2HVQA

Structure of adenylated full-length t4 rna ligase 2
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
329
structure length
316
Chain Sequence
SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFSEKKVELSEADNKLVGILACYVTLNRVNNVISKIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 37.6 kDa protein in Gp24-hoc intergenic region
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase
total genus 91
structure length 316
sequence length 329
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvqA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvqA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvqA01
3TY8A 3RR5A 2HIXA 4UCOA 4E6NA 4UCRA 1XK5A 3NC0B 5D1OA 1VS0A 3S24A 2HVQA 2VUGA 3L2PA 1TA8A 3BABA 4CC6A 2HVSA 1A0IA 4UCTA 1P16A 2Q2UA 5D1PA 3JSNA 4PZ6A 4LH6A 4PZ7A 5DISC 1CKNA 4EFBA 1X9NA 2CFMA 3NBYB 3VNNA 1FVIA 1CKNB 3TY5A 4DRFA 4UCVA 3GDEA 4EQ5A 4UFZA 3BA8A 1XDNA 1P8LA 1V9PA 3BAAA 4CC5A 2HVRA 3BA9A 5FPOA 1CKMA 3GJXB 4EFEA 2HIVA 3PN1A 3JSLA 4LH7A 3NBZB 3RTXA 4UCUA 4PZ8A 3GB8B 1B04A 3TY9A 3KYHC 2Q2TA 1CKOA 3W1BA 1S68A 4GLXA 3W1GA 5FPRA 3W5OA 2OWOA 4EEQA 1TAEA 5D1OB 1DGSA 3UQ8A 4UCSA 3QWUA
chains in the Genus database with same CATH superfamily
2ELHA 5D6FA 4ZZLA 2K5CA 5K5QA 1R6RA 2PFBA 4DV4H 3J81K 1TBXA 1QVUA 3E6CC 1XMKA 1D0ZA 1W5TA 3IKVA 1VQ4I 2WTEA 1JTYA 5C3EJ 5EEHA 2WAFA 4O4IF 4A3KG 2HFHA 3FMRA 3NC0B 3TINA 1DP7P 3BTJA 1MKMA 4GFBA 1Y56A 3EUHA 4I09A 3SDBA 5B3SH 4TUYF 1S9FA 2KRHA 2EILH 3PO2G 2I5UA 2CJJA 1WZ2A 3K9TA 1S0NA 3W2WA 5ICFA 4UCTA 4QSHA 2X6WA 1OMIA 4DR3H 2O61A 1RR8C 5FRMA 4OOIA 1YHQI 4RGRA 5LGNA 5ILVA 1OLTA 2L4AA 2YU3A 3GF2A 3MKYB 3PR5B 4FFNA 3GTJA 2MGQA 3FXRA 4F4YA 4MA5A 3D5SC 1H88C 3KETA 3S2DJ 5EG0A 4EMSA 3WE3A 1P7IA 4BDZA 2IS2A 4DR2H 5DMXA 4A12A 5I5YA 2DFEA 4MV1A 4L9TA 4LB5A 1YW8A 3K4KA 4TM5A 5JLXA 4TV9F 3MFHA 2KRFA 2EV5A 4DL4A 2E2HA 4I98B 1MH4A 3V7RA 3WU2C 4PWQA 3GTOA 1YFHA 4X6AJ 3OS1A 4ITVA 3OS0A 5FLXK 2DWCA 2WE6A 2JEJA 1X3WB 3I56I 4MFDA 3TOAA 4A2BA 2IS1A 3T8TA 3HOZJ 4PZJA 5CVRA 3WWIA 2R8KA 2AGOA 5LXTF 1KU7A 4G9YA 3RCOA 1B6AA 1FJLA 1BW6A 4PJ0C 4Q8FA 3BQ0A 5BMVF 2WAEA 3L2VA 2D1VA 4KICA 1XDNA 5JUMA 3MWMA 2RQPA 2VI6A 2J6TA 1FBQA 4Z2YA 2ZGIA 3OHAA 4KA4A 3NRVA 3Q1KA 2RNGA 2J6UA 3CJRB 4FETA 4IRGA 3OYJA 2N8GA 2JQ7A 4DL7A 2FNPA 2TCTA 3TO9A 4CO8A 1IXSB 1P9QC 3PW2A 3H20A 5E3MA 4EGZA 2YU9A 3HTUA 3NBZB 1IAWA 2HHFB 2CO5A 3GB8B 2R8IA 1FWZA 4BQOA 1CGPA 1B04A 5C1OA 1KTAA 1AOYA 3DU5A 1VQ8I 1Z91A 1YX3A 3Q8QB 3KLOA 1O3TA 4MFEA 4XIDA 4C9YA 3R61A 2Q2TA 2NVYA 3MAJA 3SXYA 4B3AA 2HR3A 1E3OC 3NAUA 1BJZA 2ISYA 2Z3YA 2R5ZA 4RNOA 2J6SA 3H5AA 4EGYA 1T3NA 2DXIA 5EZYF 1WFXA 5K1YA 3HOZG 2NNYA 2MG4A 5JFRA 1GT0C 2EA4A 1V5EA 4EJVA 5JLWA 3HKZN 4IHJF 5GAHJ 1SVLA 4HSRA 5FKOA 2RKHA 1MDMA 2W8KA 3S8PA 5D1OB 1DGSA 5E79C 4DYCA 4LSAA 2UU9H 4IWYA 2JEIA 1OWTA 1U9NA 1VZ0A 2CFXA 3FHNA 3BZ6A 3GLXA 2K9NA 1JJ6C 3MR5A 4A3DJ 1ETYA 3RIRA 2VT2A 2Q0OA 4L5JA 1VQPI 4U7CA 2XIGA 4UCOA 2M4KA 1XTAA 4WWCA 2J5PA 2ZFUA 3ROUA 1L2ZA 2H6BA 3NARA 3RKYA 4XRSG 3SEZA 4O7TA 3I55I 5JVDF 3FKIA 2P6TA 2DJIA 3BPXA 2R4GA 4LD5A 2ZXIA 4XOPA 1B8IB 1WRJA 1S10A 4XSXF 3WTVC 2GPWA 3CCVI 2ESHA 2GWRA 3KCCA 2R92J 1JDEA 2W9CB 2UVVA 3W6JB 3R9RA 3BDDA 1HKQA 3L2PA 4MNUA 3KYDB 2EJ0A 5I5WA 4JV1A 4AD9A 5TGTA 2COMA 1XG1A 2KZGA 2DK8A 3LSRA 1J0RA 3L2QA 3MR2A 2CU7A 1U9OA 5KG5A 2XAGA 3OOPA 1P16A 1W96A 5LHIA 1ZREA 2RDPA 2ZJ2A 5F0HA 4NNJA 1GVJA 4GKJH 5DQIA 5IT9W 4EM1A 3PIPF 4IQ4A 4PFPA 3WHBA 5DISC 1KU9A 1I1GA 2OC6A 4EFBA 4RB2C 1GYFA 3U1DA 1XCBA 2LFBA 2IW5A 5DGIA 5E1WA 4IF4A 1R22A 2PJRA 3WGHA 1UAAA 5KT4A 3J81W 4A3DG 5H80A 4ED2A 1S7OA 4OIPF 3I4PA 4FM9A 1HKSA 2Z33A 3P9CA 4R8UA 2R7ZA 3JSPA 4P96A 2MBFA 2FOWA 4A6EA 4DYQA 3BR5A 4XN3A 4O7WA 4BJTA 1GXPA 4IIJF 1BIAA 5F6FA 3ONQA 3BG6A 3SFZA 5E18F 1LPQA 2XV4S 4K6NA 5BYBA 3PR4A 3GTPA 5L1LA 5KFGA 4ECSA 2JA2A 2QZ8A 5KG1A 1QHHD 4HPQA 1PVEA 3OYCA 1I1LA 4WBNF 1TWAJ 2A69F 2ME6A 3RPQA 1U5TA 1P4WA 3IWFA 5J6XA 5LD2C 1DU0A 1WH5A 1IRGA 4ZI7F 3FK7A 4Q45A 2HDWA 1Z0XA 2BHYA 2JA7J 2KSWA 3ZMVA 1U5TC 3DXJF 1GLNA 3A01B 2DTRA 3LQQA 3IKTA 1ZH5A 2LBFA 4YAKB 3HPHA 1G6NA 2JEGA 3OOUA 3QOPA 1I6UA 5FD5A 4J9MA 2HIVA 3W6KB 2DPIA 1W0UA 3CMMA 3PQJA 2XPUA 3EUAA 4A69C 2WAQE 2Y75A 5BWTA 1F1ZA 3BG3A 3H1CA 2CKZB 3RKQA 5E17F 1TTYA 1TT5B 2JPCA 5FLXW 3OWTA 1K78A 2VL8A 1AKHB 3P9KA 1IUFA 3FXOA 4EG0A 4NZMA 1IGNA 4FISA 1USSA 2GIZA 4LFAH 2IA1A 3E6MA 3TP0A 1V5GA 2VIXA 1RZ4A 2JJ7A 5E20A 2ZJTA 4XLFA 3BZKA 3WE2A 3ZQIA 4CMFA 2OF7A 2HOTA 4KN4X 4KYWA 1SFKA 4XQFA 1YG2A 3M4OJ 2VQEH 4IHXA 1KYZA 1QRYA 3BTIA 2W6NA 3JRXA 3QWUA 2ZMEA 4BQNA 4M6VA 3JZIA 2DMUA 1JX4A 1ZG1A 2ZCWA 3LOCA 3K4BA 2LYCA 2X0LA 1KQ9A 2OQGA 2DJNA 2EBIA 5EEGA 3HHHA 1O3RA 2ZBKA 1LDDA 2Z16A 1FOXA 1JKOC 1RJRA 5FFXA 1CF7A 5KFKA 2IJLA 2NNNA 4Q4ZF 5D8DA 4LF6H 3GWZA 4L5IA 1A9XA 5DG9A 1P7JA 1RI7A 3DF8A 3ASOH 5IP6A 2X1EA 2YRWA 5M5XJ 4P1WA 4XNFA 3CMAI 4XRFA 2HZTA 1R00A 3FK6A 1T08B 5GPAA 5IT9Z 1IO2A 5F1RA 4CMDA 4XN0A 1IBLH 1LFPA 1HLVA 1M6VA 3UZBA 2C2RA 1RYSA 2L01A 5CVUA 5KFDA 3BOQA 4RM3A 3TDUC 1X9NA 3J81Z 1S0OA 1TLHB 4HX4A 3DPUA 3VEPA 4YG2F 4AM3A 3I59A 2H27A 3T9FA 2HWVA 3NBYB 2LVSA 2RV8A 2X6OA 2CWEA 2LC2A 4O3MA 4AU7A 1XDUA 2D2WA 4P9FA 1FLIA 5FLMJ 4BBSJ 3IRQA 3DBLB 5BOXA 2YZLA 3WG7H 1K1QA 4BKXA 3JW4A 4A6DA 1D5YA 1UNNC 2RDIA 1E4EA 4EQ5A 2DFIA 3RB3A 3BP8A 5C44J 5I5UA 2VQFH 3M1EA 4AYBE 4QWEA 5KT5A 2FMYA 2EIMH 1WCMA 2JRMA 3GLKA 1EKVA 4NB5A 4I6ZA 2H8RA 4J9SA 4ECWA 2PBIA 4UY8I 5LYJF 1TWGJ 3TMOA 3A02A 3HO8A 3T0YA 2KDZA 4RLFA 4IHTA 2GAUA 1HA8A 2IXSA 2CNVA 3MKZA 2R93A 2ZXHA 1U8RA 1X2MA 2Q8KA 3G4SI 2V9VA 2VQLA 3SGIA 3Q5FA 5KFUA 1YITI 2BYVE 2X48A 2VPSA 4ENJA 4CXFA 1EH7A 2E7XA 2M5WA 4GCVA 3L2RA 5IP9J 4M3FA 3S16J 2YS6A 3CQZA 2KHMA 2F5DA 2W7PA 4OU0A 5FKKA 5JVTA 5FLXZ 1OR7A 3F21A 2VLAA 3HEFA 3HJEA 1U6GA 2YR2A 4TV8F 1BOBA 4FS1A 2DCEA 1VBGA 1HBXG 4L5EA 5CQEA 5FLMG 2CMPA 3R5XA 1P2FA 2WB1E 4BBSG 4Y8VB 2DAAA 4RB0A 3AL0C 3PNTA 4DV3H 2AQ4A 3U9GA 1Y8RB 2XROA 4Q47A 5LLQA 1F9NA 1FPQA 3ABLH 4HW0A 4HDUA 3C7JA 1N75A 4ESBA 1EYZA 2AXTC 3A03A 2V79A 5EOYA 2OD5A 5J4YA 4A3GJ 2QVOA 2G0EA 1IV8A 3K1NA 3KP2A 4JI2H 5KKNB 3E5QA 4RAZA 3BACA 3AG2H 3EPIA 4F93B 4IVNA 5EYRA 5BQTA 2F4IA 1G2HA 2YZMA 1BW5A 4NUBA 2Z2SB 2L3DA 4HA8A 2QK4A 2I8DA 4KN7X 4FFOA 4DIQA 1JKPC 1E3HA 5IP9G 3O8GA 2FE3A 2H94A 3S32A 5E3LA 2LF7A 4MTDA 4O84A 4D7NA 5KFRA 3RI4A 2LLKA 4Z6YA 4RZRA 4UXNA 4LFCH 1I5ZA 2AQEA 4YIFA 2B63J 1FJGH 1KU2A 3OYMA 3B6CA 3MZ8A 3KZIC 4RGSA 2XRNA 1VF9A 2FPGB 4PBCA 5KG7A 1R23A 5ICGA 3I4NG 3M9OB 2HZDA 1FP1D 1ON1A 2E1CA 3U1KA 3FMQA 4S05A 3QYEA 2XD4A 3BY6A 4A3GG 3H0GJ 2KZVA 2P8TA 2Z02A 1T0FA 5D5WB 1TL8A 2WV0A 2HEOA 4UNOA 1IZ1A 4GLWA 4YP3A 4Q4DA 3F8BA 3MWEA 3BT9A 3JRHA 3H4BA 4MTEA 1Z9CA 2QCOA 1Z3YA 1OCCH 3WHCA 3HRMA 5DD8A 4A3MJ 3LA2A 1JJ8C 4IX7A 3ECOA 1W36C 5BNGA 4DQ2A 3TIIA 2K7LA 4RGUA 5A2QK 1Y0UA 1ENHA 1XMXA 2W9BB 1MMAA 3SYTA 2LTPA 2Q2EB 2Y2ZA 1E3PA 2B63G 1OCZH 2LKSA 3CC4I 5KFCA 3VPBA 3FHZA 3T9EA 4O3PA 1PYVA 1QZYA 3GVAA 4N4NB 4Q4CA 2GBYA 1ZLJA 3HOYJ 3M9MB 3GTLJ 4C5CA 4B1RA 3W3CA 2HG8A 2L9RA 5L1KA 4RUAA 4BE1A 4CH7A 4XR6A 3I53A 1R5ID 1CKMA 3H0GG 3GV8B 4IRCA 1BI0A 2QGUA 4DNCA 5EGOB 1JT0A 4IRDA 4XLEA 1GSOA 2X1CA 3AG3H 2OCEA 1A6QA 4CZCA 1WJDA 4MO7A 2VE8A 2R6FA 2VXZA 4G3IA 3CZ6A 1RC9A 3VPRA 2M0CA 1CQJB 4AIDA 2OAZA 2YUSA 1K7AA 2UUAH 4A3MG 2EZLA 4R7RA 4M72A 3RV4A 2NU7B 2W6OA 5DG7A 4ZDPA 2FF4A 2HOAA 2HPIA 1VBHA 3PFYA 3N6XA 3GUDA 2MW8A 1A36A 4DW6A 3K69A 4EEFG 1FOKA 3KEQA 3MKLA 1V5FA 2Z5UA 3R6SA 5EZGA 5LEJA 3PSIA 1NK3P 3MCZA 3TO7A 3PFIA 1HC8A 3DEWA 4BU2A 1FTZA 2BXZA 1C3OA 4JI5H 1HQCA 4I99C 3QZ7A 3HOYG 5C5JA 5I47A 3QU3A 2H8WA 5D4RA 3TY8A 2LKPA 1MNEA 5LBQA 3DKWA 3FM5A 4U7BA 5EEAA 2VASA 4KIFA 2RNJA 2BOLA 3JRFA 4QWQA 3JRCA 1IN7A 3J80K 1A48A 1I2KA 3NWSA 1QO0D 1FOWA 2DFFA 2R7NA 5IP7G 5J40A 3CDHA 1ZG5A 4HDVA 1IF1A 3CO6C 1GSHA 3CUOA 2IT0A 5CA1F 5FKMA 4J9OA 4QLCU 4JXUA 5BWUA 3CUQA 3LQRA 3V4ZA 5DDGA 1DU6A 5GONF 3MR6A 3C0FB 1R5HA 1IOWA 1NG6A 1XGSA 2OV7A 1BJAA 5DUKA 4O86A 3T9DA 2NAZA 2VOOA 1R1TA 1MJ9A 2V6CA 4DJAA 2K40A 3DKYA 4D5FA 4N0BA 3FIWA 3V42A 4JBAA 4Q44A 3IH4A 3F8MA 4PZ7A 2CQ7A 3KAKA 3TW6A 1FX7A 3J7AK 2R92A 4DOZA 4LMYA 3K1MA 2JMWA 4PK4A 4F91B 3IRRA 3CSWA 3OIQA 1N48A 4IL6C 2K86A 3CJQB 3DBHB 3CLOA 3T8RA 3L2CA 1O3SA 4HYEA 2P4WA 3I64A 2MLGA 2D5VA 3H9QA 1AHDP 3T5LA 2R5YB 4CHUA 1E0EA 1VKZA 3VNNA 3K4CA 1OCRH 4NLGA 2OU2A 1EKEA 2A61A 4HAMA 5H2FC 1LB2A 3GTKA 3X2QH 4O4JF 1AUVA 1JI8A 4I0AA 4A5NA 3G6VA 2FSWA 3ZQLA 3AW8A 2ELKA 2XPVA 4HLXA 3DCFA 5F08A 2QBYA 4ZC3A 2ME0A 2W6QA 4C3JJ 3S1QJ 4F55A 3HIFA 4EATA 1IUYA 5CAEB 1S5LC 3PNVA 1VNDA 3BG5A 3TL4X 2R7WA 3RPUA 4NQWA 3ZMUA 3HOUJ 5HV6A 1GLVA 3U2RA 5L9XA 2FNAA 4WXCA 2O0YA 1I39A 3CC2I 9ANTA 2IP4A 3GIQA 4DV2H 2QQAA 2W82A 2GM4A 4BXXG 4G94A 3TKYA 5GTIC 3OYLA 2ZFWA 3WTYC 5KFHA 1J5EH 1X4OA 3RPUD 3KLNA 4QWBA 3ZCOA 2ADUA 5IYZF 4EJUA 1SVOA 1XB4A 2HDDA 4EFEA 1T2KA 4OIOF 4LJZF 1PDNC 3LWBA 1J9IA 2EIJH 3EQLF 2JZYA 1HW2A 3FXUA 1R1VA 3ISPA 3GTQJ 5L1IA 5BPFA 3U21A 2UXXA 3MZHA 1TP4A 3TY9A 1MDMB 5BWWA 1MJAA 4RNMA 1S6LA 3DPTA 3WTUC 3G1MA 4IAJA 3G6XA 1W5SA 3R0JA 2VODA 1OYIA 2A1HA 3W1BA 3TQ1A 2AU0A 1F4KA 3N05A 1CQIB 2HS5A 1ON2A 4RBOA 5A2QW 1TWCJ 1IG7A 4JI7H 3HHGA 2OZUA 3KX2A 4NHJA 3CD6I 3F23A 4PSXA 3R5FA 3TEKA 5EWEA 5BWXA 3AAFA 2G9WA 1O3QA 5HBRB 3WU1B 3IH2A 2NUAB 1TAEA 3TQTA 2OWOA 2DODA 2NOGA 3DP7A 5FD6A 3MJFA 5DCMA 3JRAA 5JQGF 1S03G 5KAFC 4EJWA 1SVMA 4FE2A 2P6SA 3MMYB 3RQIA 2LOOA 2HOEA 2R7DA 3GV7B 1SYXB 2G7HA 1A3GA 4P5OA 2RDJA 4LLLA 1USTA 2K27A 1B72A 3I4MG 4LIVA 1VI0A 4DL2A 4XK4A 1GXQA 1MMNA 3W2AA 3HUGA 3N97A 2XSDC 4O6JA 1LE8A 4GRIA 2DT6A 1WRVA 5DGHA 1D0YA 3K7AJ 1JIHA 2HVQA 3H35A 4N9IA 4MA0A 3CF5F 1WHUA 4Q8EA 3MD2A 2JA5A 5LEKA 1LJ9A 4UV8A 1EV7A 4XLHA 1Z2OX 5LRRA 4A3FJ 3SZGA 4IO9F 2NVXJ 1SD6A 4WXHA 5B66C 1UG0A 1WI9A 2YS7A 2KJBA 1ZELA 3BJOA 1ZRFA 4A5MA 5D1PA 1BBYA 3V8JA 1WWXA 3JCUC 4KNYA 4A3IG 2C22A 2VB6A 2F4VH 2Y4RA 2WV1A 3K4MA 4O3OA 5L3FA 3VA7A 2HQRA 1S97A 1R9TJ 3E97A 1V55H 5IY5H 3RGXA 2FBKA 5JH7F 2EFQA 4D5CA 1FKAH 1NK2P 3D5RC 3J80W 3J7AY 2BR0A 1ZR4A 4F52A 2XAJA 3CMEI 1U5TB 3C2HA 2EFPA 3EUHC 3RJPA 1Y39A 3FXJA 2YX7A 3KZYA 1WJAA 3UFXB 4L18B 3O2PE 1CQTA 4C5BA 4E4HA 2V9WA 3KEOA 2LBFB 3ECHA 2MABA 5IYCJ 4RA2A 1JXLA 3FBNB 3F8CA 4V2GA 4CKCA 4A3FG 3GZ6A 2P7CB 2OJED 5KNLA 3RF2A 1K4TA 1RUOA 4F3QA 2E1NA 4KIBA 3GFIA 2FQ3A 3LSTA 3PUFA 1K78B 3OHBA 4DUYH 1SD4A 5FPOA 4F7ZA 2C6YA 4P9UA 4PFOA 2R7LA 2JSCA 3LMLA 4A2AA 5L3DA 3OTOH 3G6EI 4FASD 2GLOA 5KFSA 4ECYA 4UCUA 5J1UA 3BZCA 4CICA 4EYHB 4HV6A 2W57A 4YR0A 3LSIA 4F4WA 1JTXA 4L9NA 3E6DA 2EB7A 3DTFA 1U0JA 3GIJA 1V54H 1TWGA 2E2IJ 3OIOA 5HVQC 5HODA 1XSDA 2XSJC 2R87A 4O7RA 3HOVJ 5A2QZ 1VQKI 1OFCX 4F4XA 2HQNA 2KIQA 2PMZN 3KP6A 3GFJA 4BQQA 1T39A 4U7DA 4BQAA 2FPPB 2FBHA 2FBIA 1X1PA 2LSOA 4XONA 4A0XA 5KFVA 2JN6A 4O5VA 5IYCG 4IHSA 3HOTA 2Y0SA 1ITYA 3ABTA 2KIFA 1RNLA 1WJEA 1B4AA 1Y0NA 3LA7A 5D5XB 2W84A 2E2JJ 4GDFA 1IN5A 2VR1A 4ECXA 2QKMB 2ZDQA 3DTEA 3GXOA 1YTYA 2DIKA 4I0BA 2GOMA 1RK5A 4ECTA 2K9SA 1LDJA 1ERDA 2DA2A 1FYKA 2E5NA 1PUEE 4O3SA 3LQSA 1MW7A 4W97A 1MMGA 4DL6A 4E7IA 1CE8A 5FKLA 5DS9A 2NVQJ 4JI4H 2ZSIB 4MV4A 4O4HF 3LSGA 4JX5A 2F5VA 2JWTA 4PCQA 3GIMA 1S9HA 1WJCA 1RKTA 2BGCA 2X9DA 2ZDGA 5J8CA 1WPKA 1K83J 1XSXA 3CESA 4PDBA 3PM1A 5FROA 1Y1WG 1AU7A 3ZQQA 1J75A 2EJ3A 5LGTA 2IP2A 1ACIA 5D8KB 5FO5A 3HOVG 4M0JA 4HNTA 5J1YA 3BJAA 4J9NA 2VOPA 2IAIA 1R5GA 4YRVA 1TC3C 1A04A 5J47A 3ULQB 5BWVA 5C8YF 3FKJA 1IDZA 3T5JA 2AGQA 2IMWP 1BM9A 4J9KA 2XC9A 4I7HA 3N40P 2JUCA 3HGYA 3QODA 5KG3A 3JSNA 4ME6A 2AGPA 3DLLF 3BQZA 3HOXJ 2IRFG 2NOJB 1T38A 1IOVA 1ORKA 4XSZF 3ZQCA 1MSEC 2DA4A 1B9NA 4C3IJ 4HR7A 4EJOA 5H6QA 2E71A 4LF5H 4EV0A 1E4EB 5HDKA 3J80Z 5KCMA 2EFWA 3F8NA 2MLKA 2W85A 4FX0A 2XAHA 4FE7A 2QEXI 5KFJA 1U78A 1CKNB 3OSNA 2JT1A 3R4KA 2Z04A 3FISA 2LR8A 2RREA 3GIPA 5D5UB 2A6EF 3OUZA 3S93A 5EWGA 4BDYA 1UFMA 2HU9A 2BVLA 4RAYA 3VPDA 1ETVA 4LB6B 3H36A 1JHFA 2VPQA 2QQBA 2LF8A 2ELJA 4CCNA 3RFCA 3ZQFA 5L3EA 2I10A 1M0WA 4LF4H 3BJYA 4QPOA 1LEAA 4ANJA 1I3QJ 1KC7A 2HYJA 4IHVA 1QQIA 2YZGA 2E1MB 4LSXA 3AL0B 1MBHA 4IZOA 3HOXG 4AC0A 1IDYA 3GBGA 2W6PA 2PQ8A 2DK5A 3RYRA 3GFMA 4M9ZA 2QYOA 1I2LA 3N44B 4DV0H 2K9QA 5C4XJ 2DLLA 1FBUA 5H6RA 4DYRA 4JX6A 4X0GA 1QZZA 3EYYA 3G3ZA 1SMYF 2ZO4A 1I27A 2HHHH 1J2XA 2XF7A 4A3CJ 2DZDA 3FXKA 4LG0B 2W1OA 4ZTJA 2FK3A 2RN7A 3M7GA 3DBRB 2M87A 2O7OA 4XLAA 1YIOA 4RS8A 1UHWA 2RQQA 5I5XA 4PDKA 1YRNA 1PK8A 4BAYA 3N43B 2KT0A 2KL4A 5LRSA 3C1DA 5ILUA 1ZQ3P 1JKQC 3L7WA 1F5TA 3KTMA 3K6GA 1ZHFA 2IPQX 1ETKA 4GC7A 2Y48A 1YW7A 2Y9YA 5F0FA 3SDGA 2L5QA 4WD3A 1RPWA 4RAGA 2LY2A 2XB0X 5JHUA 1H8AC 3KP4A 3L4JA 4RMNA 4U0VA 2XGEA 2JA6J 5AIPA 1T8IA 3MR3A 1PJRA 3LMMA 3EPGA 1MIJA 1U2WA 2HYGD 3JR9A 1TWHJ 5C4XG 4HF0A 2E7WA 4UVCA 2AXLA 5CVIA 1WJBA 4DIMA 2CQYA 2EZKA 4IOCF 2M7AA 2W70A 1JT6A 1ZYRF 4PSWA 1S7EA 4ED3A 1Q1VA 3RZDJ 4A3CG 1TQIA 1FY7A 2MSYA 1JDBB 3LNQA 2R7KA 4UUGA 1FTTA 3GMEA 4RAFA 4PGHA 1V51A 2CSOA 1DV1A 1ZK8A 5CLSA 2V1XA 3JTHA 2DPUA 2R7XA 4MEYF 1TQPA 2HOSA 1Z6TA 4NC7A 3PL8A 3H40A 3N8DA 4O2AF 2DA5A 2Q2UA 3GLLA 4MGRA 2PX9A 1ZG3A 4XL9A 3HRUA 4I76A 1VQOI 2FRHA 2XRLA 4EM2A 2SCUB 2ZMEC 5JHFA 1S8NA 2MD0A 4BHCA 2ATLA 3O8HA 1BL0A 1T33A 1PX2A 4RNNA 3LSMA 3CP8A 5CVVA 2TDXA 1Z2PX 3Q8PB 2IS6A 2JA6G 4QWCA 2GLTA 3ETHA 2CW0F 1ETWA 5KT3A 1SD7A 1B33N 2ETHA 1X1BA 4KT5C 1FVIA 3DV8A 3J7YJ 3HM5A 2WBMA 2R7MA 3TY5A 1I50A 2O6GE 3UNGC 3S3NA 3NQOA 2GQRA 3VODA 2MC4A 2DDAA 4H4KC 2L0KA 3TO6A 2YZNA 4B3MH 4ED1A 1SAXA 2IBKA 2LKXA 2CW8A 1LFBA 3BA8A 2AO9A 4A3LG 1J7KA 1UC8A 4LFUA 3ZMDA 3K4LA 3OL3A 4HX8A 5IOZA 1JXSA 4PJJA 4CDGA 3DPLC 2JA8J 4QIWE 4UUSB 4DR7H 2EK5A 2W24A 2Z9OA 3PW0A 4AYBA 4YELA 2HHFA 3NWTA 4Q0YA 5GADJ 1R7JA 1N78A 4J9QA 2CQXA 3GILA 1LKXA 4JI8H 3WO1A 3AG4H 3CJTB 5LP6F 4UVAA 1RETA 4LG3A 3BQ1A 3G71I 1MJBA 2R7VA 2VPRA 4R1HA 5D4SA 2FU4A 2LY1A 1FYMA 1OYYA 2CV0A 1LVKA 4ED0A 2NRAC 3J7AO 1BJTA 5DG8A 1OBDA 5M5YJ 2VE9A 4E7LA 4CUGA 2VUMA 1SAUA 4EVIA 1L0OC 1KJQA 4JQFA 2Q1ZB 4XM3A 4EJTA 5CYVA 3Q3SA 2XC7A 3GTJJ 4LITA 2CUZA 4ED6A 4MQ9F 4H0EA 4F50A 2GQQA 3CEBA 2DMTA 4K2EA 3CP2A 2L7KA 4DR4H 5K5OA 2V58A 2DQLA 4XMYA 3IHUA 5IOYA 1D3YA 3OUUA 3L00A 1OISA 1YLFA 5EF6A 3GTQA 3E5UA 1EUDB 5FFZA 1YW9A 4EEQA 3FF5A 4MV7A 1K79A 3GTMJ 1WVRA 3UQ8A 2UXBH 2V26A 2JA8G 2FEZA 3DU6A 2UVUA 4XBFA 4ZQIA 1MBFA 2QSHX 3HC7A 5DEQA 2OPTA 1ETQA 1F43A 2M0MA 4YEJA 2EFNA 3M8JA 2L7MP 3M1CA 3RR5A 2WDTA 3DTKA 3T99A 4WHXA 2X85A 1TWCA 3V8KA 3H3UA 4R8HA 4BYYA 1IXRC 4BEHA 3Q8RB 5F1JA 1OR7C 4LGWA 4A3EG 4DUZH 5FR9A 2E1MC 4XKWA 3H9GA 2DYRH 1R71A 2ZJRF 1EJ9A 1S0MA 5ED4A 1EKFA 3F6VA 4LIUA 1TW2A 3UR3C 2CS3A 3I4NJ 2GQSA 3I54A 1JUPA 1WQ2A 2AQFA 2VJ5A 2H09A 3WG9A 3RAXA 2CW7A 1VQ5I 2M30A 1HKTA 1EF4A 1KQ0A 4L1KA 2WY7Q 3HSRA 2Y9ZA 4I02A 4G6TB 5L3CA 1GSAA 5BPDA 1IRZA 1KQ8A 3WNZA 3V7SA 2O9LA 4U87A 5ERIA 1QA6A 2X5RA 2DPJA 2FK1A 2PN6A 2XGXA 2DW4A 3QPLA 4II2A 4M9XA 4OAYA 5JR3A 4MEXF 2R84A 1WKMA 2XF5A 4E7HA 3T9BA 2IGNA 3FX3A 2PN1A 3VB2A 2DOFA 2QBYB 3H92A 2B9SA 1ZAOA 2NVYJ 1BI1A 2HPMA 4MV6A 3A0BC 4QW9A 3BJ6A 3W2VA 2V4RA 3HL2A 2NVXA 4FE4A 4FT8A 2COGA 3ZOBA 2IA6A 2EV0A 1R49A 5DAAA 3UZOA 4M3BA 4YJ3F 4K0KH 2FQ4A 5J1RA 3FWEA 5FNVF 3PW5A 3KHHA 4E7KA 3FM3A 2W6ZA 3RB4A 1SFEA 2KJCA 4DBRA 1BOAA 4CYCB 1Z3XA 2FK2A 3ZR8X 4ZHQF 4TQRA 3I12A 2P0AA 1VTNC 4FFRA 1TW3A 3JRWA 3MKWB 1RYRA 4DZPA 2VC1A 5TJJA 3F22A 2QUFA 1OCTC 2XDVA 1QHGA 3AX6A 5L1JA 3T1HH 4G7OF 3RGZA 5BPHA 1N33H 2HVRA 1OQYA 1QPMA 3QQAA 4NYEA 1JLLB 2FLNA 4RB3C 1MH3A 3BR6A 3FKIJ 5IYBJ 5B1BH 1TT0A 3M07A 4CHIA 2ZNZA 1T0FC 4MV9A 4ED8A 3WTTC 1R4NB 1BI3A 3OSFA 1BN5A 2HQAA 2Y0SN 2J9GA 3GJXB 4O7LA 4A3BJ 3IL2A 2OH2A 2LH9A 4O3QA 2PMZE 2P5LC 3JSLA 4LH7A 3QZ8A 2L7ZA 3CJNA 4CYDA 5F27A 1X3UA 1RRJA 3KE2A 2UVRA 1QZEA 1FIAA 1XCVA 1XGNA 2VQGA 1QPIA 2M7BA 3ZQGA 1HSTA 2XCLA 1IN4A 4XLPF 3N6RA 1ZTRA 5DCMB 3RB0A 3SQNA 5BR8H 2V1UA 4GLXA 2NU6B 1N32H 2ZKZA 3F8FA 1UCRA 4PUSA 2W7NA 4EGJA 4G8XA 3H3VK 5BWRA 5JVGF 3I0TA 1B72B 2QWWA 4DL5A 1X4PA 2LD5A 4HQMA 1RR7A 3DKXA 2EZHA 3V8LA 1SEUA 1LE8B 1FYLA 3JTGA 2A07F 4O7YA 5IP7J 2ZSHB 1BR2A 3I71A 5E3OA 3OYDA 2OTJI 4ECQA 3FKIG 3GYHX 1Y8QB 3QRFF 5KFZA 4DBQA 3K2ZA 3QWLA 5IYBG 1ZLKA 1MZBA 4YY3H 1W5CC 2XKOA 2VBYA 4MV3A 1D5VA 3BCBA 3HKZE 5DLGA 4X64H 4A3BG 2F48A 4DR1H 1IN6A 1ZRDA 4C2MJ 3WWHA 1KGSA 1Z77A 3MQ0A 1APLC 1C0WA 1ETXA 4WCGA 3M8EA 3S24A 3ZN0A 3QPTA 2XASA 5HNHA 4CE5A 3MFIA 1UZCA 1N34H 1PP8F 2VUGA 4XRSA 2VQDA 2MYSA 4DR6H 1O7LA 1RESA 2Z1DA 4PJMA 4A93J 4XX0B 4E4TA 5IT3A 3DF7A 3K4NA 1GDTA 4JYKA 5GAGJ 2GIVA 2K02A 1RJQA 3KHRA 3F0CA 2O8KA 4IPAA 4RB1A 3D1NI 1SANA 2VJ4A 5B1AH 4F92B 3DLAA 3T5HA 2CQNA 2BBYA 3QPHA 2PVPA 2R7ZG 2QA4I 1D1AA 5BS6A 4HQ6A 2R8GA 4BY7J 5J2TF 3ML6A 1ZGWA 2VPLA 4ZYHA 4FFPA 2R7RA 5DV5A 2DYSH 3Q9SA 2STTA 2HGXA 1M7JA 4WX9A 2XF6A 3H0DA 1MNMC 3CCYA 5EG0B 3HYIA 3LAJA 1J59A 3OYHA 3ERED 1NH3A 1HCRA 4NZOA 3JRBA 3C18A 3CUQC 4E7ZA 5FJ8J 2NVUB 4BXUA 3JSOA 4BXXJ 3IN5A 2QLZA 2FJ1A 5LL6b 1A6IA 1HNXH 3CCQI 2GXBA 1XMOH 4N9HA 4A93G 3BQ2A 1P92A 4GYGA 2XCPA 4LK1F 1P8LA 1V9PA 4TV7A 2BW3A 3CCSI 3Q9VA 2BY2A 2QYZA 2BZTA 4Y52J 4QJFA 4LF9H 1WH2A 2A68F 2L9NA 2O3FA 5K7ZA 4JOMA 1LNWA 4M3EA 3LP8A 4Y33A 5KG4A 2ZXWH 3PQKA 2JRTA 5FRNA 2VKDA 1FSHA 2DQRA 4CCMA 1LQ1A 4MHGA 1X1AA 3C2GA 4C30A 4YJ2F 5CR5A 3OL4A 4EGQA 5KFAA 2FMLA 3IV5A 4IRHA 4BY7G 3AFHA 1W7PA 3C3WA 3EYIA 4KUMA 3FBIB 1I6XA 2DOAA 3U9TA 3KHLA 1KJIA 2R7QA 2VQHA 4JV5H 2DA3A 5E1XA 2QF7A 1OBGA 2V9PA 3G8DA 5GTHC 3VYUB 1W7PD 1TZLA 4JV0A 1UC9A 5FJ8G 3SHFA 4IRKA 4GXOA 1M0TA 1SFUA 4HSTA 4BNCA 2OQRA 2UXNA 3G1OA 1FIPA 3KZZA 3OYNA 2CGPA 3T1YH 5TISC 4EEYA 4DV7H 2MD5A 2MA3A 3T5XA 4W1UA 1EHIA 4EYIB 5HNFA 5LMNH 4BUPA 1ONVA 3AKZA 2RVCA 2R5ZB 2H6CA 3I4MJ 1A35A 2DA1A 4KMUX 2VA3A 5EJCA 2GA2A 2VJIA 1FT9A 3ZMSA 1XDSA 2L2OA 1TWAA 4IHYA 1DGRM 2XPWA 2HIXA 4DQNA 3PNYA 2MCTA 4YR2A 3F72A 2ZB9A 1PP7U 4E6NA 3GIDA 2YPRA 1PUFA 2F4MB 4P55A 1FMWA 2NS0A 2NS7A 2FD5A 1BXRA 2BVMA 3G1LA 2FB9A 5KFPA 4JI3H 1GV5A 4KJZA 2EINH 3R0AA 4AUXA 3U9SA 4CCLA 2R7SA 1EH6A 4G7HF 3KHGA 2UUCH 4HLYA 5HNEA 3LL7A 2WC2A 2X0SA 4A3IJ 3FXQA 2NU9B 5L3BA 2M34A 2R86A 2IA2A 3KP7A 3P7NA 3K5HA 1HNWH 1I7LA 3IP4B 2OA4A 2X51A 1TWHA 5KT6A 3BR3A 2HTSA 2Y31A 3BC8A 2DBBA 3H3ZA 3HPGA 4OIQF 1IBMH 5HDGA 3PIOF 4J0MA 2ALZA 1HDDC 2VT3A 1EA3A 1R1UA 3CQZJ 2ZJPF 6PAXA 1LVAA 2LDUA 3DTGA 4PZ6A 1AN7A 2UUBH 4AQYH 2XAUA 1HXDA 4IZZA 2YW2A 4GGGA 2NU8B 4ECZA 4B44A 4YB8B 4M9UA 2BV6A 2XGPA 2DT7B 2ID6A 2NYXA 2R7FA 3VYSB 1YS7A 5J4VA 4A3JG 2W9BA 2OTLI 4Y4RA 2HQ5A 1AUXA 2ASJA 3KPHA 1D8JA 2JUGA 4B48A 4ZOLF 2EV6A 1MGTA 2Z99A 2QQ8A 4I01A 4Y13A 4J01A 3GEZA 1YIJI 3QQMA 5LA6F 3S1NJ 3H9JA 1E2XA 2PJRB 1YJWI 1XNRH 2LG4A 2R82A 3V4GA 4UFZA 3SE7A 4NBQA 3DAAA 4R8UB 5CVJA 3V4SA 2WADA 1ODDA 2YX4A 3GTGJ 1CS0A 2HGSA 1EZ1A 5KFFA 5I60A 4FU0A 5ICCA 2PBZA 2RC4A 1EUCB 3PUBA 4D0PA 2M9HA 2KRCA 2FA5A 1KONA 5J3LA 1LUJB 3NUAA 2JSPA 2YSRA 5AONA 4D9JA 4DGWB 5M5WJ 4XLCA 1QBJA 3FMAA 1UJ8A 4FCYA 4BHBA 1YRNB 2E5ZA 3M3YJ 2WWYA 4ZJZA 2GA1A 4HQEA 2PLYA 3CCEI 1BGWA 2UVWA 4HNVA 2FMAA 2A6HF 4Y7NJ 5GPCA 3I9V2 5CB4F 4J00A 2YWVA 2ASLA 3C2BA 2V1DA 1STZA 3QU6A 3L2UA 1I7NA 5HDNA 3KALA 2W4SA 3F9KA 4HF1A 2PJPA 1DV2A 3BCAA 4MAMA 4ETSA 2A5WA 5FKNA 1Z1DA 3K3PA 1XMQH 3WTXC 2CNUA 1S68A 5KT2A 1K6OA 2GXGA 1B1BA 4ZYAA 1JUSA 2CFOA 4XYMB 3U54A 1Z6RA 2HDKA 1T56A 5C1PA 2LP0A 4HZFA 3LSHA 1IYDA 3OYEA 2FKLA 3K4JA 4KITB 1IC8A 5E3NA 3PJRA 4IKFA 4KMFA 2VC0A 3T9CA 1X1CA 2EFOA 3ZQHA 4FS2A 3OYIA 3RUPA 1D8KA 5KFLA 5K3WA 2IGMA 2XCAA 2JA7A 1G3SA 4EQQA 3HT5A 3FXMA 1G3TA 1P6RA 5HLIA 1RIOH 4JI0H 3G2BA 1Y14B 5EWFA 5E1ZB 1XPXA 4HG2A 1Y1WJ 5K5RA 2JEFA 2WYOA 3G8CA 3BROA 4M3DA 4JYAH 3DTIA 5JI6A 1K61A 4M71A 1HSJA 1A0GA 2ZMEB 3FDYA 3S3OA 1XK5A 4NC6A 2W9AA 5CA0F 1IW7F 4ED7A 2K4BA 3RB6A 3BTLA 3BTCA 3GTMA 4CSWA 3H5RA 2CZGA 3QP5A 4XZ3B 2DTZA 1I1MA 3KP5A 3ZMZA 5C3EG 4O7ZA 5LHHA 2M3AA 4KIGA 5JQWA 3TOBA 1CF7B 4CCKA 1BR1A 2P5VA 4HX7A 3S2WA 3VDXA 3HOSA 4ESFA 2R3SA 3AG1H 1O57A 3T9AA 4DV1H 1G59A 1GGOA 2FXAA 1WGXA 2HXOA 5HLHA 2K3PA 1X19A 5KAIC 1FC3A 3NGDA 2R5YA 1T98A 3PW4A 4CKEA 3OR2C 4L0YB 1EKPA 2FP4B 1JKRC 1WI3A 1OPCA 4A0ZA 4IQJA 1KU3A 2VA2A 4X1EA 4BHPA 1KUTA 3WTSC 3HDDA 3MFKA 3ZP5A 1Z05A 1Z21A 4E70A 5FB2A 5E25A 1T36A 3SZPA 1WR2A 4QTRA 1FOYA 4WF2A 2V7FA 5KFMA 3RKXA 2UV1A 3RSNA 4NDLA 4RCNA 4FHTA 3ZN1A 2HKOA 2UUZA 5L3GA 5AIQA 1YO5C 1T95A 1TQMA 2P7VB 5K7HA 3VSLA 4C2UA 3I59B 2EQRA 5FLVA 3GDEA 4X62H 1YOVB 2E1OA 4FQGA 2UXDH 4I50F 4ZYGA 1V3FA 1LEBA 3RV3A 2Y0SE 3QP6A 2DI3A 2FOKA 2XAFA 4JX4A 1G4DA 3J7ZI 3PO3J 2GPSA 4AIHA 2P0WA 4CKBA 2DO7A 4OMYA 1GO3E 3BAAA 4I4TF 4WK8F 2OCCH 2F2EA 4O81A 3O6BB 3WGGA 1BA5A 1W0TA 3R5HA 4ZTFA 2H1LA 2B63A 4O82A 4S0HB 5EDNA 1OCPA 3LULA 3SI8A 4II3A 3JRDA 2EIKH 3CO7C 4B3XA 2P81A 2O03A 3IAM2 3LSPA 1B6SA 3NEUA 1N25A 3VFZA 1UELB 4XLNF 3ABMH 5JVLA 4QPQA 1JUMA 2FUG2 3H0GA 5LMUH 1MMDA 5EDWA 5CKTA 1J09A 2EWNA 3F6OA 4GKKH 2CH0A 3K0LA 5H20A 3ZMTA 1CKOA 2YL2A 3K5IA 2C35B 1X1DA 2YCHA 2IBDA 3V6JA 4FBUA 4L0ZB 1N56A 1GVDA 2VKVA 3W5OA 1V4RA 4JP0A 4ECUA 1KYWA 3KFWX 4BEHB 3K70C 1T6SA 4AIJA 1G2WA 3UYYA 1AWCA 3N41B 3HBLA 2COJA 4O7SA 2CQQA 3K70D 4YAJB 3PO3G 5E8GA 3M4IA 2B0LA 5I5SA 3TIGA 2X4HA 4V19K 4WXDA 2CV1A 4QW8A 2EH3A 3BG9A 5HOOA 3GTKJ 4JV2A 4YFNF 2KDOA 4Y17A 3Q0WA 2V5AA 3GIIA 2FJZA 4I55F 3VWBA 3K3VA 1DIKA 4S04A 5HLGA 3HXLA 5KX5F 3A0HC 4UCRA 2L7FP 3GTLA 3Q0UA 2E5LH 2WAQA 3MWDA 5LOVF 5KG2A 4O3NA 1IRFA 4CCOA 4PGGA 3OYGA 5CM0A 4OIRF 3ORRA 3D5LA 3S17J 4UB6C 1MBGA 1VQ6I 1IBKH 4RUCA 1F36A 3TBIA 1KJ8A 5HLTA 4OWRB 4BL0B 3LWFA 2HVSA 2LRDA 2CYYA 4EBDA 4B3RH 1VQ9I 1DQUA 2VQCA 5ICEA 3ABKH 2R92G 1D1BA 1YJNI 5KFQA 4F4ZA 1B6RA 3TW7A 4C2MA 2CNQA 2E35A 3HRTA 4J9LA 1T94A 1I1KA 4BWSC 2ZNYA 3IUOA 3L09A 1SFOJ 4G12A 2VONA 1MBKA 2B7EA 5KVRA 4HEA2 1S72I 2RGRA 4MV8A 3V7CA 4ENMA 2EIYA 2HKXA 2O8XA 2MFZA 2MH2A 2DMNA 1ZETA 1KZHA 3HSFA 3JREA 5J2UF 1E4FT 4TVIA 1U8BA 2PG4A 2ACJA 4OMZA 4Q5SF 3WO0A 4APMA 2JVGA 5IPAA 1L3LA 4A3LJ 1Z67A 1Y1VJ 5KFIA 1HR0H 4ENNA 3S1RJ 1SFXA 2R7TA 3G73A 2KKOA 2V59A 1DAAA 1OKRA 1SCUB 4IRIA 4O7NA 1H9GA 4B3SH 3RDIA 2Q7DA 2ZM6H 4ZYDA 4B09A 3H3VH 2QM3A 4U88A 2OLSA 3TEDA 5DYMA 3I58A 3EPZA 5D8LB 5F0CA 1RUNA 3DEEA 4M9SA 1TWFJ 1VQNI 5DD4A 4CC5A 3QFFA 2BXYA 5KS8A 3KYCB 4A2UA 3GZNB 3EETA 1XSVA 5HS9A 2QB5A 1IRXA 5FGMA 1IV6A 4QIWA 3HGGA 2AHQA 2ECCA 3BR2A 4X65H 2HXIA 5KFBA 4GO1A 1K4SA 1S29A 4BS9A 2JA5J 2R7UA 1H89C 4ZDOA 3BR0A 3L4KA 1SD5A 2DAOA 5I5TA 4PZ8A 2JA7G 2RAEA 3A1YA 5KFWA 4DL3A 1GHCA 2C00A 2I80A 5GAEJ 1X2NA 2O5RA 4NXMH 3FXLA 3T7AA 2IVMA 1ZN2A 2A3SA 4M3GA 4RGXA 4ZH4F 2E34A 4HN2A 1LFUP 1Y1VG 5KFYA 2BE5F 1KJJA 5EZHA 4MIMA 2VKEA 1IYEA 4EM0B 2WY8Q 3CTAA 3SJMA 3R23A 1ZGAA 2PMUA 2DMQA 1XN7A 5HS8A 4AVZA 2RF4A 1X58A 1B59A 2V4JC 4YFKF 2TRTA 1IN8A 3COAC 1KT8A 2DABA 1RKWA 2NS8A 3JAMK 5DGBA 5IWAH 4LF8H 2BY3A 4O7VA 2DA7A 1U3EM 4A3EJ 2ZXJA 5CPRB 2I87A 3RJ0A 2XVCA 3GW2A 3OR1C 3ZGKA 1BNCA 2IGOA 2VXDA 3CC7I 1YYVA 5CE8A 4JUZA 1DPRA 3BWGA 5KG0A 3ZXSA 5DLFA 3PSFA 3RBDA 3L2WA 2L02A 1MBJA 2VBZA 1O7FA 4M6XA 2X6YA 4XKCA 5CQGA 2JA5G 2UZKA 3P9IA 4KDPA 3DEUA 4CZZA 5D1OA 1OCOH 4AVPA 2IGKA 1E4GT 5KG6A 3VMMA 3Q0VA 2BQRA 2K9LA 1GV2A 2E60A 3D0SA 1XS9A 1JGSA 3JRIA 3KYLA 2WB1A 1R4MB 4ZZDA 1TA8A 2PMHA 2E2HJ 2P5KA 3WTWC 1N36H 4C5AA 3S14J 4Y3OA 3KP3A 4D1QA 1I3AA 4XRMA 1VAJA 2HGCA 3GTOJ 2QKLB 2OZ6A 5F9NA 3FMSA 2K85A 2M2EA 2VBXA 3CUQB 3GCMA 4KT6A 4ZDLA 4BXFA 5DM6F 3LAPA 2F5FA 3R60A 2RGVA 4B47A 5D5VB 1B8IA 5IYDJ 2W9CA 2EPFA 2KIMA 5HS7A 2WTFA 2ABJA 5KFOA 4O3RA 2DDBA 1CKNA 2BEOA 1XD7A 1X3ZB 2ISZA 1IJWC 4J9RA 1ZRCA 4XORA 3REOA 3E5NA 2DMPA 2L54A 2CFMA 4ABZA 1SEIA 3RBEA 1HF0A 4DAAA 1K1SA 4BE2A 1FNNA 3E5XA 1W93A 1BC7C 1Z7UA 1G8XA 1C30A 1RJPA 3V6HA 2BW3B 2BY1A 4YHHH 3SNOA 5B5EC 4U0YA 3PZPA 4UUTA 3TGNA 4PJNA 3OYFA 5J8FA 4UCVA 1SMTA 5LFAA 1UMQA 2X6XA 4JI6H 5F04A 3HG9A 4JI1H 2YU9J 3K10A 4ASNA 3ETJA 2NVTJ 2K9MA 4BJ6C 4GC6A 1W7PB 3N4MA 3OYAA 1VFCA 5DGAA 3SFIA 5C44G 1QU3A 1FEXA 3PVXA 4YR3A 4IR1A 4B43A 1RK6A 2Y30A 5IYDG 3FZVA 1NG7A 4LG0A 2M4GA 4NQWB 4BACA 4KFCA 2CQKA 3E3VA 2CG4A 2WA0A 1MSFC 3JRGA 2LMDA 2D1HA 3E0JB 1R36A 3BR1A 4LFBH 3GTGA 4DV6H 3MVPA 4IHWA 4NC8A 4AWXB 1UHSA 3GIKA 1W4MA 1UG2A 2HNHA 5K2MA 3T5KA 1R9TA 1ET0A 4FBTA 2PMZA 2A5YB 2XHKA 2DN0A 3KYHC 2XB5A 2H1KA 3A01A 3W6VA 2FPIB 4UHTA 3B02A 3QOEA 3LSKA 3GQCA 4U6PA 3RAQA 4NZNA 2KMUA 4JK1X 4XKVA 4RM2A 3HZJA 1D1CA 4HOBA 1IXCA 5M3FJ 2HTJA 2DLNA 1DGWY 2HGWA 5FPRA 2QSFX 3CF2A 2JK3A 5DTDA 1JE8A 2V9KA 3VOEA 1PUFB 2IS4A 2C2DA 3M8FA 2KFDA 2XAQA 3BQYA 3VYTB 1KBLA 3OS2A 4YFXF 3GZ5A 3T1BA 3GV5B 2DFHA 2UXCH 2KP6A 2M8EA 3OMYA 1AKHA 4G6DA 4UVBA 4ON0A 1DUXC 4DLKA 2KPMA 2XGDA 4ECVA 3E7LA 4LLGF 3QAHA 4UUVA 4FFLA 2OBPA 4RLQA 4A0YA 1H9TA 4G7ZF 2F5EA 3DWLE 3LSJA 2R0QC 4LOCA 2QQ9A 2K3FA 4D7MA 5BPIA 1XGMA 4CGZA 5BYAA 3OSPA 4UB8C 3CCMI 2DPDA 1VS0A 3SZTA 3HKZA 3VYRB 3KEYA 3OIPA 4IEJA 4M7EA 2KQRA 3HOWJ 2XKPA 1S7AA 3KAJA 2VOBA 3PFFA 1NTCA 4Q48A 3ORQA 4CC6A 4XKBA 3I3LA 3HSEA 4BY1J 3HUGB 3ZRGA 2BQ3A 2E19A 4MQVA 2XGQA 4DR5H 2CV2A 3OYKA 3ABUA 4IOAF 1FMVA 1Y6IA 1YX5A 2XUBA 4G6QA 1Y1WA 2R7ZJ 1W36D 5KK1A 1DP3A 2E2IA 2OUMA 2FLLA 1K6YA 3LFKA 5F9LA 3F3XA 3IAS2 3L1PA 4HRIA 4J19A 3U55A 4LH6A 5DQGA 4NXNH 2ID3A 1E17A 4LK0F 1JGGA 2V4QA 3B6AA 3JAMW 3P5JA 4Q43A 3ESWB 5KHDA 2R85A 3M9NB 3GTPJ 2V6EA 1WH7A 2Y69H 1MBEA 3HB9A 3CLQA 2ASDA 1BC8C 1LDKB 2LY9A 4M6YA 1ZARA 1QNTA 4CA0A 5DM7F 3CMYA 3N42B 3U0GA 4QWAA 1G3YA 1MD0A 2I8CA 1B9MA 2Y0MA 3E1SA 4DRFA 1HDPA 3S1MJ 3GFLA 3RZOJ 1YJ9I 2D45A 2ODTX 3VOTA 3KXYT 3RKWA 2KLOA 5CJ9A 5F64A 4B8XA 4UUSA 3HOWG 3M9AA 3Q8SB 1POGA 2DA6A 2EZIA 2L4MA 3IH3A 4HYKA 1ULZA 4XYLB 5KFTA 4B4CA 3CCRI 1YS6A 4MLOA 3PW7A 4BY1G 2F4OB 5T14A 1I1SA 1UHMA 1Z2NX 3MEXA 1K83A 1XC5A 4BGDA 3JZ6A 3H5NA 4HBLA 3LA3A 4X66H 1YQAA 4YIRX 4J9PA 3QYFA 1MNDA 2QSGX 2V1NA 2R8JA 3B73A 1VQ7I 2XGCA 2GOXB 1WSUA 2QENA 2ZDHA 3ASNH 5GP9A 2BQUA 3KREA 3PN1A 4C2TA 1ZKGA 3RTRA 3RTXA 2A6TA 1JHHA 2LREA 1EH8A 4RDUA 1H0MA 3O3KA 3S2HJ 2VBWA 4M73A 2W6MA 4IXAA 3G6YA 4QWDA 2IA0A 4HV5A 2JVHA 5LHGA 1AA7A 3WU0A 4E6KG 1ZAUA 4I2OA 1REPC 4LLNA 3KIOA 3MN2A 3OV8A 1WJFA 2K4JA 2UWMA 1ZHQA 5C4JJ 1JKJB 2L9SA 2A05A 1YI2I 1BR4A 2WAQN 2YRXA 4B3TH 2PEXA 1DDNA 1ZHSA 1HNZH 1WJ5A 3TP3A 2GZWA 2DT5A 1WSCA 3VPCA 1S3JA 4IR9A 1FP2A 1YE9A 1NHAA 2R8HA 4TQSA 3A4CA 2R7OA 2ICWG 1G3WA 3BG7A 4OAZA 2HJWA 3WODF 1GUUA 1TNSA 2E36A 3AYHB 5D6EA 3EUKL 2W8LA 1I50J 3CVZA 1TNTA 3VSKA 3ELKA 1Q1HA 2BY0A 2HDCA 5KT7A 3BLYA 3K1PA 2LK2A 2M45A 4IWXA 1I3QA 3WGIA 3E6BA 2J5OA 4ECRA 4BBRJ 4IJAA 2W48A 2NXNB 3TDZC 2VN2A 3RYPA 3QYBA 5M3MJ 3SEQA 5DUIA 4BJ5C 2M05A 4XOTA 2CUJA 2CUEA 4Y15A 3BABA 3BPVA 4GYIA 1P4AA 4BE0A 4O2BF 1M1EB 2HYFA 3TQNA 1A0IA 2ZC2A 2F5CA 1V4YA 3IC7A 1XGOA 2GXAA 4ENKA 4EBCA 2CRGA 4ZYEA 1ZR2A 1HW5A 4AIKA 3JZFA 3CDLA 2C28A 4PJLA 3JAMZ 2VKHA 4A3JJ 4UV9A 1KEEA 4FGRA 2FLPA 4HNUA 4KHPH 3Q2OA 3GX4X 2ECBA 3GO5A 2W71A 2X1DA 2YS9A 5BMZA 2VUMJ 2EJRA 4BH9A 3IG0A 1FBSA 4EBEA 1KJ9A 1WCMJ 1A31A 3CCUI 1MMSA 2F6CA 4YBZB 3RQ4A 4CYCA 1VQMI 2KISA 2M8GX 1J5YA 4CCJA 3FDSA 1KA8A 1ULYA 1Z7LA 3IWZA 1BIBA 1QVTA 3QPSA 4L9VA 4DV5H 4LF7H 4L9JA 1OJLA 3A2KA 1HW1A 4U0WA 2ESNA 1I6HJ 1ZQ7A 4BBRG 5TRDA 3LFUA 4QIWN 2JA6A 5LGUA 2R93J 4C3HJ 2JPBA 3MZYA 1SFOA 1HOMA 4FTHA 5KFNA 2COIA 2COBA 5E8IA 3ZPLA 3S15J 2W25A 4ESJA 2IEKA 1QGPA 3ERMA 1BI2A 1I94H 1A5JA 3OYBA 3H4DA 4R79A 4O4LF 3RIZA 2LNBA 1W1WE 1XNQH 2JTVA 1ZGJA 3V6KA 2MC3A 1Y1VA 3ZQ7A 5K7FA 2AS5F 3UKGA 3OSGA 1OYWA 3BA9A 2DOEA 3DFGA 2PI0A 3HTSB 3HOUG 4AYBN 1N77A 1SC7A 2VJJA 2EA2A 3L9FA 2Q2EA 2YYAA 1UB9A 2VUMG 1XMAA 2M1BA 3WTZA 4A3KJ 3HRSA 3DQVC 1D0XA 4YIIA 2STWA 1WCMG 2KIUA 2HI3A 4HF2A 2DU9A 1O75A 1O4XA 4OINF 1TWFA 3OY9A 2EJ2A 3T54A 4O83A 3S3MA 3I5UA 2G7UA 5ILSA 1FZPB 1R58A 2C2EA 4KISA 3PO2J 5DCFA 2BHZA 2MH9A 1XX5A 4M74A 3W1GA 2R93G 3CCLI 2W7OA 5EGOA 3CCJI 4V2FA 4FX4A 4RZQA 1ETOA 5KFEA 4RU9A 2ZJQF 2CUFA 3EDPA 4XICA 4E7JA 5KFXA 2FX0A 1DPUA 3CDIA 1VQLI 4FFMA 5IT9K 4YQWA 5DQHA 1FSEA 2WB1N 3K2AA 4E7SA 2W00A 5I5VA 4N4OB 3WWJA 4DZJA 4UCSA 1P4XA 2L9VA 4OX9H
chains in the Genus database with same CATH topology
3TY8A 2KDOA 1MNEA 2M0MA 4YEJA 4U7BA 2K5CA 3M8JA 3RR5A 1R6RA 3M1CA 2VASA 3VWBA 2WDTA 2BOLA 3K3VA 4DV4H 3DTKA 2X85A 3HXLA 3NWSA 1D0ZA 4UCRA 4BEHA 2E5LH 2WAQA 1OR7C 2WAFA 4DUZH 4CCOA 2E1MC 4XKWA 3NC0B 3OYGA 3H9GA 1Y56A 4LIUA 3UR3C 3SDBA 3D5LA 2CS3A 1IBKH 2KRHA 2AQFA 3TBIA 2VJ5A 5HLTA 4OWRB 4BL0B 2HVSA 3C0FB 2CW7A 2LRDA 3W2WA 1NG6A 2OV7A 4B3RH 1DQUA 4UCTA 2VQCA 2WY7Q 2X6WA 4DR3H 4DJAA 5FRMA 1D1BA 3DKYA 4G6TB 3V42A 1OLTA 3MKYB 4U87A 4PZ7A 4BWSC 3IUOA 4II2A 3D5SC 4OAYA 3KAKA 2XF5A 4E7HA 3J7AK 2IGNA 4DR2H 4DOZA 4HEA2 4BDZA 2IS2A 4LMYA 4PK4A 4F91B 2RGRA 3K4KA 3OIQA 2HPMA 3CJQB 2MFZA 3W2VA 3H9QA 3HL2A 1E4FT 1E0EA 3VNNA 3K4CA 4APMA 2JVGA 3OS1A 4ITVA 3OS0A 2WE6A 4K0KH 1HR0H 4E7KA 2R7TA 1JI8A 4DBRA 4A2BA 2IS1A 1Z3XA 4ZC3A 4B3SH 3ZR8X 2ZM6H 4F55A 3RCOA 4EATA 3MKWB 3EPZA 3PNVA 2R7WA 3TL4X 2WAEA 3L2VA 1XDNA 2XDVA 1QHGA 3DEEA 3MWMA 3T1HH 3RGZA 4CC5A 4DV2H 2HVRA 1N33H 2W82A 3OYLA 4M7EA 4RB3C 2RNGA 3CJRB 4FETA 1X4OA 3RPUD 1TT0A 3OYJA 1J5EH 1IRXA 3ZCOA 1T0FC 4MV9A 2HQAA 3GJXB 1P9QC 4EFEA 2LH9A 3H20A 4X65H 2R7UA 4ZDOA 4BS9A 3JSLA 4LH7A 3L4KA 3NBZB 4PZ8A 3GB8B 3A1YA 4BQOA 3U21A 1B04A 3DU5A 2O5RA 2VQGA 3TY9A 2M7BA 4NXMH 1YX3A 3DPTA 4C9YA 2Q2TA 4IAJA 5BR8H 3W1BA 4GLXA 3N05A 1N32H 3H5AA 4PUSA 2DXIA 5A2QW 2WY8Q 1WFXA 2W7NA 4JI7H 3KX2A 1V5EA 4PSXA 4AVZA 1X4PA 4HSRA 3DKXA 2OWOA 2V4JC 1TAEA 3S8PA 5D1OB 1DGSA 5FD6A 5IWAH 4LF8H 4LSAA 2UU9H 1S03G 2ZSHB 1BR2A 3OYDA 3RJ0A 5CPRB 1VZ0A 3MMYB 3OR1C 3FHNA 2LOOA 3ZGKA 2IGOA 2VXDA 4DBQA 1SYXB 1MZBA 4YY3H 3ZXSA 3PSFA 3L2WA 2XIGA 4P5OA 2M4KA 4UCOA 3BCBA 4X64H 2ZFUA 4LIVA 1L2ZA 4DR1H 2X6YA 4XKCA 5CQGA 1MMNA 3W2AA 3SEZA 2DJIA 2R4GA 5D1OA 2ZXIA 2IGKA 4GRIA 2DT6A 4XOPA 3S24A 1D0YA 5HNHA 1E4GT 2K9LA 2E60A 2HVQA 3H35A 1N34H 3KYLA 2VUGA 3MD2A 2WB1A 3L2PA 2MYSA 1TA8A 2Z1DA 4PJMA 4XLHA 1Z2OX 5TGTA 1N36H 3SZGA 3L2QA 4Y3OA 4D1QA 3DF7A 3K4NA 1UG0A 2QKLB 1P16A 1ZELA 4BXFA 4KT6A 4ZDLA 5D1PA 2F4VH 4NNJA 4B47A 2RGVA 2VB6A 4RB1A 4GKJH 3K4MA 5IT9W 2VJ4A 4F92B 3DLAA 4IQ4A 4PFPA 5DISC 1CKNA 2OC6A 4EFBA 3RGXA 1D1AA 4RB2C 1GYFA 1FKAH 4XORA 3D5RC 2PJRA 2VPLA 1UAAA 2R7RA 3J81W 1SEIA 2CFMA 3J7AY 3J80W 2XF6A 3H0DA 4BE2A 4F52A 4FM9A 1G8XA 3C2HA 2BW3B 3OYHA 4YHHH 3EUHC 4XN3A 1WJAA 4PJNA 4BJTA 4E7ZA 3OYFA 4UCVA 4E4HA 5LFAA 2X6XA 4JI6H 3ONQA 3BG6A 2LBFB 3HG9A 4JI1H 2MABA 5LL6b 1HNXH 2JA2A 3FBNB 3K10A 1XMOH 1QHHD 4HPQA 3OYCA 2K9MA 4BJ6C 5KNLA 3RF2A 1P8LA 5LD2C 1V9PA 2BW3A 4F3QA 3OYAA 2HDWA 4LF9H 1QU3A 1WH2A 2KSWA 2L9NA 4B43A 1GLNA 4JOMA 4DUYH 4Y33A 1NG7A 2LBFA 2M4GA 4NQWB 4BACA 3HPHA 5FPOA 5FRNA 2VKDA 3OOUA 4PFOA 1I6UA 4CCMA 2WA0A 5FD5A 3LMLA 2HIVA 4A2AA 1X1AA 3C2GA 3CMMA 4C30A 3E0JB 3OL4A 4FASD 3OTOH 4LFBH 4UCUA 3EUAA 3AFHA 4DV6H 2W57A 3FBIB 4NC8A 3LSIA 2DOAA 2HNHA 1U0JA 2PMZA 5FLXW 2R7QA 2VQHA 3OWTA 3KYHC 4JV5H 5HVQC 2VL8A 2XSJC 3QOEA 3LSKA 3VYUB 1TZLA 2KMUA 4BQQA 4XKVA 4RM2A 1D1CA 4XONA 4LFAH 1M0TA 4HSTA 1DGWY 1V5GA 2VIXA 3CF2A 3OYNA 2Y0SA 3HOTA 5FPRA 3T1YH 2ZJTA 4XLFA 2V9KA 2IS4A 4DV7H 1WJEA 1SFKA 4XQFA 2VQEH 3VYTB 5HNFA 5LMNH 4BUPA 2QKMB 3AKZA 3OS2A 3DTEA 2GOMA 2UXCH 2KP6A 3OMYA 1ERDA 3QWUA 2E5NA 2VJIA 4BQNA 2KPMA 1MW7A 2L2OA 1MMGA 1DGRM 4E7IA 2HIXA 2MCTA 3PNYA 3K4BA 2LYCA 4RLQA 4E6NA 4JI4H 3DWLE 2ZSIB 1FMWA 4JI3H 3LSGA 2BVMA 2F5VA 2Z16A 1S9HA 4KJZA 1WJCA 1VS0A 3HKZA 3VYRB 3KEYA 3CESA 3OIPA 4CCLA 2KQRA 5FROA 2R7SA 2VOBA 3KAJA 3ZQQA 4PDBA 2UUCH 3LL7A 4LF6H 4CC6A 4XKBA 3I3LA 3HUGB 3ZRGA 4HNTA 4DR5H 2CV2A 3OYKA 2X1EA 1HNWH 4YRVA 3IP4B 1FMVA 1Y6IA 1YX5A 2X51A 4P1WA 4XNFA 3FKJA 1W36D 1DP3A 2OUMA 3BC8A 4I7HA 1K6YA 3HPGA 3N40P 1IBMH 3QODA 4XN0A 3IAS2 4HRIA 3JSNA 1EA3A 1LFPA 4PZ6A 4LH6A 1AN7A 4J0MA 2NOJB 2UUBH 4NXNH 3JAMW 2XAUA 4AQYH 4IZZA 5KHDA 2V6EA 4RM3A 1X9NA 4LF5H 4B44A 5KCMA 2DT7B 3DPUA 3F8NA 3VYSB 1LDKB 3NBYB 4Y4RA 4CA0A 3N42B 2JUGA 2LC2A 4B48A 1CKNB 3E1SA 4AU7A 4J01A 4DRFA 2RREA 3KXYT 3H9JA 2KLOA 3S93A 2PJRB 4BDYA 1XNRH 2LG4A 2HU9A 2BVLA 4RAYA 4EQ5A 4UFZA 2VQFH 4MLOA 2WADA 2ELJA 4CCNA 1Z2NX 2HGSA 1M0WA 4LF4H 4BGDA 3H5NA 4QPOA 4ANJA 3TMOA 4X66H 2E1MB 4LSXA 3AL0B 4RLFA 3PUBA 3QYFA 1MNDA 1HA8A 2V1NA 2IXSA 2KRCA 1KONA 3MKZA 2ZXHA 3GBGA 2GOXB 2JSPA 4DGWB 3FMAA 4D9JA 3N44B 4DV0H 4XLCA 2VQLA 2E5ZA 3PN1A 2VPSA 4C2TA 4X0GA 4ZJZA 3RTRA 3L2RA 3RTXA 1BGWA 3EYYA 2A6TA 2KHMA 3I9V2 2XF7A 2LREA 2VLAA 4J00A 2HHHH 3L2UA 3KALA 1BOBA 2W4SA 3F9KA 2W1OA 2DCEA 3BCAA 4ZTJA 4ETSA 2A5WA 1XMQH 4XLAA 2JVHA 5CQEA 1AA7A 4E6KG 1S68A 2CMPA 4DR6H 2RQQA 4ZYAA 1ZHQA 1WJFA 2CFOA 3PNTA 3AL0C 2UWMA 4RB0A 4DV3H 2L9SA 3N43B 1BR4A 2KL4A 4B3TH 3LSHA 1HNZH 1ZHSA 1WJ5A 3OYEA 3K4JA 4KITB 3K6GA 1N75A 3PJRA 4IKFA 1YE9A 5EOYA 1X1CA 3A4CA 2R7OA 2L5QA 3BG7A 4OAZA 3OYIA 2IGMA 4JI2H 2LY2A 3L4JA 3EUKL 4RMNA 3CVZA 4RAZA 4JI0H 3VSKA 1PJRA 3G2BA 3BLYA 3LMMA 4F93B 4HG2A 2F4IA 2WYOA 1WJBA 4JYAH 4NUBA 2Z2SB 3DTIA 2I8DA 2M7AA 3FDYA 4DIQA 3S3OA 1XK5A 4PSWA 2FE3A 3S32A 3QYBA 3SEQA 4MTDA 4CSWA 3H5RA 4BJ5C 4XOTA 2CUJA 3BABA 4LFCH 2AQEA 1FJGH 4BE0A 2M3AA 1A0IA 3OYMA 2R7XA 4CCKA 1BR1A 3HOSA 3VDXA 4NC7A 3PL8A 2HZDA 2Q2UA 4DV1H 1G59A 4XL9A 4PJLA 2K3PA 2VKHA 1X19A 3QYEA 4HNUA 4KHPH 3OR2C 5JHFA 2MD0A 2KZVA 4IQJA 2X1DA 3LSMA 3CP8A 3IG0A 1Z2PX 1Z21A 2IS6A 2F6CA 3RQ4A 4CCJA 4MTEA 1Z7LA 1Z3YA 2V7FA 4DV5H 1X1BA 1FVIA 2UV1A 3RSNA 3A2KA 3TY5A 4LF7H 2WBMA 2UUZA 3LFUA 3UNGC 1T95A 4IX7A 3S3NA 1W36C 3VSLA 2MC4A 4C2UA 4H4KC 4X62H 3GDEA 4B3MH 1IBLH 1MMAA 2CW8A 2UXDH 3BA8A 3SYTA 2Q2EB 1I94H 3K4LA 3OL3A 3OYBA 2P0WA 4R79A 4PJJA 3BAAA 1PYVA 3DPLC 3RIZA 4N4NB 4DR7H 1XNQH 4AYBA 4YELA 3NWTA 4ZTFA 4Q0YA 3W3CA 1N78A 3BA9A 1LKXA 4JI8H 4II3A 4BE1A 1N77A 4CH7A 4XR6A 2VJJA 1CKMA 4B3XA 2O03A 4LG3A 3IAM2 4XLEA 2R7VA 2X1CA 3DQVC 1D0XA 4CZCA 1WJDA 1UELB 2LY1A 2VXZA 4QPQA 1LVKA 3CZ6A 2CV0A 2FUG2 1O75A 1BJTA 3OY9A 5LMUH 1MMDA 4E7LA 5CKTA 1J09A 4CUGA 3S3MA 4GKKH 2CH0A 1SAUA 2UUAH 4KISA 4JQFA 2Q1ZB 1CKOA 4XM3A 4R7RA 2YCHA 1X1DA 3W1GA 2XC7A 4LITA 2CUZA 4ZDPA 2HPIA 3PFYA 3N6XA 4RZQA 3CP2A 2L7KA 4DR4H 3W5OA 1V5FA 4XMYA 4BEHB 3N41B 3K70C 4E7JA 3PSIA 3K70D 4BU2A 4EEQA 4MV7A 2UXBH 3UQ8A 4E7SA 3M4IA 2W00A 2V26A 4N4OB 3DU6A 4JI5H 4UCSA 2CV1A 3HC7A 4OX9H 5HOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TY8 A;  3RR5 A;  2HIX A;  4UCO A;  4E6N A;  4UCR A;  1XK5 A;  3NC0 B;  5D1O A;  1VS0 A;  3S24 A;  2HVQ A;  2VUG A;  3L2P A;  1TA8 A;  3BAB A;  4CC6 A;  2HVS A;  1A0I A;  4UCT A;  1P16 A;  2Q2U A;  5D1P A;  3JSN A;  4PZ6 A;  4LH6 A;  4PZ7 A;  5DIS C;  1CKN A;  4EFB A;  1X9N A;  2CFM A;  3NBY B;  3VNN A;  1FVI A;  1CKN B;  3TY5 A;  4DRF A;  4UCV A;  3GDE A;  4EQ5 A;  4UFZ A;  3BA8 A;  1XDN A;  1P8L A;  1V9P A;  3BAA A;  4CC5 A;  2HVR A;  3BA9 A;  5FPO A;  1CKM A;  3GJX B;  4EFE A;  2HIV A;  3PN1 A;  3JSL A;  4LH7 A;  3NBZ B;  3RTX A;  4UCU A;  4PZ8 A;  3GB8 B;  1B04 A;  3TY9 A;  3KYH C;  2Q2T A;  1CKO A;  3W1B A;  1S68 A;  4GLX A;  3W1G A;  5FPR A;  3W5O A;  2OWO A;  4EEQ A;  1TAE A;  5D1O B;  1DGS A;  3UQ8 A;  4UCS A;  3QWU A; 
#chains in the Genus database with same CATH topology
 2ELH A;  5D6F A;  4ZZL A;  2K5C A;  5K5Q A;  1R6R A;  2PFB A;  4DV4 H;  3J81 K;  1TBX A;  1QVU A;  3E6C C;  1XMK A;  1D0Z A;  1W5T A;  3IKV A;  1VQ4 I;  2WTE A;  1JTY A;  5C3E J;  5EEH A;  2WAF A;  4O4I F;  4A3K G;  2HFH A;  3FMR A;  3NC0 B;  3TIN A;  1DP7 P;  3BTJ A;  1MKM A;  4GFB A;  1Y56 A;  3EUH A;  4I09 A;  3SDB A;  5B3S H;  4TUY F;  1S9F A;  2KRH A;  2EIL H;  3PO2 G;  2I5U A;  2CJJ A;  1WZ2 A;  3K9T A;  1S0N A;  3W2W A;  5ICF A;  4UCT A;  4QSH A;  2X6W A;  1OMI A;  4DR3 H;  2O61 A;  1RR8 C;  5FRM A;  4OOI A;  1YHQ I;  4RGR A;  5LGN A;  5ILV A;  1OLT A;  2L4A A;  2YU3 A;  3GF2 A;  3MKY B;  3PR5 B;  4FFN A;  3GTJ A;  2MGQ A;  3FXR A;  4F4Y A;  4MA5 A;  3D5S C;  1H88 C;  3KET A;  3S2D J;  5EG0 A;  4EMS A;  3WE3 A;  1P7I A;  4BDZ A;  2IS2 A;  4DR2 H;  5DMX A;  4A12 A;  5I5Y A;  2DFE A;  4MV1 A;  4L9T A;  4LB5 A;  1YW8 A;  3K4K A;  4TM5 A;  5JLX A;  4TV9 F;  3MFH A;  2KRF A;  2EV5 A;  4DL4 A;  2E2H A;  4I98 B;  1MH4 A;  3V7R A;  3WU2 C;  4PWQ A;  3GTO A;  1YFH A;  4X6A J;  3OS1 A;  4ITV A;  3OS0 A;  5FLX K;  2DWC A;  2WE6 A;  2JEJ A;  1X3W B;  3I56 I;  4MFD A;  3TOA A;  4A2B A;  2IS1 A;  3T8T A;  3HOZ J;  4PZJ A;  5CVR A;  3WWI A;  2R8K A;  2AGO A;  5LXT F;  1KU7 A;  4G9Y A;  3RCO A;  1B6A A;  1FJL A;  1BW6 A;  4PJ0 C;  4Q8F A;  3BQ0 A;  5BMV F;  2WAE A;  3L2V A;  2D1V A;  4KIC A;  1XDN A;  5JUM A;  3MWM A;  2RQP A;  2VI6 A;  2J6T A;  1FBQ A;  4Z2Y A;  2ZGI A;  3OHA A;  4KA4 A;  3NRV A;  3Q1K A;  2RNG A;  2J6U A;  3CJR B;  4FET A;  4IRG A;  3OYJ A;  2N8G A;  2JQ7 A;  4DL7 A;  2FNP A;  2TCT A;  3TO9 A;  4CO8 A;  1IXS B;  1P9Q C;  3PW2 A;  3H20 A;  5E3M A;  4EGZ A;  2YU9 A;  3HTU A;  3NBZ B;  1IAW A;  2HHF B;  2CO5 A;  3GB8 B;  2R8I A;  1FWZ A;  4BQO A;  1CGP A;  1B04 A;  5C1O A;  1KTA A;  1AOY A;  3DU5 A;  1VQ8 I;  1Z91 A;  1YX3 A;  3Q8Q B;  3KLO A;  1O3T A;  4MFE A;  4XID A;  4C9Y A;  3R61 A;  2Q2T A;  2NVY A;  3MAJ A;  3SXY A;  4B3A A;  2HR3 A;  1E3O C;  3NAU A;  1BJZ A;  2ISY A;  2Z3Y A;  2R5Z A;  4RNO A;  2J6S A;  3H5A A;  4EGY A;  1T3N A;  2DXI A;  5EZY F;  1WFX A;  5K1Y A;  3HOZ G;  2NNY A;  2MG4 A;  5JFR A;  1GT0 C;  2EA4 A;  1V5E A;  4EJV A;  5JLW A;  3HKZ N;  4IHJ F;  5GAH J;  1SVL A;  4HSR A;  5FKO A;  2RKH A;  1MDM A;  2W8K A;  3S8P A;  5D1O B;  1DGS A;  5E79 C;  4DYC A;  4LSA A;  2UU9 H;  4IWY A;  2JEI A;  1OWT A;  1U9N A;  1VZ0 A;  2CFX A;  3FHN A;  3BZ6 A;  3GLX A;  2K9N A;  1JJ6 C;  3MR5 A;  4A3D J;  1ETY A;  3RIR A;  2VT2 A;  2Q0O A;  4L5J A;  1VQP I;  4U7C A;  2XIG A;  4UCO A;  2M4K A;  1XTA A;  4WWC A;  2J5P A;  2ZFU A;  3ROU A;  1L2Z A;  2H6B A;  3NAR A;  3RKY A;  4XRS G;  3SEZ A;  4O7T A;  3I55 I;  5JVD F;  3FKI A;  2P6T A;  2DJI A;  3BPX A;  2R4G A;  4LD5 A;  2ZXI A;  4XOP A;  1B8I B;  1WRJ A;  1S10 A;  4XSX F;  3WTV C;  2GPW A;  3CCV I;  2ESH A;  2GWR A;  3KCC A;  2R92 J;  1JDE A;  2W9C B;  2UVV A;  3W6J B;  3R9R A;  3BDD A;  1HKQ A;  3L2P A;  4MNU A;  3KYD B;  2EJ0 A;  5I5W A;  4JV1 A;  4AD9 A;  5TGT A;  2COM A;  1XG1 A;  2KZG A;  2DK8 A;  3LSR A;  1J0R A;  3L2Q A;  3MR2 A;  2CU7 A;  1U9O A;  5KG5 A;  2XAG A;  3OOP A;  1P16 A;  1W96 A;  5LHI A;  1ZRE A;  2RDP A;  2ZJ2 A;  5F0H A;  4NNJ A;  1GVJ A;  4GKJ H;  5DQI A;  5IT9 W;  4EM1 A;  3PIP F;  4IQ4 A;  4PFP A;  3WHB A;  5DIS C;  1KU9 A;  1I1G A;  2OC6 A;  4EFB A;  4RB2 C;  1GYF A;  3U1D A;  1XCB A;  2LFB A;  2IW5 A;  5DGI A;  5E1W A;  4IF4 A;  1R22 A;  2PJR A;  3WGH A;  1UAA A;  5KT4 A;  3J81 W;  4A3D G;  5H80 A;  4ED2 A;  1S7O A;  4OIP F;  3I4P A;  4FM9 A;  1HKS A;  2Z33 A;  3P9C A;  4R8U A;  2R7Z A;  3JSP A;  4P96 A;  2MBF A;  2FOW A;  4A6E A;  4DYQ A;  3BR5 A;  4XN3 A;  4O7W A;  4BJT A;  1GXP A;  4IIJ F;  1BIA A;  5F6F A;  3ONQ A;  3BG6 A;  3SFZ A;  5E18 F;  1LPQ A;  2XV4 S;  4K6N A;  5BYB A;  3PR4 A;  3GTP A;  5L1L A;  5KFG A;  4ECS A;  2JA2 A;  2QZ8 A;  5KG1 A;  1QHH D;  4HPQ A;  1PVE A;  3OYC A;  1I1L A;  4WBN F;  1TWA J;  2A69 F;  2ME6 A;  3RPQ A;  1U5T A;  1P4W A;  3IWF A;  5J6X A;  5LD2 C;  1DU0 A;  1WH5 A;  1IRG A;  4ZI7 F;  3FK7 A;  4Q45 A;  2HDW A;  1Z0X A;  2BHY A;  2JA7 J;  2KSW A;  3ZMV A;  1U5T C;  3DXJ F;  1GLN A;  3A01 B;  2DTR A;  3LQQ A;  3IKT A;  1ZH5 A;  2LBF A;  4YAK B;  3HPH A;  1G6N A;  2JEG A;  3OOU A;  3QOP A;  1I6U A;  5FD5 A;  4J9M A;  2HIV A;  3W6K B;  2DPI A;  1W0U A;  3CMM A;  3PQJ A;  2XPU A;  3EUA A;  4A69 C;  2WAQ E;  2Y75 A;  5BWT A;  1F1Z A;  3BG3 A;  3H1C A;  2CKZ B;  3RKQ A;  5E17 F;  1TTY A;  1TT5 B;  2JPC A;  5FLX W;  3OWT A;  1K78 A;  2VL8 A;  1AKH B;  3P9K A;  1IUF A;  3FXO A;  4EG0 A;  4NZM A;  1IGN A;  4FIS A;  1USS A;  2GIZ A;  4LFA H;  2IA1 A;  3E6M A;  3TP0 A;  1V5G A;  2VIX A;  1RZ4 A;  2JJ7 A;  5E20 A;  2ZJT A;  4XLF A;  3BZK A;  3WE2 A;  3ZQI A;  4CMF A;  2OF7 A;  2HOT A;  4KN4 X;  4KYW A;  1SFK A;  4XQF A;  1YG2 A;  3M4O J;  2VQE H;  4IHX A;  1KYZ A;  1QRY A;  3BTI A;  2W6N A;  3JRX A;  3QWU A;  2ZME A;  4BQN A;  4M6V A;  3JZI A;  2DMU A;  1JX4 A;  1ZG1 A;  2ZCW A;  3LOC A;  3K4B A;  2LYC A;  2X0L A;  1KQ9 A;  2OQG A;  2DJN A;  2EBI A;  5EEG A;  3HHH A;  1O3R A;  2ZBK A;  1LDD A;  2Z16 A;  1FOX A;  1JKO C;  1RJR A;  5FFX A;  1CF7 A;  5KFK A;  2IJL A;  2NNN A;  4Q4Z F;  5D8D A;  4LF6 H;  3GWZ A;  4L5I A;  1A9X A;  5DG9 A;  1P7J A;  1RI7 A;  3DF8 A;  3ASO H;  5IP6 A;  2X1E A;  2YRW A;  5M5X J;  4P1W A;  4XNF A;  3CMA I;  4XRF A;  2HZT A;  1R00 A;  3FK6 A;  1T08 B;  5GPA A;  5IT9 Z;  1IO2 A;  5F1R A;  4CMD A;  4XN0 A;  1IBL H;  1LFP A;  1HLV A;  1M6V A;  3UZB A;  2C2R A;  1RYS A;  2L01 A;  5CVU A;  5KFD A;  3BOQ A;  4RM3 A;  3TDU C;  1X9N A;  3J81 Z;  1S0O A;  1TLH B;  4HX4 A;  3DPU A;  3VEP A;  4YG2 F;  4AM3 A;  3I59 A;  2H27 A;  3T9F A;  2HWV A;  3NBY B;  2LVS A;  2RV8 A;  2X6O A;  2CWE A;  2LC2 A;  4O3M A;  4AU7 A;  1XDU A;  2D2W A;  4P9F A;  1FLI A;  5FLM J;  4BBS J;  3IRQ A;  3DBL B;  5BOX A;  2YZL A;  3WG7 H;  1K1Q A;  4BKX A;  3JW4 A;  4A6D A;  1D5Y A;  1UNN C;  2RDI A;  1E4E A;  4EQ5 A;  2DFI A;  3RB3 A;  3BP8 A;  5C44 J;  5I5U A;  2VQF H;  3M1E A;  4AYB E;  4QWE A;  5KT5 A;  2FMY A;  2EIM H;  1WCM A;  2JRM A;  3GLK A;  1EKV A;  4NB5 A;  4I6Z A;  2H8R A;  4J9S A;  4ECW A;  2PBI A;  4UY8 I;  5LYJ F;  1TWG J;  3TMO A;  3A02 A;  3HO8 A;  3T0Y A;  2KDZ A;  4RLF A;  4IHT A;  2GAU A;  1HA8 A;  2IXS A;  2CNV A;  3MKZ A;  2R93 A;  2ZXH A;  1U8R A;  1X2M A;  2Q8K A;  3G4S I;  2V9V A;  2VQL A;  3SGI A;  3Q5F A;  5KFU A;  1YIT I;  2BYV E;  2X48 A;  2VPS A;  4ENJ A;  4CXF A;  1EH7 A;  2E7X A;  2M5W A;  4GCV A;  3L2R A;  5IP9 J;  4M3F A;  3S16 J;  2YS6 A;  3CQZ A;  2KHM A;  2F5D A;  2W7P A;  4OU0 A;  5FKK A;  5JVT A;  5FLX Z;  1OR7 A;  3F21 A;  2VLA A;  3HEF A;  3HJE A;  1U6G A;  2YR2 A;  4TV8 F;  1BOB A;  4FS1 A;  2DCE A;  1VBG A;  1HBX G;  4L5E A;  5CQE A;  5FLM G;  2CMP A;  3R5X A;  1P2F A;  2WB1 E;  4BBS G;  4Y8V B;  2DAA A;  4RB0 A;  3AL0 C;  3PNT A;  4DV3 H;  2AQ4 A;  3U9G A;  1Y8R B;  2XRO A;  4Q47 A;  5LLQ A;  1F9N A;  1FPQ A;  3ABL H;  4HW0 A;  4HDU A;  3C7J A;  1N75 A;  4ESB A;  1EYZ A;  2AXT C;  3A03 A;  2V79 A;  5EOY A;  2OD5 A;  5J4Y A;  4A3G J;  2QVO A;  2G0E A;  1IV8 A;  3K1N A;  3KP2 A;  4JI2 H;  5KKN B;  3E5Q A;  4RAZ A;  3BAC A;  3AG2 H;  3EPI A;  4F93 B;  4IVN A;  5EYR A;  5BQT A;  2F4I A;  1G2H A;  2YZM A;  1BW5 A;  4NUB A;  2Z2S B;  2L3D A;  4HA8 A;  2QK4 A;  2I8D A;  4KN7 X;  4FFO A;  4DIQ A;  1JKP C;  1E3H A;  5IP9 G;  3O8G A;  2FE3 A;  2H94 A;  3S32 A;  5E3L A;  2LF7 A;  4MTD A;  4O84 A;  4D7N A;  5KFR A;  3RI4 A;  2LLK A;  4Z6Y A;  4RZR A;  4UXN A;  4LFC H;  1I5Z A;  2AQE A;  4YIF A;  2B63 J;  1FJG H;  1KU2 A;  3OYM A;  3B6C A;  3MZ8 A;  3KZI C;  4RGS A;  2XRN A;  1VF9 A;  2FPG B;  4PBC A;  5KG7 A;  1R23 A;  5ICG A;  3I4N G;  3M9O B;  2HZD A;  1FP1 D;  1ON1 A;  2E1C A;  3U1K A;  3FMQ A;  4S05 A;  3QYE A;  2XD4 A;  3BY6 A;  4A3G G;  3H0G J;  2KZV A;  2P8T A;  2Z02 A;  1T0F A;  5D5W B;  1TL8 A;  2WV0 A;  2HEO A;  4UNO A;  1IZ1 A;  4GLW A;  4YP3 A;  4Q4D A;  3F8B A;  3MWE A;  3BT9 A;  3JRH A;  3H4B A;  4MTE A;  1Z9C A;  2QCO A;  1Z3Y A;  1OCC H;  3WHC A;  3HRM A;  5DD8 A;  4A3M J;  3LA2 A;  1JJ8 C;  4IX7 A;  3ECO A;  1W36 C;  5BNG A;  4DQ2 A;  3TII A;  2K7L A;  4RGU A;  5A2Q K;  1Y0U A;  1ENH A;  1XMX A;  2W9B B;  1MMA A;  3SYT A;  2LTP A;  2Q2E B;  2Y2Z A;  1E3P A;  2B63 G;  1OCZ H;  2LKS A;  3CC4 I;  5KFC A;  3VPB A;  3FHZ A;  3T9E A;  4O3P A;  1PYV A;  1QZY A;  3GVA A;  4N4N B;  4Q4C A;  2GBY A;  1ZLJ A;  3HOY J;  3M9M B;  3GTL J;  4C5C A;  4B1R A;  3W3C A;  2HG8 A;  2L9R A;  5L1K A;  4RUA A;  4BE1 A;  4CH7 A;  4XR6 A;  3I53 A;  1R5I D;  1CKM A;  3H0G G;  3GV8 B;  4IRC A;  1BI0 A;  2QGU A;  4DNC A;  5EGO B;  1JT0 A;  4IRD A;  4XLE A;  1GSO A;  2X1C A;  3AG3 H;  2OCE A;  1A6Q A;  4CZC A;  1WJD A;  4MO7 A;  2VE8 A;  2R6F A;  2VXZ A;  4G3I A;  3CZ6 A;  1RC9 A;  3VPR A;  2M0C A;  1CQJ B;  4AID A;  2OAZ A;  2YUS A;  1K7A A;  2UUA H;  4A3M G;  2EZL A;  4R7R A;  4M72 A;  3RV4 A;  2NU7 B;  2W6O A;  5DG7 A;  4ZDP A;  2FF4 A;  2HOA A;  2HPI A;  1VBH A;  3PFY A;  3N6X A;  3GUD A;  2MW8 A;  1A36 A;  4DW6 A;  3K69 A;  4EEF G;  1FOK A;  3KEQ A;  3MKL A;  1V5F A;  2Z5U A;  3R6S A;  5EZG A;  5LEJ A;  3PSI A;  1NK3 P;  3MCZ A;  3TO7 A;  3PFI A;  1HC8 A;  3DEW A;  4BU2 A;  1FTZ A;  2BXZ A;  1C3O A;  4JI5 H;  1HQC A;  4I99 C;  3QZ7 A;  3HOY G;  5C5J A;  5I47 A;  3QU3 A;  2H8W A;  5D4R A;  3TY8 A;  2LKP A;  1MNE A;  5LBQ A;  3DKW A;  3FM5 A;  4U7B A;  5EEA A;  2VAS A;  4KIF A;  2RNJ A;  2BOL A;  3JRF A;  4QWQ A;  3JRC A;  1IN7 A;  3J80 K;  1A48 A;  1I2K A;  3NWS A;  1QO0 D;  1FOW A;  2DFF A;  2R7N A;  5IP7 G;  5J40 A;  3CDH A;  1ZG5 A;  4HDV A;  1IF1 A;  3CO6 C;  1GSH A;  3CUO A;  2IT0 A;  5CA1 F;  5FKM A;  4J9O A;  4QLC U;  4JXU A;  5BWU A;  3CUQ A;  3LQR A;  3V4Z A;  5DDG A;  1DU6 A;  5GON F;  3MR6 A;  3C0F B;  1R5H A;  1IOW A;  1NG6 A;  1XGS A;  2OV7 A;  1BJA A;  5DUK A;  4O86 A;  3T9D A;  2NAZ A;  2VOO A;  1R1T A;  1MJ9 A;  2V6C A;  4DJA A;  2K40 A;  3DKY A;  4D5F A;  4N0B A;  3FIW A;  3V42 A;  4JBA A;  4Q44 A;  3IH4 A;  3F8M A;  4PZ7 A;  2CQ7 A;  3KAK A;  3TW6 A;  1FX7 A;  3J7A K;  2R92 A;  4DOZ A;  4LMY A;  3K1M A;  2JMW A;  4PK4 A;  4F91 B;  3IRR A;  3CSW A;  3OIQ A;  1N48 A;  4IL6 C;  2K86 A;  3CJQ B;  3DBH B;  3CLO A;  3T8R A;  3L2C A;  1O3S A;  4HYE A;  2P4W A;  3I64 A;  2MLG A;  2D5V A;  3H9Q A;  1AHD P;  3T5L A;  2R5Y B;  4CHU A;  1E0E A;  1VKZ A;  3VNN A;  3K4C A;  1OCR H;  4NLG A;  2OU2 A;  1EKE A;  2A61 A;  4HAM A;  5H2F C;  1LB2 A;  3GTK A;  3X2Q H;  4O4J F;  1AUV A;  1JI8 A;  4I0A A;  4A5N A;  3G6V A;  2FSW A;  3ZQL A;  3AW8 A;  2ELK A;  2XPV A;  4HLX A;  3DCF A;  5F08 A;  2QBY A;  4ZC3 A;  2ME0 A;  2W6Q A;  4C3J J;  3S1Q J;  4F55 A;  3HIF A;  4EAT A;  1IUY A;  5CAE B;  1S5L C;  3PNV A;  1VND A;  3BG5 A;  3TL4 X;  2R7W A;  3RPU A;  4NQW A;  3ZMU A;  3HOU J;  5HV6 A;  1GLV A;  3U2R A;  5L9X A;  2FNA A;  4WXC A;  2O0Y A;  1I39 A;  3CC2 I;  9ANT A;  2IP4 A;  3GIQ A;  4DV2 H;  2QQA A;  2W82 A;  2GM4 A;  4BXX G;  4G94 A;  3TKY A;  5GTI C;  3OYL A;  2ZFW A;  3WTY C;  5KFH A;  1J5E H;  1X4O A;  3RPU D;  3KLN A;  4QWB A;  3ZCO A;  2ADU A;  5IYZ F;  4EJU A;  1SVO A;  1XB4 A;  2HDD A;  4EFE A;  1T2K A;  4OIO F;  4LJZ F;  1PDN C;  3LWB A;  1J9I A;  2EIJ H;  3EQL F;  2JZY A;  1HW2 A;  3FXU A;  1R1V A;  3ISP A;  3GTQ J;  5L1I A;  5BPF A;  3U21 A;  2UXX A;  3MZH A;  1TP4 A;  3TY9 A;  1MDM B;  5BWW A;  1MJA A;  4RNM A;  1S6L A;  3DPT A;  3WTU C;  3G1M A;  4IAJ A;  3G6X A;  1W5S A;  3R0J A;  2VOD A;  1OYI A;  2A1H A;  3W1B A;  3TQ1 A;  2AU0 A;  1F4K A;  3N05 A;  1CQI B;  2HS5 A;  1ON2 A;  4RBO A;  5A2Q W;  1TWC J;  1IG7 A;  4JI7 H;  3HHG A;  2OZU A;  3KX2 A;  4NHJ A;  3CD6 I;  3F23 A;  4PSX A;  3R5F A;  3TEK A;  5EWE A;  5BWX A;  3AAF A;  2G9W A;  1O3Q A;  5HBR B;  3WU1 B;  3IH2 A;  2NUA B;  1TAE A;  3TQT A;  2OWO A;  2DOD A;  2NOG A;  3DP7 A;  5FD6 A;  3MJF A;  5DCM A;  3JRA A;  5JQG F;  1S03 G;  5KAF C;  4EJW A;  1SVM A;  4FE2 A;  2P6S A;  3MMY B;  3RQI A;  2LOO A;  2HOE A;  2R7D A;  3GV7 B;  1SYX B;  2G7H A;  1A3G A;  4P5O A;  2RDJ A;  4LLL A;  1UST A;  2K27 A;  1B72 A;  3I4M G;  4LIV A;  1VI0 A;  4DL2 A;  4XK4 A;  1GXQ A;  1MMN A;  3W2A A;  3HUG A;  3N97 A;  2XSD C;  4O6J A;  1LE8 A;  4GRI A;  2DT6 A;  1WRV A;  5DGH A;  1D0Y A;  3K7A J;  1JIH A;  2HVQ A;  3H35 A;  4N9I A;  4MA0 A;  3CF5 F;  1WHU A;  4Q8E A;  3MD2 A;  2JA5 A;  5LEK A;  1LJ9 A;  4UV8 A;  1EV7 A;  4XLH A;  1Z2O X;  5LRR A;  4A3F J;  3SZG A;  4IO9 F;  2NVX J;  1SD6 A;  4WXH A;  5B66 C;  1UG0 A;  1WI9 A;  2YS7 A;  2KJB A;  1ZEL A;  3BJO A;  1ZRF A;  4A5M A;  5D1P A;  1BBY A;  3V8J A;  1WWX A;  3JCU C;  4KNY A;  4A3I G;  2C22 A;  2VB6 A;  2F4V H;  2Y4R A;  2WV1 A;  3K4M A;  4O3O A;  5L3F A;  3VA7 A;  2HQR A;  1S97 A;  1R9T J;  3E97 A;  1V55 H;  5IY5 H;  3RGX A;  2FBK A;  5JH7 F;  2EFQ A;  4D5C A;  1FKA H;  1NK2 P;  3D5R C;  3J80 W;  3J7A Y;  2BR0 A;  1ZR4 A;  4F52 A;  2XAJ A;  3CME I;  1U5T B;  3C2H A;  2EFP A;  3EUH C;  3RJP A;  1Y39 A;  3FXJ A;  2YX7 A;  3KZY A;  1WJA A;  3UFX B;  4L18 B;  3O2P E;  1CQT A;  4C5B A;  4E4H A;  2V9W A;  3KEO A;  2LBF B;  3ECH A;  2MAB A;  5IYC J;  4RA2 A;  1JXL A;  3FBN B;  3F8C A;  4V2G A;  4CKC A;  4A3F G;  3GZ6 A;  2P7C B;  2OJE D;  5KNL A;  3RF2 A;  1K4T A;  1RUO A;  4F3Q A;  2E1N A;  4KIB A;  3GFI A;  2FQ3 A;  3LST A;  3PUF A;  1K78 B;  3OHB A;  4DUY H;  1SD4 A;  5FPO A;  4F7Z A;  2C6Y A;  4P9U A;  4PFO A;  2R7L A;  2JSC A;  3LML A;  4A2A A;  5L3D A;  3OTO H;  3G6E I;  4FAS D;  2GLO A;  5KFS A;  4ECY A;  4UCU A;  5J1U A;  3BZC A;  4CIC A;  4EYH B;  4HV6 A;  2W57 A;  4YR0 A;  3LSI A;  4F4W A;  1JTX A;  4L9N A;  3E6D A;  2EB7 A;  3DTF A;  1U0J A;  3GIJ A;  1V54 H;  1TWG A;  2E2I J;  3OIO A;  5HVQ C;  5HOD A;  1XSD A;  2XSJ C;  2R87 A;  4O7R A;  3HOV J;  5A2Q Z;  1VQK I;  1OFC X;  4F4X A;  2HQN A;  2KIQ A;  2PMZ N;  3KP6 A;  3GFJ A;  4BQQ A;  1T39 A;  4U7D A;  4BQA A;  2FPP B;  2FBH A;  2FBI A;  1X1P A;  2LSO A;  4XON A;  4A0X A;  5KFV A;  2JN6 A;  4O5V A;  5IYC G;  4IHS A;  3HOT A;  2Y0S A;  1ITY A;  3ABT A;  2KIF A;  1RNL A;  1WJE A;  1B4A A;  1Y0N A;  3LA7 A;  5D5X B;  2W84 A;  2E2J J;  4GDF A;  1IN5 A;  2VR1 A;  4ECX A;  2QKM B;  2ZDQ A;  3DTE A;  3GXO A;  1YTY A;  2DIK A;  4I0B A;  2GOM A;  1RK5 A;  4ECT A;  2K9S A;  1LDJ A;  1ERD A;  2DA2 A;  1FYK A;  2E5N A;  1PUE E;  4O3S A;  3LQS A;  1MW7 A;  4W97 A;  1MMG A;  4DL6 A;  4E7I A;  1CE8 A;  5FKL A;  5DS9 A;  2NVQ J;  4JI4 H;  2ZSI B;  4MV4 A;  4O4H F;  3LSG A;  4JX5 A;  2F5V A;  2JWT A;  4PCQ A;  3GIM A;  1S9H A;  1WJC A;  1RKT A;  2BGC A;  2X9D A;  2ZDG A;  5J8C A;  1WPK A;  1K83 J;  1XSX A;  3CES A;  4PDB A;  3PM1 A;  5FRO A;  1Y1W G;  1AU7 A;  3ZQQ A;  1J75 A;  2EJ3 A;  5LGT A;  2IP2 A;  1ACI A;  5D8K B;  5FO5 A;  3HOV G;  4M0J A;  4HNT A;  5J1Y A;  3BJA A;  4J9N A;  2VOP A;  2IAI A;  1R5G A;  4YRV A;  1TC3 C;  1A04 A;  5J47 A;  3ULQ B;  5BWV A;  5C8Y F;  3FKJ A;  1IDZ A;  3T5J A;  2AGQ A;  2IMW P;  1BM9 A;  4J9K A;  2XC9 A;  4I7H A;  3N40 P;  2JUC A;  3HGY A;  3QOD A;  5KG3 A;  3JSN A;  4ME6 A;  2AGP A;  3DLL F;  3BQZ A;  3HOX J;  2IRF G;  2NOJ B;  1T38 A;  1IOV A;  1ORK A;  4XSZ F;  3ZQC A;  1MSE C;  2DA4 A;  1B9N A;  4C3I J;  4HR7 A;  4EJO A;  5H6Q A;  2E71 A;  4LF5 H;  4EV0 A;  1E4E B;  5HDK A;  3J80 Z;  5KCM A;  2EFW A;  3F8N A;  2MLK A;  2W85 A;  4FX0 A;  2XAH A;  4FE7 A;  2QEX I;  5KFJ A;  1U78 A;  1CKN B;  3OSN A;  2JT1 A;  3R4K A;  2Z04 A;  3FIS A;  2LR8 A;  2RRE A;  3GIP A;  5D5U B;  2A6E F;  3OUZ A;  3S93 A;  5EWG A;  4BDY A;  1UFM A;  2HU9 A;  2BVL A;  4RAY A;  3VPD A;  1ETV A;  4LB6 B;  3H36 A;  1JHF A;  2VPQ A;  2QQB A;  2LF8 A;  2ELJ A;  4CCN A;  3RFC A;  3ZQF A;  5L3E A;  2I10 A;  1M0W A;  4LF4 H;  3BJY A;  4QPO A;  1LEA A;  4ANJ A;  1I3Q J;  1KC7 A;  2HYJ A;  4IHV A;  1QQI A;  2YZG A;  2E1M B;  4LSX A;  3AL0 B;  1MBH A;  4IZO A;  3HOX G;  4AC0 A;  1IDY A;  3GBG A;  2W6P A;  2PQ8 A;  2DK5 A;  3RYR A;  3GFM A;  4M9Z A;  2QYO A;  1I2L A;  3N44 B;  4DV0 H;  2K9Q A;  5C4X J;  2DLL A;  1FBU A;  5H6R A;  4DYR A;  4JX6 A;  4X0G A;  1QZZ A;  3EYY A;  3G3Z A;  1SMY F;  2ZO4 A;  1I27 A;  2HHH H;  1J2X A;  2XF7 A;  4A3C J;  2DZD A;  3FXK A;  4LG0 B;  2W1O A;  4ZTJ A;  2FK3 A;  2RN7 A;  3M7G A;  3DBR B;  2M87 A;  2O7O A;  4XLA A;  1YIO A;  4RS8 A;  1UHW A;  2RQQ A;  5I5X A;  4PDK A;  1YRN A;  1PK8 A;  4BAY A;  3N43 B;  2KT0 A;  2KL4 A;  5LRS A;  3C1D A;  5ILU A;  1ZQ3 P;  1JKQ C;  3L7W A;  1F5T A;  3KTM A;  3K6G A;  1ZHF A;  2IPQ X;  1ETK A;  4GC7 A;  2Y48 A;  1YW7 A;  2Y9Y A;  5F0F A;  3SDG A;  2L5Q A;  4WD3 A;  1RPW A;  4RAG A;  2LY2 A;  2XB0 X;  5JHU A;  1H8A C;  3KP4 A;  3L4J A;  4RMN A;  4U0V A;  2XGE A;  2JA6 J;  5AIP A;  1T8I A;  3MR3 A;  1PJR A;  3LMM A;  3EPG A;  1MIJ A;  1U2W A;  2HYG D;  3JR9 A;  1TWH J;  5C4X G;  4HF0 A;  2E7W A;  4UVC A;  2AXL A;  5CVI A;  1WJB A;  4DIM A;  2CQY A;  2EZK A;  4IOC F;  2M7A A;  2W70 A;  1JT6 A;  1ZYR F;  4PSW A;  1S7E A;  4ED3 A;  1Q1V A;  3RZD J;  4A3C G;  1TQI A;  1FY7 A;  2MSY A;  1JDB B;  3LNQ A;  2R7K A;  4UUG A;  1FTT A;  3GME A;  4RAF A;  4PGH A;  1V51 A;  2CSO A;  1DV1 A;  1ZK8 A;  5CLS A;  2V1X A;  3JTH A;  2DPU A;  2R7X A;  4MEY F;  1TQP A;  2HOS A;  1Z6T A;  4NC7 A;  3PL8 A;  3H40 A;  3N8D A;  4O2A F;  2DA5 A;  2Q2U A;  3GLL A;  4MGR A;  2PX9 A;  1ZG3 A;  4XL9 A;  3HRU A;  4I76 A;  1VQO I;  2FRH A;  2XRL A;  4EM2 A;  2SCU B;  2ZME C;  5JHF A;  1S8N A;  2MD0 A;  4BHC A;  2ATL A;  3O8H A;  1BL0 A;  1T33 A;  1PX2 A;  4RNN A;  3LSM A;  3CP8 A;  5CVV A;  2TDX A;  1Z2P X;  3Q8P B;  2IS6 A;  2JA6 G;  4QWC A;  2GLT A;  3ETH A;  2CW0 F;  1ETW A;  5KT3 A;  1SD7 A;  1B33 N;  2ETH A;  1X1B A;  4KT5 C;  1FVI A;  3DV8 A;  3J7Y J;  3HM5 A;  2WBM A;  2R7M A;  3TY5 A;  1I50 A;  2O6G E;  3UNG C;  3S3N A;  3NQO A;  2GQR A;  3VOD A;  2MC4 A;  2DDA A;  4H4K C;  2L0K A;  3TO6 A;  2YZN A;  4B3M H;  4ED1 A;  1SAX A;  2IBK A;  2LKX A;  2CW8 A;  1LFB A;  3BA8 A;  2AO9 A;  4A3L G;  1J7K A;  1UC8 A;  4LFU A;  3ZMD A;  3K4L A;  3OL3 A;  4HX8 A;  5IOZ A;  1JXS A;  4PJJ A;  4CDG A;  3DPL C;  2JA8 J;  4QIW E;  4UUS B;  4DR7 H;  2EK5 A;  2W24 A;  2Z9O A;  3PW0 A;  4AYB A;  4YEL A;  2HHF A;  3NWT A;  4Q0Y A;  5GAD J;  1R7J A;  1N78 A;  4J9Q A;  2CQX A;  3GIL A;  1LKX A;  4JI8 H;  3WO1 A;  3AG4 H;  3CJT B;  5LP6 F;  4UVA A;  1RET A;  4LG3 A;  3BQ1 A;  3G71 I;  1MJB A;  2R7V A;  2VPR A;  4R1H A;  5D4S A;  2FU4 A;  2LY1 A;  1FYM A;  1OYY A;  2CV0 A;  1LVK A;  4ED0 A;  2NRA C;  3J7A O;  1BJT A;  5DG8 A;  1OBD A;  5M5Y J;  2VE9 A;  4E7L A;  4CUG A;  2VUM A;  1SAU A;  4EVI A;  1L0O C;  1KJQ A;  4JQF A;  2Q1Z B;  4XM3 A;  4EJT A;  5CYV A;  3Q3S A;  2XC7 A;  3GTJ J;  4LIT A;  2CUZ A;  4ED6 A;  4MQ9 F;  4H0E A;  4F50 A;  2GQQ A;  3CEB A;  2DMT A;  4K2E A;  3CP2 A;  2L7K A;  4DR4 H;  5K5O A;  2V58 A;  2DQL A;  4XMY A;  3IHU A;  5IOY A;  1D3Y A;  3OUU A;  3L00 A;  1OIS A;  1YLF A;  5EF6 A;  3GTQ A;  3E5U A;  1EUD B;  5FFZ A;  1YW9 A;  4EEQ A;  3FF5 A;  4MV7 A;  1K79 A;  3GTM J;  1WVR A;  3UQ8 A;  2UXB H;  2V26 A;  2JA8 G;  2FEZ A;  3DU6 A;  2UVU A;  4XBF A;  4ZQI A;  1MBF A;  2QSH X;  3HC7 A;  5DEQ A;  2OPT A;  1ETQ A;  1F43 A;  2M0M A;  4YEJ A;  2EFN A;  3M8J A;  2L7M P;  3M1C A;  3RR5 A;  2WDT A;  3DTK A;  3T99 A;  4WHX A;  2X85 A;  1TWC A;  3V8K A;  3H3U A;  4R8H A;  4BYY A;  1IXR C;  4BEH A;  3Q8R B;  5F1J A;  1OR7 C;  4LGW A;  4A3E G;  4DUZ H;  5FR9 A;  2E1M C;  4XKW A;  3H9G A;  2DYR H;  1R71 A;  2ZJR F;  1EJ9 A;  1S0M A;  5ED4 A;  1EKF A;  3F6V A;  4LIU A;  1TW2 A;  3UR3 C;  2CS3 A;  3I4N J;  2GQS A;  3I54 A;  1JUP A;  1WQ2 A;  2AQF A;  2VJ5 A;  2H09 A;  3WG9 A;  3RAX A;  2CW7 A;  1VQ5 I;  2M30 A;  1HKT A;  1EF4 A;  1KQ0 A;  4L1K A;  2WY7 Q;  3HSR A;  2Y9Z A;  4I02 A;  4G6T B;  5L3C A;  1GSA A;  5BPD A;  1IRZ A;  1KQ8 A;  3WNZ A;  3V7S A;  2O9L A;  4U87 A;  5ERI A;  1QA6 A;  2X5R A;  2DPJ A;  2FK1 A;  2PN6 A;  2XGX A;  2DW4 A;  3QPL A;  4II2 A;  4M9X A;  4OAY A;  5JR3 A;  4MEX F;  2R84 A;  1WKM A;  2XF5 A;  4E7H A;  3T9B A;  2IGN A;  3FX3 A;  2PN1 A;  3VB2 A;  2DOF A;  2QBY B;  3H92 A;  2B9S A;  1ZAO A;  2NVY J;  1BI1 A;  2HPM A;  4MV6 A;  3A0B C;  4QW9 A;  3BJ6 A;  3W2V A;  2V4R A;  3HL2 A;  2NVX A;  4FE4 A;  4FT8 A;  2COG A;  3ZOB A;  2IA6 A;  2EV0 A;  1R49 A;  5DAA A;  3UZO A;  4M3B A;  4YJ3 F;  4K0K H;  2FQ4 A;  5J1R A;  3FWE A;  5FNV F;  3PW5 A;  3KHH A;  4E7K A;  3FM3 A;  2W6Z A;  3RB4 A;  1SFE A;  2KJC A;  4DBR A;  1BOA A;  4CYC B;  1Z3X A;  2FK2 A;  3ZR8 X;  4ZHQ F;  4TQR A;  3I12 A;  2P0A A;  1VTN C;  4FFR A;  1TW3 A;  3JRW A;  3MKW B;  1RYR A;  4DZP A;  2VC1 A;  5TJJ A;  3F22 A;  2QUF A;  1OCT C;  2XDV A;  1QHG A;  3AX6 A;  5L1J A;  3T1H H;  4G7O F;  3RGZ A;  5BPH A;  1N33 H;  2HVR A;  1OQY A;  1QPM A;  3QQA A;  4NYE A;  1JLL B;  2FLN A;  4RB3 C;  1MH3 A;  3BR6 A;  3FKI J;  5IYB J;  5B1B H;  1TT0 A;  3M07 A;  4CHI A;  2ZNZ A;  1T0F C;  4MV9 A;  4ED8 A;  3WTT C;  1R4N B;  1BI3 A;  3OSF A;  1BN5 A;  2HQA A;  2Y0S N;  2J9G A;  3GJX B;  4O7L A;  4A3B J;  3IL2 A;  2OH2 A;  2LH9 A;  4O3Q A;  2PMZ E;  2P5L C;  3JSL A;  4LH7 A;  3QZ8 A;  2L7Z A;  3CJN A;  4CYD A;  5F27 A;  1X3U A;  1RRJ A;  3KE2 A;  2UVR A;  1QZE A;  1FIA A;  1XCV A;  1XGN A;  2VQG A;  1QPI A;  2M7B A;  3ZQG A;  1HST A;  2XCL A;  1IN4 A;  4XLP F;  3N6R A;  1ZTR A;  5DCM B;  3RB0 A;  3SQN A;  5BR8 H;  2V1U A;  4GLX A;  2NU6 B;  1N32 H;  2ZKZ A;  3F8F A;  1UCR A;  4PUS A;  2W7N A;  4EGJ A;  4G8X A;  3H3V K;  5BWR A;  5JVG F;  3I0T A;  1B72 B;  2QWW A;  4DL5 A;  1X4P A;  2LD5 A;  4HQM A;  1RR7 A;  3DKX A;  2EZH A;  3V8L A;  1SEU A;  1LE8 B;  1FYL A;  3JTG A;  2A07 F;  4O7Y A;  5IP7 J;  2ZSH B;  1BR2 A;  3I71 A;  5E3O A;  3OYD A;  2OTJ I;  4ECQ A;  3FKI G;  3GYH X;  1Y8Q B;  3QRF F;  5KFZ A;  4DBQ A;  3K2Z A;  3QWL A;  5IYB G;  1ZLK A;  1MZB A;  4YY3 H;  1W5C C;  2XKO A;  2VBY A;  4MV3 A;  1D5V A;  3BCB A;  3HKZ E;  5DLG A;  4X64 H;  4A3B G;  2F48 A;  4DR1 H;  1IN6 A;  1ZRD A;  4C2M J;  3WWH A;  1KGS A;  1Z77 A;  3MQ0 A;  1APL C;  1C0W A;  1ETX A;  4WCG A;  3M8E A;  3S24 A;  3ZN0 A;  3QPT A;  2XAS A;  5HNH A;  4CE5 A;  3MFI A;  1UZC A;  1N34 H;  1PP8 F;  2VUG A;  4XRS A;  2VQD A;  2MYS A;  4DR6 H;  1O7L A;  1RES A;  2Z1D A;  4PJM A;  4A93 J;  4XX0 B;  4E4T A;  5IT3 A;  3DF7 A;  3K4N A;  1GDT A;  4JYK A;  5GAG J;  2GIV A;  2K02 A;  1RJQ A;  3KHR A;  3F0C A;  2O8K A;  4IPA A;  4RB1 A;  3D1N I;  1SAN A;  2VJ4 A;  5B1A H;  4F92 B;  3DLA A;  3T5H A;  2CQN A;  2BBY A;  3QPH A;  2PVP A;  2R7Z G;  2QA4 I;  1D1A A;  5BS6 A;  4HQ6 A;  2R8G A;  4BY7 J;  5J2T F;  3ML6 A;  1ZGW A;  2VPL A;  4ZYH A;  4FFP A;  2R7R A;  5DV5 A;  2DYS H;  3Q9S A;  2STT A;  2HGX A;  1M7J A;  4WX9 A;  2XF6 A;  3H0D A;  1MNM C;  3CCY A;  5EG0 B;  3HYI A;  3LAJ A;  1J59 A;  3OYH A;  3ERE D;  1NH3 A;  1HCR A;  4NZO A;  3JRB A;  3C18 A;  3CUQ C;  4E7Z A;  5FJ8 J;  2NVU B;  4BXU A;  3JSO A;  4BXX J;  3IN5 A;  2QLZ A;  2FJ1 A;  5LL6 b;  1A6I A;  1HNX H;  3CCQ I;  2GXB A;  1XMO H;  4N9H A;  4A93 G;  3BQ2 A;  1P92 A;  4GYG A;  2XCP A;  4LK1 F;  1P8L A;  1V9P A;  4TV7 A;  2BW3 A;  3CCS I;  3Q9V A;  2BY2 A;  2QYZ A;  2BZT A;  4Y52 J;  4QJF A;  4LF9 H;  1WH2 A;  2A68 F;  2L9N A;  2O3F A;  5K7Z A;  4JOM A;  1LNW A;  4M3E A;  3LP8 A;  4Y33 A;  5KG4 A;  2ZXW H;  3PQK A;  2JRT A;  5FRN A;  2VKD A;  1FSH A;  2DQR A;  4CCM A;  1LQ1 A;  4MHG A;  1X1A A;  3C2G A;  4C30 A;  4YJ2 F;  5CR5 A;  3OL4 A;  4EGQ A;  5KFA A;  2FML A;  3IV5 A;  4IRH A;  4BY7 G;  3AFH A;  1W7P A;  3C3W A;  3EYI A;  4KUM A;  3FBI B;  1I6X A;  2DOA A;  3U9T A;  3KHL A;  1KJI A;  2R7Q A;  2VQH A;  4JV5 H;  2DA3 A;  5E1X A;  2QF7 A;  1OBG A;  2V9P A;  3G8D A;  5GTH C;  3VYU B;  1W7P D;  1TZL A;  4JV0 A;  1UC9 A;  5FJ8 G;  3SHF A;  4IRK A;  4GXO A;  1M0T A;  1SFU A;  4HST A;  4BNC A;  2OQR A;  2UXN A;  3G1O A;  1FIP A;  3KZZ A;  3OYN A;  2CGP A;  3T1Y H;  5TIS C;  4EEY A;  4DV7 H;  2MD5 A;  2MA3 A;  3T5X A;  4W1U A;  1EHI A;  4EYI B;  5HNF A;  5LMN H;  4BUP A;  1ONV A;  3AKZ A;  2RVC A;  2R5Z B;  2H6C A;  3I4M J;  1A35 A;  2DA1 A;  4KMU X;  2VA3 A;  5EJC A;  2GA2 A;  2VJI A;  1FT9 A;  3ZMS A;  1XDS A;  2L2O A;  1TWA A;  4IHY A;  1DGR M;  2XPW A;  2HIX A;  4DQN A;  3PNY A;  2MCT A;  4YR2 A;  3F72 A;  2ZB9 A;  1PP7 U;  4E6N A;  3GID A;  2YPR A;  1PUF A;  2F4M B;  4P55 A;  1FMW A;  2NS0 A;  2NS7 A;  2FD5 A;  1BXR A;  2BVM A;  3G1L A;  2FB9 A;  5KFP A;  4JI3 H;  1GV5 A;  4KJZ A;  2EIN H;  3R0A A;  4AUX A;  3U9S A;  4CCL A;  2R7S A;  1EH6 A;  4G7H F;  3KHG A;  2UUC H;  4HLY A;  5HNE A;  3LL7 A;  2WC2 A;  2X0S A;  4A3I J;  3FXQ A;  2NU9 B;  5L3B A;  2M34 A;  2R86 A;  2IA2 A;  3KP7 A;  3P7N A;  3K5H A;  1HNW H;  1I7L A;  3IP4 B;  2OA4 A;  2X51 A;  1TWH A;  5KT6 A;  3BR3 A;  2HTS A;  2Y31 A;  3BC8 A;  2DBB A;  3H3Z A;  3HPG A;  4OIQ F;  1IBM H;  5HDG A;  3PIO F;  4J0M A;  2ALZ A;  1HDD C;  2VT3 A;  1EA3 A;  1R1U A;  3CQZ J;  2ZJP F;  6PAX A;  1LVA A;  2LDU A;  3DTG A;  4PZ6 A;  1AN7 A;  2UUB H;  4AQY H;  2XAU A;  1HXD A;  4IZZ A;  2YW2 A;  4GGG A;  2NU8 B;  4ECZ A;  4B44 A;  4YB8 B;  4M9U A;  2BV6 A;  2XGP A;  2DT7 B;  2ID6 A;  2NYX A;  2R7F A;  3VYS B;  1YS7 A;  5J4V A;  4A3J G;  2W9B A;  2OTL I;  4Y4R A;  2HQ5 A;  1AUX A;  2ASJ A;  3KPH A;  1D8J A;  2JUG A;  4B48 A;  4ZOL F;  2EV6 A;  1MGT A;  2Z99 A;  2QQ8 A;  4I01 A;  4Y13 A;  4J01 A;  3GEZ A;  1YIJ I;  3QQM A;  5LA6 F;  3S1N J;  3H9J A;  1E2X A;  2PJR B;  1YJW I;  1XNR H;  2LG4 A;  2R82 A;  3V4G A;  4UFZ A;  3SE7 A;  4NBQ A;  3DAA A;  4R8U B;  5CVJ A;  3V4S A;  2WAD A;  1ODD A;  2YX4 A;  3GTG J;  1CS0 A;  2HGS A;  1EZ1 A;  5KFF A;  5I60 A;  4FU0 A;  5ICC A;  2PBZ A;  2RC4 A;  1EUC B;  3PUB A;  4D0P A;  2M9H A;  2KRC A;  2FA5 A;  1KON A;  5J3L A;  1LUJ B;  3NUA A;  2JSP A;  2YSR A;  5AON A;  4D9J A;  4DGW B;  5M5W J;  4XLC A;  1QBJ A;  3FMA A;  1UJ8 A;  4FCY A;  4BHB A;  1YRN B;  2E5Z A;  3M3Y J;  2WWY A;  4ZJZ A;  2GA1 A;  4HQE A;  2PLY A;  3CCE I;  1BGW A;  2UVW A;  4HNV A;  2FMA A;  2A6H F;  4Y7N J;  5GPC A;  3I9V 2;  5CB4 F;  4J00 A;  2YWV A;  2ASL A;  3C2B A;  2V1D A;  1STZ A;  3QU6 A;  3L2U A;  1I7N A;  5HDN A;  3KAL A;  2W4S A;  3F9K A;  4HF1 A;  2PJP A;  1DV2 A;  3BCA A;  4MAM A;  4ETS A;  2A5W A;  5FKN A;  1Z1D A;  3K3P A;  1XMQ H;  3WTX C;  2CNU A;  1S68 A;  5KT2 A;  1K6O A;  2GXG A;  1B1B A;  4ZYA A;  1JUS A;  2CFO A;  4XYM B;  3U54 A;  1Z6R A;  2HDK A;  1T56 A;  5C1P A;  2LP0 A;  4HZF A;  3LSH A;  1IYD A;  3OYE A;  2FKL A;  3K4J A;  4KIT B;  1IC8 A;  5E3N A;  3PJR A;  4IKF A;  4KMF A;  2VC0 A;  3T9C A;  1X1C A;  2EFO A;  3ZQH A;  4FS2 A;  3OYI A;  3RUP A;  1D8K A;  5KFL A;  5K3W A;  2IGM A;  2XCA A;  2JA7 A;  1G3S A;  4EQQ A;  3HT5 A;  3FXM A;  1G3T A;  1P6R A;  5HLI A;  1RIO H;  4JI0 H;  3G2B A;  1Y14 B;  5EWF A;  5E1Z B;  1XPX A;  4HG2 A;  1Y1W J;  5K5R A;  2JEF A;  2WYO A;  3G8C A;  3BRO A;  4M3D A;  4JYA H;  3DTI A;  5JI6 A;  1K61 A;  4M71 A;  1HSJ A;  1A0G A;  2ZME B;  3FDY A;  3S3O A;  1XK5 A;  4NC6 A;  2W9A A;  5CA0 F;  1IW7 F;  4ED7 A;  2K4B A;  3RB6 A;  3BTL A;  3BTC A;  3GTM A;  4CSW A;  3H5R A;  2CZG A;  3QP5 A;  4XZ3 B;  2DTZ A;  1I1M A;  3KP5 A;  3ZMZ A;  5C3E G;  4O7Z A;  5LHH A;  2M3A A;  4KIG A;  5JQW A;  3TOB A;  1CF7 B;  4CCK A;  1BR1 A;  2P5V A;  4HX7 A;  3S2W A;  3VDX A;  3HOS A;  4ESF A;  2R3S A;  3AG1 H;  1O57 A;  3T9A A;  4DV1 H;  1G59 A;  1GGO A;  2FXA A;  1WGX A;  2HXO A;  5HLH A;  2K3P A;  1X19 A;  5KAI C;  1FC3 A;  3NGD A;  2R5Y A;  1T98 A;  3PW4 A;  4CKE A;  3OR2 C;  4L0Y B;  1EKP A;  2FP4 B;  1JKR C;  1WI3 A;  1OPC A;  4A0Z A;  4IQJ A;  1KU3 A;  2VA2 A;  4X1E A;  4BHP A;  1KUT A;  3WTS C;  3HDD A;  3MFK A;  3ZP5 A;  1Z05 A;  1Z21 A;  4E70 A;  5FB2 A;  5E25 A;  1T36 A;  3SZP A;  1WR2 A;  4QTR A;  1FOY A;  4WF2 A;  2V7F A;  5KFM A;  3RKX A;  2UV1 A;  3RSN A;  4NDL A;  4RCN A;  4FHT A;  3ZN1 A;  2HKO A;  2UUZ A;  5L3G A;  5AIQ A;  1YO5 C;  1T95 A;  1TQM A;  2P7V B;  5K7H A;  3VSL A;  4C2U A;  3I59 B;  2EQR A;  5FLV A;  3GDE A;  4X62 H;  1YOV B;  2E1O A;  4FQG A;  2UXD H;  4I50 F;  4ZYG A;  1V3F A;  1LEB A;  3RV3 A;  2Y0S E;  3QP6 A;  2DI3 A;  2FOK A;  2XAF A;  4JX4 A;  1G4D A;  3J7Z I;  3PO3 J;  2GPS A;  4AIH A;  2P0W A;  4CKB A;  2DO7 A;  4OMY A;  1GO3 E;  3BAA A;  4I4T F;  4WK8 F;  2OCC H;  2F2E A;  4O81 A;  3O6B B;  3WGG A;  1BA5 A;  1W0T A;  3R5H A;  4ZTF A;  2H1L A;  2B63 A;  4O82 A;  4S0H B;  5EDN A;  1OCP A;  3LUL A;  3SI8 A;  4II3 A;  3JRD A;  2EIK H;  3CO7 C;  4B3X A;  2P81 A;  2O03 A;  3IAM 2;  3LSP A;  1B6S A;  3NEU A;  1N25 A;  3VFZ A;  1UEL B;  4XLN F;  3ABM H;  5JVL A;  4QPQ A;  1JUM A;  2FUG 2;  3H0G A;  5LMU H;  1MMD A;  5EDW A;  5CKT A;  1J09 A;  2EWN A;  3F6O A;  4GKK H;  2CH0 A;  3K0L A;  5H20 A;  3ZMT A;  1CKO A;  2YL2 A;  3K5I A;  2C35 B;  1X1D A;  2YCH A;  2IBD A;  3V6J A;  4FBU A;  4L0Z B;  1N56 A;  1GVD A;  2VKV A;  3W5O A;  1V4R A;  4JP0 A;  4ECU A;  1KYW A;  3KFW X;  4BEH B;  3K70 C;  1T6S A;  4AIJ A;  1G2W A;  3UYY A;  1AWC A;  3N41 B;  3HBL A;  2COJ A;  4O7S A;  2CQQ A;  3K70 D;  4YAJ B;  3PO3 G;  5E8G A;  3M4I A;  2B0L A;  5I5S A;  3TIG A;  2X4H A;  4V19 K;  4WXD A;  2CV1 A;  4QW8 A;  2EH3 A;  3BG9 A;  5HOO A;  3GTK J;  4JV2 A;  4YFN F;  2KDO A;  4Y17 A;  3Q0W A;  2V5A A;  3GII A;  2FJZ A;  4I55 F;  3VWB A;  3K3V A;  1DIK A;  4S04 A;  5HLG A;  3HXL A;  5KX5 F;  3A0H C;  4UCR A;  2L7F P;  3GTL A;  3Q0U A;  2E5L H;  2WAQ A;  3MWD A;  5LOV F;  5KG2 A;  4O3N A;  1IRF A;  4CCO A;  4PGG A;  3OYG A;  5CM0 A;  4OIR F;  3ORR A;  3D5L A;  3S17 J;  4UB6 C;  1MBG A;  1VQ6 I;  1IBK H;  4RUC A;  1F36 A;  3TBI A;  1KJ8 A;  5HLT A;  4OWR B;  4BL0 B;  3LWF A;  2HVS A;  2LRD A;  2CYY A;  4EBD A;  4B3R H;  1VQ9 I;  1DQU A;  2VQC A;  5ICE A;  3ABK H;  2R92 G;  1D1B A;  1YJN I;  5KFQ A;  4F4Z A;  1B6R A;  3TW7 A;  4C2M A;  2CNQ A;  2E35 A;  3HRT A;  4J9L A;  1T94 A;  1I1K A;  4BWS C;  2ZNY A;  3IUO A;  3L09 A;  1SFO J;  4G12 A;  2VON A;  1MBK A;  2B7E A;  5KVR A;  4HEA 2;  1S72 I;  2RGR A;  4MV8 A;  3V7C A;  4ENM A;  2EIY A;  2HKX A;  2O8X A;  2MFZ A;  2MH2 A;  2DMN A;  1ZET A;  1KZH A;  3HSF A;  3JRE A;  5J2U F;  1E4F T;  4TVI A;  1U8B A;  2PG4 A;  2ACJ A;  4OMZ A;  4Q5S F;  3WO0 A;  4APM A;  2JVG A;  5IPA A;  1L3L A;  4A3L J;  1Z67 A;  1Y1V J;  5KFI A;  1HR0 H;  4ENN A;  3S1R J;  1SFX A;  2R7T A;  3G73 A;  2KKO A;  2V59 A;  1DAA A;  1OKR A;  1SCU B;  4IRI A;  4O7N A;  1H9G A;  4B3S H;  3RDI A;  2Q7D A;  2ZM6 H;  4ZYD A;  4B09 A;  3H3V H;  2QM3 A;  4U88 A;  2OLS A;  3TED A;  5DYM A;  3I58 A;  3EPZ A;  5D8L B;  5F0C A;  1RUN A;  3DEE A;  4M9S A;  1TWF J;  1VQN I;  5DD4 A;  4CC5 A;  3QFF A;  2BXY A;  5KS8 A;  3KYC B;  4A2U A;  3GZN B;  3EET A;  1XSV A;  5HS9 A;  2QB5 A;  1IRX A;  5FGM A;  1IV6 A;  4QIW A;  3HGG A;  2AHQ A;  2ECC A;  3BR2 A;  4X65 H;  2HXI A;  5KFB A;  4GO1 A;  1K4S A;  1S29 A;  4BS9 A;  2JA5 J;  2R7U A;  1H89 C;  4ZDO A;  3BR0 A;  3L4K A;  1SD5 A;  2DAO A;  5I5T A;  4PZ8 A;  2JA7 G;  2RAE A;  3A1Y A;  5KFW A;  4DL3 A;  1GHC A;  2C00 A;  2I80 A;  5GAE J;  1X2N A;  2O5R A;  4NXM H;  3FXL A;  3T7A A;  2IVM A;  1ZN2 A;  2A3S A;  4M3G A;  4RGX A;  4ZH4 F;  2E34 A;  4HN2 A;  1LFU P;  1Y1V G;  5KFY A;  2BE5 F;  1KJJ A;  5EZH A;  4MIM A;  2VKE A;  1IYE A;  4EM0 B;  2WY8 Q;  3CTA A;  3SJM A;  3R23 A;  1ZGA A;  2PMU A;  2DMQ A;  1XN7 A;  5HS8 A;  4AVZ A;  2RF4 A;  1X58 A;  1B59 A;  2V4J C;  4YFK F;  2TRT A;  1IN8 A;  3COA C;  1KT8 A;  2DAB A;  1RKW A;  2NS8 A;  3JAM K;  5DGB A;  5IWA H;  4LF8 H;  2BY3 A;  4O7V A;  2DA7 A;  1U3E M;  4A3E J;  2ZXJ A;  5CPR B;  2I87 A;  3RJ0 A;  2XVC A;  3GW2 A;  3OR1 C;  3ZGK A;  1BNC A;  2IGO A;  2VXD A;  3CC7 I;  1YYV A;  5CE8 A;  4JUZ A;  1DPR A;  3BWG A;  5KG0 A;  3ZXS A;  5DLF A;  3PSF A;  3RBD A;  3L2W A;  2L02 A;  1MBJ A;  2VBZ A;  1O7F A;  4M6X A;  2X6Y A;  4XKC A;  5CQG A;  2JA5 G;  2UZK A;  3P9I A;  4KDP A;  3DEU A;  4CZZ A;  5D1O A;  1OCO H;  4AVP A;  2IGK A;  1E4G T;  5KG6 A;  3VMM A;  3Q0V A;  2BQR A;  2K9L A;  1GV2 A;  2E60 A;  3D0S A;  1XS9 A;  1JGS A;  3JRI A;  3KYL A;  2WB1 A;  1R4M B;  4ZZD A;  1TA8 A;  2PMH A;  2E2H J;  2P5K A;  3WTW C;  1N36 H;  4C5A A;  3S14 J;  4Y3O A;  3KP3 A;  4D1Q A;  1I3A A;  4XRM A;  1VAJ A;  2HGC A;  3GTO J;  2QKL B;  2OZ6 A;  5F9N A;  3FMS A;  2K85 A;  2M2E A;  2VBX A;  3CUQ B;  3GCM A;  4KT6 A;  4ZDL A;  4BXF A;  5DM6 F;  3LAP A;  2F5F A;  3R60 A;  2RGV A;  4B47 A;  5D5V B;  1B8I A;  5IYD J;  2W9C A;  2EPF A;  2KIM A;  5HS7 A;  2WTF A;  2ABJ A;  5KFO A;  4O3R A;  2DDB A;  1CKN A;  2BEO A;  1XD7 A;  1X3Z B;  2ISZ A;  1IJW C;  4J9R A;  1ZRC A;  4XOR A;  3REO A;  3E5N A;  2DMP A;  2L54 A;  2CFM A;  4ABZ A;  1SEI A;  3RBE A;  1HF0 A;  4DAA A;  1K1S A;  4BE2 A;  1FNN A;  3E5X A;  1W93 A;  1BC7 C;  1Z7U A;  1G8X A;  1C30 A;  1RJP A;  3V6H A;  2BW3 B;  2BY1 A;  4YHH H;  3SNO A;  5B5E C;  4U0Y A;  3PZP A;  4UUT A;  3TGN A;  4PJN A;  3OYF A;  5J8F A;  4UCV A;  1SMT A;  5LFA A;  1UMQ A;  2X6X A;  4JI6 H;  5F04 A;  3HG9 A;  4JI1 H;  2YU9 J;  3K10 A;  4ASN A;  3ETJ A;  2NVT J;  2K9M A;  4BJ6 C;  4GC6 A;  1W7P B;  3N4M A;  3OYA A;  1VFC A;  5DGA A;  3SFI A;  5C44 G;  1QU3 A;  1FEX A;  3PVX A;  4YR3 A;  4IR1 A;  4B43 A;  1RK6 A;  2Y30 A;  5IYD G;  3FZV A;  1NG7 A;  4LG0 A;  2M4G A;  4NQW B;  4BAC A;  4KFC A;  2CQK A;  3E3V A;  2CG4 A;  2WA0 A;  1MSF C;  3JRG A;  2LMD A;  2D1H A;  3E0J B;  1R36 A;  3BR1 A;  4LFB H;  3GTG A;  4DV6 H;  3MVP A;  4IHW A;  4NC8 A;  4AWX B;  1UHS A;  3GIK A;  1W4M A;  1UG2 A;  2HNH A;  5K2M A;  3T5K A;  1R9T A;  1ET0 A;  4FBT A;  2PMZ A;  2A5Y B;  2XHK A;  2DN0 A;  3KYH C;  2XB5 A;  2H1K A;  3A01 A;  3W6V A;  2FPI B;  4UHT A;  3B02 A;  3QOE A;  3LSK A;  3GQC A;  4U6P A;  3RAQ A;  4NZN A;  2KMU A;  4JK1 X;  4XKV A;  4RM2 A;  3HZJ A;  1D1C A;  4HOB A;  1IXC A;  5M3F J;  2HTJ A;  2DLN A;  1DGW Y;  2HGW A;  5FPR A;  2QSF X;  3CF2 A;  2JK3 A;  5DTD A;  1JE8 A;  2V9K A;  3VOE A;  1PUF B;  2IS4 A;  2C2D A;  3M8F A;  2KFD A;  2XAQ A;  3BQY A;  3VYT B;  1KBL A;  3OS2 A;  4YFX F;  3GZ5 A;  3T1B A;  3GV5 B;  2DFH A;  2UXC H;  2KP6 A;  2M8E A;  3OMY A;  1AKH A;  4G6D A;  4UVB A;  4ON0 A;  1DUX C;  4DLK A;  2KPM A;  2XGD A;  4ECV A;  3E7L A;  4LLG F;  3QAH A;  4UUV A;  4FFL A;  2OBP A;  4RLQ A;  4A0Y A;  1H9T A;  4G7Z F;  2F5E A;  3DWL E;  3LSJ A;  2R0Q C;  4LOC A;  2QQ9 A;  2K3F A;  4D7M A;  5BPI A;  1XGM A;  4CGZ A;  5BYA A;  3OSP A;  4UB8 C;  3CCM I;  2DPD A;  1VS0 A;  3SZT A;  3HKZ A;  3VYR B;  3KEY A;  3OIP A;  4IEJ A;  4M7E A;  2KQR A;  3HOW J;  2XKP A;  1S7A A;  3KAJ A;  2VOB A;  3PFF A;  1NTC A;  4Q48 A;  3ORQ A;  4CC6 A;  4XKB A;  3I3L A;  3HSE A;  4BY1 J;  3HUG B;  3ZRG A;  2BQ3 A;  2E19 A;  4MQV A;  2XGQ A;  4DR5 H;  2CV2 A;  3OYK A;  3ABU A;  4IOA F;  1FMV A;  1Y6I A;  1YX5 A;  2XUB A;  4G6Q A;  1Y1W A;  2R7Z J;  1W36 D;  5KK1 A;  1DP3 A;  2E2I A;  2OUM A;  2FLL A;  1K6Y A;  3LFK A;  5F9L A;  3F3X A;  3IAS 2;  3L1P A;  4HRI A;  4J19 A;  3U55 A;  4LH6 A;  5DQG A;  4NXN H;  2ID3 A;  1E17 A;  4LK0 F;  1JGG A;  2V4Q A;  3B6A A;  3JAM W;  3P5J A;  4Q43 A;  3ESW B;  5KHD A;  2R85 A;  3M9N B;  3GTP J;  2V6E A;  1WH7 A;  2Y69 H;  1MBE A;  3HB9 A;  3CLQ A;  2ASD A;  1BC8 C;  1LDK B;  2LY9 A;  4M6Y A;  1ZAR A;  1QNT A;  4CA0 A;  5DM7 F;  3CMY A;  3N42 B;  3U0G A;  4QWA A;  1G3Y A;  1MD0 A;  2I8C A;  1B9M A;  2Y0M A;  3E1S A;  4DRF A;  1HDP A;  3S1M J;  3GFL A;  3RZO J;  1YJ9 I;  2D45 A;  2ODT X;  3VOT A;  3KXY T;  3RKW A;  2KLO A;  5CJ9 A;  5F64 A;  4B8X A;  4UUS A;  3HOW G;  3M9A A;  3Q8S B;  1POG A;  2DA6 A;  2EZI A;  2L4M A;  3IH3 A;  4HYK A;  1ULZ A;  4XYL B;  5KFT A;  4B4C A;  3CCR I;  1YS6 A;  4MLO A;  3PW7 A;  4BY1 G;  2F4O B;  5T14 A;  1I1S A;  1UHM A;  1Z2N X;  3MEX A;  1K83 A;  1XC5 A;  4BGD A;  3JZ6 A;  3H5N A;  4HBL A;  3LA3 A;  4X66 H;  1YQA A;  4YIR X;  4J9P A;  3QYF A;  1MND A;  2QSG X;  2V1N A;  2R8J A;  3B73 A;  1VQ7 I;  2XGC A;  2GOX B;  1WSU A;  2QEN A;  2ZDH A;  3ASN H;  5GP9 A;  2BQU A;  3KRE A;  3PN1 A;  4C2T A;  1ZKG A;  3RTR A;  3RTX A;  2A6T A;  1JHH A;  2LRE A;  1EH8 A;  4RDU A;  1H0M A;  3O3K A;  3S2H J;  2VBW A;  4M73 A;  2W6M A;  4IXA A;  3G6Y A;  4QWD A;  2IA0 A;  4HV5 A;  2JVH A;  5LHG A;  1AA7 A;  3WU0 A;  4E6K G;  1ZAU A;  4I2O A;  1REP C;  4LLN A;  3KIO A;  3MN2 A;  3OV8 A;  1WJF A;  2K4J A;  2UWM A;  1ZHQ A;  5C4J J;  1JKJ B;  2L9S A;  2A05 A;  1YI2 I;  1BR4 A;  2WAQ N;  2YRX A;  4B3T H;  2PEX A;  1DDN A;  1ZHS A;  1HNZ H;  1WJ5 A;  3TP3 A;  2GZW A;  2DT5 A;  1WSC A;  3VPC A;  1S3J A;  4IR9 A;  1FP2 A;  1YE9 A;  1NHA A;  2R8H A;  4TQS A;  3A4C A;  2R7O A;  2ICW G;  1G3W A;  3BG7 A;  4OAZ A;  2HJW A;  3WOD F;  1GUU A;  1TNS A;  2E36 A;  3AYH B;  5D6E A;  3EUK L;  2W8L A;  1I50 J;  3CVZ A;  1TNT A;  3VSK A;  3ELK A;  1Q1H A;  2BY0 A;  2HDC A;  5KT7 A;  3BLY A;  3K1P A;  2LK2 A;  2M45 A;  4IWX A;  1I3Q A;  3WGI A;  3E6B A;  2J5O A;  4ECR A;  4BBR J;  4IJA A;  2W48 A;  2NXN B;  3TDZ C;  2VN2 A;  3RYP A;  3QYB A;  5M3M J;  3SEQ A;  5DUI A;  4BJ5 C;  2M05 A;  4XOT A;  2CUJ A;  2CUE A;  4Y15 A;  3BAB A;  3BPV A;  4GYI A;  1P4A A;  4BE0 A;  4O2B F;  1M1E B;  2HYF A;  3TQN A;  1A0I A;  2ZC2 A;  2F5C A;  1V4Y A;  3IC7 A;  1XGO A;  2GXA A;  4ENK A;  4EBC A;  2CRG A;  4ZYE A;  1ZR2 A;  1HW5 A;  4AIK A;  3JZF A;  3CDL A;  2C28 A;  4PJL A;  3JAM Z;  2VKH A;  4A3J J;  4UV9 A;  1KEE A;  4FGR A;  2FLP A;  4HNU A;  4KHP H;  3Q2O A;  3GX4 X;  2ECB A;  3GO5 A;  2W71 A;  2X1D A;  2YS9 A;  5BMZ A;  2VUM J;  2EJR A;  4BH9 A;  3IG0 A;  1FBS A;  4EBE A;  1KJ9 A;  1WCM J;  1A31 A;  3CCU I;  1MMS A;  2F6C A;  4YBZ B;  3RQ4 A;  4CYC A;  1VQM I;  2KIS A;  2M8G X;  1J5Y A;  4CCJ A;  3FDS A;  1KA8 A;  1ULY A;  1Z7L A;  3IWZ A;  1BIB A;  1QVT A;  3QPS A;  4L9V A;  4DV5 H;  4LF7 H;  4L9J A;  1OJL A;  3A2K A;  1HW1 A;  4U0W A;  2ESN A;  1I6H J;  1ZQ7 A;  4BBR G;  5TRD A;  3LFU A;  4QIW N;  2JA6 A;  5LGU A;  2R93 J;  4C3H J;  2JPB A;  3MZY A;  1SFO A;  1HOM A;  4FTH A;  5KFN A;  2COI A;  2COB A;  5E8I A;  3ZPL A;  3S15 J;  2W25 A;  4ESJ A;  2IEK A;  1QGP A;  3ERM A;  1BI2 A;  1I94 H;  1A5J A;  3OYB A;  3H4D A;  4R79 A;  4O4L F;  3RIZ A;  2LNB A;  1W1W E;  1XNQ H;  2JTV A;  1ZGJ A;  3V6K A;  2MC3 A;  1Y1V A;  3ZQ7 A;  5K7F A;  2AS5 F;  3UKG A;  3OSG A;  1OYW A;  3BA9 A;  2DOE A;  3DFG A;  2PI0 A;  3HTS B;  3HOU G;  4AYB N;  1N77 A;  1SC7 A;  2VJJ A;  2EA2 A;  3L9F A;  2Q2E A;  2YYA A;  1UB9 A;  2VUM G;  1XMA A;  2M1B A;  3WTZ A;  4A3K J;  3HRS A;  3DQV C;  1D0X A;  4YII A;  2STW A;  1WCM G;  2KIU A;  2HI3 A;  4HF2 A;  2DU9 A;  1O75 A;  1O4X A;  4OIN F;  1TWF A;  3OY9 A;  2EJ2 A;  3T54 A;  4O83 A;  3S3M A;  3I5U A;  2G7U A;  5ILS A;  1FZP B;  1R58 A;  2C2E A;  4KIS A;  3PO2 J;  5DCF A;  2BHZ A;  2MH9 A;  1XX5 A;  4M74 A;  3W1G A;  2R93 G;  3CCL I;  2W7O A;  5EGO A;  3CCJ I;  4V2F A;  4FX4 A;  4RZQ A;  1ETO A;  5KFE A;  4RU9 A;  2ZJQ F;  2CUF A;  3EDP A;  4XIC A;  4E7J A;  5KFX A;  2FX0 A;  1DPU A;  3CDI A;  1VQL I;  4FFM A;  5IT9 K;  4YQW A;  5DQH A;  1FSE A;  2WB1 N;  3K2A A;  4E7S A;  2W00 A;  5I5V A;  4N4O B;  3WWJ A;  4DZJ A;  4UCS A;  1P4X A;  2L9V A;  4OX9 H; 
#chains in the Genus database with same CATH homology
 3TY8 A;  2KDO A;  1MNE A;  2M0M A;  4YEJ A;  4U7B A;  2K5C A;  3M8J A;  3RR5 A;  1R6R A;  3M1C A;  2VAS A;  3VWB A;  2WDT A;  2BOL A;  3K3V A;  4DV4 H;  3DTK A;  2X85 A;  3HXL A;  3NWS A;  1D0Z A;  4UCR A;  4BEH A;  2E5L H;  2WAQ A;  1OR7 C;  2WAF A;  4DUZ H;  4CCO A;  2E1M C;  4XKW A;  3NC0 B;  3OYG A;  3H9G A;  1Y56 A;  4LIU A;  3UR3 C;  3SDB A;  3D5L A;  2CS3 A;  1IBK H;  2KRH A;  2AQF A;  3TBI A;  2VJ5 A;  5HLT A;  4OWR B;  4BL0 B;  2HVS A;  3C0F B;  2CW7 A;  2LRD A;  3W2W A;  1NG6 A;  2OV7 A;  4B3R H;  1DQU A;  4UCT A;  2VQC A;  2WY7 Q;  2X6W A;  4DR3 H;  4DJA A;  5FRM A;  1D1B A;  3DKY A;  4G6T B;  3V42 A;  1OLT A;  3MKY B;  4U87 A;  4PZ7 A;  4BWS C;  3IUO A;  4II2 A;  3D5S C;  4OAY A;  3KAK A;  2XF5 A;  4E7H A;  3J7A K;  2IGN A;  4DR2 H;  4DOZ A;  4HEA 2;  4BDZ A;  2IS2 A;  4LMY A;  4PK4 A;  4F91 B;  2RGR A;  3K4K A;  3OIQ A;  2HPM A;  3CJQ B;  2MFZ A;  3W2V A;  3H9Q A;  3HL2 A;  1E4F T;  1E0E A;  3VNN A;  3K4C A;  4APM A;  2JVG A;  3OS1 A;  4ITV A;  3OS0 A;  2WE6 A;  4K0K H;  1HR0 H;  4E7K A;  2R7T A;  1JI8 A;  4DBR A;  4A2B A;  2IS1 A;  1Z3X A;  4ZC3 A;  4B3S H;  3ZR8 X;  2ZM6 H;  4F55 A;  3RCO A;  4EAT A;  3MKW B;  3EPZ A;  3PNV A;  2R7W A;  3TL4 X;  2WAE A;  3L2V A;  1XDN A;  2XDV A;  1QHG A;  3DEE A;  3MWM A;  3T1H H;  3RGZ A;  4CC5 A;  4DV2 H;  2HVR A;  1N33 H;  2W82 A;  3OYL A;  4M7E A;  4RB3 C;  2RNG A;  3CJR B;  4FET A;  1X4O A;  3RPU D;  1TT0 A;  3OYJ A;  1J5E H;  1IRX A;  3ZCO A;  1T0F C;  4MV9 A;  2HQA A;  3GJX B;  1P9Q C;  4EFE A;  2LH9 A;  3H20 A;  4X65 H;  2R7U A;  4ZDO A;  4BS9 A;  3JSL A;  4LH7 A;  3L4K A;  3NBZ B;  4PZ8 A;  3GB8 B;  3A1Y A;  4BQO A;  3U21 A;  1B04 A;  3DU5 A;  2O5R A;  2VQG A;  3TY9 A;  2M7B A;  4NXM H;  1YX3 A;  3DPT A;  4C9Y A;  2Q2T A;  4IAJ A;  5BR8 H;  3W1B A;  4GLX A;  3N05 A;  1N32 H;  3H5A A;  4PUS A;  2DXI A;  5A2Q W;  2WY8 Q;  1WFX A;  2W7N A;  4JI7 H;  3KX2 A;  1V5E A;  4PSX A;  4AVZ A;  1X4P A;  4HSR A;  3DKX A;  2OWO A;  2V4J C;  1TAE A;  3S8P A;  5D1O B;  1DGS A;  5FD6 A;  5IWA H;  4LF8 H;  4LSA A;  2UU9 H;  1S03 G;  2ZSH B;  1BR2 A;  3OYD A;  3RJ0 A;  5CPR B;  1VZ0 A;  3MMY B;  3OR1 C;  3FHN A;  2LOO A;  3ZGK A;  2IGO A;  2VXD A;  4DBQ A;  1SYX B;  1MZB A;  4YY3 H;  3ZXS A;  3PSF A;  3L2W A;  2XIG A;  4P5O A;  2M4K A;  4UCO A;  3BCB A;  4X64 H;  2ZFU A;  4LIV A;  1L2Z A;  4DR1 H;  2X6Y A;  4XKC A;  5CQG A;  1MMN A;  3W2A A;  3SEZ A;  2DJI A;  2R4G A;  5D1O A;  2ZXI A;  2IGK A;  4GRI A;  2DT6 A;  4XOP A;  3S24 A;  1D0Y A;  5HNH A;  1E4G T;  2K9L A;  2E60 A;  2HVQ A;  3H35 A;  1N34 H;  3KYL A;  2VUG A;  3MD2 A;  2WB1 A;  3L2P A;  2MYS A;  1TA8 A;  2Z1D A;  4PJM A;  4XLH A;  1Z2O X;  5TGT A;  1N36 H;  3SZG A;  3L2Q A;  4Y3O A;  4D1Q A;  3DF7 A;  3K4N A;  1UG0 A;  2QKL B;  1P16 A;  1ZEL A;  4BXF A;  4KT6 A;  4ZDL A;  5D1P A;  2F4V H;  4NNJ A;  4B47 A;  2RGV A;  2VB6 A;  4RB1 A;  4GKJ H;  3K4M A;  5IT9 W;  2VJ4 A;  4F92 B;  3DLA A;  4IQ4 A;  4PFP A;  5DIS C;  1CKN A;  2OC6 A;  4EFB A;  3RGX A;  1D1A A;  4RB2 C;  1GYF A;  1FKA H;  4XOR A;  3D5R C;  2PJR A;  2VPL A;  1UAA A;  2R7R A;  3J81 W;  1SEI A;  2CFM A;  3J7A Y;  3J80 W;  2XF6 A;  3H0D A;  4BE2 A;  4F52 A;  4FM9 A;  1G8X A;  3C2H A;  2BW3 B;  3OYH A;  4YHH H;  3EUH C;  4XN3 A;  1WJA A;  4PJN A;  4BJT A;  4E7Z A;  3OYF A;  4UCV A;  4E4H A;  5LFA A;  2X6X A;  4JI6 H;  3ONQ A;  3BG6 A;  2LBF B;  3HG9 A;  4JI1 H;  2MAB A;  5LL6 b;  1HNX H;  2JA2 A;  3FBN B;  3K10 A;  1XMO H;  1QHH D;  4HPQ A;  3OYC A;  2K9M A;  4BJ6 C;  5KNL A;  3RF2 A;  1P8L A;  5LD2 C;  1V9P A;  2BW3 A;  4F3Q A;  3OYA A;  2HDW A;  4LF9 H;  1QU3 A;  1WH2 A;  2KSW A;  2L9N A;  4B43 A;  1GLN A;  4JOM A;  4DUY H;  4Y33 A;  1NG7 A;  2LBF A;  2M4G A;  4NQW B;  4BAC A;  3HPH A;  5FPO A;  5FRN A;  2VKD A;  3OOU A;  4PFO A;  1I6U A;  4CCM A;  2WA0 A;  5FD5 A;  3LML A;  2HIV A;  4A2A A;  1X1A A;  3C2G A;  3CMM A;  4C30 A;  3E0J B;  3OL4 A;  4FAS D;  3OTO H;  4LFB H;  4UCU A;  3EUA A;  3AFH A;  4DV6 H;  2W57 A;  3FBI B;  4NC8 A;  3LSI A;  2DOA A;  2HNH A;  1U0J A;  2PMZ A;  5FLX W;  2R7Q A;  2VQH A;  3OWT A;  3KYH C;  4JV5 H;  5HVQ C;  2VL8 A;  2XSJ C;  3QOE A;  3LSK A;  3VYU B;  1TZL A;  2KMU A;  4BQQ A;  4XKV A;  4RM2 A;  1D1C A;  4XON A;  4LFA H;  1M0T A;  4HST A;  1DGW Y;  1V5G A;  2VIX A;  3CF2 A;  3OYN A;  2Y0S A;  3HOT A;  5FPR A;  3T1Y H;  2ZJT A;  4XLF A;  2V9K A;  2IS4 A;  4DV7 H;  1WJE A;  1SFK A;  4XQF A;  2VQE H;  3VYT B;  5HNF A;  5LMN H;  4BUP A;  2QKM B;  3AKZ A;  3OS2 A;  3DTE A;  2GOM A;  2UXC H;  2KP6 A;  3OMY A;  1ERD A;  3QWU A;  2E5N A;  2VJI A;  4BQN A;  2KPM A;  1MW7 A;  2L2O A;  1MMG A;  1DGR M;  4E7I A;  2HIX A;  2MCT A;  3PNY A;  3K4B A;  2LYC A;  4RLQ A;  4E6N A;  4JI4 H;  3DWL E;  2ZSI B;  1FMW A;  4JI3 H;  3LSG A;  2BVM A;  2F5V A;  2Z16 A;  1S9H A;  4KJZ A;  1WJC A;  1VS0 A;  3HKZ A;  3VYR B;  3KEY A;  3CES A;  3OIP A;  4CCL A;  2KQR A;  5FRO A;  2R7S A;  2VOB A;  3KAJ A;  3ZQQ A;  4PDB A;  2UUC H;  3LL7 A;  4LF6 H;  4CC6 A;  4XKB A;  3I3L A;  3HUG B;  3ZRG A;  4HNT A;  4DR5 H;  2CV2 A;  3OYK A;  2X1E A;  1HNW H;  4YRV A;  3IP4 B;  1FMV A;  1Y6I A;  1YX5 A;  2X51 A;  4P1W A;  4XNF A;  3FKJ A;  1W36 D;  1DP3 A;  2OUM A;  3BC8 A;  4I7H A;  1K6Y A;  3HPG A;  3N40 P;  1IBM H;  3QOD A;  4XN0 A;  3IAS 2;  4HRI A;  3JSN A;  1EA3 A;  1LFP A;  4PZ6 A;  4LH6 A;  1AN7 A;  4J0M A;  2NOJ B;  2UUB H;  4NXN H;  3JAM W;  2XAU A;  4AQY H;  4IZZ A;  5KHD A;  2V6E A;  4RM3 A;  1X9N A;  4LF5 H;  4B44 A;  5KCM A;  2DT7 B;  3DPU A;  3F8N A;  3VYS B;  1LDK B;  3NBY B;  4Y4R A;  4CA0 A;  3N42 B;  2JUG A;  2LC2 A;  4B48 A;  1CKN B;  3E1S A;  4AU7 A;  4J01 A;  4DRF A;  2RRE A;  3KXY T;  3H9J A;  2KLO A;  3S93 A;  2PJR B;  4BDY A;  1XNR H;  2LG4 A;  2HU9 A;  2BVL A;  4RAY A;  4EQ5 A;  4UFZ A;  2VQF H;  4MLO A;  2WAD A;  2ELJ A;  4CCN A;  1Z2N X;  2HGS A;  1M0W A;  4LF4 H;  4BGD A;  3H5N A;  4QPO A;  4ANJ A;  3TMO A;  4X66 H;  2E1M B;  4LSX A;  3AL0 B;  4RLF A;  3PUB A;  3QYF A;  1MND A;  1HA8 A;  2V1N A;  2IXS A;  2KRC A;  1KON A;  3MKZ A;  2ZXH A;  3GBG A;  2GOX B;  2JSP A;  4DGW B;  3FMA A;  4D9J A;  3N44 B;  4DV0 H;  4XLC A;  2VQL A;  2E5Z A;  3PN1 A;  2VPS A;  4C2T A;  4X0G A;  4ZJZ A;  3RTR A;  3L2R A;  3RTX A;  1BGW A;  3EYY A;  2A6T A;  2KHM A;  3I9V 2;  2XF7 A;  2LRE A;  2VLA A;  4J00 A;  2HHH H;  3L2U A;  3KAL A;  1BOB A;  2W4S A;  3F9K A;  2W1O A;  2DCE A;  3BCA A;  4ZTJ A;  4ETS A;  2A5W A;  1XMQ H;  4XLA A;  2JVH A;  5CQE A;  1AA7 A;  4E6K G;  1S68 A;  2CMP A;  4DR6 H;  2RQQ A;  4ZYA A;  1ZHQ A;  1WJF A;  2CFO A;  3PNT A;  3AL0 C;  2UWM A;  4RB0 A;  4DV3 H;  2L9S A;  3N43 B;  1BR4 A;  2KL4 A;  4B3T H;  3LSH A;  1HNZ H;  1ZHS A;  1WJ5 A;  3OYE A;  3K4J A;  4KIT B;  3K6G A;  1N75 A;  3PJR A;  4IKF A;  1YE9 A;  5EOY A;  1X1C A;  3A4C A;  2R7O A;  2L5Q A;  3BG7 A;  4OAZ A;  3OYI A;  2IGM A;  4JI2 H;  2LY2 A;  3L4J A;  3EUK L;  4RMN A;  3CVZ A;  4RAZ A;  4JI0 H;  3VSK A;  1PJR A;  3G2B A;  3BLY A;  3LMM A;  4F93 B;  4HG2 A;  2F4I A;  2WYO A;  1WJB A;  4JYA H;  4NUB A;  2Z2S B;  3DTI A;  2I8D A;  2M7A A;  3FDY A;  4DIQ A;  3S3O A;  1XK5 A;  4PSW A;  2FE3 A;  3S32 A;  3QYB A;  3SEQ A;  4MTD A;  4CSW A;  3H5R A;  4BJ5 C;  4XOT A;  2CUJ A;  3BAB A;  4LFC H;  2AQE A;  1FJG H;  4BE0 A;  2M3A A;  1A0I A;  3OYM A;  2R7X A;  4CCK A;  1BR1 A;  3HOS A;  3VDX A;  4NC7 A;  3PL8 A;  2HZD A;  2Q2U A;  4DV1 H;  1G59 A;  4XL9 A;  4PJL A;  2K3P A;  2VKH A;  1X19 A;  3QYE A;  4HNU A;  4KHP H;  3OR2 C;  5JHF A;  2MD0 A;  2KZV A;  4IQJ A;  2X1D A;  3LSM A;  3CP8 A;  3IG0 A;  1Z2P X;  1Z21 A;  2IS6 A;  2F6C A;  3RQ4 A;  4CCJ A;  4MTE A;  1Z7L A;  1Z3Y A;  2V7F A;  4DV5 H;  1X1B A;  1FVI A;  2UV1 A;  3RSN A;  3A2K A;  3TY5 A;  4LF7 H;  2WBM A;  2UUZ A;  3LFU A;  3UNG C;  1T95 A;  4IX7 A;  3S3N A;  1W36 C;  3VSL A;  2MC4 A;  4C2U A;  4H4K C;  4X62 H;  3GDE A;  4B3M H;  1IBL H;  1MMA A;  2CW8 A;  2UXD H;  3BA8 A;  3SYT A;  2Q2E B;  1I94 H;  3K4L A;  3OL3 A;  3OYB A;  2P0W A;  4R79 A;  4PJJ A;  3BAA A;  1PYV A;  3DPL C;  3RIZ A;  4N4N B;  4DR7 H;  1XNQ H;  4AYB A;  4YEL A;  3NWT A;  4ZTF A;  4Q0Y A;  3W3C A;  1N78 A;  3BA9 A;  1LKX A;  4JI8 H;  4II3 A;  4BE1 A;  1N77 A;  4CH7 A;  4XR6 A;  2VJJ A;  1CKM A;  4B3X A;  2O03 A;  4LG3 A;  3IAM 2;  4XLE A;  2R7V A;  2X1C A;  3DQV C;  1D0X A;  4CZC A;  1WJD A;  1UEL B;  2LY1 A;  2VXZ A;  4QPQ A;  1LVK A;  3CZ6 A;  2CV0 A;  2FUG 2;  1O75 A;  1BJT A;  3OY9 A;  5LMU H;  1MMD A;  4E7L A;  5CKT A;  1J09 A;  4CUG A;  3S3M A;  4GKK H;  2CH0 A;  1SAU A;  2UUA H;  4KIS A;  4JQF A;  2Q1Z B;  1CKO A;  4XM3 A;  4R7R A;  2YCH A;  1X1D A;  3W1G A;  2XC7 A;  4LIT A;  2CUZ A;  4ZDP A;  2HPI A;  3PFY A;  3N6X A;  4RZQ A;  3CP2 A;  2L7K A;  4DR4 H;  3W5O A;  1V5F A;  4XMY A;  4BEH B;  3N41 B;  3K70 C;  4E7J A;  3PSI A;  3K70 D;  4BU2 A;  4EEQ A;  4MV7 A;  2UXB H;  3UQ8 A;  4E7S A;  3M4I A;  2W00 A;  2V26 A;  4N4O B;  3DU6 A;  4JI5 H;  4UCS A;  2CV1 A;  3HC7 A;  4OX9 H;  5HOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...