1ERDA 4CHUA 1D5YA 5KFNA 3SYTA 5LRRA 2LR8A 2O03A 5CLSA 2F4OB 1U5TA 4JBAA 2R3SA 4OU0A 4YJ3F 1ZG5A 3PUFA 3DV8A 2OTJI 2CW7A 3TBIA 2WYOA 3J80Z 2J6SA 4DIMA 4RGXA 4XRMA 4BACA 3HPGA 2MH9A 1SD7A 4JX6A 5IP7G 2HVSA 2YSRA 1XMAA 3CDHA 3M1CA 2VLAA 1NK3P 2XGDA 4M0JA 2HWVA 2XCPA 3L4KA 4W97A 5E3LA 3SQNA 3RI4A 2Y4RA 4X0GA 1YRNA 3GXOA 4RAZA 2VPLA 3VPRA 4KIGA 3AL0C 4I09A 2R5ZA 1SYXB 3I4NG 1OWTA 3E3VA 3FM5A 1H88C 1TZLA 2CZGA 4IO9F 3GTPA 2N8GA 4APMA 4NBQA 2DPIA 2IPQX 1PYVA 5CE8A 3AYHB 1S6LA 2VBZA 3HKZA 1VF9A 5LP6F 3GIQA 3CVZA 3LFKA 4M6VA 3IAM2 2DMQA 3C18A 3F6VA 2M30A 4HR7A 1ZHSA 3K70C 1ZKGA 2D45A 5EG0A 3KLNA 1YLFA 4A2BA 4J9NA 5A2QZ 3LQQA 4J9SA 4TV9F 2V26A 1JKRC 4V19K 4MQVA 4YFNF 4E70A 3C0FB 2XCAA 1CF7B 2CFOA 3JSNA 4MTEA 4B3XA 3E5QA 4O82A 1DPUA 5BPHA 1RETA 2QGUA 3MD2A 1UELB 3GB8B 1WJ5A 2IA6A 5EZGA 1S0OA 4X6AJ 3Q0WA 2GLTA 2Q2EB 5HDGA 4ECVA 3CQZJ 3FXQA 3DFGA 3MFKA 2OV7A 4CYCA 4DQNA 2ECBA 5IYCG 5DG8A 2UUAH 4Q4CA 1DU6A 4X1EA 3N05A 5KHDA 5LHIA 5EWFA 1MBGA 1CQJB 3O8HA 3ZQGA 1IUYA 3GTKJ 2V4JC 3T5XA 3HL2A 3H3ZA 5TJJA 3W6VA 4XLFA 5IP6A 4NC8A 5DISC 1WJDA 2XROA 2DIKA 3JZ6A 1B9MA 2RREA 2JA6J 1TWFA 2VJ5A 2COGA 3DQVC 2GM4A 3CJNA 4HV5A 1RJQA 1I3AA 3H5RA 4ZOLF 3CZ6A 2QKMB 4B44A 1VZ0A 2YPRA 3JRFA 2ZXHA 2Y0MA 2AS5F 1OISA 3HBLA 3G2BA 3H9QA 4C3HJ 1S8NA 2DAAA 5KG3A 5EWEA 2VJIA 3RZDJ 3L4JA 2KRFA 3GUDA 5TISC 3OR2C 4AVPA 2V9WA 4HNUA 4HNTA 3QOPA 3HRSA 2DFFA 2R7MA 2DW4A 5EJCA 5DG9A 2V1XA 2QZ8A 1J09A 5I5XA 4LLLA 4EJWA 1APLC 3WGIA 1U6GA 2EJ0A 2FJZA 1CQTA 2R87A 2VUMG 2C2EA 4DL2A 1BGWA 2IAIA 4XM3A 1JI8A 2WB1A 2M1BA 4IZOA 3PR5B 4CXFA 1XNRH 2QSGX 4DR5H 1P4AA 3W2WA 4BBSJ 1LUJB 5HNHA 2ASDA 4LSAA 4A3FG 1ZYRF 1DPRA 4M3EA 2XPWA 3BPXA 3EUHC 4G7HF 2GLOA 3EPIA 3L2QA 5ICCA 3KCCA 3CDLA 1SMYF 4U88A 1GUUA 4HW0A 5H2FC 4BBRJ 3K5HA 3AW8A 2L9VA 3BQYA 4NNJA 4XORA 4F91B 4PDBA 1EA3A 1FOKA 4R8UA 3CCVI 1BBYA 5DD8A 5JHFA 5TRDA 1CKOA 1I2LA 5JFRA 2CNVA 3T54A 1RKTA 4AIJA 4F7ZA 3WGHA 3WE2A 4EQ5A 3FISA 3HO8A 3LSJA 2IRFG 3V42A 2E36A 2TRTA 4BU2A 4PJ0C 3DTIA 3JRCA 2NUAB 2QUFA 1CQIB 3HYIA 1G4DA 3CSWA 1KBLA 5F0HA 2H8RA 4AM3A 3MN2A 1TNTA 4JQFA 1ZR2A 3DU5A 1YI2I 1SD6A 1EYZA 2KT0A 2YRXA 4LF6H 4QW9A 4WHXA 2HOAA 3V4GA 4UCRA 3PW4A 4NC7A 1I1KA 2P5KA 2XHKA 2E60A 2W6NA 5J1UA 1E4FT 1KZHA 4I55F 4TM5A 5EEAA 3J7AK 2L01A 4DRFA 1T98A 2COJA 2L9RA 3L1PA 3Q8SB 2EV6A 1BOBA 4EJTA 3UYYA 2NXNB 2JTVA 4F3QA 2KL4A 4IR1A 3UNGC 4U0YA 1BR1A 1EF4A 1YIOA 2W9CA 1P4WA 1Z0XA 4C5BA 4Z2YA 1A04A 5J47A 4GRIA 1MBEA 2NS7A 2X6XA 4LITA 4YB8B 1AKHA 2FNPA 2XASA 1QZYA 3LAPA 4ECRA 3N8DA 5FLMJ 3RPQA 1UZCA 4DBQA 2G0EA 5DM6F 3OYJA 2XSDC 5LRSA 2RF4A 1FYKA 1I50A 4MNUA 5KFLA 2YU9A 4Q5SF 1MZBA 3PR4A 2ZBKA 3WG7H 2GIZA 3BJOA 4ZTJA 4X62H 5B3SH 4XYMB 4BY1J 4RNOA 3BQ1A 5JLXA 3C7JA 5LHGA 1QZZA 1X3WB 2YUSA 2W6QA 2PMZA 4O7WA 3ERED 1AU7A 5AONA 2JA7A 3KZYA 5ILSA 4FISA 5K1YA 1N75A 3HOZG 5GTIC 4IRHA 2Q2UA 5FR9A 4O86A 2NVYA 4UCUA 5D6EA 2AXLA 2XRNA 2ELJA 3HTUA 3HJEA 4CSWA 2O8KA 2IS1A 1GYFA 3U2RA 3ZQLA 2GPSA 1ACIA 3UKGA 3VSKA 2DMTA 2LFBA 1MMNA 3X2QH 2FMLA 3F8FA 4CO8A 1ON1A 1B6SA 1H9GA 2IGMA 5IP7J 1YJNI 1KQ0A 1NK2P 1UFMA 2IA0A 2L3DA 2R8IA 3TP0A 4PJNA 3A01B 1FSEA 3M7GA 3K10A 3QWLA 2KJCA 4UVCA 2OF7A 4CMDA 3BG6A 1Q1HA 3BWGA 3K4KA 4IF4A 4NDLA 3WGGA 3ZN1A 4O7SA 3I56I 2R92A 2M8GX 2UUCH 3I59B 1O7FA 4I98B 4UFZA 2HVRA 2LRDA 3WTZA 5IT9Z 4A3EG 3AG4H 3BR2A 4LF5H 4XN0A 1WFXA 4MFEA 4XR6A 2L4MA 1B8IA 4ECXA 3KYCB 5CAEB 4YG2F 4LG0A 1KQ9A 2F4MB 4D7MA 3IRQA 2IEKA 2R7FA 1B72A 5GAEJ 2W7NA 1R5HA 2UXDH 4ITVA 2HDKA 2Y9YA 1TAEA 3M4IA 1EKPA 4ZQIA 1QQIA 1D1CA 1ZN2A 3R4KA 2NVXJ 2R7KA 2K27A 4L9JA 4C5CA 3CP2A 1S72I 1JLLB 2W7OA 5K5RA 3H0GA 5E20A 3GIPA 3MFHA 1HDDC 2BY0A 1F4KA 4HLYA 1ON2A 3TOBA 3QQAA 5KFHA 5J2TF 2DA7A 5BWVA 4LF8H 5J8CA 2CO5A 3MKZA 1ZHQA 2MC4A 2BW3B 1SD4A 4NC6A 5J6XA 1HW2A 5IYCJ 4L18B 4CCJA 3OOUA 1FYMA 1SVOA 1ZGJA 2CQXA 3K69A 3EPGA 4F4ZA 4UY8I 2LYCA 1RYRA 1QNTA 2UXNA 3EYYA 3TKYA 1FOXA 2M87A 2VR1A 3PFFA 4ED2A 1I1GA 4E4HA 3TDZC 5D1PA 1G3SA 1Z6TA 4O81A 2R8HA 5FKNA 1D1BA 4A3LG 2OA4A 3HGYA 4PZ8A 3GO5A 2OUMA 3OYNA 4D5FA 4DOZA 1N48A 2QK4A 4E7ZA 3IV5A 2BR0A 1FBUA 3W6KB 2LVSA 1MIJA 3BTLA 5J40A 3LSMA 3KTMA 2K3FA 2PI0A 4A2AA 3RB0A 3N6RA 3GCMA 4J9OA 5H6RA 1O75A 2XGPA 4CH7A 1FC3A 1KT8A 5CVJA 2HQAA 3V7CA 4E6KG 1QA6A 2NNYA 4MGRA 1E3OC 3HOUG 4IL6C 4FTHA 3BJ6A 3E97A 3M8EA 1YHQI 1Y39A 4DV6H 2XAFA 4DNCA 1D5VA 4JI4H 2ALZA 3T8RA 1VQ9I 4LB6B 1ETYA 2JA7G 1M0TA 1FMWA 2PMHA 1P7IA 4OIRF 5DM7F 1A0GA 2DT6A 1FP2A 2CQ7A 4C2UA 3VYUB 4D7NA 1Z6RA 1VBGA 3CCLI 1IBKH 2WBMA 1HW1A 4YIIA 2FPGB 4A3FJ 1VQOI 3DKXA 2DODA 1ZRFA 4LJZF 2V7FA 5C1OA 2K9SA 3HOXG 2VQHA 2CWEA 1FNNA 1VQ8I 5LGTA 3T9AA 3T5HA 4EEFG 3TO7A 4Y13A 1QGPA 3JREA 1BN5A 4BE2A 2C00A 1VQMI 1YJ9I 4O2BF 5HLIA 4Y33A 2IA2A 1BJAA 2VE8A 4UB6C 2DMPA 2EINH 4L0YB 4JI0H 2DI3A 2ZFWA 2NVQJ 4DV3H 3ULQB 4NUBA 4YFKF 4XKWA 4TUYF 3OMYA 4HRIA 3GWZA 3Q3SA 1KQ8A 3W5OA 4FS2A 3MZ8A 2K9MA 4LMYA 5B1BH 2VE9A 3IAS2 4HNVA 4RNNA 2LOOA 5LGUA 3KFWX 4IHWA 5JI6A 2CUZA 2ZJQF 2PMUA 5EOYA 4DJAA 4IHTA 2A3SA 5CB4F 4DL6A 3RR5A 1OCCH 3BZ6A 1Y1VA 4ED3A 1IOVA 2OCCH 5KFGA 1K1QA 2F48A 1WQ2A 1F5TA 2IGKA 5DMXA 2R8JA 3G73A 1S7EA 2EA4A 4AIKA 3HKZE 4RLQA 3DLAA 4JI5H 1JHHA 5AIQA 4BH9A 3GV5B 1YX3A 5JVGF 4HSTA 4HQMA 3W1GA 1ZETA 1S7AA 2EFWA 1ZRDA 2M05A 2L9NA 1L3LA 3AG1H 4A3GG 4HAMA 2NU9B 4RM3A 3TL4X 3E6CC 2CUFA 4E7JA 1DP3A 4G8XA 2GAUA 5IP9J 4AU7A 4U6PA 2XC9A 2EQRA 3LOCA 2H94A 1EZ1A 2YW2A 1A31A 2ZB9A 1FPQA 1UHWA 1T3NA 3CJRB 2A68F 3DBLB 1EJ9A 3J80W 3H35A 3CCEI 4G7OF 1BA5A 3BCAA 4MFDA 1TWFJ 2FX0A 4YY3H 2GA1A 2Y0SN 4MEXF 4BQNA 2O6GE 4D0PA 1POGA 1T36A 2EH3A 2NVTJ 1UC9A 1DU0A 2V79A 3RQIA 3GFIA 3OS0A 4O7YA 2A07F 4IRKA 1L0OC 1V4RA 2E1OA 3MCZA 5EGOB 3LSGA 4EEQA 1SEIA 1SFXA 4LIUA 1CKNB 3ZCOA 3V8LA 3QQMA 3LL7A 4F52A 5D8LB 5EZYF 4ZYAA 3T5JA 4OWRB 2ZMEB 3E0JB 3KYHC 2IW5A 5HDKA 2A6EF 2UZKA 1I1MA 5B5EC 1KGSA 2JEFA 4A93G 4RAFA 2DU9A 1IRZA 4RUCA 2ID3A 3ML6A 3RPUD 2EFQA 2E2HJ 4PCQA 5DD4A 1ZARA 4WX9A 4R79A 1DP7P 4ZHQF 4LIVA 2R93A 1NH3A 4ECSA 2B9SA 2VBWA 5BPFA 4KT5C 4XLHA 5A2QW 3OOPA 2XV4S 3OV8A 2VBYA 3LA7A 2HOSA 4IHYA 3U0GA 5LOVF 1XCVA 2ZMEC 4B3TH 4PSWA 4ZZDA 1RUOA 4MO7A 3BR0A 5I47A 2ZXWH 3I54A 2FE3A 1V51A 1IV8A 2I80A 3KEOA 2ZNZA 1U2WA 5FRMA 2NVUB 3RTRA 4BXUA 1CKNA 2WB1E 5J8FA 4FX0A 1HNXH 2KKOA 1O7LA 3ASOH 5FPOA 1T0FA 3VSLA 3KP7A 5BNGA 3I4MJ 1A0IA 1EKVA 3LFUA 2WWYA 2F5EA 4JI1H 2BYVE 1UNNC 3KZIC 1LVAA 1IAWA 4EBDA 3WO1A 1Y6IA 3U1KA 4IJAA 4OMYA 4DBRA 3KREA 2XPUA 4MLOA 4C3JJ 2YZLA 3GIIA 2W48A 5M5WJ 4BQQA 5L1JA 5HNFA 4DR3H 5DCMB 4X64H 3WWIA 4I50F 5HS9A 3PQKA 4LFBH 1T95A 1JGGA 2COMA 2HFHA 3HG9A 4CCLA 3KALA 1S9FA 1UHSA 3OYMA 3Q1KA 2A5WA 1GGOA 3CMMA 2PJRB 1Y1VG 1YFHA 3Q9VA 3WU2C 4CKEA 3QYBA 3KE2A 3REOA 3BT9A 3NGDA 4M3DA 1FVIA 3DPTA 4XSZF 4WF2A 2HQ5A 3FXMA 3PO3J 1IG7A 1K4TA 1YX5A 1K4SA 1AUXA 4XNFA 4R1HA 1E4EB 5IT3A 5HLHA 2WC2A 1J59A 2PX9A 3OIQA 4QPOA 2X1CA 1MNEA 1IN4A 2BQ3A 1RKWA 2JVHA 4FQGA 1JKPC 3TIGA 3MR2A 4U7DA 2GQSA 5KG4A 3T5KA 4N9HA 1WI3A 2FJ1A 1QHHD 5FLXZ 4YFXF 1ZAUA 3D0SA 1X3UA 1I6HJ 1I1LA 2FF4A 3I5UA 2M45A 5BWUA 2CUEA 4IEJA 1AHDP 5HLTA 3JRDA 1XB4A 3OYKA 3RGZA 1IZ1A 2KJBA 3HUGB 3BP8A 4BJ6C 3PZPA 5EDNA 4U0WA 3TEKA 4IRCA 4ZDPA 1I50J 2YZMA 2DFIA 3S1NJ 2ATLA 2ZDQA 2ETHA 2TCTA 3JAMZ 4I6ZA 2RVCA 4IR9A 1PX2A 2R7SA 4DUZH 2RGRA 4XQFA 5ILUA 3JSOA 1GLVA 2RKHA 4GXOA 3CCJI 5K7HA 5C4JJ 5F0CA 3CC2I 2W6OA 2JA7J 4LFAH 4YR2A 3M3YJ 1IRXA 2V1DA 3A0BC 4C2MA 1HSTA 1X1AA 3TGNA 2V9KA 3C1DA 1GXPA 2GXGA 1O57A 2NVYJ 2ZNYA 4KFCA 2V59A 3E5XA 3OL4A 4HDUA 4OINF 2GBYA 2JK3A 5FFXA 2JA5A 5BWWA 4BXXG 1K61A 4BNCA 1KJ8A 5K7ZA 4IXAA 2Z3YA 3HHHA 3HT5A 3GTJA 1PP8F 3PW2A 2P7CB 2LC2A 4II3A 4XYLB 2PMZE 2RDPA 2W25A 3HOXJ 4R8HA 1K1SA 5FLVA 3MFIA 3C3WA 4UUSA 4CCMA 1N34H 3FBIB 3M9NB 1MGTA 3ABTA 3W2AA 2XDVA 1TLHB 2PBIA 3NARA 3NBZB 3F3XA 3IWZA 4PZ6A 2DN0A 3PL8A 4A0XA 3H5NA 4UNOA 1TWHA 1FTZA 3T1YH 2AQFA 2R92J 4GCVA 1HCRA 3L2WA 1KONA 1LFUP 2BHYA 5E17F 3GZNB 5DQHA 2P81A 3FXUA 2NRAC 4ENKA 2R7RA 5DLGA 2MBFA 1FY7A 1P7JA 3I58A 4BJ5C 4A12A 4BE1A 2X0LA 4KIFA 1KJIA 4P9UA 4YAKB 4JV2A 4XX0B 1GV2A 2ADUA 3J7YJ 1FSHA 2HU9A 2XAGA 3V6HA 1R9TJ 1X2MA 4UHTA 4YJ2F 2DO7A 1KU7A 4EBCA 2ZKZA 2QA4I 3GTMJ 4JI2H 4ENJA 4JI8H 3FBNB 2NNNA 5FKMA 3AG2H 3OS2A 5I5WA 1SFKA 3H9GA 1DV2A 4WD3A 3GBGA 3NUAA 1S3JA 5DTDA 2DMNA 1N36H 4RAYA 4MAMA 1I27A 2FXAA 1WH5A 1XMXA 4EATA 4Y17A 3QPLA 2ZCWA 1FOYA 4O7RA 5CPRB 4S04A 4PDKA 4BY1G 3CC4I 1IXSB 2LNBA 1YRNB 4JYKA 3M8JA 4A3GJ 5EF6A 3JSPA 3LMMA 3K4LA 5BPIA 5BYAA 2R5ZB 1IUFA 2CS3A 3F6OA 3H92A 4CUGA 5D4RA 2KSWA 4ZYHA 5HODA 5DAAA 1GHCA 1HR0H 2EPFA 2I10A 3ELKA 4WXHA 4Q4DA 1V5GA 5I5SA 3ABLH 1J75A 2L7FP 3T9DA 5J3LA 3T99A 3U55A 5CYVA 3R9RA 4A3IG 3PFYA 4MA5A 2UVUA 3FZVA 3GYHX 5KFIA 2F4VH 2ZJPF 2P6TA 3AL0B 4XLAA 5IPAA 2QYZA 1V3FA 1SAXA 2DA3A 5BMZA 1M6VA 4G9YA 5EG0B 2IGOA 5HDNA 5FNVF 1IBLH 5FKOA 2OH2A 2HPIA 2W82A 2BY1A 3KHRA 4DYCA 2EIMH 2Y0SA 3CUOA 5KFQA 1MH4A 2KRCA 1I5ZA 3TINA 4J9LA 1MNDA 2X51A 1Y56A 5FKKA 1EKFA 4O83A 3AKZA 4J9MA 2UVRA 2FRHA 4PZJA 3S1QJ 1RESA 4HF1A 2FK2A 5IT9W 3FK7A 1LFPA 2FBHA 1YITI 1ZG1A 4A93J 3ETJA 3ZPLA 2VPQA 3FKIA 4X65H 3DWLE 2M5WA 2OQRA 3ECHA 3HSFA 5F04A 1U3EM 1FTTA 5K3WA 4IRDA 4CYCB 1U9OA 1IJWC 3A0HC 2PVPA 2AQEA 1W5CC 2E7XA 5GPCA 4G94A 2MH2A 3G1MA 3ZGKA 2YRWA 3BABA 1ETVA 5LD2C 2O3FA 4XRFA 1B33N 1UG2A 4O4LF 5D8KB 2UWMA 2DCEA 4JUZA 3HEFA 4RB2C 2ME6A 4ETSA 3TP3A 4B48A 1GV5A 3R0AA 1SEUA 1A3GA 3RB6A 1MBKA 1WRJA 2O7OA 3WTVC 2IVMA 1MBJA 1L2ZA 1UB9A 1WJFA 5KFYA 2DOAA 3K1NA 2D1HA 3IC7A 4HSRA 2JZYA 3CCUI 1H8AC 2HIVA 2EA2A 4O84A 3EETA 3V7SA 3HXLA 3VB2A 3GLKA 4D9JA 2VJ4A 4NB5A 1ENHA 1F43A 4EYIB 4LSXA 1V4YA 3N97A 3TY8A 5FRNA 2R4GA 3BTJA 2P6SA 2YR2A 1TP4A 2KIQA 1IXCA 1T56A 2EBIA 3RV4A 3T1HH 3AX6A 3PO2G 4IHJF 3PW7A 2L2OA 2HXIA 4IAJA 1YG2A 2R85A 3I53A 4KDPA 2VOPA 1F36A 2CYYA 3HSRA 5KAFC 1DQUA 5ILVA 3H3VK 3J7AO 5KAIC 3LP8A 2OLSA 1V54H 3KPHA 4O3MA 1M1EB 1WI9A 3CLOA 1Y1VJ 2HG8A 3VYRB 4IIJF 2E7WA 2UXXA 3RAXA 2FD5A 1T8IA 1JUPA 3DEWA 4EJUA 1UMQA 2RV8A 2WY8Q 2YWVA 3SEQA 4CC5A 4BS9A 3DAAA 2QQAA 1TWAJ 3G3ZA 1YW8A 3RKXA 5DGIA 4IWXA 2YX4A 4HF0A 2V9PA 2EFOA 1SC7A 3ETHA 4N9IA 2CUJA 4BEHB 1Q1VA 3D5RC 4DR7H 3SDBA 5F9NA 1MBHA 3AG3H 3V8KA 4R8UB 5FPRA 2F5DA 3KP4A 1FZPB 3IN5A 3U9TA 1LEAA 1BC8C 2BE5F 3KHGA 3PW0A 4KISA 1XX5A 3RV3A 2FK1A 5L1KA 3T8TA 1XGSA 3BROA 4LF4H 2Q8KA 3PW5A 3DBHB 5M3FJ 3J80K 4ENNA 1I6XA 2IP4A 4MV7A 3JRWA 3SZPA 4DAAA 5EWGA 5C3EG 3F21A 4IQJA 3HDDA 2VI6A 1DUXC 1AOYA 1TBXA 4RS8A 2W4SA 1T94A 2PFBA 2DABA 4MV6A 5J4VA 4BEHA 2Y30A 3T9EA 3MKLA 2O61A 3SI8A 1KTAA 2LY2A 1JDEA 1PDNC 3K6GA 2XKOA 4IQ4A 1WCMA 1LDDA 4M74A 1FJGH 4P96A 4IHVA 3VYTB 1MBFA 2DTRA 3LWFA 4U0VA 4V2GA 4YRVA 3TIIA 2YS9A 4LGWA 3FM3A 3ZRGA 4IHSA 3TQTA 3RF2A 1QVUA 3FK6A 3H5AA 2QEXI 4BXXJ 2W9CB 5DDGA 4RZQA 2EZKA 3DKYA 5H6QA 4ANJA 2VQFH 1BIAA 2CSOA 2VXZA 3K1MA 2R6FA 3MWDA 2XSJC 3H20A 4O3NA 3IKVA 1CKMA 5A2QK 4PSXA 3SE7A 1AKHB 1F9NA 4A3CJ 4D1QA 3BZCA 3Q5FA 3S14J 1MW7A 2VT3A 2GQQA 2OWOA 4A3DJ 1MMGA 4L9VA 1X1PA 1X1BA 4V2FA 4H4KC 4B4CA 1VQ5I 4E7KA 3UZBA 4FBTA 2XAUA 2ISZA 2Z2SB 5D5XB 2DOEA 2PEXA 4A2UA 5ED4A 3W1BA 4Y52J 1D0ZA 3HOYJ 2JUGA 1N33H 3KHLA 1QRYA 5KFUA 3RIRA 2FLLA 4M9XA 4QWEA 2ZDGA 4KMUX 4FFOA 2XGXA 2L02A 2L7MP 4LH7A 3N43B 1HW5A 2EB7A 3KZZA 5D5UB 5IP9G 1R00A 3BG5A 1QHGA 4EG0A 3QRFF 5D1OA 3G6YA 2KIFA 3BA8A 1EH8A 1XCBA 4G7ZF 1UHMA 2LKSA 2DFEA 1W7PA 4G6TB 1Z9CA 2VONA 2L4AA 4AIHA 3HHGA 4PJJA 1K78A 3RKWA 1GSAA 3TMOA 1JT6A 1BI0A 1W4MA 5M5XJ 4IX7A 1H9TA 3DU6A 3TW6A 2W70A 4LK0F 5HBRB 5DQIA 2UU9H 2LMDA 4L5JA 4KHPH 5KFAA 2WTEA 1B6AA 1E3PA 1G59A 3QFFA 2W57A 1IW7F 2OD5A 3GIMA 1Y1WA 1O3TA 2HVQA 2R7OA 5E3NA 3OYHA 3RKQA 5KG1A 5KFJA 2I5UA 3Q8QB 5EZHA 3TY5A 2DK5A 2ZJTA 4A3IJ 2FU4A 1XGMA 3PNTA 1B8IB 3GV8B 2QSFX 4P9FA 4W1UA 3WODF 4EM2A 1T39A 1Y0NA 4LG0B 3I0TA 5F0FA 3S8PA 1I6UA 1TWCJ 2R7ZA 1ODDA 1B72B 1R1TA 1IYDA 3ZQFA 3JSLA 1TQPA 5LFAA 4ED6A 4FE4A 4EMSA 2R8KA 2MC3A 1ZQ3P 2DA1A 3DP7A 4EGQA 5KT6A 2MD5A 3H40A 4A5MA 2YYAA 4GO1A 4P5OA 4BJTA 2R8GA 4M9ZA 3GIKA 4CCOA 2EK5A 2E1NA 4DR2H 1JJ8C 1BXRA 3KAJA 4YAJB 2PJPA 5KG5A 2E2IA 4QWDA 2UVWA 1XSVA 2KDOA 4ESJA 2LKXA 3V8JA 3I4MG 5F08A 5KFEA 1FT9A 5LYJF 4F4XA 2VPRA 1KU3A 5FFZA 2QBYB 1MSEC 5KFKA 2X85A 1X58A 3CMEI 3GJXB 4YIRX 3KEYA 1ORKA 4ZDLA 3H4DA 1HC8A 5IYDJ 5M5YJ 1DGWY 3M07A 3FMSA 3PSFA 2VOOA 2XGQA 4GYGA 4BDYA 2JA2A 1VQ6I 4E6NA 2BV6A 5LA6F 3GZ5A 1HNZH 4C3IJ 4ZH4F 3IH4A 3DKWA 3M9MB 1HKQA 3ZQHA 4WBNF 4GKKH 3OR1C 5DV5A 3RTXA 4B3MH 2ZJ2A 2X4HA 3PO3G 3L2CA 2STWA 4UCSA 1S0NA 2QBYA 4BUPA 1X4OA 3PO2J 4UCOA 3OTOH 3J7AY 4ECZA 4EM0B 4O4IF 2XC7A 5KG7A 3G6XA 3N44B 5FLXW 2QQ9A 5KT7A 3VFZA 1KEEA 2R7TA 3IH2A 3GTQA 2ZSIB 4BY7G 3ZQIA 5LLQA 2GWRA 4A5NA 4E4TA 1S9HA 5JVLA 5E79C 4ABZA 3E5NA 3CJQB 1X9NA 3BR5A 2Q0OA 2E35A 4ZDOA 3ZMTA 1P9QC 4NQWA 1ETOA 2FQ4A 4J01A 2LKPA 2VASA 1YS6A 3L2VA 1BIBA 3I3LA 2R7WA 1D0XA 4E7LA 4DIQA 1WPKA 3JAMW 4BWSC 2K86A 3RSNA 2NU7B 2YZGA 3CLQA 3DF7A 2G9WA 2QWWA 2VC0A 1BR4A 3KXYT 4M72A 5L3BA 4Q8EA 1ZTRA 3B6CA 1MMDA 1ZRCA 1UAAA 2RGVA 1IDZA 3Q0UA 2E2JJ 1CE8A 1WHUA 4RBOA 2UVVA 4RAGA 5EEHA 3F0CA 1D0YA 3R5FA 3R5XA 4HF2A 3KP6A 2X48A 4B43A 1R4MB 1VAJA 4F92B 4OAZA 2MLGA 1FIAA 3QWUA 2J6TA 2DXIA 4PGHA 1XDSA 2EWNA 3FMRA 5C3EJ 3R6SA 2CFMA 2VUGA 4FFPA 2AXTC 2E1MB 3SNOA 1WGXA 1Z7LA 3H3UA 1N78A 3FDSA 3OSPA 3J7ZI 1WZ2A 2GZWA 1OQYA 3M4OJ 2DA6A 3F8BA 1EH6A 3G6EI 1YW7A 3JRAA 2AO9A 1U78A 5J1YA 2EZIA 3F72A 2JEJA 2XIGA 2P8TA 4XL9A 2DDBA 3OYIA 5CA1F 3OHBA 3MVPA 2R92G 2X9DA 3GTPJ 4JV0A 2E1MC 1XG1A 5IT9K 5FGMA 2PG4A 2CKZB 2IP2A 4TVIA 5KFRA 2OZ6A 2R7QA 4ECYA 3CCYA 3F23A 5E1XA 1TA8A 2XKPA 3EYIA 5KFOA 4QTRA 3OIPA 2Y0SE 4WK8F 5FB2A 3IRRA 2HQRA 3BG7A 3KP3A 4UV9A 3KYLA 4M9UA 4RNMA 1VQLI 3L2PA 1R58A 5I5UA 1I3QA 4ZYDA 3JZFA 2DYRH 2ELHA 5FKLA 1T38A 3NC0B 3IHUA 2K85A
chains in the Genus database with same CATH topology
4PK4A 1WJ5A 3IP4B 1G8XA 2UUBH 4AYBA 2XF7A 2R7SA 4DUZH 2RGRA 2Q2EB 4XQFA 4JI7H 2FUG2 4E7HA 2OV7A 3PJRA 4XMYA 3NWSA 3MMYB 2VKDA 4R7RA 3BC8A 4JI0H 4LFAH 2UUAH 1IRXA 1LDKB 2R7XA 4BQOA 3N05A 5KHDA 1XDNA 1X1AA 4UCVA 2V9KA 1W36C 2IS4A 3OL4A 2V4JC 3HL2A 3HPHA 2UXBH 2BVMA 3NBYB 4XLFA 1XMOH 4NC8A 5DISC 1WJDA 3FDYA 2RREA 2LC2A 4II3A 2VJ5A 3DQVC 2MABA 4J0MA 3H5RA 2X6YA 3CZ6A 2QKMB 4B44A 1VZ0A 1VS0A 4CCMA 3OYFA 1N34H 3FBIB 2ZXHA 2F6CA 2Z16A 3G2BA 3H9QA 1MMAA 2F5VA 2XDVA 3W2AA 3NBZB 2VJIA 3L4JA 4PZ6A 4NQWB 3PL8A 3H5NA 3T1YH 3OR2C 1U0JA 2AQFA 3KX2A 1I94H 4HNUA 4HNTA 3L2WA 1KONA 2LBFA 5TGTA 3HOSA 2CV1A 3MKWB 5LMUH 1J09A 2R7VA 3S93A 1IBMH 2R7RA 3AFHA 4BJ5C 4C9YA 4BE1A 2YCHA 3OYAA 1WJEA 4KJZA 4YEJA 2CV0A 1BGWA 2LY1A 4XM3A 2HU9A 2WB1A 1JI8A 1X4PA 2F4IA 4NXMH 2UXCH 1XNRH 5FD5A 2KLOA 4DR5H 3W2WA 3OYLA 4HEA2 2HIXA 5HNHA 4DV1H 4JI2H 3BA9A 4LSAA 3MKYB 4JI8H 3FBNB 1HNWH 3OS2A 2P0WA 1SFKA 2MYSA 3H9GA 2WA0A 1T0FC 3EUHC 2VJJA 3GBGA 1UG0A 4XKBA 4CZCA 3N42B 4II2A 1N36H 4RAYA 3K3VA 3K4CA 3L2QA 4BE0A 4EATA 1E4GT 3DTKA 4NNJA 4XORA 4F91B 4DV5H 1EA3A 5CPRB 4BGDA 4PDBA 3OYDA 2JSPA 2VB6A 2CV2A 3M8JA 5JHFA 1CKOA 3QYEA 3LMMA 3K4LA 4OX9H 1YE9A 2CS3A 4CUGA 2KSWA 1NG7A 2LH9A 1HR0H 3K4JA 2KZVA 4EQ5A 2WDTA 1V5GA 1X1CA 3V42A 4YELA 4BU2A 4N4OB 3DTIA 3PFYA 4J00A 3H9JA 3OWTA 3W2VA 3IG0A 1TT0A 1X1DA 4JOMA 4JQFA 3PNVA 3DU5A 4Q0YA 4LF6H 1XNQH 2F4VH 3AL0B 4XLAA 4PFPA 3U21A 3CF2A 4B3SH 3LSKA 2WY7Q 3A2KA 4UCRA 2Z1DA 2IGOA 2VXDA 4NC7A 2A6TA 2E60A 3BLYA 4XLCA 4ZTFA 1IBLH 3C2GA 4LF7H 2BW3A 4FASD 2HPIA 2L9SA 3S3NA 2W82A 1E4FT 3J7AK 1Z3XA 4DRFA 2Y0SA 2KRCA 3FHNA 1MNDA 2X51A 1Y56A 1BOBA 3AKZA 4DV0H 3A4CA 4F3QA 2KL4A 2E5LH 3QODA 3UNGC 1XK5A 5IT9W 1BR1A 1LFPA 5KCMA 4X65H 4RLFA 4XOPA 3DWLE 2M3AA 4NXNH 4U87A 1XMQH 4AQYH 1AN7A 2OC6A 1D1AA 2AQEA 4GRIA 2X6XA 4LITA 3ZGKA 3BABA 4PJLA 5LD2C 4XN3A 5HOOA 4PZ7A 1Z2PX 2VQCA 2UWMA 2DCEA 4RB2C 2HZDA 3UR3C 2LREA 3VYSB 4DBQA 4ETSA 4B48A 3OYJA 4XKCA 4B3RH 4ZC3A 3OS1A 4IZZA 1L2ZA 1MZBA 1WJFA 2HNHA 2DOAA 1Z2NX 4ZTJA 4X62H 4HSRA 4XOTA 2HIVA 3A1YA 4DR4H 3HXLA 5CQEA 4D9JA 2VJ4A 1R6RA 2PMZA 2I8DA 3GDEA 2VPSA 4LSXA 3LSIA 1OLTA 5FRNA 3TY8A 2R4GA 1N75A 4CCKA 4EFBA 2VQEH 4GLXA 2Q2UA 3T1HH 2LBFB 4UCUA 3FMAA 3HC7A 2HDWA 2L2OA 3RQ4A 4IAJA 2KRHA 3N41B 2ELJA 4CSWA 2IS1A 1GYFA 4DGWB 3PN1A 4JI6H 1DQUA 1WJCA 3VSKA 1MMNA 3IUOA 5CQGA 2IGMA 3VYRB 4PJNA 2WY8Q 3K10A 3SEQA 4LH6A 4CC5A 4BS9A 3BG6A 3BCBA 5LMNH 3K4KA 1V5FA 4IKFA 4EFEA 2WAFA 2UUCH 3CP8A 4N4NB 1B04A 1FKAH 4UFZA 2HVRA 2LRDA 2CUJA 4BEHB 4LF5H 4K0KH 4XN0A 1WFXA 3D5RC 4DR7H 4XR6A 3SDBA 2JVGA 3F8NA 3K70D 2IS6A 5FPRA 3NWTA 3EUAA 2W7NA 2UXDH 4ITVA 5KNLA 3OL3A 1TAEA 4KISA 3M4IA 2BVLA 1D1CA 2WE6A 1X19A 3CP2A 4LF4H 1QU3A 4BDZA 4MV7A 4IQJA 2VL8A 2KMUA 3K4BA 2Q1ZB 3OYBA 2W4SA 4LF8H 5FD6A 4BEHA 3S32A 3MKZA 1ZHQA 2MC4A 2BW3B 3D5LA 4B47A 2VOBA 2KHMA 2LY2A 3K6GA 3OYCA 4CCJA 3OOUA 4IQ4A 3ZQQA 1FJGH 2LYCA 2IGNA 4HPQA 3VYTB 4DUYH 3EYYA 2K3PA 4YRVA 4QPQA 3ZRGA 3RF2A 3H5AA 4E4HA 5D1PA 3QOEA 4RZQA 1ZELA 4BXFA 3DKYA 2XF6A 1D1BA 4ANJA 4CCNA 2VXZA 2VQFH 4P1WA 2XSJC 4PZ8A 4FETA 3H20A 2LG4A 1CKMA 2OUMA 3OYNA 4PSXA 4DOZA 1M0WA 2M7BA 3VDXA 4E7ZA 2MD0A 4D1QA 2W00A 1MW7A 4UCTA 2OWOA 3LSMA 4A2AA 1MMGA 2X1DA 1O75A 4CH7A 2L5QA 1Z3YA 2V6EA 1X1BA 4H4KC 3KAKA 2HQAA 4E6KG 4E7KA 2XAUA 2Z2SB 3W1BA 3BAAA 3LMLA 4DV6H 3I9V2 1D0ZA 2JUGA 4HG2A 1N33H 4JI4H 3VWBA 4DV7H 1M0TA 1FMWA 3S3MA 2WAEA 2DT6A 2VIXA 4C2TA 4C2UA 4PUSA 3VYUB 1IBKH 4LH7A 3N43B 2WBMA 2XF5A 1J5EH 2GOMA 1QHGA 2HGSA 5D1OA 3DKXA 3ONQA 3D5SC 3BA8A 3CESA 3DTEA 2V7FA 3E1SA 4LG3A 4G6TB 4PFOA 4YHHH 2VQHA 4PJJA 3TMOA 3ZR8X 4IX7A 4GKKH 1LVKA 2UV1A 3DU6A 4BE2A 3RJ0A 2UU9H 4LFCH 4MTDA 4KT6A 4M7EA 4KHPH 4Y33A 5HVQC 3VNNA 1G59A 3HOTA 4X66H 2W57A 4PJMA 4DV3H 3EPZA 4NUBA 2DJIA 4XKWA 3OMYA 4HRIA 2HVQA 2R7OA 4RMNA 3OYHA 3W5OA 3UQ8A 2R7UA 2K9MA 1WH2A 4LMYA 2M7AA 2M4GA 3IAS2 3TY5A 2ZJTA 2LOOA 3SEZA 3S24A 2CUZA 3PNYA 3PNTA 2PJRA 5EOYA 3S8PA 4E7IA 4DJAA 1I6UA 4DV4H 4E7SA 3RR5A 4BL0B 3OYEA 3K4MA 1S03G 2ZFUA 2HPMA 3OY9A 3JSLA 3F9KA 5LFAA 2IGKA 1NG6A 2QKLB 3N40P 4RB3C 1PJRA 4AVZA 4RLQA 2UUZA 3DLAA 4C30A 4JI5H 4P5OA 4BJTA 1YX3A 3N6XA 4HSTA 4CCOA 3W1GA 1N32H 2VQGA 4FM9A 4DR2H 3DPLC 3KAJA 2L9NA 2IXSA 4RB0A 4DR6H 2Q2TA 2X6WA 2KDOA 3H0DA 4RM3A 4XLEA 3TL4X 4CA0A 4CC6A 4E7JA 2IS2A 1DP3A 2ZM6H 4AU7A 2M4KA 5LL6b 4KITB 1DGSA 2VKHA 2X85A 4LF9H 3C2HA 3CJRB 3GJXB 1LKXA 3J80W 3KEYA 4ZDLA 5FROA 3H35A 1GLNA 4MV9A 3BCAA 4YY3H 1DGWY 2ZXIA 3PSFA 2VQLA 4BQNA 4BDYA 1HA8A 1K6YA 2JA2A 4E6NA 1HNZH 3LSHA 3L2RA 3OS0A 3MWMA 2ZSHB 3SZGA 2W1OA 3RGXA 3LSGA 4EEQA 1SEIA 4LIUA 1CKNB 3OR1C 4F93B 3RTXA 4B3MH 3ZCOA 1AA7A 1OR7C 2DT7B 3LL7A 4F52A 4UCSA 1P16A 4ZYAA 5CKTA 4OWRB 2E5ZA 3E0JB 2V1NA 3KYHC 3RIZA 4GKJH 4BUPA 1X4OA 2NOJB 2CW8A 1P8LA 3J7AY 4UCOA 4RB1A 3OTOH 2XC7A 3RPUD 4DR1H 1W36D 3N44B 5FLXW 4OAYA 4R79A 1WJBA 5IWAH 2R7TA 2M0MA 2ZSIB 4LIVA 2HHHH 3DPUA 1S9HA 2CMPA 1Z2OX 1X9NA 3CJQB 4XLHA 5A2QW 3OYGA 1BJTA 2RNGA 2GOXB 2MFZA 4ZDOA 4B3TH 1P9QC 4PSWA 4J01A 4JV5H 4XKVA 1WJAA 2VASA 1V9PA 5D1OB 3L2VA 4I7HA 1FMVA 3DEEA 3I3LA 2R7WA 4ZJZA 2FE3A 1D0XA 2KP6A 3TY9A 1CKNA 5FRMA 3RTRA 4E7LA 4DIQA 4JI3H 3JAMW 1HNXH 2WADA 1V5EA 2WAQA 3RSNA 5FPOA 3VSLA 4BWSC 3W3CA 3DF7A 4DV2H 1E0EA 2KPMA 1BR4A 2CH0A 1A0IA 3FKJA 3LFUA 1SAUA 3KXYT 4JI1H 3ZXSA 2K5CA 1MMDA 3K4NA 1UAAA 2RGVA 2X1EA 1Y6IA 1ERDA 2BOLA 4DBRA 4MLOA 3SYTA 4BQQA 2O03A 5HNFA 4DR3H 1D0YA 4X64H 1N77A 3RCOA 4RM2A 4LFBH 2CW7A 3TBIA 4B43A 2WYOA 5BR8H 1T95A 4OAZA 4F92B 3HG9A 3QWUA 4CCLA 3L2UA 2DXIA 3KALA 4Y3OA 4BACA 3HPGA 3OYMA 1BR2A 2A5WA 3CMMA 3PUBA 2PJRB 1Z21A 2HVSA 3M1CA 4F55A 2RQQA 2CFMA 2VLAA 2VUGA 2E1MB 3L4KA 3QYBA 4JYAH 2L7KA 4X0GA 1S68A 1Z7LA 1FVIA 2VPLA 3DPTA 1N78A 4RAZA 2KQRA 3AL0C 1SYXB 4U7BA 3J81W 1YX5A 2E5NA 4XNFA 3EUKL 1TZLA 4APMA 3OIQA 4QPOA 3OYIA 4XL9A 2XIGA 1PYVA 1MNEA 2X1CA 2JVHA 4XONA 2E1MC 2O5RA 3HKZA 3QYFA 3CVZA 2R7QA 1QHHD 3IAM2 1ZHSA 1TA8A 2MCTA 3K70C 4A2BA 3OIPA 2V26A 3C0FB 3BG7A 5HLTA 3KYLA 3OYKA 3S3OA 2CFOA 3HUGB 3PSIA 4B3XA 4BJ6C 3JSNA 3L2PA 4MTEA 3RGZA 2K9LA 3MD2A 4ZDPA 3NC0B 4Y4RA 1UELB 3GB8B 1DGRM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XK5 A;  5D1P A;  4E6N A;  4PZ8 A;  1CKM A;  3BAB A;  4EEQ A;  4PZ7 A;  4UCT A;  2OWO A;  1XDN A;  1CKN B;  3RTX A;  4UCV A;  4UCS A;  1P16 A;  3KYH C;  3NBY B;  4UCO A;  1P8L A;  3W1B A;  3BAA A;  5DIS C;  2HIV A;  1VS0 A;  1X9N A;  3GDE A;  3NBZ B;  3TY8 A;  4PZ6 A;  4EFB A;  4LH7 A;  4GLX A;  2Q2U A;  1V9P A;  5D1O B;  4UCU A;  5D1O A;  3BA8 A;  3TY9 A;  1CKN A;  3PN1 A;  5FPO A;  1A0I A;  3VNN A;  2HIX A;  4LH6 A;  3BA9 A;  4CC5 A;  2HVQ A;  3W5O A;  3UQ8 A;  1B04 A;  3TY5 A;  3QWU A;  4UFZ A;  2HVR A;  3S24 A;  2HVS A;  2VUG A;  2CFM A;  5FPR A;  3RR5 A;  1S68 A;  1CKO A;  1FVI A;  3JSL A;  1TAE A;  4EQ5 A;  3W1G A;  2Q2T A;  1TA8 A;  4UCR A;  4CC6 A;  3JSN A;  3L2P A;  4DRF A;  1DGS A;  3NC0 B;  4EFE A;  3GB8 B;  3GJX B; 
#chains in the Genus database with same CATH topology
 4PK4 A;  4QWQ A;  3V4Z A;  3WTU C;  1G8X A;  3RFC A;  3H0G G;  2UUB H;  1KC7 A;  5KT3 A;  5CVR A;  5HS8 A;  2XF7 A;  3BZK A;  1OCR H;  3E6M A;  4LK1 F;  4EM1 A;  3KP5 A;  1JKJ B;  4L1K A;  1FOW A;  2FUG 2;  4E7H A;  2HOT A;  4JI7 H;  1QO0 D;  3PJR A;  4XMY A;  1G3Y A;  2XGE A;  2P7V B;  2VKD A;  3BC8 A;  3NWS A;  4XLP F;  1KJJ A;  4HA8 A;  4M3G A;  5C5J A;  5KT4 A;  1LDK B;  3GTK A;  2E19 A;  5BS6 A;  3TO6 A;  3KEQ A;  2QCO A;  1W36 C;  2IS4 A;  2JA6 A;  2UXB H;  5CA0 F;  2BVM A;  4A3M G;  4ZZL A;  3MQ0 A;  3T9B A;  3KYD B;  4O6J A;  3Q8R B;  4TQS A;  3GV7 B;  2DLL A;  2E34 A;  2MAB A;  3JW4 A;  1WSU A;  4J0M A;  1I39 A;  5F64 A;  1FP1 D;  4CIC A;  4EGY A;  3OYF A;  3RJP A;  1R49 A;  4ME6 A;  5BYB A;  2EFN A;  2F6C A;  5L9X A;  1MMA A;  4WXC A;  1JX4 A;  1RI7 A;  4OMZ A;  3J81 Z;  1J9I A;  1LE8 A;  3HSE A;  2BXY A;  3L00 A;  3KX2 A;  3BQ2 A;  1ZR4 A;  4FGR A;  2FEZ A;  2LBF A;  5TGT A;  2CV1 A;  2FBI A;  2LD5 A;  2R7V A;  4FFN A;  3DEU A;  4GC6 A;  4QLC U;  3VPD A;  4I01 A;  4C9Y A;  2KIU A;  4CGZ A;  1FYL A;  1R7J A;  3OYA A;  5JH7 F;  4KJZ A;  4YEJ A;  4YR0 A;  2FA5 A;  2LY1 A;  2EZH A;  4DW6 A;  1SVL A;  2Z5U A;  2F4I A;  4NXM H;  2X6O A;  5FD5 A;  2KLO A;  1N25 A;  5C4X G;  1XGO A;  4HEA 2;  3SGI A;  2NAZ A;  3IKT A;  2RC4 A;  2FSW A;  5B66 C;  3BA9 A;  3MKY B;  1K83 A;  1I7N A;  4FE7 A;  5GPA A;  4ENM A;  4A3J G;  2LSO A;  2ODT X;  5T14 A;  2MYS A;  2R84 A;  4MV4 A;  4YR3 A;  1T0F C;  1WWX A;  3QZ8 A;  4QIW N;  1UG0 A;  4CZC A;  3OHA A;  4CKC A;  4II2 A;  5LEJ A;  2MLK A;  4BHP A;  2J6U A;  3K4C A;  3RYR A;  4BE0 A;  1LQ1 A;  1RYS A;  1OBD A;  2B63 A;  4CMF A;  1M7J A;  4GLW A;  1H0M A;  1BNC A;  4DV5 H;  1OCZ H;  5KFX A;  1QPM A;  4BGD A;  2HHF A;  1GVD A;  2VB6 A;  4B1R A;  1MDM A;  2CV2 A;  2BY3 A;  3WU1 B;  3SJM A;  1A35 A;  3FMQ A;  4YP3 A;  4OX9 H;  3S2W A;  1NG7 A;  2LH9 A;  1VQK I;  1LNW A;  3QU3 A;  3OSF A;  2KZV A;  1S29 A;  4S0H B;  3BJA A;  4QWA A;  4YEL A;  4G3I A;  4N4O B;  1KYZ A;  1TWG A;  1QBJ A;  4NYE A;  4O2A F;  2NU6 B;  3GFJ A;  3H9J A;  3K9T A;  3SHF A;  5L3E A;  2K9Q A;  5E8I A;  3IG0 A;  1TT0 A;  4IHX A;  4Q0Y A;  2QSH X;  1S5L C;  1O3Q A;  2XD4 A;  2Z02 A;  3U21 A;  4PFP A;  4B3S H;  1SFO A;  5B1A H;  2GXB A;  1ZLK A;  2WY7 Q;  3A2K A;  2Z1D A;  1OMI A;  2HKO A;  1W0U A;  1S0M A;  4LF7 H;  3CTA A;  1Z05 A;  3C2G A;  4A0Y A;  2SCU B;  4FAS D;  3S3N A;  4J9K A;  4EEY A;  2BBY A;  1VQ4 I;  2ASL A;  1D8J A;  3HTS B;  1Z3X A;  4I2O A;  2OTL I;  4HOB A;  1LJ9 A;  2VBX A;  1DIK A;  4DV0 H;  3A4C A;  4DL4 A;  3O8G A;  2E5L H;  3QOD A;  2WV1 A;  1RUN A;  5KCM A;  3JRI A;  4TV7 A;  4RLF A;  4XOP A;  3QU6 A;  2M3A A;  3CDI A;  4NXN H;  2G7H A;  4U87 A;  4OOI A;  1XMQ H;  4EBE A;  3PM1 A;  2I87 A;  5EDW A;  4BY7 J;  4I4T F;  4K2E A;  5HOO A;  4PZ7 A;  3R60 A;  2FOW A;  1Z2P X;  2VQC A;  2ME0 A;  4A69 C;  4HBL A;  1XDU A;  3FX3 A;  2LRE A;  4KIC A;  3UR3 C;  1A9X A;  3N4M A;  1ZQ7 A;  4XKC A;  2D1V A;  1HKT A;  4LLN A;  2B7E A;  1VQP I;  5KG6 A;  3OS1 A;  4IZZ A;  4B3R H;  3S17 J;  2RN7 A;  1ITY A;  1SAN A;  2HNH A;  5LHH A;  1Z2N X;  1RK6 A;  3ECO A;  3QPS A;  2YU9 J;  2OCE A;  3HOW G;  4DR4 H;  5CQE A;  4UUS B;  3JRG A;  1TT5 B;  3GDE A;  3LSI A;  1OKR A;  1OLT A;  2LP0 A;  3QPH A;  4ON0 A;  1VKZ A;  2ID6 A;  1Y1W J;  4O4H F;  1SD5 A;  1W7P D;  4XK4 A;  4G12 A;  3MWE A;  3RBD A;  2HDW A;  5IOZ A;  4RGS A;  2KRH A;  2QYO A;  4M3F A;  4QSH A;  2C35 B;  1IN7 A;  4FFR A;  4Q48 A;  3P9C A;  2HEO A;  2ZXJ A;  1WJC A;  1TQI A;  1JTX A;  2K4B A;  2R7Z J;  1HF0 A;  3VPC A;  1R36 A;  3LSR A;  2OJE D;  4AUX A;  1IXR C;  3H1C A;  2R93 G;  3ASN H;  5DUK A;  3TO9 A;  1OPC A;  1ZH5 A;  3RYP A;  1YQA A;  4LH6 A;  2HXO A;  2WAQ N;  5E25 A;  5LMN H;  4A3C G;  2P0A A;  4HDV A;  3HM5 A;  1U8B A;  1O3R A;  1V5F A;  3MEX A;  1HDP A;  4M6X A;  1YTY A;  2WAF A;  2CGP A;  2Q7D A;  5KFZ A;  4A0Z A;  4A3D G;  2FBK A;  4N4N B;  4FCY A;  1B04 A;  1VI0 A;  2QEN A;  4ASN A;  4FHT A;  3I12 A;  4RZR A;  5JQG F;  1K79 A;  3HRU A;  1HQC A;  5ERI A;  2J5O A;  3CUQ C;  3GFL A;  3HOY G;  3F8N A;  3EUA A;  3L09 A;  1Z67 A;  4HYE A;  3ZQ7 A;  1GSH A;  5KK1 A;  3Q2O A;  5LGN A;  3GTO A;  2R82 A;  1A6I A;  2BVL A;  3DF8 A;  2WE6 A;  2NU8 B;  4HX4 A;  4LLG F;  3CUQ A;  3GTG A;  1C0W A;  1QU3 A;  3BG3 A;  2W6Z A;  2FK3 A;  2XPV A;  3O3K A;  1NHA A;  3P5J A;  3PFI A;  2Z33 A;  5DGA A;  3R0J A;  4DQ2 A;  2ESN A;  3S16 J;  3ORR A;  2E71 A;  3WTY C;  3H0G J;  4XBF A;  5CM0 A;  3K4B A;  5KVR A;  4HLX A;  3V6J A;  3OYB A;  5KFF A;  1P92 A;  5FD6 A;  2ZGI A;  3LQS A;  1YJW I;  2DWC A;  2W9B A;  2KHM A;  5E3O A;  3WTS C;  3U1D A;  3E6B A;  4ECT A;  4O3Q A;  4BAY A;  5FO5 A;  3ZQQ A;  1FJL A;  2XB0 X;  5I5Y A;  2IGN A;  3VA7 A;  4DUY H;  5D5V B;  4QPQ A;  1GSO A;  5KFS A;  2EJR A;  3TDU C;  4YIF A;  4A3M J;  5FLX K;  2H1L A;  3QOE A;  4QW8 A;  1EH7 A;  2XF6 A;  4BYY A;  4CCN A;  1B59 A;  4GFB A;  4AYB N;  3GTQ J;  5GAD J;  2CNU A;  1VQ7 I;  3SFI A;  4RCN A;  3U54 A;  4FET A;  2LG4 A;  3PQJ A;  5BPD A;  2LF8 A;  5D5W B;  2M7B A;  3VDX A;  2X5R A;  2MD0 A;  1EKE A;  2W00 A;  4NZM A;  5DGH A;  2OBP A;  1J5Y A;  1E17 A;  3JRB A;  5FJ8 G;  1GT0 C;  3BAC A;  1PVE A;  4O5V A;  1Z3Y A;  4GYI A;  4XSX F;  2L0K A;  4UVB A;  3SDG A;  3CCR I;  4M9S A;  2LF7 A;  2VUM A;  2YZN A;  4AC0 A;  3LML A;  3JAM K;  4O3R A;  2PN6 A;  4NLG A;  5LEK A;  1BC7 C;  1GDT A;  4DV7 H;  2HGX A;  2HTJ A;  5IYB G;  4L5E A;  2WAE A;  1ZG3 A;  3I71 A;  3JCU C;  5HLG A;  4RA2 A;  2VIX A;  1YO5 C;  4C2T A;  2W85 A;  4PUS A;  1EHI A;  4FS1 A;  5C4X J;  2JA8 G;  3M8F A;  2EIL H;  4RDU A;  3W6J B;  1JHF A;  1J5E H;  1QPI A;  2GOM A;  2ZDH A;  5JVD F;  4J9Q A;  3ONQ A;  4XRS A;  3D5S C;  2C2D A;  4A3J J;  3DTE A;  3ZOB A;  2JA5 G;  4LG3 A;  4PFO A;  4CDG A;  2GIV A;  2HYF A;  2HS5 A;  4M6Y A;  3TQ1 A;  1H89 C;  5IYD G;  1LVK A;  2UV1 A;  3RJ0 A;  4OIQ F;  2GA2 A;  2PBZ A;  3LUL A;  5E1Z B;  4TV8 F;  1R22 A;  2BQR A;  5IY5 H;  4QIW A;  3VNN A;  4PJM A;  3G1O A;  1XPX A;  3EPZ A;  4PGG A;  2DJI A;  1W5T A;  3FIW A;  5CJ9 A;  1MKM A;  1XS9 A;  2DJN A;  3UQ8 A;  2R7U A;  4L9T A;  4HQE A;  2R7N A;  1WH2 A;  4F50 A;  1FIP A;  2HDD A;  1BI2 A;  3U9G A;  2M4G A;  2DBB A;  1R5G A;  3GZ6 A;  1RK5 A;  5L1I A;  3JR9 A;  1LFB A;  2LDU A;  3SEZ A;  1LPQ A;  2JSC A;  4NHJ A;  2A61 A;  2JT1 A;  3ZMV A;  3RZO J;  1W96 A;  1BW5 A;  4MEY F;  4UUV A;  1XD7 A;  4M3B A;  1WSC A;  5KFW A;  1T33 A;  1P2F A;  4E7S A;  4LOC A;  1OYI A;  2PN1 A;  3FXR A;  2I8C A;  3BTC A;  3K4M A;  2RQP A;  1S03 G;  2ZFU A;  2HPM A;  3OY9 A;  2EIJ H;  1MJA A;  2O0Y A;  1I3Q J;  1NG6 A;  3I4P A;  3JRX A;  4L9N A;  1GO3 E;  5L3C A;  4KN7 X;  4AVZ A;  2HJW A;  4BHB A;  1JDB B;  5L3F A;  1RR7 A;  2UUZ A;  3WTT C;  4C30 A;  4O7Z A;  4DZJ A;  5BOX A;  5C1P A;  1B4A A;  1ZHF A;  2C6Y A;  3N6X A;  5DEQ A;  3QP6 A;  4AD9 A;  3CD6 I;  3DPL C;  1QVT A;  3JTH A;  5JUM A;  2P5V A;  2V6C A;  3WTW C;  3H0D A;  4CA0 A;  4CC6 A;  4J9R A;  2DA2 A;  5F9L A;  2HKX A;  4UXN A;  3CEB A;  2IMW P;  2ZM6 H;  4EGZ A;  1S10 A;  1CF7 A;  5LL6 b;  1A48 A;  5I60 A;  1Y14 B;  1XC5 A;  1JKO C;  2VKH A;  2Y69 H;  1W0T A;  3C2H A;  3E7L A;  4RGR A;  4O4J F;  4CKB A;  2M9H A;  3H36 A;  3P7N A;  1LKX A;  2OU2 A;  2XGC A;  3ABK H;  3T0Y A;  1O4X A;  4HX8 A;  5J4Y A;  1GLN A;  3RPU A;  4MV9 A;  1J7K A;  2ZXI A;  1QZE A;  2LTP A;  2Q2E A;  2V4Q A;  4U7C A;  3BPV A;  5K7F A;  1RJP A;  2JRM A;  3L2R A;  1A5J A;  1IV6 A;  3MWM A;  3HOW J;  2ZSH B;  4MA0 A;  3GME A;  1PUF B;  4A3B G;  2GXA A;  3A02 A;  5J1R A;  3GFM A;  3IL2 A;  4F93 B;  1IGN A;  1X3Z B;  5CVV A;  2DT7 B;  4PBC A;  2E2H A;  2D2W A;  1P16 A;  3RIZ A;  4NZN A;  3RB4 A;  2V1N A;  4FFL A;  1I7L A;  2CW8 A;  4EJO A;  4GGG A;  1P8L A;  5KFT A;  5F6F A;  2Y75 A;  3BOQ A;  1W36 D;  3K3P A;  5BQT A;  4HQ6 A;  5IWA H;  3FKI G;  3ZP5 A;  3ESW B;  3ZMZ A;  4YQW A;  2HHH H;  2FMY A;  4IOA F;  4HZF A;  5HV6 A;  1Z2O X;  1WH7 A;  4Q43 A;  4OIP F;  2Z9O A;  1BJT A;  2DOF A;  2GOX B;  2JPB A;  2MFZ A;  1K83 J;  4MHG A;  3O2P E;  2R93 J;  3LNQ A;  5KG2 A;  4XRS G;  3OSN A;  4XKV A;  1WJA A;  1V9P A;  5D1O B;  5D6F A;  4RU9 A;  1ETK A;  2P5L C;  1PUF A;  3DEE A;  3WNZ A;  1GVJ A;  3IWF A;  4ZJZ A;  5DS9 A;  4IRI A;  2VN2 A;  3TY9 A;  4ED0 A;  2B63 J;  1W7P B;  1K78 B;  4F4Y A;  1IO2 A;  2CFX A;  2RAE A;  3Q9S A;  4JI3 H;  1V5E A;  2DA5 A;  1YS7 A;  2BHZ A;  2WAQ A;  3EUH A;  3W3C A;  2P4W A;  3WE3 A;  3M9A A;  1MNM C;  4DV2 H;  2IBK A;  5GTH C;  2KPM A;  3PIO F;  4ZYG A;  3FKJ A;  3JTG A;  1FEX A;  1P6R A;  3ABM H;  1VBH A;  1IN6 A;  4XID A;  1CS0 A;  2HQN A;  2X1E A;  5ICF A;  2BOL A;  2R7L A;  3BQ0 A;  1DAA A;  2KIS A;  1BOA A;  4FE2 A;  2ESH A;  1SCU B;  2HTS A;  4KYW A;  3BR3 A;  1TWG J;  3QPT A;  3RCO A;  4RM2 A;  1N77 A;  5BR8 H;  2LLK A;  2HGW A;  3WHB A;  3GIL A;  2AGQ A;  4EQQ A;  3L2U A;  4Y3O A;  1BR2 A;  1V55 H;  3FHZ A;  3PUB A;  1SFO J;  5I5V A;  3B73 A;  1Z21 A;  4F55 A;  2FNA A;  2RQQ A;  5DUI A;  2Z04 A;  4JYA H;  2L7K A;  3ABU A;  1S68 A;  3S15 J;  1B6R A;  2ELK A;  4NZO A;  4QWB A;  5ICE A;  2V9V A;  2KQR A;  2QM3 A;  2JJ7 A;  5DLF A;  4IPA A;  4MQ9 F;  4U7B A;  5KT5 A;  1W5S A;  2E5N A;  4KUM A;  3J81 W;  3EUK L;  1JGS A;  4A3K G;  1USS A;  4B3A A;  1WRV A;  4M73 A;  4AID A;  3FXJ A;  4P55 A;  4XON A;  2O5R A;  3QYF A;  4RGU A;  1VTN C;  2YX7 A;  4DYR A;  2M34 A;  3S1R J;  1ZAO A;  1Y8R B;  2IA1 A;  1FBQ A;  3K0L A;  2MCT A;  5DYM A;  2GPW A;  4LFU A;  1YOV B;  2BZT A;  2DLN A;  3HOV G;  1R4N B;  4IWY A;  4DL5 A;  2Z99 A;  4AWX B;  1RZ4 A;  2ICW G;  2IT0 A;  3HRM A;  3RUP A;  2DA4 A;  3VMM A;  3S3O A;  2CJJ A;  1IF1 A;  3PSI A;  5K5O A;  5L1L A;  1XGN A;  2C22 A;  2YU3 A;  3EQL F;  4Y8V B;  3F8C A;  1XMK A;  2K9L A;  4AYB A;  2A5Y B;  4Y4R A;  4EFE A;  1DGR M;  1OJL A;  5FJ8 J;  4CE5 A;  1EV7 A;  3IP4 B;  1BL0 A;  3GTL A;  3LAJ A;  3QAH A;  3DLL F;  3TED A;  4L0Z B;  4MV1 A;  1Z91 A;  3RDI A;  2Y9Z A;  2FOK A;  3SXY A;  3MMY B;  4R7R A;  2H6B A;  1E3H A;  2DZD A;  2CQN A;  1I1S A;  5IYB J;  2R7X A;  4BQO A;  4FFM A;  3GVA A;  1XDN A;  4UCV A;  4JX4 A;  3BDD A;  5KKN B;  3LQR A;  3OUU A;  3BQZ A;  2JA8 J;  2O8X A;  1HKS A;  3NAU A;  5CVI A;  1WCM G;  3HPH A;  1G3T A;  4C2M J;  1W93 A;  3WWH A;  3NBY B;  4HYK A;  1ZK8 A;  1TC3 C;  4O3P A;  3MAJ A;  1XMO H;  3FDY A;  3ZQC A;  2K7L A;  1WR2 A;  2JA5 J;  4EGJ A;  3CCM I;  3DTG A;  1KYW A;  4JK1 X;  1T2K A;  2X6Y A;  2YS7 A;  1TTY A;  3WO0 A;  5AIP A;  4I99 C;  3GTJ J;  1VS0 A;  4IRG A;  3UFX B;  1E2X A;  3NRV A;  3I4N J;  2F5C A;  2Z16 A;  5KX5 F;  3CJT B;  2F5V A;  4GDF A;  1R1V A;  1B1B A;  1UJ8 A;  2EV5 A;  2EFP A;  4NQW B;  3MJF A;  2EV0 A;  2M2E A;  1BI1 A;  1U0J A;  1I94 H;  2BGC A;  2HYJ A;  1LEB A;  1KA8 A;  3HOS A;  2WV0 A;  4I0B A;  3MKW B;  5LMU H;  1TWH J;  3BY6 A;  3HGG A;  3S93 A;  2EZL A;  3ZMU A;  1IBM H;  2R0Q C;  3AFH A;  1R9T A;  2YCH A;  4M71 A;  4KNY A;  1WJE A;  2CV0 A;  4LD5 A;  3Q0V A;  5BMV F;  3GTM A;  1T6S A;  4ZI7 F;  1X4P A;  3B6A A;  1BM9 A;  2ZJR F;  5KFM A;  2UXC H;  2W84 A;  4O7T A;  2IBD A;  3GTO J;  2QQ8 A;  3OYL A;  2HIX A;  5CR5 A;  3TOA A;  4DV1 H;  2VA3 A;  1VQN I;  4FBU A;  3A01 A;  2ZC2 A;  1OFC X;  1HNW H;  4O7L A;  2P0W A;  3GTG J;  2JN6 A;  3I59 A;  2WA0 A;  4XKB A;  2KZG A;  2BY2 A;  2VJJ A;  3T1B A;  5M3M J;  4LB5 A;  1IYE A;  3V4S A;  3N42 B;  3K3V A;  5L3D A;  4ESB A;  5J2U F;  3SFZ A;  2KDZ A;  3BG9 A;  1E4G T;  3C2B A;  2VOD A;  3DTK A;  3T7A A;  4N0B A;  2HI3 A;  4ECQ A;  3OYD A;  2JSP A;  4Q47 A;  4ECU A;  2JPC A;  4HX7 A;  3L9F A;  3QYE A;  1PK8 A;  2OZU A;  1YE9 A;  3FXK A;  3K4J A;  2H6C A;  4ECW A;  3SZT A;  2MG4 A;  4DZP A;  2WDT A;  5KFD A;  1X1C A;  2Y31 A;  1Y1W G;  1OYY A;  1G3W A;  2M0C A;  3HRT A;  4J00 A;  3PVX A;  3OWT A;  3W2V A;  1EUC B;  1X1D A;  4JOM A;  1I2K A;  1XNQ H;  3PNV A;  1Y0U A;  1RJR A;  1BI3 A;  2C2R A;  2ECC A;  2W6P A;  5JR3 A;  1ETW A;  1S7O A;  3CF2 A;  1IOW A;  1MD0 A;  3LSK A;  3CCQ I;  3ZMS A;  3S2D J;  2OAZ A;  3A03 A;  2VXD A;  2R7Z G;  2A6T A;  3BLY A;  1JTY A;  4XLC A;  4A6E A;  4ZTF A;  2BW3 A;  2L9S A;  3ZMD A;  4ED1 A;  1UCR A;  1R23 A;  1RR8 C;  2W7P A;  3COA C;  2VC1 A;  2DPJ A;  1W1W E;  4A3B J;  1C30 A;  3FHN A;  2DPD A;  4MV8 A;  4FX4 A;  2ASJ A;  4B09 A;  3GLL A;  3T5L A;  1B9N A;  4H0E A;  2VUM J;  3LA3 A;  1TW2 A;  2KIM A;  1XK5 A;  4I02 A;  3GLX A;  2A05 A;  3G71 I;  5KFP A;  2W9A A;  3NQO A;  4O3O A;  1BW6 A;  2V58 A;  4TQR A;  2NOG A;  4JXU A;  3G4S I;  3LSP A;  1Z1D A;  3G8C A;  4AQY H;  1TW3 A;  3QP5 A;  1AN7 A;  4XIC A;  2OC6 A;  1D1A A;  4O7N A;  3FKI J;  5C8Y F;  2CQY A;  1UC8 A;  1RC9 A;  2D5V A;  4PJL A;  4XN3 A;  1ZRE A;  2AGO A;  4WCG A;  3OUZ A;  2CNQ A;  5F27 A;  3T9F A;  1HOM A;  2HZD A;  3VYS B;  5JVT A;  2FLN A;  3GID A;  1IN8 A;  2RDJ A;  4J19 A;  4ZC3 A;  3M9O B;  1SMT A;  2DT5 A;  3DCF A;  2EJ3 A;  3LWB A;  3F8M A;  5K5Q A;  5D8D A;  4WWC A;  2W8K A;  1ULY A;  1BJZ A;  3DTF A;  1IRG A;  3WTX C;  1JXL A;  2B0L A;  4XOT A;  3A1Y A;  3CQZ A;  3VOE A;  1HLV A;  4KIB A;  1WKM A;  3KIO A;  3LST A;  3MZY A;  1R6R A;  1T08 B;  1JIH A;  2I8D A;  2VPS A;  2K4J A;  2JQ7 A;  3R23 A;  1D3Y A;  5DCF A;  1LE8 B;  4CCK A;  5JHU A;  4EFB A;  2VQE H;  5K2M A;  4GLX A;  1OCO H;  2CW0 F;  2OPT A;  2CG4 A;  2JRT A;  2LBF B;  3FMA A;  5DG7 A;  3HC7 A;  1ULZ A;  3RQ4 A;  2Y48 A;  3I64 A;  3N41 B;  1TL8 A;  4B8X A;  3K1P A;  1S97 A;  3OSG A;  2V5A A;  4DGW B;  2DMU A;  3PN1 A;  2FPP B;  2K9N A;  5KG0 A;  4JI6 H;  4G6Q A;  4QIW E;  1JT0 A;  3VOD A;  1FWZ A;  3RBE A;  3IUO A;  3CC7 I;  5CQG A;  3QZ7 A;  3JZI A;  5C44 G;  1SFE A;  5GAH J;  3HIF A;  1TWA A;  2F2E A;  4UB8 C;  1R1U A;  2TDX A;  2K40 A;  5ICG A;  9ANT A;  1FLI A;  2DPU A;  3BCB A;  2MA3 A;  2A69 F;  2J5P A;  2QQB A;  1STZ A;  4IKF A;  3CO7 C;  4JV1 A;  1AUV A;  4A3K J;  3MZH A;  3CP8 A;  3S1M J;  1AWC A;  1FKA H;  2A1H A;  4EJV A;  3D1N I;  1DV1 A;  2A6H F;  2PQ8 A;  5BWR A;  2GQR A;  4K0K H;  2FQ3 A;  2FKL A;  1PUE E;  2JVG A;  4A6D A;  2HHF B;  3ROU A;  3K70 D;  5KT2 A;  4Z6Y A;  3L7W A;  2IS6 A;  4UV8 A;  1MDM B;  2Y2Z A;  1KJ9 A;  3NWT A;  5GON F;  2DK8 A;  3B02 A;  3KET A;  1N56 A;  3GEZ A;  5KNL A;  3OL3 A;  3HOV J;  2QF7 A;  4O3S A;  2H8W A;  2HR3 A;  5IOY A;  2X0S A;  1X19 A;  4UUG A;  4F4W A;  1KU9 A;  2BXZ A;  1U9N A;  3FF5 A;  3P9K A;  4FT8 A;  4BDZ A;  3G1L A;  1ETX A;  1G6N A;  4DL7 A;  1X2N A;  2DDA A;  2JEI A;  5KFC A;  1KJQ A;  4XZ3 B;  3Q8P B;  2VL8 A;  2KMU A;  2R7D A;  2Q1Z B;  4J9P A;  4DYQ A;  5CVU A;  3S32 A;  2NS0 A;  3HOZ J;  3H4B A;  3D5L A;  4B47 A;  3HKZ N;  2IJL A;  4ED8 A;  2VOB A;  2W71 A;  4K6N A;  3GF2 A;  1OCP A;  3OYC A;  2XUB A;  3FXO A;  4Y7N J;  5BWT A;  1ETQ A;  3M1E A;  2AU0 A;  2STT A;  3H3V H;  4HPQ A;  1R5I D;  4UUT A;  1Y8Q B;  3E5U A;  1R71 A;  2K3P A;  1WCM J;  5JLW A;  5GP9 A;  5EYR A;  3G8D A;  2DYS H;  1YYV A;  1ZEL A;  4BXF A;  4EV0 A;  4P1W A;  2H1K A;  4G6D A;  1RNL A;  4WXD A;  1SVM A;  4HN2 A;  1M0W A;  4I0A A;  5L3G A;  5EGO A;  3T9C A;  4UCT A;  4ESF A;  2VQD A;  1WVR A;  2X1D A;  2L54 A;  2HOE A;  3FWE A;  2JMW A;  2L5Q A;  2V6E A;  1IN5 A;  2CRG A;  1O3S A;  2ZME A;  4A3E J;  3KAK A;  3IH3 A;  2J9G A;  1JUM A;  3BAA A;  1MJB A;  2LK2 A;  1KUT A;  4DL3 A;  3I9V 2;  1RRJ A;  1LDJ A;  4HG2 A;  3DXJ F;  3RKY A;  2FLP A;  3VWB A;  4D5C A;  1XSD A;  5F1R A;  2ABJ A;  5KFB A;  5H80 A;  3DBR B;  2AHQ A;  3S3M A;  1JKQ C;  2BEO A;  1JUS A;  2FB9 A;  2EJ2 A;  2ACJ A;  2JEG A;  3WU0 A;  4O7V A;  5DGB A;  4I76 A;  2XF5 A;  1IC8 A;  1ZLJ A;  2NYX A;  3K2A A;  2HGS A;  5KFV A;  5IYZ F;  2WAQ E;  3CES A;  2C28 A;  3E1S A;  5E1W A;  2MW8 A;  2JA6 G;  1HBX G;  1VND A;  4YHH H;  3WG9 A;  3WHC A;  3BR6 A;  3KP2 A;  3ZR8 X;  1F1Z A;  3AAF A;  3GX4 X;  4EYH B;  4BQA A;  4HV6 A;  4KA4 A;  3OIO A;  4LFC H;  2XRL A;  5H20 A;  4KT6 A;  1OYW A;  5F1J A;  4MTD A;  1MH3 A;  4M7E A;  4YBZ B;  5HVQ C;  1XTA A;  1ONV A;  4KN4 X;  3PIP F;  2DAO A;  2M8E A;  3HOT A;  5D4S A;  1JXS A;  4X66 H;  3J81 K;  1ET0 A;  2QB5 A;  2XCL A;  4Q44 A;  1A6Q A;  5GAG J;  2O9L A;  5DCM A;  4RMN A;  2WB1 N;  5I5T A;  3ERM A;  1NTC A;  4QJF A;  3G6V A;  2M7A A;  1IRF A;  2DFH A;  3ORQ A;  5LXT F;  3K2Z A;  1IDY A;  2HYG D;  2RDI A;  1RIO H;  1TWC A;  3S24 A;  3PNY A;  4XLN F;  4A3L J;  2H27 A;  1XSX A;  1D8K A;  3TQN A;  1TNS A;  2PJR A;  4BBS G;  2HGC A;  4E7I A;  2YL2 A;  5DQG A;  1K6O A;  4BKX A;  3E6D A;  4JP0 A;  2F5F A;  2CQK A;  5EEG A;  4C5A A;  4DV4 H;  4BL0 B;  3V6K A;  3CMY A;  1TQM A;  3OYE A;  5JQW A;  3F9K A;  3R5H A;  3BJY A;  2EIY A;  2HZT A;  2XAQ A;  3O6B B;  1E4E A;  2JUC A;  3U9S A;  2QKL B;  3N40 P;  3EDP A;  4RB3 C;  1PJR A;  3HOU J;  2V1U A;  3CUQ B;  2W6M A;  2CU7 A;  3MR3 A;  2K02 A;  4MV3 A;  2XB5 A;  3RAQ A;  2VA2 A;  3GTL J;  3WWJ A;  3CMA I;  4BBR G;  1SFU A;  1ZGW A;  2EIK H;  2XAH A;  4S05 A;  1MMS A;  3MR6 A;  2MGQ A;  2VQG A;  3HB9 A;  1MSF C;  1OBG A;  4FM9 A;  2B63 G;  1N32 H;  3V7R A;  4BHC A;  2ISY A;  2IXS A;  4RB0 A;  3VOT A;  4DR6 H;  4EVI A;  2Q2T A;  2X6W A;  3RB3 A;  4XLE A;  1YW9 A;  2R5Y B;  2IS2 A;  2FPI B;  2W9B B;  3CCS I;  2H09 A;  3ISP A;  5HNE A;  3CF5 F;  2E2I J;  4AYB E;  2M4K A;  1PP7 U;  1LB2 A;  4KIT B;  2MSY A;  3HUG A;  4IOC F;  1U8R A;  2R86 A;  1DGS A;  2ZO4 A;  2DTZ A;  4UVA A;  4LF9 H;  2NVX A;  1REP C;  1HSJ A;  2AGP A;  5FRO A;  3GW2 A;  4OIO F;  4QWC A;  3R61 A;  1DDN A;  3NEU A;  2V4R A;  1C3O A;  1RPW A;  2VQL A;  1HA8 A;  2RNJ A;  3HZJ A;  1G2W A;  1K6Y A;  4ED7 A;  5E18 F;  2W8L A;  3KLO A;  1A36 A;  1FBS A;  3LSH A;  4CZZ A;  1CGP A;  2WTF A;  1YIJ I;  3SZG A;  1J0R A;  5E3M A;  1P4X A;  2COB A;  2W1O A;  1MJ9 A;  4JX5 A;  3RGX A;  1Z77 A;  3FXL A;  3K7A J;  3CO6 C;  2OQG A;  2PLY A;  2E1C A;  2YS6 A;  2NS8 A;  1AA7 A;  1OR7 C;  2QLZ A;  2R5Y A;  1VFC A;  2VKV A;  3LA2 A;  1HXD A;  3F22 A;  5CKT A;  2E5Z A;  4Q45 A;  4L5I A;  4GKJ H;  5HS7 A;  1XN7 A;  2QVO A;  5LBQ A;  2NOJ B;  3BTI A;  3I55 I;  4RB1 A;  2HDC A;  3BR1 A;  1JE8 A;  4KMF A;  4DR1 H;  2BQU A;  4ZYE A;  4DLK A;  4OAY A;  1K7A A;  3TW7 A;  4RUA A;  1WJB A;  1UST A;  2M0M A;  4IVN A;  1Z7U A;  2CQQ A;  2COI A;  2W24 A;  1OR7 A;  1FX7 A;  2CMP A;  1U5T B;  3DPU A;  5E8G A;  1GXQ A;  1OCT C;  3OYG A;  3VPB A;  2RNG A;  4GC7 A;  1EUD B;  5FLM G;  4CHI A;  5C44 J;  2XAJ A;  2L7Z A;  1G2H A;  4Y15 A;  4JV5 H;  5KS8 A;  2LY9 A;  2VKE A;  3S2H J;  4I7H A;  2FP4 B;  1FMV A;  3GQC A;  2PMZ N;  4CYD A;  1JJ6 C;  3MR5 A;  2KP6 A;  3VEP A;  2VT2 A;  1ZGA A;  2FMA A;  3UZO A;  3JRH A;  3P9I A;  1U5T C;  2WAD A;  3GIJ A;  4Q4Z F;  4Q8F A;  4MIM A;  2G7U A;  6PAX A;  3ZN0 A;  1E0E A;  4FU0 A;  4PWQ A;  2DQR A;  2CH0 A;  2KFD A;  1KU2 A;  2DQL A;  1SAU A;  5BWX A;  3ZXS A;  2K5C A;  3K4N A;  1J2X A;  3K5I A;  2XVC A;  2JWT A;  2AQ4 A;  3KHH A;  1ERD A;  4CHU A;  1D5Y A;  5KFN A;  3SYT A;  5LRR A;  2LR8 A;  2O03 A;  5CLS A;  2F4O B;  1U5T A;  4JBA A;  2R3S A;  4OU0 A;  4YJ3 F;  1ZG5 A;  3PUF A;  3DV8 A;  2OTJ I;  2CW7 A;  3TBI A;  2WYO A;  3J80 Z;  2J6S A;  4DIM A;  4RGX A;  4XRM A;  4BAC A;  3HPG A;  2MH9 A;  1SD7 A;  4JX6 A;  5IP7 G;  2HVS A;  2YSR A;  1XMA A;  3CDH A;  3M1C A;  2VLA A;  1NK3 P;  2XGD A;  4M0J A;  2HWV A;  2XCP A;  3L4K A;  4W97 A;  5E3L A;  3SQN A;  3RI4 A;  2Y4R A;  4X0G A;  1YRN A;  3GXO A;  4RAZ A;  2VPL A;  3VPR A;  4KIG A;  3AL0 C;  4I09 A;  2R5Z A;  1SYX B;  3I4N G;  1OWT A;  3E3V A;  3FM5 A;  1H88 C;  1TZL A;  2CZG A;  4IO9 F;  3GTP A;  2N8G A;  4APM A;  4NBQ A;  2DPI A;  2IPQ X;  1PYV A;  5CE8 A;  3AYH B;  1S6L A;  2VBZ A;  3HKZ A;  1VF9 A;  5LP6 F;  3GIQ A;  3CVZ A;  3LFK A;  4M6V A;  3IAM 2;  2DMQ A;  3C18 A;  3F6V A;  2M30 A;  4HR7 A;  1ZHS A;  3K70 C;  1ZKG A;  2D45 A;  5EG0 A;  3KLN A;  1YLF A;  4A2B A;  4J9N A;  5A2Q Z;  3LQQ A;  4J9S A;  4TV9 F;  2V26 A;  1JKR C;  4V19 K;  4MQV A;  4YFN F;  4E70 A;  3C0F B;  2XCA A;  1CF7 B;  2CFO A;  3JSN A;  4MTE A;  4B3X A;  3E5Q A;  4O82 A;  1DPU A;  5BPH A;  1RET A;  2QGU A;  3MD2 A;  1UEL B;  3GB8 B;  1WJ5 A;  2IA6 A;  5EZG A;  1S0O A;  4X6A J;  3Q0W A;  2GLT A;  2Q2E B;  5HDG A;  4ECV A;  3CQZ J;  3FXQ A;  3DFG A;  3MFK A;  2OV7 A;  4CYC A;  4DQN A;  2ECB A;  5IYC G;  5DG8 A;  2UUA H;  4Q4C A;  1DU6 A;  4X1E A;  3N05 A;  5KHD A;  5LHI A;  5EWF A;  1MBG A;  1CQJ B;  3O8H A;  3ZQG A;  1IUY A;  3GTK J;  2V4J C;  3T5X A;  3HL2 A;  3H3Z A;  5TJJ A;  3W6V A;  4XLF A;  5IP6 A;  4NC8 A;  5DIS C;  1WJD A;  2XRO A;  2DIK A;  3JZ6 A;  1B9M A;  2RRE A;  2JA6 J;  1TWF A;  2VJ5 A;  2COG A;  3DQV C;  2GM4 A;  3CJN A;  4HV5 A;  1RJQ A;  1I3A A;  3H5R A;  4ZOL F;  3CZ6 A;  2QKM B;  4B44 A;  1VZ0 A;  2YPR A;  3JRF A;  2ZXH A;  2Y0M A;  2AS5 F;  1OIS A;  3HBL A;  3G2B A;  3H9Q A;  4C3H J;  1S8N A;  2DAA A;  5KG3 A;  5EWE A;  2VJI A;  3RZD J;  3L4J A;  2KRF A;  3GUD A;  5TIS C;  3OR2 C;  4AVP A;  2V9W A;  4HNU A;  4HNT A;  3QOP A;  3HRS A;  2DFF A;  2R7M A;  2DW4 A;  5EJC A;  5DG9 A;  2V1X A;  2QZ8 A;  1J09 A;  5I5X A;  4LLL A;  4EJW A;  1APL C;  3WGI A;  1U6G A;  2EJ0 A;  2FJZ A;  1CQT A;  2R87 A;  2VUM G;  2C2E A;  4DL2 A;  1BGW A;  2IAI A;  4XM3 A;  1JI8 A;  2WB1 A;  2M1B A;  4IZO A;  3PR5 B;  4CXF A;  1XNR H;  2QSG X;  4DR5 H;  1P4A A;  3W2W A;  4BBS J;  1LUJ B;  5HNH A;  2ASD A;  4LSA A;  4A3F G;  1ZYR F;  1DPR A;  4M3E A;  2XPW A;  3BPX A;  3EUH C;  4G7H F;  2GLO A;  3EPI A;  3L2Q A;  5ICC A;  3KCC A;  3CDL A;  1SMY F;  4U88 A;  1GUU A;  4HW0 A;  5H2F C;  4BBR J;  3K5H A;  3AW8 A;  2L9V A;  3BQY A;  4NNJ A;  4XOR A;  4F91 B;  4PDB A;  1EA3 A;  1FOK A;  4R8U A;  3CCV I;  1BBY A;  5DD8 A;  5JHF A;  5TRD A;  1CKO A;  1I2L A;  5JFR A;  2CNV A;  3T54 A;  1RKT A;  4AIJ A;  4F7Z A;  3WGH A;  3WE2 A;  4EQ5 A;  3FIS A;  3HO8 A;  3LSJ A;  2IRF G;  3V42 A;  2E36 A;  2TRT A;  4BU2 A;  4PJ0 C;  3DTI A;  3JRC A;  2NUA B;  2QUF A;  1CQI B;  3HYI A;  1G4D A;  3CSW A;  1KBL A;  5F0H A;  2H8R A;  4AM3 A;  3MN2 A;  1TNT A;  4JQF A;  1ZR2 A;  3DU5 A;  1YI2 I;  1SD6 A;  1EYZ A;  2KT0 A;  2YRX A;  4LF6 H;  4QW9 A;  4WHX A;  2HOA A;  3V4G A;  4UCR A;  3PW4 A;  4NC7 A;  1I1K A;  2P5K A;  2XHK A;  2E60 A;  2W6N A;  5J1U A;  1E4F T;  1KZH A;  4I55 F;  4TM5 A;  5EEA A;  3J7A K;  2L01 A;  4DRF A;  1T98 A;  2COJ A;  2L9R A;  3L1P A;  3Q8S B;  2EV6 A;  1BOB A;  4EJT A;  3UYY A;  2NXN B;  2JTV A;  4F3Q A;  2KL4 A;  4IR1 A;  3UNG C;  4U0Y A;  1BR1 A;  1EF4 A;  1YIO A;  2W9C A;  1P4W A;  1Z0X A;  4C5B A;  4Z2Y A;  1A04 A;  5J47 A;  4GRI A;  1MBE A;  2NS7 A;  2X6X A;  4LIT A;  4YB8 B;  1AKH A;  2FNP A;  2XAS A;  1QZY A;  3LAP A;  4ECR A;  3N8D A;  5FLM J;  3RPQ A;  1UZC A;  4DBQ A;  2G0E A;  5DM6 F;  3OYJ A;  2XSD C;  5LRS A;  2RF4 A;  1FYK A;  1I50 A;  4MNU A;  5KFL A;  2YU9 A;  4Q5S F;  1MZB A;  3PR4 A;  2ZBK A;  3WG7 H;  2GIZ A;  3BJO A;  4ZTJ A;  4X62 H;  5B3S H;  4XYM B;  4BY1 J;  4RNO A;  3BQ1 A;  5JLX A;  3C7J A;  5LHG A;  1QZZ A;  1X3W B;  2YUS A;  2W6Q A;  2PMZ A;  4O7W A;  3ERE D;  1AU7 A;  5AON A;  2JA7 A;  3KZY A;  5ILS A;  4FIS A;  5K1Y A;  1N75 A;  3HOZ G;  5GTI C;  4IRH A;  2Q2U A;  5FR9 A;  4O86 A;  2NVY A;  4UCU A;  5D6E A;  2AXL A;  2XRN A;  2ELJ A;  3HTU A;  3HJE A;  4CSW A;  2O8K A;  2IS1 A;  1GYF A;  3U2R A;  3ZQL A;  2GPS A;  1ACI A;  3UKG A;  3VSK A;  2DMT A;  2LFB A;  1MMN A;  3X2Q H;  2FML A;  3F8F A;  4CO8 A;  1ON1 A;  1B6S A;  1H9G A;  2IGM A;  5IP7 J;  1YJN I;  1KQ0 A;  1NK2 P;  1UFM A;  2IA0 A;  2L3D A;  2R8I A;  3TP0 A;  4PJN A;  3A01 B;  1FSE A;  3M7G A;  3K10 A;  3QWL A;  2KJC A;  4UVC A;  2OF7 A;  4CMD A;  3BG6 A;  1Q1H A;  3BWG A;  3K4K A;  4IF4 A;  4NDL A;  3WGG A;  3ZN1 A;  4O7S A;  3I56 I;  2R92 A;  2M8G X;  2UUC H;  3I59 B;  1O7F A;  4I98 B;  4UFZ A;  2HVR A;  2LRD A;  3WTZ A;  5IT9 Z;  4A3E G;  3AG4 H;  3BR2 A;  4LF5 H;  4XN0 A;  1WFX A;  4MFE A;  4XR6 A;  2L4M A;  1B8I A;  4ECX A;  3KYC B;  5CAE B;  4YG2 F;  4LG0 A;  1KQ9 A;  2F4M B;  4D7M A;  3IRQ A;  2IEK A;  2R7F A;  1B72 A;  5GAE J;  2W7N A;  1R5H A;  2UXD H;  4ITV A;  2HDK A;  2Y9Y A;  1TAE A;  3M4I A;  1EKP A;  4ZQI A;  1QQI A;  1D1C A;  1ZN2 A;  3R4K A;  2NVX J;  2R7K A;  2K27 A;  4L9J A;  4C5C A;  3CP2 A;  1S72 I;  1JLL B;  2W7O A;  5K5R A;  3H0G A;  5E20 A;  3GIP A;  3MFH A;  1HDD C;  2BY0 A;  1F4K A;  4HLY A;  1ON2 A;  3TOB A;  3QQA A;  5KFH A;  5J2T F;  2DA7 A;  5BWV A;  4LF8 H;  5J8C A;  2CO5 A;  3MKZ A;  1ZHQ A;  2MC4 A;  2BW3 B;  1SD4 A;  4NC6 A;  5J6X A;  1HW2 A;  5IYC J;  4L18 B;  4CCJ A;  3OOU A;  1FYM A;  1SVO A;  1ZGJ A;  2CQX A;  3K69 A;  3EPG A;  4F4Z A;  4UY8 I;  2LYC A;  1RYR A;  1QNT A;  2UXN A;  3EYY A;  3TKY A;  1FOX A;  2M87 A;  2VR1 A;  3PFF A;  4ED2 A;  1I1G A;  4E4H A;  3TDZ C;  5D1P A;  1G3S A;  1Z6T A;  4O81 A;  2R8H A;  5FKN A;  1D1B A;  4A3L G;  2OA4 A;  3HGY A;  4PZ8 A;  3GO5 A;  2OUM A;  3OYN A;  4D5F A;  4DOZ A;  1N48 A;  2QK4 A;  4E7Z A;  3IV5 A;  2BR0 A;  1FBU A;  3W6K B;  2LVS A;  1MIJ A;  3BTL A;  5J40 A;  3LSM A;  3KTM A;  2K3F A;  2PI0 A;  4A2A A;  3RB0 A;  3N6R A;  3GCM A;  4J9O A;  5H6R A;  1O75 A;  2XGP A;  4CH7 A;  1FC3 A;  1KT8 A;  5CVJ A;  2HQA A;  3V7C A;  4E6K G;  1QA6 A;  2NNY A;  4MGR A;  1E3O C;  3HOU G;  4IL6 C;  4FTH A;  3BJ6 A;  3E97 A;  3M8E A;  1YHQ I;  1Y39 A;  4DV6 H;  2XAF A;  4DNC A;  1D5V A;  4JI4 H;  2ALZ A;  3T8R A;  1VQ9 I;  4LB6 B;  1ETY A;  2JA7 G;  1M0T A;  1FMW A;  2PMH A;  1P7I A;  4OIR F;  5DM7 F;  1A0G A;  2DT6 A;  1FP2 A;  2CQ7 A;  4C2U A;  3VYU B;  4D7N A;  1Z6R A;  1VBG A;  3CCL I;  1IBK H;  2WBM A;  1HW1 A;  4YII A;  2FPG B;  4A3F J;  1VQO I;  3DKX A;  2DOD A;  1ZRF A;  4LJZ F;  2V7F A;  5C1O A;  2K9S A;  3HOX G;  2VQH A;  2CWE A;  1FNN A;  1VQ8 I;  5LGT A;  3T9A A;  3T5H A;  4EEF G;  3TO7 A;  4Y13 A;  1QGP A;  3JRE A;  1BN5 A;  4BE2 A;  2C00 A;  1VQM I;  1YJ9 I;  4O2B F;  5HLI A;  4Y33 A;  2IA2 A;  1BJA A;  2VE8 A;  4UB6 C;  2DMP A;  2EIN H;  4L0Y B;  4JI0 H;  2DI3 A;  2ZFW A;  2NVQ J;  4DV3 H;  3ULQ B;  4NUB A;  4YFK F;  4XKW A;  4TUY F;  3OMY A;  4HRI A;  3GWZ A;  3Q3S A;  1KQ8 A;  3W5O A;  4FS2 A;  3MZ8 A;  2K9M A;  4LMY A;  5B1B H;  2VE9 A;  3IAS 2;  4HNV A;  4RNN A;  2LOO A;  5LGU A;  3KFW X;  4IHW A;  5JI6 A;  2CUZ A;  2ZJQ F;  2PMU A;  5EOY A;  4DJA A;  4IHT A;  2A3S A;  5CB4 F;  4DL6 A;  3RR5 A;  1OCC H;  3BZ6 A;  1Y1V A;  4ED3 A;  1IOV A;  2OCC H;  5KFG A;  1K1Q A;  2F48 A;  1WQ2 A;  1F5T A;  2IGK A;  5DMX A;  2R8J A;  3G73 A;  1S7E A;  2EA4 A;  4AIK A;  3HKZ E;  4RLQ A;  3DLA A;  4JI5 H;  1JHH A;  5AIQ A;  4BH9 A;  3GV5 B;  1YX3 A;  5JVG F;  4HST A;  4HQM A;  3W1G A;  1ZET A;  1S7A A;  2EFW A;  1ZRD A;  2M05 A;  2L9N A;  1L3L A;  3AG1 H;  4A3G G;  4HAM A;  2NU9 B;  4RM3 A;  3TL4 X;  3E6C C;  2CUF A;  4E7J A;  1DP3 A;  4G8X A;  2GAU A;  5IP9 J;  4AU7 A;  4U6P A;  2XC9 A;  2EQR A;  3LOC A;  2H94 A;  1EZ1 A;  2YW2 A;  1A31 A;  2ZB9 A;  1FPQ A;  1UHW A;  1T3N A;  3CJR B;  2A68 F;  3DBL B;  1EJ9 A;  3J80 W;  3H35 A;  3CCE I;  4G7O F;  1BA5 A;  3BCA A;  4MFD A;  1TWF J;  2FX0 A;  4YY3 H;  2GA1 A;  2Y0S N;  4MEX F;  4BQN A;  2O6G E;  4D0P A;  1POG A;  1T36 A;  2EH3 A;  2NVT J;  1UC9 A;  1DU0 A;  2V79 A;  3RQI A;  3GFI A;  3OS0 A;  4O7Y A;  2A07 F;  4IRK A;  1L0O C;  1V4R A;  2E1O A;  3MCZ A;  5EGO B;  3LSG A;  4EEQ A;  1SEI A;  1SFX A;  4LIU A;  1CKN B;  3ZCO A;  3V8L A;  3QQM A;  3LL7 A;  4F52 A;  5D8L B;  5EZY F;  4ZYA A;  3T5J A;  4OWR B;  2ZME B;  3E0J B;  3KYH C;  2IW5 A;  5HDK A;  2A6E F;  2UZK A;  1I1M A;  5B5E C;  1KGS A;  2JEF A;  4A93 G;  4RAF A;  2DU9 A;  1IRZ A;  4RUC A;  2ID3 A;  3ML6 A;  3RPU D;  2EFQ A;  2E2H J;  4PCQ A;  5DD4 A;  1ZAR A;  4WX9 A;  4R79 A;  1DP7 P;  4ZHQ F;  4LIV A;  2R93 A;  1NH3 A;  4ECS A;  2B9S A;  2VBW A;  5BPF A;  4KT5 C;  4XLH A;  5A2Q W;  3OOP A;  2XV4 S;  3OV8 A;  2VBY A;  3LA7 A;  2HOS A;  4IHY A;  3U0G A;  5LOV F;  1XCV A;  2ZME C;  4B3T H;  4PSW A;  4ZZD A;  1RUO A;  4MO7 A;  3BR0 A;  5I47 A;  2ZXW H;  3I54 A;  2FE3 A;  1V51 A;  1IV8 A;  2I80 A;  3KEO A;  2ZNZ A;  1U2W A;  5FRM A;  2NVU B;  3RTR A;  4BXU A;  1CKN A;  2WB1 E;  5J8F A;  4FX0 A;  1HNX H;  2KKO A;  1O7L A;  3ASO H;  5FPO A;  1T0F A;  3VSL A;  3KP7 A;  5BNG A;  3I4M J;  1A0I A;  1EKV A;  3LFU A;  2WWY A;  2F5E A;  4JI1 H;  2BYV E;  1UNN C;  3KZI C;  1LVA A;  1IAW A;  4EBD A;  3WO1 A;  1Y6I A;  3U1K A;  4IJA A;  4OMY A;  4DBR A;  3KRE A;  2XPU A;  4MLO A;  4C3J J;  2YZL A;  3GII A;  2W48 A;  5M5W J;  4BQQ A;  5L1J A;  5HNF A;  4DR3 H;  5DCM B;  4X64 H;  3WWI A;  4I50 F;  5HS9 A;  3PQK A;  4LFB H;  1T95 A;  1JGG A;  2COM A;  2HFH A;  3HG9 A;  4CCL A;  3KAL A;  1S9F A;  1UHS A;  3OYM A;  3Q1K A;  2A5W A;  1GGO A;  3CMM A;  2PJR B;  1Y1V G;  1YFH A;  3Q9V A;  3WU2 C;  4CKE A;  3QYB A;  3KE2 A;  3REO A;  3BT9 A;  3NGD A;  4M3D A;  1FVI A;  3DPT A;  4XSZ F;  4WF2 A;  2HQ5 A;  3FXM A;  3PO3 J;  1IG7 A;  1K4T A;  1YX5 A;  1K4S A;  1AUX A;  4XNF A;  4R1H A;  1E4E B;  5IT3 A;  5HLH A;  2WC2 A;  1J59 A;  2PX9 A;  3OIQ A;  4QPO A;  2X1C A;  1MNE A;  1IN4 A;  2BQ3 A;  1RKW A;  2JVH A;  4FQG A;  1JKP C;  3TIG A;  3MR2 A;  4U7D A;  2GQS A;  5KG4 A;  3T5K A;  4N9H A;  1WI3 A;  2FJ1 A;  1QHH D;  5FLX Z;  4YFX F;  1ZAU A;  3D0S A;  1X3U A;  1I6H J;  1I1L A;  2FF4 A;  3I5U A;  2M45 A;  5BWU A;  2CUE A;  4IEJ A;  1AHD P;  5HLT A;  3JRD A;  1XB4 A;  3OYK A;  3RGZ A;  1IZ1 A;  2KJB A;  3HUG B;  3BP8 A;  4BJ6 C;  3PZP A;  5EDN A;  4U0W A;  3TEK A;  4IRC A;  4ZDP A;  1I50 J;  2YZM A;  2DFI A;  3S1N J;  2ATL A;  2ZDQ A;  2ETH A;  2TCT A;  3JAM Z;  4I6Z A;  2RVC A;  4IR9 A;  1PX2 A;  2R7S A;  4DUZ H;  2RGR A;  4XQF A;  5ILU A;  3JSO A;  1GLV A;  2RKH A;  4GXO A;  3CCJ I;  5K7H A;  5C4J J;  5F0C A;  3CC2 I;  2W6O A;  2JA7 J;  4LFA H;  4YR2 A;  3M3Y J;  1IRX A;  2V1D A;  3A0B C;  4C2M A;  1HST A;  1X1A A;  3TGN A;  2V9K A;  3C1D A;  1GXP A;  2GXG A;  1O57 A;  2NVY J;  2ZNY A;  4KFC A;  2V59 A;  3E5X A;  3OL4 A;  4HDU A;  4OIN F;  2GBY A;  2JK3 A;  5FFX A;  2JA5 A;  5BWW A;  4BXX G;  1K61 A;  4BNC A;  1KJ8 A;  5K7Z A;  4IXA A;  2Z3Y A;  3HHH A;  3HT5 A;  3GTJ A;  1PP8 F;  3PW2 A;  2P7C B;  2LC2 A;  4II3 A;  4XYL B;  2PMZ E;  2RDP A;  2W25 A;  3HOX J;  4R8H A;  1K1S A;  5FLV A;  3MFI A;  3C3W A;  4UUS A;  4CCM A;  1N34 H;  3FBI B;  3M9N B;  1MGT A;  3ABT A;  3W2A A;  2XDV A;  1TLH B;  2PBI A;  3NAR A;  3NBZ B;  3F3X A;  3IWZ A;  4PZ6 A;  2DN0 A;  3PL8 A;  4A0X A;  3H5N A;  4UNO A;  1TWH A;  1FTZ A;  3T1Y H;  2AQF A;  2R92 J;  4GCV A;  1HCR A;  3L2W A;  1KON A;  1LFU P;  2BHY A;  5E17 F;  3GZN B;  5DQH A;  2P81 A;  3FXU A;  2NRA C;  4ENK A;  2R7R A;  5DLG A;  2MBF A;  1FY7 A;  1P7J A;  3I58 A;  4BJ5 C;  4A12 A;  4BE1 A;  2X0L A;  4KIF A;  1KJI A;  4P9U A;  4YAK B;  4JV2 A;  4XX0 B;  1GV2 A;  2ADU A;  3J7Y J;  1FSH A;  2HU9 A;  2XAG A;  3V6H A;  1R9T J;  1X2M A;  4UHT A;  4YJ2 F;  2DO7 A;  1KU7 A;  4EBC A;  2ZKZ A;  2QA4 I;  3GTM J;  4JI2 H;  4ENJ A;  4JI8 H;  3FBN B;  2NNN A;  5FKM A;  3AG2 H;  3OS2 A;  5I5W A;  1SFK A;  3H9G A;  1DV2 A;  4WD3 A;  3GBG A;  3NUA A;  1S3J A;  5DTD A;  2DMN A;  1N36 H;  4RAY A;  4MAM A;  1I27 A;  2FXA A;  1WH5 A;  1XMX A;  4EAT A;  4Y17 A;  3QPL A;  2ZCW A;  1FOY A;  4O7R A;  5CPR B;  4S04 A;  4PDK A;  4BY1 G;  3CC4 I;  1IXS B;  2LNB A;  1YRN B;  4JYK A;  3M8J A;  4A3G J;  5EF6 A;  3JSP A;  3LMM A;  3K4L A;  5BPI A;  5BYA A;  2R5Z B;  1IUF A;  2CS3 A;  3F6O A;  3H92 A;  4CUG A;  5D4R A;  2KSW A;  4ZYH A;  5HOD A;  5DAA A;  1GHC A;  1HR0 H;  2EPF A;  2I10 A;  3ELK A;  4WXH A;  4Q4D A;  1V5G A;  5I5S A;  3ABL H;  1J75 A;  2L7F P;  3T9D A;  5J3L A;  3T99 A;  3U55 A;  5CYV A;  3R9R A;  4A3I G;  3PFY A;  4MA5 A;  2UVU A;  3FZV A;  3GYH X;  5KFI A;  2F4V H;  2ZJP F;  2P6T A;  3AL0 B;  4XLA A;  5IPA A;  2QYZ A;  1V3F A;  1SAX A;  2DA3 A;  5BMZ A;  1M6V A;  4G9Y A;  5EG0 B;  2IGO A;  5HDN A;  5FNV F;  1IBL H;  5FKO A;  2OH2 A;  2HPI A;  2W82 A;  2BY1 A;  3KHR A;  4DYC A;  2EIM H;  2Y0S A;  3CUO A;  5KFQ A;  1MH4 A;  2KRC A;  1I5Z A;  3TIN A;  4J9L A;  1MND A;  2X51 A;  1Y56 A;  5FKK A;  1EKF A;  4O83 A;  3AKZ A;  4J9M A;  2UVR A;  2FRH A;  4PZJ A;  3S1Q J;  1RES A;  4HF1 A;  2FK2 A;  5IT9 W;  3FK7 A;  1LFP A;  2FBH A;  1YIT I;  1ZG1 A;  4A93 J;  3ETJ A;  3ZPL A;  2VPQ A;  3FKI A;  4X65 H;  3DWL E;  2M5W A;  2OQR A;  3ECH A;  3HSF A;  5F04 A;  1U3E M;  1FTT A;  5K3W A;  4IRD A;  4CYC B;  1U9O A;  1IJW C;  3A0H C;  2PVP A;  2AQE A;  1W5C C;  2E7X A;  5GPC A;  4G94 A;  2MH2 A;  3G1M A;  3ZGK A;  2YRW A;  3BAB A;  1ETV A;  5LD2 C;  2O3F A;  4XRF A;  1B33 N;  1UG2 A;  4O4L F;  5D8K B;  2UWM A;  2DCE A;  4JUZ A;  3HEF A;  4RB2 C;  2ME6 A;  4ETS A;  3TP3 A;  4B48 A;  1GV5 A;  3R0A A;  1SEU A;  1A3G A;  3RB6 A;  1MBK A;  1WRJ A;  2O7O A;  3WTV C;  2IVM A;  1MBJ A;  1L2Z A;  1UB9 A;  1WJF A;  5KFY A;  2DOA A;  3K1N A;  2D1H A;  3IC7 A;  4HSR A;  2JZY A;  3CCU I;  1H8A C;  2HIV A;  2EA2 A;  4O84 A;  3EET A;  3V7S A;  3HXL A;  3VB2 A;  3GLK A;  4D9J A;  2VJ4 A;  4NB5 A;  1ENH A;  1F43 A;  4EYI B;  4LSX A;  1V4Y A;  3N97 A;  3TY8 A;  5FRN A;  2R4G A;  3BTJ A;  2P6S A;  2YR2 A;  1TP4 A;  2KIQ A;  1IXC A;  1T56 A;  2EBI A;  3RV4 A;  3T1H H;  3AX6 A;  3PO2 G;  4IHJ F;  3PW7 A;  2L2O A;  2HXI A;  4IAJ A;  1YG2 A;  2R85 A;  3I53 A;  4KDP A;  2VOP A;  1F36 A;  2CYY A;  3HSR A;  5KAF C;  1DQU A;  5ILV A;  3H3V K;  3J7A O;  5KAI C;  3LP8 A;  2OLS A;  1V54 H;  3KPH A;  4O3M A;  1M1E B;  1WI9 A;  3CLO A;  1Y1V J;  2HG8 A;  3VYR B;  4IIJ F;  2E7W A;  2UXX A;  3RAX A;  2FD5 A;  1T8I A;  1JUP A;  3DEW A;  4EJU A;  1UMQ A;  2RV8 A;  2WY8 Q;  2YWV A;  3SEQ A;  4CC5 A;  4BS9 A;  3DAA A;  2QQA A;  1TWA J;  3G3Z A;  1YW8 A;  3RKX A;  5DGI A;  4IWX A;  2YX4 A;  4HF0 A;  2V9P A;  2EFO A;  1SC7 A;  3ETH A;  4N9I A;  2CUJ A;  4BEH B;  1Q1V A;  3D5R C;  4DR7 H;  3SDB A;  5F9N A;  1MBH A;  3AG3 H;  3V8K A;  4R8U B;  5FPR A;  2F5D A;  3KP4 A;  1FZP B;  3IN5 A;  3U9T A;  1LEA A;  1BC8 C;  2BE5 F;  3KHG A;  3PW0 A;  4KIS A;  1XX5 A;  3RV3 A;  2FK1 A;  5L1K A;  3T8T A;  1XGS A;  3BRO A;  4LF4 H;  2Q8K A;  3PW5 A;  3DBH B;  5M3F J;  3J80 K;  4ENN A;  1I6X A;  2IP4 A;  4MV7 A;  3JRW A;  3SZP A;  4DAA A;  5EWG A;  5C3E G;  3F21 A;  4IQJ A;  3HDD A;  2VI6 A;  1DUX C;  1AOY A;  1TBX A;  4RS8 A;  2W4S A;  1T94 A;  2PFB A;  2DAB A;  4MV6 A;  5J4V A;  4BEH A;  2Y30 A;  3T9E A;  3MKL A;  2O61 A;  3SI8 A;  1KTA A;  2LY2 A;  1JDE A;  1PDN C;  3K6G A;  2XKO A;  4IQ4 A;  1WCM A;  1LDD A;  4M74 A;  1FJG H;  4P96 A;  4IHV A;  3VYT B;  1MBF A;  2DTR A;  3LWF A;  4U0V A;  4V2G A;  4YRV A;  3TII A;  2YS9 A;  4LGW A;  3FM3 A;  3ZRG A;  4IHS A;  3TQT A;  3RF2 A;  1QVU A;  3FK6 A;  3H5A A;  2QEX I;  4BXX J;  2W9C B;  5DDG A;  4RZQ A;  2EZK A;  3DKY A;  5H6Q A;  4ANJ A;  2VQF H;  1BIA A;  2CSO A;  2VXZ A;  3K1M A;  2R6F A;  3MWD A;  2XSJ C;  3H20 A;  4O3N A;  3IKV A;  1CKM A;  5A2Q K;  4PSX A;  3SE7 A;  1AKH B;  1F9N A;  4A3C J;  4D1Q A;  3BZC A;  3Q5F A;  3S14 J;  1MW7 A;  2VT3 A;  2GQQ A;  2OWO A;  4A3D J;  1MMG A;  4L9V A;  1X1P A;  1X1B A;  4V2F A;  4H4K C;  4B4C A;  1VQ5 I;  4E7K A;  3UZB A;  4FBT A;  2XAU A;  2ISZ A;  2Z2S B;  5D5X B;  2DOE A;  2PEX A;  4A2U A;  5ED4 A;  3W1B A;  4Y52 J;  1D0Z A;  3HOY J;  2JUG A;  1N33 H;  3KHL A;  1QRY A;  5KFU A;  3RIR A;  2FLL A;  4M9X A;  4QWE A;  2ZDG A;  4KMU X;  4FFO A;  2XGX A;  2L02 A;  2L7M P;  4LH7 A;  3N43 B;  1HW5 A;  2EB7 A;  3KZZ A;  5D5U B;  5IP9 G;  1R00 A;  3BG5 A;  1QHG A;  4EG0 A;  3QRF F;  5D1O A;  3G6Y A;  2KIF A;  3BA8 A;  1EH8 A;  1XCB A;  4G7Z F;  1UHM A;  2LKS A;  2DFE A;  1W7P A;  4G6T B;  1Z9C A;  2VON A;  2L4A A;  4AIH A;  3HHG A;  4PJJ A;  1K78 A;  3RKW A;  1GSA A;  3TMO A;  1JT6 A;  1BI0 A;  1W4M A;  5M5X J;  4IX7 A;  1H9T A;  3DU6 A;  3TW6 A;  2W70 A;  4LK0 F;  5HBR B;  5DQI A;  2UU9 H;  2LMD A;  4L5J A;  4KHP H;  5KFA A;  2WTE A;  1B6A A;  1E3P A;  1G59 A;  3QFF A;  2W57 A;  1IW7 F;  2OD5 A;  3GIM A;  1Y1W A;  1O3T A;  2HVQ A;  2R7O A;  5E3N A;  3OYH A;  3RKQ A;  5KG1 A;  5KFJ A;  2I5U A;  3Q8Q B;  5EZH A;  3TY5 A;  2DK5 A;  2ZJT A;  4A3I J;  2FU4 A;  1XGM A;  3PNT A;  1B8I B;  3GV8 B;  2QSF X;  4P9F A;  4W1U A;  3WOD F;  4EM2 A;  1T39 A;  1Y0N A;  4LG0 B;  3I0T A;  5F0F A;  3S8P A;  1I6U A;  1TWC J;  2R7Z A;  1ODD A;  1B72 B;  1R1T A;  1IYD A;  3ZQF A;  3JSL A;  1TQP A;  5LFA A;  4ED6 A;  4FE4 A;  4EMS A;  2R8K A;  2MC3 A;  1ZQ3 P;  2DA1 A;  3DP7 A;  4EGQ A;  5KT6 A;  2MD5 A;  3H40 A;  4A5M A;  2YYA A;  4GO1 A;  4P5O A;  4BJT A;  2R8G A;  4M9Z A;  3GIK A;  4CCO A;  2EK5 A;  2E1N A;  4DR2 H;  1JJ8 C;  1BXR A;  3KAJ A;  4YAJ B;  2PJP A;  5KG5 A;  2E2I A;  4QWD A;  2UVW A;  1XSV A;  2KDO A;  4ESJ A;  2LKX A;  3V8J A;  3I4M G;  5F08 A;  5KFE A;  1FT9 A;  5LYJ F;  4F4X A;  2VPR A;  1KU3 A;  5FFZ A;  2QBY B;  1MSE C;  5KFK A;  2X85 A;  1X58 A;  3CME I;  3GJX B;  4YIR X;  3KEY A;  1ORK A;  4ZDL A;  3H4D A;  1HC8 A;  5IYD J;  5M5Y J;  1DGW Y;  3M07 A;  3FMS A;  3PSF A;  2VOO A;  2XGQ A;  4GYG A;  4BDY A;  2JA2 A;  1VQ6 I;  4E6N A;  2BV6 A;  5LA6 F;  3GZ5 A;  1HNZ H;  4C3I J;  4ZH4 F;  3IH4 A;  3DKW A;  3M9M B;  1HKQ A;  3ZQH A;  4WBN F;  4GKK H;  3OR1 C;  5DV5 A;  3RTX A;  4B3M H;  2ZJ2 A;  2X4H A;  3PO3 G;  3L2C A;  2STW A;  4UCS A;  1S0N A;  2QBY A;  4BUP A;  1X4O A;  3PO2 J;  4UCO A;  3OTO H;  3J7A Y;  4ECZ A;  4EM0 B;  4O4I F;  2XC7 A;  5KG7 A;  3G6X A;  3N44 B;  5FLX W;  2QQ9 A;  5KT7 A;  3VFZ A;  1KEE A;  2R7T A;  3IH2 A;  3GTQ A;  2ZSI B;  4BY7 G;  3ZQI A;  5LLQ A;  2GWR A;  4A5N A;  4E4T A;  1S9H A;  5JVL A;  5E79 C;  4ABZ A;  3E5N A;  3CJQ B;  1X9N A;  3BR5 A;  2Q0O A;  2E35 A;  4ZDO A;  3ZMT A;  1P9Q C;  4NQW A;  1ETO A;  2FQ4 A;  4J01 A;  2LKP A;  2VAS A;  1YS6 A;  3L2V A;  1BIB A;  3I3L A;  2R7W A;  1D0X A;  4E7L A;  4DIQ A;  1WPK A;  3JAM W;  4BWS C;  2K86 A;  3RSN A;  2NU7 B;  2YZG A;  3CLQ A;  3DF7 A;  2G9W A;  2QWW A;  2VC0 A;  1BR4 A;  3KXY T;  4M72 A;  5L3B A;  4Q8E A;  1ZTR A;  3B6C A;  1MMD A;  1ZRC A;  1UAA A;  2RGV A;  1IDZ A;  3Q0U A;  2E2J J;  1CE8 A;  1WHU A;  4RBO A;  2UVV A;  4RAG A;  5EEH A;  3F0C A;  1D0Y A;  3R5F A;  3R5X A;  4HF2 A;  3KP6 A;  2X48 A;  4B43 A;  1R4M B;  1VAJ A;  4F92 B;  4OAZ A;  2MLG A;  1FIA A;  3QWU A;  2J6T A;  2DXI A;  4PGH A;  1XDS A;  2EWN A;  3FMR A;  5C3E J;  3R6S A;  2CFM A;  2VUG A;  4FFP A;  2AXT C;  2E1M B;  3SNO A;  1WGX A;  1Z7L A;  3H3U A;  1N78 A;  3FDS A;  3OSP A;  3J7Z I;  1WZ2 A;  2GZW A;  1OQY A;  3M4O J;  2DA6 A;  3F8B A;  1EH6 A;  3G6E I;  1YW7 A;  3JRA A;  2AO9 A;  1U78 A;  5J1Y A;  2EZI A;  3F72 A;  2JEJ A;  2XIG A;  2P8T A;  4XL9 A;  2DDB A;  3OYI A;  5CA1 F;  3OHB A;  3MVP A;  2R92 G;  2X9D A;  3GTP J;  4JV0 A;  2E1M C;  1XG1 A;  5IT9 K;  5FGM A;  2PG4 A;  2CKZ B;  2IP2 A;  4TVI A;  5KFR A;  2OZ6 A;  2R7Q A;  4ECY A;  3CCY A;  3F23 A;  5E1X A;  1TA8 A;  2XKP A;  3EYI A;  5KFO A;  4QTR A;  3OIP A;  2Y0S E;  4WK8 F;  5FB2 A;  3IRR A;  2HQR A;  3BG7 A;  3KP3 A;  4UV9 A;  3KYL A;  4M9U A;  4RNM A;  1VQL I;  3L2P A;  1R58 A;  5I5U A;  1I3Q A;  4ZYD A;  3JZF A;  2DYR H;  2ELH A;  5FKL A;  1T38 A;  3NC0 B;  3IHU A;  2K85 A; 
#chains in the Genus database with same CATH homology
 4PK4 A;  1WJ5 A;  3IP4 B;  1G8X A;  2UUB H;  4AYB A;  2XF7 A;  2R7S A;  4DUZ H;  2RGR A;  2Q2E B;  4XQF A;  4JI7 H;  2FUG 2;  4E7H A;  2OV7 A;  3PJR A;  4XMY A;  3NWS A;  3MMY B;  2VKD A;  4R7R A;  3BC8 A;  4JI0 H;  4LFA H;  2UUA H;  1IRX A;  1LDK B;  2R7X A;  4BQO A;  3N05 A;  5KHD A;  1XDN A;  1X1A A;  4UCV A;  2V9K A;  1W36 C;  2IS4 A;  3OL4 A;  2V4J C;  3HL2 A;  3HPH A;  2UXB H;  2BVM A;  3NBY B;  4XLF A;  1XMO H;  4NC8 A;  5DIS C;  1WJD A;  3FDY A;  2RRE A;  2LC2 A;  4II3 A;  2VJ5 A;  3DQV C;  2MAB A;  4J0M A;  3H5R A;  2X6Y A;  3CZ6 A;  2QKM B;  4B44 A;  1VZ0 A;  1VS0 A;  4CCM A;  3OYF A;  1N34 H;  3FBI B;  2ZXH A;  2F6C A;  2Z16 A;  3G2B A;  3H9Q A;  1MMA A;  2F5V A;  2XDV A;  3W2A A;  3NBZ B;  2VJI A;  3L4J A;  4PZ6 A;  4NQW B;  3PL8 A;  3H5N A;  3T1Y H;  3OR2 C;  1U0J A;  2AQF A;  3KX2 A;  1I94 H;  4HNU A;  4HNT A;  3L2W A;  1KON A;  2LBF A;  5TGT A;  3HOS A;  2CV1 A;  3MKW B;  5LMU H;  1J09 A;  2R7V A;  3S93 A;  1IBM H;  2R7R A;  3AFH A;  4BJ5 C;  4C9Y A;  4BE1 A;  2YCH A;  3OYA A;  1WJE A;  4KJZ A;  4YEJ A;  2CV0 A;  1BGW A;  2LY1 A;  4XM3 A;  2HU9 A;  2WB1 A;  1JI8 A;  1X4P A;  2F4I A;  4NXM H;  2UXC H;  1XNR H;  5FD5 A;  2KLO A;  4DR5 H;  3W2W A;  3OYL A;  4HEA 2;  2HIX A;  5HNH A;  4DV1 H;  4JI2 H;  3BA9 A;  4LSA A;  3MKY B;  4JI8 H;  3FBN B;  1HNW H;  3OS2 A;  2P0W A;  1SFK A;  2MYS A;  3H9G A;  2WA0 A;  1T0F C;  3EUH C;  2VJJ A;  3GBG A;  1UG0 A;  4XKB A;  4CZC A;  3N42 B;  4II2 A;  1N36 H;  4RAY A;  3K3V A;  3K4C A;  3L2Q A;  4BE0 A;  4EAT A;  1E4G T;  3DTK A;  4NNJ A;  4XOR A;  4F91 B;  4DV5 H;  1EA3 A;  5CPR B;  4BGD A;  4PDB A;  3OYD A;  2JSP A;  2VB6 A;  2CV2 A;  3M8J A;  5JHF A;  1CKO A;  3QYE A;  3LMM A;  3K4L A;  4OX9 H;  1YE9 A;  2CS3 A;  4CUG A;  2KSW A;  1NG7 A;  2LH9 A;  1HR0 H;  3K4J A;  2KZV A;  4EQ5 A;  2WDT A;  1V5G A;  1X1C A;  3V42 A;  4YEL A;  4BU2 A;  4N4O B;  3DTI A;  3PFY A;  4J00 A;  3H9J A;  3OWT A;  3W2V A;  3IG0 A;  1TT0 A;  1X1D A;  4JOM A;  4JQF A;  3PNV A;  3DU5 A;  4Q0Y A;  4LF6 H;  1XNQ H;  2F4V H;  3AL0 B;  4XLA A;  4PFP A;  3U21 A;  3CF2 A;  4B3S H;  3LSK A;  2WY7 Q;  3A2K A;  4UCR A;  2Z1D A;  2IGO A;  2VXD A;  4NC7 A;  2A6T A;  2E60 A;  3BLY A;  4XLC A;  4ZTF A;  1IBL H;  3C2G A;  4LF7 H;  2BW3 A;  4FAS D;  2HPI A;  2L9S A;  3S3N A;  2W82 A;  1E4F T;  3J7A K;  1Z3X A;  4DRF A;  2Y0S A;  2KRC A;  3FHN A;  1MND A;  2X51 A;  1Y56 A;  1BOB A;  3AKZ A;  4DV0 H;  3A4C A;  4F3Q A;  2KL4 A;  2E5L H;  3QOD A;  3UNG C;  1XK5 A;  5IT9 W;  1BR1 A;  1LFP A;  5KCM A;  4X65 H;  4RLF A;  4XOP A;  3DWL E;  2M3A A;  4NXN H;  4U87 A;  1XMQ H;  4AQY H;  1AN7 A;  2OC6 A;  1D1A A;  2AQE A;  4GRI A;  2X6X A;  4LIT A;  3ZGK A;  3BAB A;  4PJL A;  5LD2 C;  4XN3 A;  5HOO A;  4PZ7 A;  1Z2P X;  2VQC A;  2UWM A;  2DCE A;  4RB2 C;  2HZD A;  3UR3 C;  2LRE A;  3VYS B;  4DBQ A;  4ETS A;  4B48 A;  3OYJ A;  4XKC A;  4B3R H;  4ZC3 A;  3OS1 A;  4IZZ A;  1L2Z A;  1MZB A;  1WJF A;  2HNH A;  2DOA A;  1Z2N X;  4ZTJ A;  4X62 H;  4HSR A;  4XOT A;  2HIV A;  3A1Y A;  4DR4 H;  3HXL A;  5CQE A;  4D9J A;  2VJ4 A;  1R6R A;  2PMZ A;  2I8D A;  3GDE A;  2VPS A;  4LSX A;  3LSI A;  1OLT A;  5FRN A;  3TY8 A;  2R4G A;  1N75 A;  4CCK A;  4EFB A;  2VQE H;  4GLX A;  2Q2U A;  3T1H H;  2LBF B;  4UCU A;  3FMA A;  3HC7 A;  2HDW A;  2L2O A;  3RQ4 A;  4IAJ A;  2KRH A;  3N41 B;  2ELJ A;  4CSW A;  2IS1 A;  1GYF A;  4DGW B;  3PN1 A;  4JI6 H;  1DQU A;  1WJC A;  3VSK A;  1MMN A;  3IUO A;  5CQG A;  2IGM A;  3VYR B;  4PJN A;  2WY8 Q;  3K10 A;  3SEQ A;  4LH6 A;  4CC5 A;  4BS9 A;  3BG6 A;  3BCB A;  5LMN H;  3K4K A;  1V5F A;  4IKF A;  4EFE A;  2WAF A;  2UUC H;  3CP8 A;  4N4N B;  1B04 A;  1FKA H;  4UFZ A;  2HVR A;  2LRD A;  2CUJ A;  4BEH B;  4LF5 H;  4K0K H;  4XN0 A;  1WFX A;  3D5R C;  4DR7 H;  4XR6 A;  3SDB A;  2JVG A;  3F8N A;  3K70 D;  2IS6 A;  5FPR A;  3NWT A;  3EUA A;  2W7N A;  2UXD H;  4ITV A;  5KNL A;  3OL3 A;  1TAE A;  4KIS A;  3M4I A;  2BVL A;  1D1C A;  2WE6 A;  1X19 A;  3CP2 A;  4LF4 H;  1QU3 A;  4BDZ A;  4MV7 A;  4IQJ A;  2VL8 A;  2KMU A;  3K4B A;  2Q1Z B;  3OYB A;  2W4S A;  4LF8 H;  5FD6 A;  4BEH A;  3S32 A;  3MKZ A;  1ZHQ A;  2MC4 A;  2BW3 B;  3D5L A;  4B47 A;  2VOB A;  2KHM A;  2LY2 A;  3K6G A;  3OYC A;  4CCJ A;  3OOU A;  4IQ4 A;  3ZQQ A;  1FJG H;  2LYC A;  2IGN A;  4HPQ A;  3VYT B;  4DUY H;  3EYY A;  2K3P A;  4YRV A;  4QPQ A;  3ZRG A;  3RF2 A;  3H5A A;  4E4H A;  5D1P A;  3QOE A;  4RZQ A;  1ZEL A;  4BXF A;  3DKY A;  2XF6 A;  1D1B A;  4ANJ A;  4CCN A;  2VXZ A;  2VQF H;  4P1W A;  2XSJ C;  4PZ8 A;  4FET A;  3H20 A;  2LG4 A;  1CKM A;  2OUM A;  3OYN A;  4PSX A;  4DOZ A;  1M0W A;  2M7B A;  3VDX A;  4E7Z A;  2MD0 A;  4D1Q A;  2W00 A;  1MW7 A;  4UCT A;  2OWO A;  3LSM A;  4A2A A;  1MMG A;  2X1D A;  1O75 A;  4CH7 A;  2L5Q A;  1Z3Y A;  2V6E A;  1X1B A;  4H4K C;  3KAK A;  2HQA A;  4E6K G;  4E7K A;  2XAU A;  2Z2S B;  3W1B A;  3BAA A;  3LML A;  4DV6 H;  3I9V 2;  1D0Z A;  2JUG A;  4HG2 A;  1N33 H;  4JI4 H;  3VWB A;  4DV7 H;  1M0T A;  1FMW A;  3S3M A;  2WAE A;  2DT6 A;  2VIX A;  4C2T A;  4C2U A;  4PUS A;  3VYU B;  1IBK H;  4LH7 A;  3N43 B;  2WBM A;  2XF5 A;  1J5E H;  2GOM A;  1QHG A;  2HGS A;  5D1O A;  3DKX A;  3ONQ A;  3D5S C;  3BA8 A;  3CES A;  3DTE A;  2V7F A;  3E1S A;  4LG3 A;  4G6T B;  4PFO A;  4YHH H;  2VQH A;  4PJJ A;  3TMO A;  3ZR8 X;  4IX7 A;  4GKK H;  1LVK A;  2UV1 A;  3DU6 A;  4BE2 A;  3RJ0 A;  2UU9 H;  4LFC H;  4MTD A;  4KT6 A;  4M7E A;  4KHP H;  4Y33 A;  5HVQ C;  3VNN A;  1G59 A;  3HOT A;  4X66 H;  2W57 A;  4PJM A;  4DV3 H;  3EPZ A;  4NUB A;  2DJI A;  4XKW A;  3OMY A;  4HRI A;  2HVQ A;  2R7O A;  4RMN A;  3OYH A;  3W5O A;  3UQ8 A;  2R7U A;  2K9M A;  1WH2 A;  4LMY A;  2M7A A;  2M4G A;  3IAS 2;  3TY5 A;  2ZJT A;  2LOO A;  3SEZ A;  3S24 A;  2CUZ A;  3PNY A;  3PNT A;  2PJR A;  5EOY A;  3S8P A;  4E7I A;  4DJA A;  1I6U A;  4DV4 H;  4E7S A;  3RR5 A;  4BL0 B;  3OYE A;  3K4M A;  1S03 G;  2ZFU A;  2HPM A;  3OY9 A;  3JSL A;  3F9K A;  5LFA A;  2IGK A;  1NG6 A;  2QKL B;  3N40 P;  4RB3 C;  1PJR A;  4AVZ A;  4RLQ A;  2UUZ A;  3DLA A;  4C30 A;  4JI5 H;  4P5O A;  4BJT A;  1YX3 A;  3N6X A;  4HST A;  4CCO A;  3W1G A;  1N32 H;  2VQG A;  4FM9 A;  4DR2 H;  3DPL C;  3KAJ A;  2L9N A;  2IXS A;  4RB0 A;  4DR6 H;  2Q2T A;  2X6W A;  2KDO A;  3H0D A;  4RM3 A;  4XLE A;  3TL4 X;  4CA0 A;  4CC6 A;  4E7J A;  2IS2 A;  1DP3 A;  2ZM6 H;  4AU7 A;  2M4K A;  5LL6 b;  4KIT B;  1DGS A;  2VKH A;  2X85 A;  4LF9 H;  3C2H A;  3CJR B;  3GJX B;  1LKX A;  3J80 W;  3KEY A;  4ZDL A;  5FRO A;  3H35 A;  1GLN A;  4MV9 A;  3BCA A;  4YY3 H;  1DGW Y;  2ZXI A;  3PSF A;  2VQL A;  4BQN A;  4BDY A;  1HA8 A;  1K6Y A;  2JA2 A;  4E6N A;  1HNZ H;  3LSH A;  3L2R A;  3OS0 A;  3MWM A;  2ZSH B;  3SZG A;  2W1O A;  3RGX A;  3LSG A;  4EEQ A;  1SEI A;  4LIU A;  1CKN B;  3OR1 C;  4F93 B;  3RTX A;  4B3M H;  3ZCO A;  1AA7 A;  1OR7 C;  2DT7 B;  3LL7 A;  4F52 A;  4UCS A;  1P16 A;  4ZYA A;  5CKT A;  4OWR B;  2E5Z A;  3E0J B;  2V1N A;  3KYH C;  3RIZ A;  4GKJ H;  4BUP A;  1X4O A;  2NOJ B;  2CW8 A;  1P8L A;  3J7A Y;  4UCO A;  4RB1 A;  3OTO H;  2XC7 A;  3RPU D;  4DR1 H;  1W36 D;  3N44 B;  5FLX W;  4OAY A;  4R79 A;  1WJB A;  5IWA H;  2R7T A;  2M0M A;  2ZSI B;  4LIV A;  2HHH H;  3DPU A;  1S9H A;  2CMP A;  1Z2O X;  1X9N A;  3CJQ B;  4XLH A;  5A2Q W;  3OYG A;  1BJT A;  2RNG A;  2GOX B;  2MFZ A;  4ZDO A;  4B3T H;  1P9Q C;  4PSW A;  4J01 A;  4JV5 H;  4XKV A;  1WJA A;  2VAS A;  1V9P A;  5D1O B;  3L2V A;  4I7H A;  1FMV A;  3DEE A;  3I3L A;  2R7W A;  4ZJZ A;  2FE3 A;  1D0X A;  2KP6 A;  3TY9 A;  1CKN A;  5FRM A;  3RTR A;  4E7L A;  4DIQ A;  4JI3 H;  3JAM W;  1HNX H;  2WAD A;  1V5E A;  2WAQ A;  3RSN A;  5FPO A;  3VSL A;  4BWS C;  3W3C A;  3DF7 A;  4DV2 H;  1E0E A;  2KPM A;  1BR4 A;  2CH0 A;  1A0I A;  3FKJ A;  3LFU A;  1SAU A;  3KXY T;  4JI1 H;  3ZXS A;  2K5C A;  1MMD A;  3K4N A;  1UAA A;  2RGV A;  2X1E A;  1Y6I A;  1ERD A;  2BOL A;  4DBR A;  4MLO A;  3SYT A;  4BQQ A;  2O03 A;  5HNF A;  4DR3 H;  1D0Y A;  4X64 H;  1N77 A;  3RCO A;  4RM2 A;  4LFB H;  2CW7 A;  3TBI A;  4B43 A;  2WYO A;  5BR8 H;  1T95 A;  4OAZ A;  4F92 B;  3HG9 A;  3QWU A;  4CCL A;  3L2U A;  2DXI A;  3KAL A;  4Y3O A;  4BAC A;  3HPG A;  3OYM A;  1BR2 A;  2A5W A;  3CMM A;  3PUB A;  2PJR B;  1Z21 A;  2HVS A;  3M1C A;  4F55 A;  2RQQ A;  2CFM A;  2VLA A;  2VUG A;  2E1M B;  3L4K A;  3QYB A;  4JYA H;  2L7K A;  4X0G A;  1S68 A;  1Z7L A;  1FVI A;  2VPL A;  3DPT A;  1N78 A;  4RAZ A;  2KQR A;  3AL0 C;  1SYX B;  4U7B A;  3J81 W;  1YX5 A;  2E5N A;  4XNF A;  3EUK L;  1TZL A;  4APM A;  3OIQ A;  4QPO A;  3OYI A;  4XL9 A;  2XIG A;  1PYV A;  1MNE A;  2X1C A;  2JVH A;  4XON A;  2E1M C;  2O5R A;  3HKZ A;  3QYF A;  3CVZ A;  2R7Q A;  1QHH D;  3IAM 2;  1ZHS A;  1TA8 A;  2MCT A;  3K70 C;  4A2B A;  3OIP A;  2V26 A;  3C0F B;  3BG7 A;  5HLT A;  3KYL A;  3OYK A;  3S3O A;  2CFO A;  3HUG B;  3PSI A;  4B3X A;  4BJ6 C;  3JSN A;  3L2P A;  4MTE A;  3RGZ A;  2K9L A;  3MD2 A;  4ZDP A;  3NC0 B;  4Y4R A;  1UEL B;  3GB8 B;  1DGR M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...