2HVQA

Structure of adenylated full-length t4 rna ligase 2
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
329
structure length
316
Chain Sequence
SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFSEKKVELSEADNKLVGILACYVTLNRVNNVISKIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase
molecule keywords Hypothetical 37.6 kDa protein in Gp24-hoc intergenic region
total genus 91
structure length 316
sequence length 329
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvqA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvqA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvqA01
4UFZA 3W1BA 1X9NA 4EEQA 1XDNA 4PZ8A 2OWOA 2CFMA 1TA8A 3KYHC 3BA8A 4PZ7A 3RR5A 1A0IA 3JSLA 4EFBA 1TAEA 1V9PA 3TY9A 3W5OA 3NBYB 3PN1A 4PZ6A 1CKNA 3GB8B 2HVQA 4UCVA 4GLXA 3QWUA 2Q2TA 2VUGA 3BABA 1S68A 1P16A 1B04A 4UCTA 5D1OA 2HIVA 3RTXA 3S24A 4EFEA 5FPOA 1P8LA 4LH6A 3GDEA 2HVRA 1CKMA 3BA9A 3BAAA 2HIXA 4UCRA 1DGSA 1FVIA 5D1OB 1CKNB 3NBZB 3NC0B 2HVSA 1CKOA 4UCSA 4UCUA 5DISC 3TY5A 4E6NA 5FPRA 3L2PA 3TY8A 1XK5A 4DRFA 4CC5A 2Q2UA 3VNNA 3JSNA 1VS0A 4CC6A 5D1PA 4LH7A 3GJXB 4UCOA 4EQ5A 3UQ8A 3W1GA
chains in the Genus database with same CATH superfamily
5JHUA 1FX7A 2EBIA 4A3DJ 1TT5B 3S16J 2OZ6A 2DW4A 1J75A 1B72A 4CHUA 4A93J 2XASA 1E2XA 2HVQA 4WX9A 2G0EA 4X62H 3BZ6A 4FISA 1XTAA 5LGNA 3PNTA 1ETQA 2HPMA 2Z02A 2DTRA 3K4NA 3DTEA 5DUIA 5FRMA 2KZGA 3GBGA 4KITB 5KFUA 2BY1A 2DAAA 3PW2A 1ZRCA 5E3MA 2A6TA 2JEJA 2R7ZJ 3U9SA 4RZRA 3EDPA 3JRGA 5M5XJ 4J9QA 3G73A 1H0MA 2V9WA 2R7NA 3LMLA 4F93B 1P4WA 1B6SA 5GAGJ 3OHBA 4UUGA 3CCRI 4E7IA 1PUFA 4BXXJ 4PJJA 3FWEA 1CF7B 5KFDA 2MSYA 5IT9K 1VQMI 5FR9A 3T1YH 3NBYB 4F7ZA 3IP4B 3FDSA 2E2JJ 2BY0A 4O2BF 1DUXC 1I50A 3FMRA 4BNCA 4JV2A 3IC7A 3TOAA 3TO9A 1MDMB 5KFIA 3J80Z 1T2KA 2DT6A 3GTKJ 5JLXA 1FSEA 1W36C 3HGYA 5J8FA 1YX3A 2X48A 3ASNH 2ZMEA 4DL5A 1B72B 4EJWA 3M4OJ 3U55A 3MR6A 2X1DA 2KRFA 2ZMEB 3HPHA 4CH7A 4BHPA 5IYZF 5J3LA 2CQYA 2BOLA 2MC3A 2E1OA 1O7LA 5KT5A 3C7JA 3KP5A 2J6UA 2DT5A 1QO0D 2FX0A 2LLKA 3T0YA 5JVDF 3BQ1A 3HOXG 4ECXA 1ZG1A 2L9NA 2H8WA 4G3IA 1B9MA 4ITVA 3ZQGA 2R8HA 4AIDA 2ZJRF 2OAZA 1FYLA 2R92G 4MLOA 2E34A 5B1BH 4QIWN 4H4KC 4HF0A 5CAEB 4YY3H 5J47A 1X19A 1JJ8C 3H3ZA 3QU6A 2L54A 2YL2A 2QKMB 3ABMH 4G8XA 4A2AA 4IRCA 2K40A 1UB9A 3L9FA 4A6EA 2A61A 4XLAA 2PLYA 1ZHSA 2VE9A 1XNQH 3QPSA 2P7CB 2LKSA 3CTAA 1GUUA 4A3KG 5D6EA 1MBJA 4LLLA 2FMYA 2ZBKA 1O75A 4OWRB 3S1RJ 1HSTA 5HDGA 2JSCA 3R0AA 5IYCJ 5C3EJ 2V9PA 4WXHA 4A69C 1VBHA 4FX0A 2NVTJ 3GTLJ 4QWAA 3PFYA 3GTJJ 1DGRM 3GTPA 3OOUA 1D1AA 4IF4A 4RGUA 2F4MB 2A05A 2ELJA 3BT9A 4ZYDA 4D7NA 4F50A 2MGQA 4FE2A 3ZQIA 1U5TC 3DBLB 4PK4A 2CUFA 2X1EA 4NUBA 3Q9SA 3JTGA 1BI2A 2ACJA 4HEA2 5JI6A 1U8RA 1BIAA 1T98A 3FDYA 4CMFA 3D5RC 1VBGA 1E4GT 4UCUA 3MR2A 1BNCA 3PIOF 1B4AA 2YWVA 5EG0B 2WE6A 2AQ4A 5GPCA 5IPAA 2ZO4A 1XPXA 1MKMA 4ENJA 1ZQ7A 3T5JA 1A5JA 3CZ6A 2MLGA 3CO7C 3HOZG 1SFOA 3H5NA 1T0FA 5F9LA 1I6XA 3GTGJ 1OKRA 2CNVA 2DOEA 2YZLA 4LB6B 2WB1A 2DA7A 5JQWA 1UMQA 2CW7A 2YS7A 2M0CA 4I98B 3GLKA 2L5QA 4JI3H 2ID6A 2R7DA 2Z16A 1UC8A 3JTHA 1SFUA 1YRNA 4KNYA 4AYBA 2L7FP 3M9MB 1EKVA 2AHQA 4GKKH 3W2VA 3DFGA 4BDZA 4Q8FA 2F5VA 1J09A 4XYLB 4Y52J 1ULZA 3GV8B 3NC0B 2A5YB 4DGWB 4DLKA 5HLIA 4BUPA 5KAIC 2MFZA 5E79C 3R61A 4UCOA 2CQ7A 3DEEA 1S7OA 3KEOA 3JREA 5HNEA 4XONA 2ATLA 2FK3A 4Y15A 1FNNA 4DQNA 1MBHA 3TDUC 2HDDA 2ESHA 3LWFA 4M9UA 5ILVA 4CCOA 4L5IA 4K6NA 3ONQA 2KQRA 4ZOLF 2JA7J 3W2WA 5JLWA 3T54A 2GQRA 3F8CA 3KEQA 4ZHQF 1A35A 1KU7A 3CF2A 3LQRA 4UB8C 1MD0A 1QZYA 5DCMA 4ZZLA 1JDEA 3SE7A 1Z91A 3B6AA 1IO2A 2DK5A 4LGWA 2P5KA 4LOCA 2R7LA 1ZR4A 3IRRA 2JZYA 3DPTA 2EZKA 4PJ0C 5FROA 4XRMA 1K79A 1FTZA 1WGXA 3TINA 2R7ZA 5KFNA 3CMYA 2HOTA 1BR4A 5T14A 2CU7A 1FY7A 2WB1N 1PUFB 4A6DA 2EIJH 2E19A 1V51A 4ED6A 2ALZA 1XGOA 2GLOA 3DTFA 2RQPA 1O3SA 4M7EA 5LMNH 2GA1A 3KYDB 2OWOA 3MD2A 5L1LA 4C2UA 2YZMA 3SYTA 5BWTA 3AG1H 2C2RA 3DCFA 3GCMA 4A3GJ 2YSRA 1W96A 3H36A 3QOEA 2WWYA 2XSDC 1IOWA 1VF9A 1PJRA 3EUKL 3NUAA 1TQPA 1ON1A 3CLQA 3KLOA 1RK5A 1S8NA 5FD6A 5CPRB 5KFTA 4O4IF 3ELKA 5KG2A 1V5GA 1WCMJ 1S72I 4AVPA 1PX2A 2ZDGA 1SANA 3GXOA 2EFQA 3L2PA 4QJFA 4LFUA 3HOTA 4HPQA 3JRXA 3ORRA 5EEAA 5FKKA 4EJTA 2IS6A 2V58A 2WB1E 2YCHA 2K86A 5IYBG 4RNMA 4UY8I 3CQZA 2IGMA 1G3WA 1IRFA 4Q4ZF 3DTGA 2LBFA 5FLMG 3OYHA 2PMZN 2HYJA 3ESWB 3KIOA 3S2DJ 3WGIA 2YW2A 1QGPA 2B63J 3LSIA 2JVGA 2BQ3A 1MSFC 4OMZA 3CDLA 4M6YA 3VEPA 4AIKA 1W0TA 3JRBA 2G7HA 1F43A 2C28A 3P9KA 4A2BA 5J4VA 2Y0SE 2D2WA 3AAFA 2CFOA 3DQVC 3HRMA 3IAM2 1IXRC 1WJDA 1X1AA 4L9JA 2GIZA 4LG3A 5KT2A 2M4GA 2TCTA 2LFBA 4MGRA 4Q45A 4FE4A 2PX9A 1Q1VA 1RZ4A 2DCEA 3L2CA 1UAAA 1D8JA 3E5NA 2DMUA 1R58A 5D5XB 5EZYF 2QZ8A 1S5LC 4B43A 1I3QJ 3MZHA 3HOXJ 2HTSA 4AIJA 4PZJA 2DAOA 2RGVA 3CC4I 4PZ8A 3KXYT 2FK2A 2EA2A 4LITA 1DV2A 3T5LA 3CCYA 4ESBA 5C3EG 1QVTA 3DBRB 3PM1A 5HV6A 4DR7H 4CCKA 4EJOA 1P6RA 3SJMA 2WV1A 2PJRA 3FIWA 4F4XA 5DMXA 1STZA 3ORQA 2KISA 1X1CA 3I5UA 4PDKA 1WH2A 4XYMB 3CESA 3HXLA 4DZPA 1S9FA 2W8KA 3KAKA 5FLVA 2L3DA 4EVIA 4UVBA 4AYBN 4YFXF 5GP9A 3PVXA 1A48A 4QIWE 5L3FA 2PMZA 5F0HA 3RB0A 2V79A 3HIFA 3RKXA 4CO8A 4A93G 3F8MA 2NOJB 3GX4X 1RUNA 2H1LA 1D5VA 5DM6F 3GTMA 3WWIA 2IGKA 1N75A 1ZHFA 4EJUA 1YW8A 1NG7A 2ZC2A 3HOWJ 3R23A 2DPIA 1UG0A 3AL0C 1ZG3A 1SYXB 1T0FC 3N40P 1AKHB 4ENMA 3QFFA 4GXOA 3BABA 3FXMA 5J6XA 3T1HH 4MIMA 1Y1VJ 3HM5A 3CP2A 2EJRA 1FIPA 2M34A 3FKJA 4XSXF 2FA5A 3T9EA 5CA0F 2DQRA 4P9UA 4IRIA 1T39A 4JP0A 3CJNA 4FT8A 4C3JJ 1EH8A 4BYYA 2XF5A 2Z1DA 3PO2J 3KYCB 2LKXA 1U8BA 3VA7A 4DR1H 2E5LH 4ED7A 4XNFA 3SI8A 3DPUA 3N4MA 3NGDA 2E7XA 3U0GA 5I60A 1BGWA 1EV7A 5I5XA 4Q5SF 4QSHA 3P5JA 1WHUA 2COBA 4II2A 4D5FA 2XB5A 5CM0A 4IR9A 2EFNA 5DD4A 4J9PA 5EWGA 1BI0A 3FZVA 1A9XA 1X3ZB 3KYLA 2FOWA 3L00A 5ERIA 3OIQA 5HODA 3RZDJ 4HSTA 2DK8A 4ESFA 1FEXA 1N48A 2LP0A 4IEJA 4FASD 4L1KA 4A3IJ 3WG7H 4G6TB 3Q5FA 3K3PA 3LSJA 4NZNA 1JTXA 4B47A 3I4MG 2KT0A 1WRJA 4M6XA 3ZMZA 2IPQX 2E2HJ 4EGYA 5IP9G 2IS4A 2FNPA 1FJGH 1Z05A 1X4OA 3M3YJ 2VONA 2Y0SA 4ED1A 3ZMTA 3K7AJ 5BWUA 4HRIA 1T56A 1F4KA 4QWCA 2R7VA 5IT3A 4DIMA 1N32H 1XMXA 4BQQA 2GM4A 5HNFA 2R92J 3LQQA 2V6EA 2MC4A 2NVYA 1Q1HA 2BZTA 4PZ6A 4MAMA 3BQ0A 1V4YA 3BJOA 1IBKH 2VL8A 2R7OA 4X64H 1I50J 2HU9A 4E6KG 5DDGA 2GPWA 2ASJA 4HF1A 1P4XA 3FXOA 2B7EA 2ZGIA 4O7RA 4EGZA 3BR5A 1Y1VG 1P7JA 2IGNA 3OS1A 4HX4A 5D1OB 3F6OA 4ECVA 2DPUA 2RNGA 4JI2H 4M3EA 3HOUJ 3TIIA 5AIQA 5EJCA 1Y56A 2Q7DA 4FFMA 3H3VK 2HGCA 1DGWY 4MV1A 3PL8A 2ME0A 2CMPA 1Y6IA 2RVCA 3G3ZA 2QSHX 2LH9A 1Z3YA 2KIQA 4BEHB 2FMLA 1TWCA 1YS7A 4DV2H 1XGNA 4E4TA 4KISA 3PFIA 2O7OA 3JRAA 3DAAA 2W9AA 3HOUG 2LF8A 3SDGA 3S14J 2WY7Q 1T95A 1XSVA 3NQOA 2V1NA 2HVSA 3AX6A 4RUAA 2KPMA 4XKBA 3GTQJ 4EYHB 2M45A 3HOVJ 4CC5A 2UUZA 3BACA 3LA3A 2LYCA 2H1KA 4ZYEA 2YRWA 3K4KA 3GEZA 1VQ7I 4WBNF 2ZJTA 1G2WA 1T08B 3GTPJ 2VBZA 4WD3A 2OC6A 1T33A 3GZ6A 3WWHA 1EKEA 2VOOA 1G4DA 2O0YA 3DBHB 4YG2F 3WWJA 3PO2G 2KDOA 3IUOA 1MH4A 2UXNA 3RQ4A 4BACA 2L9VA 2DMQA 5K5QA 2H8RA 1I3AA 2IMWP 2D1VA 1XNRH 3DPLC 2OPTA 3KLNA 2R93G 3S93A 4BGDA 4KT6A 2JA2A 4QIWA 1JKJB 5IY5H 3F8FA 5ICGA 3K9TA 4J9KA 3OYKA 1TT0A 1C30A 5DGAA 3AG3H 2XRLA 3E6MA 5IP7J 2P6SA 4I4TF 3L7WA 2JSPA 2R7FA 3G1OA 1IG7A 2STTA 4UB6C 2D5VA 2RV8A 1D0YA 3K1PA 4GO1A 3RTRA 3WODF 4FU0A 5HDNA 1UHSA 3FKIJ 3RI4A 4EFEA 2HQNA 1A04A 2W6PA 3IHUA 2Y30A 1WKMA 1TWAA 5KFAA 2IVMA 3ZQ7A 4FFOA 4JK1X 1E3PA 2XPVA 4I99C 4QW8A 5GTHC 4S04A 2IRFG 4IHSA 3GTOJ 1SMYF 4CC6A 2ZXWH 5LL6b 3H4DA 4F4WA 2V1UA 1IN4A 2CUJA 4O4LF 3S32A 2WDTA 4A3EG 1MDMA 4HYEA 1JKOC 3LSTA 2XAHA 3E5XA 3FHNA 1G3TA 3DKWA 1WVRA 4M3DA 5K2MA 4EG0A 2XGCA 1OYIA 2WTFA 4FM9A 1W7PB 2Q0OA 2E71A 2LDUA 3IH4A 3Q9VA 2VBWA 1GDTA 4EQQA 1W7PA 3RJPA 1ZG5A 3CCSI 1ETYA 4AM3A 5LXTF 2R7QA 2HXOA 3OL3A 2VLAA 2NU6B 4IHJF 3MJFA 1VQ9I 3ZMSA 1T38A 2W84A 3CCLI 5M5WJ 3D5LA 1KONA 4V19K 4D0PA 2GIVA 3L2VA 3RB6A 2HOSA 5KFMA 1VI0A 4O7SA 4DV1H 4W1UA 4XKVA 1VQPI 5JVLA 2DA4A 3OYMA 2QBYA 4ZI7F 3GTMJ 1LFPA 2CV0A 2P6TA 3I4MJ 5C8YF 3HL2A 2R0QC 4X66H 4JOMA 2R92A 1JI8A 1T36A 2C2DA 1YYVA 4APMA 3LAPA 3OYBA 1F5TA 2AO9A 2AXLA 2CQQA 5J2TF 5E17F 2HHFB 3B73A 4E4HA 4N4OB 1YIOA 2L9RA 5J1UA 1KJQA 1BJAA 1IW7F 3I54A 5FPOA 3N41B 5DG9A 1ZK8A 3PQJA 2OQRA 4FHTA 1KZHA 4BXUA 5JUMA 1N33H 2B0LA 2E1MB 1I27A 3IAS2 3FMQA 5BWWA 3GTLA 2NS7A 3JAMZ 4XL9A 4HX8A 4ENKA 1P7IA 1R23A 4ETSA 2MCTA 3KALA 4UVCA 1U0JA 5CVRA 3PNVA 1MSEC 2EFWA 3U1KA 3LSPA 1ZGAA 2ZFUA 3L2QA 1ZELA 2Y4RA 3RGXA 3KREA 2DFIA 2HFHA 3BG5A 5FLMJ 1MNMC 1I6HJ 2BEOA 5KG5A 2MH9A 1G59A 1FJLA 3PR5B 3BCAA 1OLTA 2JA5G 2X9DA 2GPSA 3GWZA 3CSWA 2FMAA 4DYQA 5J4YA 2CG4A 1J59A 2E2HA 3CJTB 2A1HA 1HLVA 1D1CA 3WU1B 2OBPA 4L5JA 2B9SA 5I5YA 4NB5A 4ZYAA 3TY5A 2BHZA 5LD2C 4OU0A 3KZIC 1XS9A 1SC7A 2OA4A 3SGIA 2XUBA 4IXAA 3GIPA 4KIGA 5D6FA 3MR5A 4HBLA 4S05A 5KFWA 5EDNA 4EEQA 3BR3A 5JQGF 2CZGA 2HEOA 5M5YJ 4W97A 3C2BA 3RUPA 2JA5A 3H4BA 1U2WA 3A2KA 3QQAA 2KRCA 3QWLA 4RLFA 2BW3B 3VPCA 4JX4A 2FJZA 1UZCA 3M1CA 4XK4A 3SXYA 2V26A 2HOAA 2EZHA 3MQ0A 3KZYA 4NC7A 2M2EA 3R9RA 2WA0A 3M07A 5TGTA 2L7MP 4XICA 2V9VA 2ZJQF 4MFDA 2JJ7A 3RKWA 5FB2A 1CKOA 4CDGA 4BU2A 1OBGA 2Q2EA 1M0TA 1OCRH 2FSWA 2V5AA 3J80K 2YX4A 3RIZA 2AXTC 1NTCA 3J7AY 5FNVF 3MWEA 4QWQA 2CS3A 5IYBJ 2F48A 1PVEA 1AA7A 5BPDA 4A3FJ 1XX5A 1BC7C 4JX6A 4GLWA 5K7FA 2MA3A 3QRFF 1FPQA 5IT9Z 1SD5A 1GLNA 1JKRC 5F27A 1FBSA 2PBIA 3GIDA 2OD5A 4BY1J 3Q8RB 1SCUB 1WI3A 3GTKA 2UZKA 4HLYA 3T9DA 2EK5A 2W9CA 4B48A 3S3MA 2AGOA 1FMVA 2R85A 1RNLA 1DPRA 2UWMA 1RK6A 4RDUA 1XG1A 1VQOI 2FOKA 3VNNA 1Y8QB 3GYHX 4CYCB 1TC3C 4C5CA 3TMOA 3OYJA 1IDZA 4JV1A 4HNUA 4GGGA 2QQ9A 3OS2A 4BBSG 3GF2A 1XMKA 2JTVA 1K1SA 2XF7A 4RAGA 5LBQA 3G71I 1SFKA 4JI8H 5CVUA 2XAUA 4HNVA 5L3EA 4EGJA 1CGPA 5I5VA 1FYKA 2O03A 5DUKA 3WU0A 2KIFA 5HS7A 1HKQA 4A0ZA 3RBEA 1N34H 2G7UA 1EKPA 1JUSA 1UJ8A 2R5YA 1XGSA 3JR9A 1ULYA 3C2HA 5KK1A 4A2UA 5F1RA 4LH6A 4J9SA 2DJIA 3HUGA 4XRSG 3I53A 4EM1A 3OUZA 1P4AA 2K9MA 3F3XA 1TLHB 3GILA 1HR0H 2R93A 3BROA 4GFBA 3DF8A 3F21A 5DLGA 2P7VB 5FGMA 3HDDA 1R4MB 1S0NA 3L2RA 1MZBA 3CP8A 1XDUA 2VQGA 4PWQA 2KJBA 4DL3A 2A5WA 3UNGC 1HNZH 2MD5A 3GTGA 1X4PA 2VKVA 4D9JA 2DA1A 2LF7A 5LHIA 1HKSA 1E0EA 3SZPA 4BH9A 4XZ3B 1VAJA 2C22A 3BDDA 1IN7A 5C4XG 4TUYF 2H6CA 3HKZE 2PMUA 4YIIA 2M8GX 4Y17A 3CF5F 3L2UA 3RGZA 2MBFA 1TWAJ 2Q2EB 1EF4A 1MMGA 3HSEA 3RQIA 3SFZA 2D1HA 2DIKA 5C1PA 5DQHA 3WO0A 2KZVA 5KFPA 2K9QA 4UV9A 4DBRA 2FF4A 2E35A 4S0HB 2GLTA 4CZZA 3QQMA 5KFKA 5HLHA 1X2MA 3V4GA 2O8KA 4ED3A 1REPC 1I5ZA 3IL2A 4LIUA 3GIMA 2DA5A 3BY6A 3BWGA 3J7AO 3T9FA 4HX7A 3ZQQA 1D5YA 1VNDA 2HHHH 1PUEE 3KP2A 5KFJA 4EBDA 4NQWA 3NAUA 4O4HF 2DA3A 5F08A 1WJBA 1O3TA 1H9GA 1QZZA 1JIHA 1N36H 1JT0A 2W9BB 1HW5A 1Y0UA 4M3FA 1TWFJ 2R7ZG 2DYSH 5HOOA 2FJ1A 5IWAH 2LKPA 1AUVA 2L2OA 2RC4A 2ISYA 2BVLA 1EUCB 5ICFA 4UCSA 2RDIA 2BXZA 4CCJA 4UV8A 1FTTA 2M4KA 1I2KA 3SNOA 2CQXA 4BL0B 4P96A 4OINF 5K7ZA 1G2HA 1DV1A 1AN7A 2W7OA 4NXMH 3E7LA 3AKZA 5L1IA 2AQEA 5CA1F 1HBXG 2FD5A 3V6KA 4O6JA 2JEFA 1IN8A 1RUOA 3BA8A 4PZ7A 1WR2A 4DUZH 2R5ZA 1IC8A 5KFBA 2UXDH 4IRHA 1S7AA 2OZUA 1UFMA 3KPHA 5TISC 1BW5A 1BBYA 4UCTA 4OIOF 3V4SA 4XSZF 1R00A 1ZLJA 2EV0A 3NWTA 3R5XA 2JUCA 1NK2P 5DAAA 2WY8Q 3HHHA 2K7LA 3T9AA 2GOMA 5DCMB 1YO5C 1FOXA 1DGSA 2NVXJ 2V1XA 2K5CA 4QPQA 1ZN2A 3OMYA 2A68F 5D1PA 2LTPA 1W4MA 1FBUA 1V54H 3U9GA 2Z33A 1K6OA 2J6TA 1XDSA 3PNYA 3S1QJ 1K1QA 2BQRA 3K6GA 3CQZJ 3MZYA 3Q8SB 3CUQB 2VODA 5CYVA 3LSHA 3AG2H 1EZ1A 1A0IA 3Q8PB 2WADA 5F6FA 1YJNI 1TP4A 3ETHA 5EGOA 2Q2TA 2DT7B 2ZXHA 1ETOA 1OBDA 4CYDA 2M3AA 2HNHA 3FISA 3R60A 3A02A 2Z04A 1WH7A 1K78B 2W24A 2C00A 2A07F 4OAZA 4PUSA 2QBYB 2KL4A 3E5UA 1O3RA 1HCRA 1O7FA 2VT3A 2DPDA 1W93A 2KFDA 1HDPA 5DCFA 2BBYA 2QQAA 3HSRA 5KVRA 3UR3C 3C0FB 4E7ZA 2E1MC 1BL0A 3L1PA 2YX7A 1VQ4I 2JVHA 3LFUA 4WHXA 3CDIA 4MFEA 5H6RA 2B63A 3Q0VA 1XGMA 1K4TA 3T5HA 1EH7A 1OR7A 2M8EA 3JCUC 3PIPF 2VUMG 5J8CA 1ZQ3P 3LA2A 4ZQIA 2XSJC 3RPUA 2UVRA 4RAYA 5EF6A 6PAXA 1HXDA 4XIDA 4LFBH 5EEGA 1Z0XA 5LA6F 3TP0A 3CCQI 2COIA 4QWDA 2JA7G 1HSJA 1MBEA 2HVRA 2AU0A 1Y1WJ 4AYBE 1BIBA 2QSFX 1B33N 2QWWA 5L3CA 2E2IJ 3WO1A 4DR3H 1IUFA 4ZDOA 1IYEA 1GHCA 5F9NA 2HZDA 1MJ9A 4CICA 5J1YA 3ISPA 5C5JA 1Z7LA 3WGHA 3S8PA 3ZQLA 2LRDA 3OYDA 3BR6A 4C3IJ 4A3BJ 1N56A 3RFCA 4FGRA 1S10A 1MGTA 2XKPA 1Z6TA 4ASNA 1F9NA 4R8UA 4G7OF 4BEHA 4RMNA 3H0DA 3WHBA 2VUGA 3JRFA 1KQ0A 4TM5A 3FBNB 1BOAA 4IOAF 1I1GA 2CGPA 2RDPA 3RAXA 5CVVA 3DKXA 1ZREA 1KA8A 5EZHA 5KFVA 1TNTA 4KDPA 3V8JA 4NXNH 3I64A 1K78A 3UZOA 3PW4A 5DV5A 1D0XA 1Z67A 3A01B 3IWZA 3PO3J 1I1SA 2GBYA 1KT8A 2ESNA 3JRWA 4EM0B 4JI1H 1PYVA 2CW0F 3FMSA 5CVIA 2HHFA 1KTAA 1B59A 4AVZA 1RIOH 1CKNA 2UXBH 1OFCX 4XRSA 1ZTRA 2JT1A 3IKVA 4MTDA 1HOMA 4KMUX 2VI6A 1W0UA 2CWEA 3TW6A 4HG2A 2I5UA 4Y8VB 3P9CA 4XLCA 4KN4X 2M7BA 2NRAC 2PN6A 4V2GA 2CW8A 1AOYA 4O3OA 4ECQA 4JV0A 4O81A 4Q47A 3KHLA 3M8JA 5ICCA 4RZQA 1PP8F 2ELKA 1U9NA 3GFLA 5TJJA 3IH3A 1A36A 4ANJA 3V6JA 1FLIA 2YU3A 1UCRA 2XCPA 3S15J 1R71A 2WC2A 1JTYA 3S2WA 1TA8A 3PR4A 1E3HA 3ETJA 3KHGA 2ZFWA 3KEYA 2V59A 1Y8RB 4JBAA 1LDDA 2LY1A 3S3OA 2V4QA 1P16A 3DTKA 3OSFA 5CR5A 4LF7H 1USTA 4O7LA 3GV5B 3AFHA 1C3OA 4O84A 2XC9A 1CKMA 3N42B 2ADUA 4Q0YA 1EH6A 2R7KA 5EG0A 2ZXJA 3HRUA 1R9TA 3H5AA 3LOCA 2A6EF 3RKYA 4JV5H 2FPGB 5EGOB 4R8UB 4F91B 2XCLA 2I10A 1AWCA 5HS9A 3GFMA 3VYSB 5D5VB 2VQHA 1KQ8A 2FPIB 4AWXB 3EUHA 1BXRA 4RNNA 1R1VA 4HOBA 3CVZA 4U88A 1R5ID 2CNUA 1VZ0A 4XKCA 2LNBA 4JI4H 2M30A 3OYEA 2EPFA 2COJA 3TIGA 1KQ9A 2ZNZA 4IWXA 4LB5A 4A5MA 3KTMA 2YR2A 2FBIA 4Y13A 4IHTA 1TWFA 3FXRA 3V8LA 1FP2A 1TZLA 4K2EA 5D8KB 2R7MA 1ETWA 1TNSA 4DNCA 3OYGA 3WTTC 5BR8H 1LVKA 4BY1G 2PI0A 1T94A 3H40A 1J5EH 5B5EC 4HR7A 1F1ZA 3W6KB 4E7KA 3VDXA 4A3DG 3GIIA 3M9NB 4ZJZA 1V3FA 1U6GA 3RAQA 4A3JJ 4RNOA 5KG1A 4DR2H 4CCMA 2OCCH 1WJCA 2R3SA 3QP6A 3M7GA 1HDDC 4ZDLA 2WV0A 4IQ4A 1TWGA 5KFOA 2Y69H 2LREA 4EV0A 4IHYA 1QVUA 3F72A 2OTJI 4HNTA 2OLSA 3GMEA 4ENNA 4F4ZA 2BV6A 4EGQA 2X0SA 3BG9A 1YFHA 4KMFA 3J81Z 1ET0A 1YW7A 2HDWA 3KETA 2EFOA 3TBIA 3DLLF 4IHXA 3BG6A 2W6OA 5GPAA 3BTCA 5D8DA 5EOYA 3BJAA 4O7VA 3Q0UA 4XOPA 5F1JA 3L4JA 5AIPA 1HF0A 2COMA 1A6IA 1ZAOA 3ROUA 2GOXB 3K1MA 2R7WA 4U6PA 3FXQA 4JX5A 4ZTFA 5D4SA 2X0LA 1BR1A 2W6MA 4MQ9F 4C2MJ 4OIRF 4DYCA 5HNHA 2M7AA 4IQJA 1ZRDA 2HYFA 4M72A 3JSPA 2DFFA 4XLNF 4C5BA 3P7NA 3HGGA 2DOFA 3H5RA 3UZBA 1EYZA 1LNWA 5JVTA 2ME6A 2DFEA 1J7KA 4TVIA 2VQCA 1U5TA 4MNUA 5E3OA 4KJZA 2JEIA 3EUAA 1F36A 4LG0A 2HJWA 2W8LA 1LJ9A 1M1EB 4O83A 5LYJF 2I87A 3Q2OA 2X85A 1VQLI 2DXIA 3S2HJ 2NS8A 3WG9A 2IP4A 1FIAA 4U0VA 2PJRB 1JKPC 3H20A 1Z7UA 4XORA 3RR5A 2W9BA 4I50F 5K5OA 3M8FA 1H9TA 2GWRA 3WTVC 2NXNB 1X1DA 5CB4F 3A1YA 4L0ZB 4F52A 1RETA 4DV0H 1WI9A 2VJ4A 3Q8QB 3EQLF 5FJ8G 4FX4A 2YS6A 4UCRA 2DWCA 1GO3E 4PJMA 4CHIA 2OJED 2XKOA 1UNNC 1JT6A 3J7ZI 5LRRA 3JSNA 2EIKH 3RYPA 4EJVA 1LQ1A 4NYEA 4RGXA 5KFQA 4RM3A 4RB1A 4A3LJ 4GC7A 1CF7A 3ZQHA 4YP3A 3QYBA 2J5OA 3R4KA 3VSLA 4NBQA 5LHHA 1LE8B 2R82A 5DTDA 5KHDA 3J81K 3COAC 2EIYA 1SFEA 1B6AA 2C6YA 2STWA 2O5RA 4O3NA 5FLXK 2ISZA 2XDVA 1UELB 1G3SA 2IAIA 2P8TA 4NDLA 5L3DA 2ZDHA 4CKCA 3RZOJ 2RREA 3QZ8A 2AGQA 4IOCF 3X2QH 3PSIA 4M9SA 4UXNA 2R86A 2VKDA 4TQSA 2CQKA 3SFIA 5HLTA 5BYAA 4ED2A 2XAJA 3TW7A 2Z9OA 5L1KA 3H9QA 2HIXA 4LK1F 2KIUA 2DMTA 3E6CC 3GO5A 1U9OA 4TV9F 2JPBA 2UVVA 2UXXA 4B44A 4PBCA 2EINH 3VOTA 1R5HA 3MVPA 1USSA 4FS1A 3K69A 4F55A 1X3UA 4IHVA 4I2OA 2DYRH 3HUGB 4JQFA 3REOA 3V7RA 2XV4S 3EETA 3HOVG 2OTLI 3RKQA 3I4NJ 2VC1A 2Y9YA 4MEYF 3DEUA 4PFOA 2IJLA 3B02A 1RR7A 2LMDA 3JAMK 3CCEI 4L0YB 1Z2PX 4N4NB 4IVNA 2P0AA 3HZJA 1HQCA 3ABKH 4GLXA 1KU3A 2E1NA 2HI3A 4IPAA 3PSFA 1U78A 4FFRA 2ZM6H 1XSDA 2K9NA 1LE8A 4PJNA 5LMUH 4ECSA 4WXCA 4CYCA 4IX7A 1QA6A 3ERED 4KN7X 3FBIB 4B3SH 2MYSA 3DU5A 1KGSA 2YU9A 3T8TA 4B3AA 4EM2A 2RNJA 5GAEJ 5E3NA 1Y0NA 4R7RA 4PDBA 1V4RA 1R36A 3W1BA 5LGTA 2VXZA 2X6YA 2CFMA 4RAZA 3GW2A 1MIJA 2IA1A 4UUSB 2L7ZA 2JA7A 2FUG2 2QYOA 1WQ2A 2JA8G 3HTUA 2NNYA 3BR0A 2M5WA 2HZTA 2QYZA 2LR8A 5F0FA 5DQIA 4ED8A 3ULQB 1W5SA 4JI0H 1VTNC 5E18F 3LULA 4G9YA 5IYCG 1LDJA 4I01A 5ED4A 1WFXA 1QQIA 1WJ5A 3C1DA 5HDKA 1B8IA 3JZFA 1LVAA 2K9LA 2Z2SB 2MLKA 1XK5A 2R8IA 3OYLA 1KJ9A 4A0XA 4B3XA 4FE7A 1I39A 3NRVA 4WCGA 4FQGA 3G1MA 2PVPA 2UVWA 2JRMA 5E8GA 2Q8KA 3GIJA 4EATA 2QA4I 1E4FT 1QHGA 2L9SA 2KJCA 2LG4A 4I7HA 1ZKGA 3FM3A 1V9PA 4BWSC 2M1BA 3I71A 2YYAA 4J19A 3LSMA 5J40A 1KC7A 2R4GA 4A3BG 2JA6J 2VA2A 5E8IA 3HOYG 2IP2A 1X1PA 2ZSIB 1RC9A 4JYKA 1K4SA 1ZH5A 5BPFA 1OWTA 2KLOA 1YOVB 4V2FA 2IA0A 3OS0A 2HQ5A 5ILUA 5I5SA 2OCEA 3BZCA 2BQUA 1E4EB 4Y33A 3FXJA 1KJ8A 3ECOA 3S3NA 3FHZA 4MTEA 5FPRA 1RJQA 2AGPA 2BE5F 4LSXA 1TQIA 2W9CB 4RS8A 2XC7A 3JRIA 3PQKA 3G8DA 3TO7A 2QKLB 4XRFA 2W6ZA 4XLEA 1RPWA 1NH3A 1JLLB 1MBFA 1OISA 1O57A 2KIMA 1SEUA 5FRNA 1ODDA 2ZB9A 3K4JA 5I5TA 2HPIA 3K70C 2V4RA 1GLVA 2Z3YA 2R84A 5DLFA 1H89C 4M73A 2GXGA 2HKOA 3OYFA 4BBRJ 2KRHA 5F64A 3H9JA 4P5OA 3V7CA 2BYVE 4A3FG 1K6YA 2WTEA 3W6JB 2X5RA 1TBXA 3IKTA 3SEQA 1YRNB 4JXUA 3RB3A 3BA9A 2KDZA 5F0CA 4DR5H 3FX3A 4DL2A 3HRTA 4U0YA 1A31A 1XC5A 2GQQA 2X6OA 3S17J 2EA4A 3TEKA 4DRFA 3I58A 3TKYA 1JKQC 1JGSA 5LP6F 2L0KA 2G9WA 2SCUB 5KT4A 4XMYA 1KU2A 2LBFB 4EQ5A 5J1RA 4FCYA 4PGHA 3GUDA 2BR0A 5C4XJ 1SFOJ 1RKWA 4BBSJ 5FKLA 1KYWA 2C2EA 4DL6A 2XAGA 3HC7A 1I7LA 1XCBA 3KHRA 1GVJA 4HA8A 4IR1A 5H20A 4HDVA 1GV5A 3FXLA 2E60A 1B9NA 1PK8A 4M3BA 1T8IA 2L4AA 4U7BA 4QWBA 5LFAA 2R93J 4LIVA 2BGCA 5DGIA 3Q1KA 2DA6A 4BJTA 2W6NA 4DV6H 5BWRA 1YQAA 2X51A 3K10A 1ZHQA 1DQUA 1JX4A 3VPRA 4O4JF 5E3LA 1Y1WG 4WK8F 3WTXC 2KHMA 3I12A 5C44G 3M1EA 4M9ZA 2EJ3A 3BTLA 3SHFA 2UV1A 4QW9A 3E6DA 1OQYA 3RB4A 2YS9A 1LEAA 3TO6A 4BS9A 5BMZA 2EZLA 3S1MJ 1PDNC 4E7LA 1ZGWA 1N25A 4O5VA 3F8BA 4RLQA 4HYKA 4K0KH 3LSGA 1LPQA 1ZGJA 4JUZA 4DOZA 1RYRA 1LDKB 3CEBA 3FK7A 1BW6A 3IWFA 5KFYA 2W4SA 2HGXA 2K4JA 1T6SA 2PN1A 4G94A 4G7ZF 2I80A 3MFKA 5EWEA 3OUUA 2XCAA 1L2ZA 3GVAA 1IXCA 2LOOA 4KIFA 1J0RA 4A3CJ 4UVAA 3MKZA 5KS8A 5KCMA 1APLC 4M6VA 1X1BA 3KP3A 5BNGA 5JFRA 3I9V2 2K3FA 3OYCA 3TGNA 5FO5A 3ZQFA 4ECWA 2UUCH 1Z9CA 5KFHA 2NS0A 2L02A 2CH0A 4Q43A 4J9MA 5EZGA 1GXPA 2XGDA 4BQAA 1ERDA 1K83A 3ZRGA 3OYIA 4DUYH 1MJAA 3F6VA 2ABJA 1MMAA 3A0BC 3QODA 5KG0A 4NZMA 4I0BA 3EPIA 3V6HA 3GV7B 3H35A 1IBLH 2MABA 2VUMJ 4RCNA 2BHYA 1GYFA 1JJ6C 4GYGA 3OSGA 3JRCA 4R79A 2O6GE 2OV7A 2MW8A 1XB4A 3I4PA 3RDIA 3SQNA 4I55F 1YTYA 2CV2A 1OPCA 4MA5A 3RV4A 2FK1A 3CCMI 4FS2A 3BJYA 3BP8A 1RYSA 5KFEA 2VKHA 4UHTA 5KAFC 1IAWA 4HAMA 1ETXA 2NVYJ 1R5GA 4IJAA 4DJAA 4OIQF 5E25A 1GXQA 2DBBA 5HVQC 1SD6A 2UUAH 3D1NI 3LSKA 2WAQE 4MV8A 1POGA 1FBQA 4UUTA 1BOBA 2ECCA 2QENA 1LB2A 1KJJA 1JXLA 3QPHA 2J6SA 3O3KA 3TEDA 2OUMA 3SEZA 5IYDG 4RAFA 2NVXA 3WE2A 4H0EA 2DDAA 3SZTA 4BHBA 3F8NA 3CJQB 3Q0WA 5GTIC 1ETKA 3HEFA 1L3LA 2DFHA 1ACIA 2BY3A 3HOZJ 4BXXG 4GC6A 1JGGA 1FWZA 2P4WA 3UFXB 1DU6A 4BE0A 2FLPA 4JYAH 3RPQA 2B63G 2X6XA 1WPKA 4A5NA 4KFCA 3IN5A 1K61A 1S7EA 4A12A 1BM9A 1WJAA 3F23A 2VOBA 2IA6A 2Y75A 3MN2A 4KUMA 4I0AA 4Q44A 3LA7A 3LL7A 3W5OA 1S3JA 3RV3A 3ZPLA 1S68A 3T9BA 5E20A 4BE1A 2LY9A 3S24A 4ON0A 2R87A 3T7AA 5IT9W 1BR2A 2XB0X 4CSWA 1HNXH 3GIKA 4EBEA 4MV7A 4N9HA 3V8KA 4Q8EA 4O86A 2NNNA 5BOXA 2IS1A 5DISC 4X65H 1J9IA 5L1JA 2EQRA 4PGGA 5FD5A 3H92A 2ZSHB 3R6SA 5JVGF 5IP6A 3OSPA 4DL7A 2PFBA 2YPRA 4Y4RA 2GZWA 2J9GA 2LVSA 4MA0A 2VPSA 3FM5A 2RAEA 3FK6A 1D3YA 2LY2A 5BS6A 2ID3A 2EJ0A 4B3RH 4MEXF 4YAKB 1SD7A 4I6ZA 4DR6H 4ABZA 2HS5A 4HF2A 2RDJA 1B1BA 1GSOA 2M87A 4L9NA 5KFCA 2P81A 2GAUA 2A69F 1QRYA 3HG9A 1B04A 1I1LA 4L9VA 4GCVA 5K5RA 3EYIA 4CA0A 4Z6YA 4HV6A 5A2QZ 4J00A 1HC8A 2TRTA 1CE8A 2VXDA 3ERMA 3VMMA 3MFIA 1W5CC 2DLLA 5DGHA 2HR3A 3FKIG 1MBKA 1U5TB 3I0TA 1VFCA 2V4JC 1BA5A 1TL8A 2XGPA 5KG6A 1OMIA 2Q1ZB 2ETHA 5L3GA 1HA8A 3G6VA 1JUMA 5IP7G 3BQ2A 4RGRA 3ABUA 3BZKA 2NOGA 2O8XA 4Y3OA 2JQ7A 1FSHA 4M74A 4TV8F 1KEEA 4ED0A 2VBYA 2LK2A 2OQGA 3NWSA 2UVUA 1JXSA 1V5EA 2GXAA 2W82A 2DJNA 5B1AH 1E3OC 2QSGX 4NC8A 3OYAA 2VKEA 1R49A 1MNDA 4KICA 3HPGA 5H2FC 2P0WA 2MH2A 2VBXA 3GQCA 3CJRB 1IJWC 4F4YA 1ORKA 1JHFA 1OCCH 3T1BA 2VR1A 3RCOA 1LFUP 3OHAA 3ZMVA 1GGOA 4NNJA 2E2IA 2VA3A 3G2BA 3ABTA 3CUQC 4RBOA 2R7SA 4YFKF 5K1YA 5IP9J 5F04A 3WTZA 4O82A 2QGUA 4B8XA 4X0GA 1IF1A 3QOPA 2VJJA 3U54A 2ECBA 4DL4A 1UC9A 5DM7F 3CCJI 4X1EA 1X2NA 3KCCA 4G6DA 4EFBA 4YFNF 3TY9A 4IRGA 1K83J 3HSFA 3N43B 2F5CA 4ZYGA 3TQTA 5DYMA 2EZIA 2QM3A 2E1CA 3VWBA 5B3SH 2UU9H 1E4EA 4L9TA 4C30A 2R8JA 3KP7A 2Z5UA 5FKMA 3H9GA 2DMPA 2EIMH 3HBLA 2RGRA 2NU7B 3DF7A 2DA2A 1FOKA 4B3TH 4YR2A 3MWMA 2IEKA 1MNEA 2ZJPF 2CFXA 2Y31A 2R7UA 3WE3A 5M3MJ 5D5UB 4B1RA 4YIFA 4YRVA 1JHHA 4CGZA 3G1LA 2QQBA 4RB0A 5LEKA 1BN5A 2PEXA 4L5EA 4RB3C 4HV5A 2K9SA 4J01A 4DR4H 2UUBH 1QU3A 3N05A 4LFAH 2CYYA 1IXSB 2W00A 1S29A 3TDZC 1ENHA 5D8LB 4JI7H 2QB5A 2DI3A 4OOIA 3H0GA 3U9TA 2RF4A 4BXFA 2CNQA 3B6CA 1J5YA 5D4RA 4L18B 4M0JA 3CMMA 5D1OA 2JA6A 2WBMA 1HW2A 1Z1DA 5KFGA 2YZGA 3HOWG 2V7FA 3IH2A 2FE3A 3AW8A 3PW7A 2QK4A 3CC7I 3DKYA 3T5XA 5E1WA 4EBCA 2HTJA 3K4BA 2V1DA 4D7MA 4E6NA 1X58A 2W85A 3C3WA 5TRDA 4IAJA 5IYDJ 3PUBA 1EJ9A 3M9AA 4EMSA 2HXIA 1I7NA 2ZDQA 3BPXA 2XAFA 2DU9A 3G6EI 5KFFA 2EFPA 5EYRA 4O3PA 3JSLA 1AHDP 2HOEA 2ZKZA 1PP7U 2DMNA 3T99A 4Q4CA 2VQLA 1QZEA 1EA3A 3V42A 4DZJA 3KHHA 3WTSC 2HIVA 2H27A 3ZN1A 4J9LA 3PZPA 1NK3P 2EILH 4LJZF 3ZOBA 4IZZA 3N97A 2JA8J 3PUFA 1R9TJ 1XSXA 2GQSA 4PFPA 1FVIA 2L7KA 3DWLE 4TV7A 5LEJA 3WGGA 2IA2A 1B8IB 1QPMA 2ZJ2A 1ITYA 3MMYB 3TOBA 3M8EA 2D45A 4DV7H 4G12A 2QLZA 3BJ6A 4UFZA 2NUAB 1YJ9I 1U3EM 1IGNA 4YELA 4IHWA 2J5PA 3VODA 3BTIA 3ZXSA 4KA4A 1Z21A 2IXSA 3PN1A 4QWEA 4ZYHA 1G6NA 4MV3A 1D8KA 2IS2A 1YLFA 1SVMA 1GVDA 4MHGA 3HYIA 4WF2A 3G6XA 3FKIA 1DU0A 4D1QA 4UNOA 1LEBA 2PBZA 3KX2A 3T9CA 3CC2I 1IOVA 2IBDA 1SD4A 3A0HC 3L4KA 3GFJA 4ZZDA 2VQDA 3OSNA 2DQLA 4O3SA 2VPRA 4XLPF 2QUFA 3LAJA 3LP8A 1VQNI 2VJIA 2M05A 1GSAA 3I59B 1MJBA 4ECTA 3GZ5A 4LF5H 1MH3A 1LFBA 3WHCA 3FMAA 1DPUA 5DGBA 1I6UA 4NC6A 3LWBA 3KP6A 4DYRA 2TDXA 4CZCA 2QF7A 1HKTA 1A6QA 3MAJA 1KYZA 2BW3A 2M0MA 1MMNA 3CMEI 3G8CA 4HZFA 1RJPA 3H3VH 4YHHH 5FJ8J 4DAAA 2F5DA 2H6BA 1ZRFA 4C3HJ 3HKZN 2ZNYA 3J7YJ 3K70D 3TP3A 1IUYA 3BAAA 2YUSA 2FBKA 2N8GA 1I94H 5BMVF 2F6CA 4DIQA 4C2TA 1IV8A 3LNQA 2R6FA 1ETVA 3PFFA 4OIPF 2XD4A 1UHMA 1P9QC 3ZQCA 2X4HA 3CUQA 1RJRA 4DV4H 3VYUB 4N9IA 3GTJA 5JR3A 4QLCU 1WRVA 2WYOA 5HLGA 1R4NB 5DG7A 2FLNA 4C2MA 3TQNA 3ZP5A 3QYFA 3OR1C 3F22A 5GONF 3GB8B 3IRQA 4CMDA 3IG0A 5LRSA 2DO7A 2W48A 1YG2A 2QCOA 5CLSA 4LLGF 3RTXA 2EH3A 5KG4A 1JE8A 1P8LA 4YBZB 1IN6A 3C18A 3VFZA 4BDYA 1IRXA 1OCOH 1YHQI 4U7CA 1TQMA 5H80A 2F4VH 3R5HA 2R7RA 2IBKA 2A6HF 1KJIA 3VOEA 3MCZA 4LK0F 2W7NA 5BPIA 4UCVA 3GLXA 4PSWA 4LH7A 2XRNA 1NG6A 1VQ8I 5BWVA 1YX5A 5J2UF 1MMSA 2WAQN 3QPLA 1QPIA 4YR3A 2ZCWA 1GV2A 4C9YA 1S0MA 2HGWA 4GDFA 4LD5A 1WZ2A 2JPCA 5KFLA 3HKZA 3JAMW 2DTZA 2R7XA 4YR0A 4E7JA 2I8CA 1B6RA 3L2WA 3QWUA 3H0GJ 1ZETA 2Z99A 4RU9A 4EYIB 1P92A 5FLXZ 5FLXW 2DOAA 1XN7A 1VQKI 3A01A 4HSRA 1FOYA 4ECYA 4LSAA 2FP4B 5DS9A 5CKTA 2JUGA 4HDUA 4IIJF 5CE8A 4LF8H 4Q4DA 3RF2A 4KT5C 2CKZB 2Q2UA 4F3QA 2YU9J 1Z2NX 4B09A 3O8HA 4MQVA 2PMHA 4O7ZA 2OF7A 2NVQJ 3BR1A 4P1WA 2CRGA 3IV5A 3BTJA 4O7TA 1XMOH 4ECUA 2PJPA 2KMUA 4O3MA 3BOQA 3CDHA 1BJZA 4CCNA 4J9NA 3LMMA 4U7DA 5K7HA 4CXFA 4ZC3A 1CQIB 5BYBA 4M9XA 3V4ZA 1YW9A 4I09A 2HDKA 3F9KA 3GFIA 4YEJA 1GT0C 4NZOA 2VQFH 2ASDA 2I8DA 1IV6A 1FC3A 2AQFA 3H3UA 3S1NJ 2RN7A 5D5WB 1V5FA 2XPUA 2VASA 2W6QA 1SVLA 1A3GA 2XIGA 5EWFA 4G6QA 4P55A 5KFXA 5JHFA 4IZOA 2FLLA 1MMDA 3QPTA 3DU6A 1X3WB 2E5NA 3E97A 2R8KA 3WTWC 2DN0A 2RQQA 4E70A 1YITI 3JZIA 3MFHA 1KUTA 1UG2A 2QQ8A 4NQWB 4FTHA 4HQ6A 2VJ5A 1I3QA 3BQZA 3HB9A 2C35B 3U1DA 3O8GA 1S6LA 1QNTA 4XOTA 4XR6A 2FXAA 4ECZA 3OYNA 5EEHA 4MV9A 4HQMA 4ZTJA 4P9FA 4E7SA 1Z77A 2PMZE 2XHKA 3OWTA 4RB2C 4LMYA 3ECHA 3E5QA 4M71A 5E1XA 2VT2A 1CQJB 3U2RA 4IRDA 5ICEA 4E7HA 3CMAI 4XKWA 1K7AA 2HYGD 1FMWA 4A3MG 3GJXB 3K4MA 3MKLA 1I2LA 3HHGA 3SZGA 4ZH4F 3ASOH 4YIRX 3VPBA 2O9LA 1RRJA 2HG8A 3W1GA 2GA2A 3I56I 4NHJA 1XDNA 3KAJA 4RUCA 5DQGA 3K2AA 3VYTB 1IDYA 2FU4A 1IBMH 2EWNA 3FXUA 1VQ6I 3CD6I 4A3LG 1Z3XA 1P2FA 1V55H 2HKXA 5M3FJ 3K2ZA 1R1TA 4KIBA 5K3WA 3ABLH 4MO7A 4RA2A 3D0SA 3AYHB 1LKXA 2ASLA 1FOWA 1SFXA 2WAEA 1CKNB 4JI6H 2W70A 1EHIA 2HQRA 2LSOA 4FETA 2W57A 1W1WE 1UHWA 3OV8A 1S0OA 3E6BA 1DIKA 1VKZA 3MZ8A 4MV6A 3T8RA 4A3GG 2JEGA 2NU9B 4A3KJ 2CV1A 1JUPA 3ML6A 3KZZA 2COGA 3T5KA 3N8DA 4R8HA 2QVOA 4IL6C 3ZCOA 2CUEA 5FKNA 3HT5A 4MV4A 1H88C 2Y9ZA 3VYRB 3R0JA 2VIXA 3P9IA 4DV5H 4BJ5C 1YJWI 3N6XA 4HLXA 4A0YA 1N77A 1OCTC 4UUVA 1M7JA 3AL0B 1S97A 5DEQA 1FT9A 2FNAA 5KG3A 1SAXA 1JDBB 3DEWA 1M6VA 3H1CA 3WTYC 3CCUI 3G6YA 5CJ9A 2LD5A 3RYRA 2DDBA 2VN2A 3FF5A 2CJJA 3I4NG 3UQ8A 4TQRA 3Q3SA 3EYYA 2K4BA 5KNLA 3DP7A 4OX9H 2ZXIA 2VB6A 4BBRG 3J81W 1W36D 1HW1A 4XLFA 2WAFA 3BG7A 4BHCA 4BAYA 1HNWH 5C4JJ 3JSOA 2VPQA 4BY7J 4YJ3F 1XMQH 2FRHA 3R5FA 2XGQA 2FPPB 5KT7A 3HRSA 4YJ2F 2Y2ZA 2YRXA 2KSWA 4O3QA 4X6AJ 3QAHA 2EJ2A 3W6VA 1R7JA 2K85A 4AIHA 2M9HA 4G7HF 2NAZA 3DV8A 2VQEH 5I47A 1LUJB 3DLAA 5CVJA 1OJLA 2RKHA 5LLQA 3W2AA 2DABA 3K4CA 2UXCH 3MWDA 3RIRA 3OY9A 5L9XA 2K02A 1BI3A 4XX0B 3NEUA 1NHAA 1O3QA 3EPZA 4FFLA 3EPGA 4QPOA 4GKJH 2PQ8A 1DP3A 3M9OB 2JWTA 2F4OB 4A3EJ 2FB9A 2VC0A 3UYYA 4M3GA 2HWVA 5FFXA 5DG8A 4DW6A 1O4XA 4O7NA 1EKFA 4JI5H 5B66C 5AONA 3W3CA 3RBDA 2XAQA 3L09A 3NARA 2XVCA 4BQOA 4HQEA 4B3MH 2AS5F 3HOYJ 2BY2A 2O3FA 1C0WA 3TQ1A 2JA6G 2E36A 1S03G 3NBZB 2CSOA 5L3BA 5JH7F 2OH2A 1YE9A 1YI2I 2H94A 1TW2A 3I55I 1IRGA 3HJEA 1TWHA 3HTSB 1MBGA 1WH5A 4IO9F 3LFKA 3KP4A 3LQSA 4FFPA 4FBUA 2IW5A 3CLOA 2K27A 4BKXA 3MKYB 1I1KA 1SAUA 4I76A 1TAEA 2X1CA 3CCVI 2XF6A 3A03A 3V7SA 1VQ5I 2W25A 1I1MA 2L01A 2W7PA 3E3VA 4EEYA 4WWCA 1AUXA 3ZMUA 3JW4A 4GRIA 2QEXI 4BE2A 2F5FA 1G3YA 3GDEA 2BXYA 4R1HA 1RKTA 2Y48A 2EV6A 5GAHJ 4IWYA 3BCBA 4FFNA 1QBJA 5E1ZB 3K4LA 2OU2A 1SEIA 3QP5A 5EDWA 2CUZA 4CE5A 4ECRA 2FQ4A 3GTQA 4DBQA 2R5ZB 3GZNB 5DD8A 3VB2A 1ZLKA 1DDNA 4C5AA 5FKOA 1XMAA 2V6CA 3M4IA 2P5LC 4PSXA 2L4MA 4J9OA 2K3PA 1QHHD 3K5HA 1YS6A 3JRHA 1XD7A 5ILSA 3QZ7A 3E0JB 3CO6C 1TWCJ 2ODTX 3C2GA 1FKAH 5A2QW 4DQ2A 3DXJF 3A4CA 3OIOA 3G4SI 3OTOH 3AG4H 4XN0A 4U87A 1Z6RA 1WJFA 2VUMA 1OYYA 4AQYH 1RR8C 2JK3A 2JMWA 4BQNA 5GADJ 2KP6A 2V9KA 1Y14B 3K3VA 1S9HA 5I5UA 4A3MJ 4HW0A 4F92B 5HS8A 2DODA 1Y1WA 2H09A 4UUSA 1AKHA 3BG3A 2PG4A 3WNZA 2W1OA 2HDCA 1VS0A 3I3LA 2DLNA 1FZPB 5HBRB 4LF9H 4GYIA 1BI1A 1WCMG 2R5YB 5H6QA 4O7WA 4J0MA 2XPWA 1E17A 4CKEA 1M0WA 3H0GG 1FYMA 2R7TA 1IN5A 4AC0A 1OCZH 1TWGJ 5FFZA 5LHGA 3D5SC 4QTRA 2NYXA 3I59A 2R8GA 3RJ0A 2W71A 4XN3A 9ANTA 2XROA 1DP7P 1ON2A 1G8XA 1A0GA 3PW0A 2CQNA 1YIJI 1Y39A 3J80W 5I5WA 5BQTA 3K1NA 2ZMEC 4II3A 2F5EA 3ZN0A 3EUHC 1EUDB 5CQGA 5KFZA 1GSHA 2IGOA 4PCQA 3BR2A 4ESJA 3DTIA 4Q48A 3HO8A 3KE2A 3OR2C 4Z2YA 1SVOA 4KYWA 3K5IA 5KKNB 1KBLA 5KFSA 1OR7C 3N6RA 2JN6A 3TL4X 5A2QK 1ZARA 1WSCA 5KT3A 4DV3H 4LFCH 1H8AC 1TW3A 1T3NA 2BVMA 4A3IG 1WJEA 2HGSA 3PJRA 4LF4H 3OIPA 3PO3G 4A3JG 2E5ZA 2XGEA 1W7PD 2CO5A 3F0CA 4RGSA 4WXDA 2FEZA 2VPLA 4XBFA 3BLYA 4RM2A 1ONVA 3UKGA 2ELHA 1BJTA 4XQFA 2DPJA 5KFRA 3WU2C 2FBHA 4IRKA 1DAAA 4KHPH 1CQTA 3JRDA 1CS0A 4O3RA 5IOZA 3CUOA 1R1UA 1IRZA 1BC8C 1FP1D 3GTOA 1R6RA 3O2PE 2EV5A 4CUGA 2VE8A 4PJLA 5BWXA 4U0WA 5CQEA 2XGXA 2MG4A 2EB7A 1N78A 3HOSA 1WSUA 1X9NA 3MKWB 1ZYRF 4XM3A 3ZMDA 5LGUA 2O61A 3KYHC 5BPHA 4YAJB 5LOVF 4AU7A 3K0LA 1WWXA 1IZ1A 4HN2A 2KKOA 2GXBA 4OMYA 2DZDA 1TTYA 4CCLA 2WAQA 4IKFA 3RPUD 4J9RA 1D1BA 1SMTA 4AUXA 4O7YA 3BQYA 1OYWA 3RSNA 4D5CA 4ME6A 3FXKA 5IOYA 3WTUC 4Y7NJ 4LG0B 2F4IA 3JZ6A 4YQWA 3TY8A 4FBTA 2E7WA 2JRTA 3MR3A 4XLHA 1D0ZA 4A3CG 1TWHJ 2FQ3A 5KX5F 5KT6A 4I02A 2X6WA 2VOPA 2LC2A 1IYDA 1OCPA 3ZR8X 2IT0A 2P5VA 2F2EA 1ZR2A 2YZNA 4OAYA 4B4CA 3QYEA 2Y0SN 3BPVA 3SDBA 3BC8A 2JA5J 3J7AK 4N0BA 4YB8B 1XCVA 1Y1VA 4NLGA 4BJ6C 3KFWX 1KU9A 1Z2OX 3E1SA 1L0OC 3QU3A 1ZAUA 3U21A 4LLNA 4O2AF 1J2XA 2ICWG 2NU8B 2HQAA 2A3SA 2Y0MA 3OL4A 3OOPA 5C44J 1RESA 4BY7G 3GIQA 1WCMA 3GLLA 3ZGKA 4AD9A 5C1OA 4EEFG 1W5TA 4CKBA 2MD0A 2NVUB 4LF6H 3N44B 3O6BB 2FKLA 3PW5A 1MW7A 1RI7A 1R22A 3MEXA 3VSKA 3LSRA 5KG7A 4ZDPA 1AU7A 3VPDA
chains in the Genus database with same CATH topology
4UFZA 4JOMA 2PJRB 3H20A 4XORA 4YELA 1JI8A 3RR5A 3ZXSA 4APMA 1Z21A 2IXSA 3PN1A 3OYBA 2HVQA 4X62H 2IS2A 1X1DA 3PNTA 4N4OB 3A1YA 4E4HA 3K4NA 4F52A 3DTEA 2HPMA 4DV0H 5FRMA 3GBGA 5FPOA 3N41B 2VJ4A 4KITB 4D1QA 3KX2A 1N33H 3IAS2 2E1MB 4UCRA 2A6TA 3L4KA 4PJMA 4XL9A 2VJIA 4ETSA 3JSNA 2MCTA 3LMLA 3KALA 4F93B 4RM3A 4RB1A 1U0JA 4LF5H 3PNVA 3QYBA 3VSLA 3FMAA 4DV7H 4E7IA 4PJJA 5KHDA 1I6UA 2ZFUA 2O5RA 4CZCA 1ZELA 3L2QA 3RGXA 3T1YH 2XDVA 3NBYB 1UELB 2BW3A 1MMNA 2M0MA 3IP4B 4YHHH 2RREA 1G59A 3PSIA 3BCAA 2VKDA 1OLTA 5HLTA 2DT6A 3K70D 3H9QA 3BAAA 2HIXA 1D1CA 1W36C 1I94H 1YX3A 4ZYAA 3TY5A 2F6CA 4DIQA 5LD2C 4C2TA 2X1DA 4B44A 3HPHA 4CH7A 4F55A 1P9QC 3HUGB 4JQFA 3VYUB 4DV4H 2BOLA 4EEQA 2WYOA 4PFOA 1Z2PX 3QYFA 3OR1C 3A2KA 3IG0A 3GB8B 2KRCA 2L9NA 4N4NB 2BW3B 4RLFA 4GLXA 4ITVA 3M1CA 3PSFA 4MLOA 4H4KC 3RTXA 4YY3H 2ZM6H 2V26A 1X19A 1P8LA 2QKMB 4BDYA 4A2AA 1IRXA 4NC7A 4PJNA 5LMUH 2WA0A 5TGTA 2R7RA 2F4VH 4XLAA 1ZHSA 4IX7A 1XNQH 1CKOA 3FBIB 4B3SH 2MYSA 3DU5A 2W7NA 4BU2A 4PSWA 4OWRB 1O75A 4LH7A 1M0TA 1NG6A 1YX5A 4R7RA 4PDBA 3RIZA 3J7AY 3W1BA 3PFYA 2VXZA 2X6YA 2CS3A 4C9YA 2CFMA 1DGRM 4RAZA 3OOUA 1D1AA 3HKZA 3JAMW 1AA7A 2R7XA 4E7JA 2ELJA 2FUG2 3L2WA 3QWUA 1GLNA 5FLXW 2DOAA 4PK4A 4NUBA 2X1EA 4JI0H 4HSRA 4HEA2 4B48A 4LSAA 3FDYA 3S3MA 5CKTA 1WFXA 1WJ5A 1FMVA 2JUGA 3D5RC 4UCUA 1E4GT 2K9LA 2UWMA 2Z2SB 4LF8H 1XK5A 3OYLA 2Q2UA 3VNNA 4F3QA 2WE6A 4B3XA 1Z2NX 3TMOA 3OYJA 3CZ6A 4HNUA 3OS2A 4P1WA 3H5NA 2XF7A 4EATA 1E4FT 1XMOH 1SFKA 1QHGA 2L9SA 2LG4A 4I7HA 2WB1A 4JI8H 2KMUA 1V9PA 4BWSC 2CW7A 2XAUA 4CCNA 3LSMA 2L5QA 2R4GA 3LMMA 2O03A 4JI3H 4ZC3A 1N34H 2Z16A 2ZSIB 3F9KA 2KLOA 4YEJA 4AYBA 3OS0A 2VQFH 3C2HA 2I8DA 4LH6A 4GKKH 3W2VA 2DJIA 4BDZA 2F5VA 1J09A 2AQFA 2K9MA 4Y33A 1HR0H 3S3NA 3NC0B 2DXIA 1V5FA 4DGWB 2VASA 4MTEA 5FPRA 4BUPA 2XIGA 4LSXA 3L2RA 2MFZA 2XC7A 2UXBH 1MZBA 2QKLB 3CP8A 5JHFA 4UCOA 3DEEA 2VQGA 4XLEA 1MMDA 3DU6A 4XONA 2E5NA 2A5WA 3UNGC 1HNZH 2RQQA 1X4PA 5FRNA 4D9JA 3K4JA 4NQWB 2HPIA 4CCOA 1E0EA 3K70C 2VJ5A 3ONQA 2KQRA 3W2WA 4XOTA 4XR6A 3OYFA 2KRHA 3CF2A 3H9JA 3OYNA 4P5OA 4MV9A 4ZTJA 1K6YA 3L2UA 3RGZA 3SEQA 2Q2EB 4E7SA 1MMGA 3OWTA 3BA9A 4RB2C 4DR5H 4LMYA 2KZVA 4DBRA 3DPTA 5FROA 4DRFA 4E7HA 4XKWA 1BR4A 1FMWA 3GJXB 4LIUA 3K4MA 4XMYA 2LBFB 4EQ5A 3SZGA 3W1GA 4M7EA 5LMNH 3KAJA 1XDNA 2OWOA 3MD2A 3ZQQA 4C2UA 2HHHH 3SYTA 3VYTB 1IBMH 3HC7A 1Z3XA 3QOEA 1WJBA 1N36H 1PJRA 3EUKL 2E60A 5HOOA 5IWAH 5FD6A 5CPRB 2L2OA 4U7BA 5LFAA 1LKXA 1V5GA 2BVLA 4LIVA 2WAEA 1CKNB 4JI6H 4UCSA 3L2PA 4CCJA 4BJTA 4DV6H 3HOTA 4HPQA 2M4KA 4FETA 2X51A 3K10A 1ZHQA 1DQUA 2W57A 4BL0B 2IS6A 2KHMA 2YCHA 4NXMH 1AN7A 2UV1A 3AKZA 2CV1A 2IGMA 2AQEA 4BS9A 2LBFA 4E7LA 3ZCOA 4RLQA 3OYHA 3BA8A 4PZ7A 4DUZH 4K0KH 2UXDH 3LSGA 3LSIA 2JVGA 3VYRB 4DOZA 2VIXA 4DV5H 1LDKB 4BJ5C 3N6XA 4UCTA 1N77A 3NWTA 2W4SA 4A2BA 3AL0B 2WY8Q 2GOMA 2CFOA 1L2ZA 3IAM2 3DQVC 2LOOA 1DGSA 1X1AA 1WJDA 3MKZA 2K5CA 4LG3A 5KCMA 2M4GA 4QPQA 3OMYA 1X1BA 3I9V2 3OYCA 5D1PA 2DCEA 1UAAA 2UUCH 3UQ8A 3PNYA 3EYYA 4B43A 5KNLA 3K6GA 3KXYT 4OX9H 2CH0A 2VB6A 2ZXIA 4PZ8A 2RGVA 3LSHA 1W36D 3J81W 4LITA 1ERDA 4XLFA 2WADA 3ZRGA 1A0IA 2WAFA 3BG7A 3OYIA 4DUYH 1HNWH 2Q2TA 4DR7H 1MMAA 2DT7B 2ZXHA 3QODA 4CCKA 2PJRA 1XMQH 2M3AA 2HNHA 1IBLH 3H35A 1X1CA 1WH2A 2MABA 3CESA 3HXLA 2KSWA 4OAZA 4PUSA 1GYFA 2KL4A 3KAKA 4R79A 2VQEH 2OV7A 2CV2A 3DLAA 2PMZA 3UR3C 3W2AA 3C0FB 3K4CA 4E7ZA 2E1MC 2UXCH 2NOJB 2VKHA 3OY9A 2JVHA 4GKJH 2IGKA 3EPZA 1N75A 4QPOA 4DJAA 3LFUA 1DP3A 1NG7A 5HVQC 1UG0A 3AL0C 1SYXB 2UUAH 1T0FC 3N40P 3LSKA 3BABA 2XSJC 3T1HH 4JI5H 4RAYA 3CP2A 1BOBA 3W3CA 4LFBH 3FKJA 2OUMA 3SEZA 4BQOA 2HVRA 4B3MH 2XF5A 1S03G 2Z1DA 3NBZB 3CJQB 3F8NA 4DR1H 2E5LH 1YE9A 4XNFA 3DPUA 4DR3H 4ZDOA 4DR4H 4JYAH 4BE0A 2HZDA 1BGWA 1Z7LA 2X6XA 3S8PA 2LRDA 3OYDA 4II2A 1WJAA 3MKYB 2VOBA 1SAUA 1TAEA 2X1CA 4BEHA 3LL7A 4RMNA 3W5OA 2XF6A 3H0DA 2VUGA 3KYLA 1S68A 3OIQA 4HSTA 4BE1A 3S24A 4GRIA 4FASD 4BE2A 5IT9W 4G6TB 1BR2A 3FBNB 4CSWA 3GDEA 1HNXH 4B47A 4MV7A 3BCBA 3K4LA 1SEIA 2IS1A 5DISC 4X65H 2CUZA 2IS4A 3DKXA 1FJGH 1X4OA 2Y0SA 5FD5A 2ZSHB 4DBQA 4NXNH 4HRIA 1D0XA 4Y4RA 2R7VA 1N32H 4BQQA 3M4IA 2VPSA 5HNFA 4PSXA 2LY2A 2V6EA 2K3PA 1QHHD 2MC4A 4JI1H 4B3RH 1PYVA 4DR6H 4PZ6A 3E0JB 4AVZA 1CKNA 1IBKH 3C2GA 1FKAH 5A2QW 3OTOH 3A4CA 2VL8A 4MTDA 2R7OA 3HG9A 4XN0A 2HU9A 4U87A 4E6KG 1B04A 4X64H 4HG2A 1WJFA 4CA0A 4XLCA 4J00A 4AQYH 4BQNA 3RF2A 2VXDA 2KP6A 2IGNA 2M7BA 2V9KA 1S9HA 3OS1A 2CW8A 5D1OB 4F92B 3K3VA 3M8JA 2RNGA 4JI2H 4RZQA 2W1OA 1VS0A 3I3LA 4LF9H 2V4JC 1Y56A 2Q1ZB 1HA8A 4J0MA 4ANJA 1DGWY 1M0WA 4Y3OA 2R7TA 1TA8A 3D5SC 3PL8A 3RJ0A 4XN3A 2CMPA 3KEYA 1Y6IA 3NWSA 1G8XA 1V5EA 2LY1A 3S3OA 2LH9A 1Z3YA 2W82A 4BEHB 4DV2H 4NC8A 3OYAA 1P16A 3DTKA 3J80W 1MNDA 4KISA 3HPGA 4LF7H 2P0WA 3AFHA 3CJRB 4II3A 1CKMA 3N42B 4Q0YA 3EUHC 2WY7Q 5CQGA 1T95A 2IGOA 3RCOA 4JV5H 3H5AA 4NNJA 2V1NA 3DTIA 2HVSA 3G2BA 2KPMA 3OR2C 4XKBA 2R7SA 4CC5A 4F91B 2UUZA 4X0GA 2VJJA 2LYCA 3VYSB 2VQHA 1OR7C 3TL4X 3K4KA 4DV3H 3CVZA 4LFCH 2ZJTA 4EFBA 4DR2H 1VZ0A 4XKCA 2BVMA 4JI4H 3OYEA 3TY9A 1WJEA 2HGSA 3PJRA 4LF4H 3N43B 3OIPA 2E5ZA 2OC6A 3VWBA 2UU9H 4C30A 2VPLA 3BLYA 4RM2A 1BJTA 3H9GA 4XQFA 1TZLA 2RGRA 3DF7A 4KHPH 4B3TH 2KDOA 3IUOA 4BACA 3RQ4A 3OYGA 3MWMA 5BR8H 1LVKA 1MNEA 2R7UA 4YRVA 1J5EH 1R6RA 1XNRH 3DPLC 4E7KA 4RB0A 3VDXA 4CUGA 4PJLA 3S93A 4BGDA 4KT6A 2JA2A 4ZJZA 5CQEA 4RB3C 1N78A 3HOSA 4CCMA 1X9NA 3MKWB 1WJCA 3OYKA 4XM3A 4J01A 1TT0A 4ZDLA 1QU3A 4IQ4A 3N05A 3KYHC 2UUBH 4LFAH 2W00A 4JI7H 4AU7A 2LREA 2JSPA 4BXFA 3RTRA 1D0YA 4HNTA 5D1OA 3CMMA 2WBMA 4CCLA 4EFEA 2V7FA 2WAQA 4IKFA 3RPUD 2FE3A 1D1BA 3DKYA 3RSNA 2HDWA 3TBIA 4E6NA 3K4BA 2F4IA 3TY8A 4IAJA 3BG6A 4CC6A 3PUBA 5EOYA 5LL6b 4XLHA 2CUJA 1D0ZA 4XOPA 3S32A 2WDTA 3L4JA 3FHNA 2GOXB 2R7WA 2X6WA 2LC2A 4ZTFA 3JSLA 3ZR8X 4FM9A 1BR1A 4OAYA 5HNHA 3QYEA 3J7AK 3SDBA 4UCVA 2M7AA 3BC8A 4IQJA 2VQLA 1EA3A 3V42A 2R7QA 3OL3A 2HIVA 4BJ6C 2VLAA 1Z2OX 3E1SA 3U21A 3H5RA 3D5LA 1KONA 2HQAA 4IZZA 3OL4A 3L2VA 2VQCA 4PFPA 1FVIA 2L7KA 3DWLE 3ZGKA 4DV1H 4KJZA 3EUAA 2MD0A 4XKVA 4LF6H 3N44B 3OYMA 3MMYB 1MW7A 1LFPA 2X85A 2CV0A 3VSKA 4ZDPA 3HL2A 4X66H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFZ A;  3W1B A;  1X9N A;  4EEQ A;  1XDN A;  4PZ8 A;  2OWO A;  2CFM A;  1TA8 A;  3KYH C;  3BA8 A;  4PZ7 A;  3RR5 A;  1A0I A;  3JSL A;  4EFB A;  1TAE A;  1V9P A;  3TY9 A;  3W5O A;  3NBY B;  3PN1 A;  4PZ6 A;  1CKN A;  3GB8 B;  2HVQ A;  4UCV A;  4GLX A;  3QWU A;  2Q2T A;  2VUG A;  3BAB A;  1S68 A;  1P16 A;  1B04 A;  4UCT A;  5D1O A;  2HIV A;  3RTX A;  3S24 A;  4EFE A;  5FPO A;  1P8L A;  4LH6 A;  3GDE A;  2HVR A;  1CKM A;  3BA9 A;  3BAA A;  2HIX A;  4UCR A;  1DGS A;  1FVI A;  5D1O B;  1CKN B;  3NBZ B;  3NC0 B;  2HVS A;  1CKO A;  4UCS A;  4UCU A;  5DIS C;  3TY5 A;  4E6N A;  5FPR A;  3L2P A;  3TY8 A;  1XK5 A;  4DRF A;  4CC5 A;  2Q2U A;  3VNN A;  3JSN A;  1VS0 A;  4CC6 A;  5D1P A;  4LH7 A;  3GJX B;  4UCO A;  4EQ5 A;  3UQ8 A;  3W1G A; 
#chains in the Genus database with same CATH topology
 5JHU A;  1FX7 A;  2EBI A;  4A3D J;  1TT5 B;  3S16 J;  2OZ6 A;  2DW4 A;  1J75 A;  1B72 A;  4CHU A;  4A93 J;  2XAS A;  1E2X A;  2HVQ A;  4WX9 A;  2G0E A;  4X62 H;  3BZ6 A;  4FIS A;  1XTA A;  5LGN A;  3PNT A;  1ETQ A;  2HPM A;  2Z02 A;  2DTR A;  3K4N A;  3DTE A;  5DUI A;  5FRM A;  2KZG A;  3GBG A;  4KIT B;  5KFU A;  2BY1 A;  2DAA A;  3PW2 A;  1ZRC A;  5E3M A;  2A6T A;  2JEJ A;  2R7Z J;  3U9S A;  4RZR A;  3EDP A;  3JRG A;  5M5X J;  4J9Q A;  3G73 A;  1H0M A;  2V9W A;  2R7N A;  3LML A;  4F93 B;  1P4W A;  1B6S A;  5GAG J;  3OHB A;  4UUG A;  3CCR I;  4E7I A;  1PUF A;  4BXX J;  4PJJ A;  3FWE A;  1CF7 B;  5KFD A;  2MSY A;  5IT9 K;  1VQM I;  5FR9 A;  3T1Y H;  3NBY B;  4F7Z A;  3IP4 B;  3FDS A;  2E2J J;  2BY0 A;  4O2B F;  1DUX C;  1I50 A;  3FMR A;  4BNC A;  4JV2 A;  3IC7 A;  3TOA A;  3TO9 A;  1MDM B;  5KFI A;  3J80 Z;  1T2K A;  2DT6 A;  3GTK J;  5JLX A;  1FSE A;  1W36 C;  3HGY A;  5J8F A;  1YX3 A;  2X48 A;  3ASN H;  2ZME A;  4DL5 A;  1B72 B;  4EJW A;  3M4O J;  3U55 A;  3MR6 A;  2X1D A;  2KRF A;  2ZME B;  3HPH A;  4CH7 A;  4BHP A;  5IYZ F;  5J3L A;  2CQY A;  2BOL A;  2MC3 A;  2E1O A;  1O7L A;  5KT5 A;  3C7J A;  3KP5 A;  2J6U A;  2DT5 A;  1QO0 D;  2FX0 A;  2LLK A;  3T0Y A;  5JVD F;  3BQ1 A;  3HOX G;  4ECX A;  1ZG1 A;  2L9N A;  2H8W A;  4G3I A;  1B9M A;  4ITV A;  3ZQG A;  2R8H A;  4AID A;  2ZJR F;  2OAZ A;  1FYL A;  2R92 G;  4MLO A;  2E34 A;  5B1B H;  4QIW N;  4H4K C;  4HF0 A;  5CAE B;  4YY3 H;  5J47 A;  1X19 A;  1JJ8 C;  3H3Z A;  3QU6 A;  2L54 A;  2YL2 A;  2QKM B;  3ABM H;  4G8X A;  4A2A A;  4IRC A;  2K40 A;  1UB9 A;  3L9F A;  4A6E A;  2A61 A;  4XLA A;  2PLY A;  1ZHS A;  2VE9 A;  1XNQ H;  3QPS A;  2P7C B;  2LKS A;  3CTA A;  1GUU A;  4A3K G;  5D6E A;  1MBJ A;  4LLL A;  2FMY A;  2ZBK A;  1O75 A;  4OWR B;  3S1R J;  1HST A;  5HDG A;  2JSC A;  3R0A A;  5IYC J;  5C3E J;  2V9P A;  4WXH A;  4A69 C;  1VBH A;  4FX0 A;  2NVT J;  3GTL J;  4QWA A;  3PFY A;  3GTJ J;  1DGR M;  3GTP A;  3OOU A;  1D1A A;  4IF4 A;  4RGU A;  2F4M B;  2A05 A;  2ELJ A;  3BT9 A;  4ZYD A;  4D7N A;  4F50 A;  2MGQ A;  4FE2 A;  3ZQI A;  1U5T C;  3DBL B;  4PK4 A;  2CUF A;  2X1E A;  4NUB A;  3Q9S A;  3JTG A;  1BI2 A;  2ACJ A;  4HEA 2;  5JI6 A;  1U8R A;  1BIA A;  1T98 A;  3FDY A;  4CMF A;  3D5R C;  1VBG A;  1E4G T;  4UCU A;  3MR2 A;  1BNC A;  3PIO F;  1B4A A;  2YWV A;  5EG0 B;  2WE6 A;  2AQ4 A;  5GPC A;  5IPA A;  2ZO4 A;  1XPX A;  1MKM A;  4ENJ A;  1ZQ7 A;  3T5J A;  1A5J A;  3CZ6 A;  2MLG A;  3CO7 C;  3HOZ G;  1SFO A;  3H5N A;  1T0F A;  5F9L A;  1I6X A;  3GTG J;  1OKR A;  2CNV A;  2DOE A;  2YZL A;  4LB6 B;  2WB1 A;  2DA7 A;  5JQW A;  1UMQ A;  2CW7 A;  2YS7 A;  2M0C A;  4I98 B;  3GLK A;  2L5Q A;  4JI3 H;  2ID6 A;  2R7D A;  2Z16 A;  1UC8 A;  3JTH A;  1SFU A;  1YRN A;  4KNY A;  4AYB A;  2L7F P;  3M9M B;  1EKV A;  2AHQ A;  4GKK H;  3W2V A;  3DFG A;  4BDZ A;  4Q8F A;  2F5V A;  1J09 A;  4XYL B;  4Y52 J;  1ULZ A;  3GV8 B;  3NC0 B;  2A5Y B;  4DGW B;  4DLK A;  5HLI A;  4BUP A;  5KAI C;  2MFZ A;  5E79 C;  3R61 A;  4UCO A;  2CQ7 A;  3DEE A;  1S7O A;  3KEO A;  3JRE A;  5HNE A;  4XON A;  2ATL A;  2FK3 A;  4Y15 A;  1FNN A;  4DQN A;  1MBH A;  3TDU C;  2HDD A;  2ESH A;  3LWF A;  4M9U A;  5ILV A;  4CCO A;  4L5I A;  4K6N A;  3ONQ A;  2KQR A;  4ZOL F;  2JA7 J;  3W2W A;  5JLW A;  3T54 A;  2GQR A;  3F8C A;  3KEQ A;  4ZHQ F;  1A35 A;  1KU7 A;  3CF2 A;  3LQR A;  4UB8 C;  1MD0 A;  1QZY A;  5DCM A;  4ZZL A;  1JDE A;  3SE7 A;  1Z91 A;  3B6A A;  1IO2 A;  2DK5 A;  4LGW A;  2P5K A;  4LOC A;  2R7L A;  1ZR4 A;  3IRR A;  2JZY A;  3DPT A;  2EZK A;  4PJ0 C;  5FRO A;  4XRM A;  1K79 A;  1FTZ A;  1WGX A;  3TIN A;  2R7Z A;  5KFN A;  3CMY A;  2HOT A;  1BR4 A;  5T14 A;  2CU7 A;  1FY7 A;  2WB1 N;  1PUF B;  4A6D A;  2EIJ H;  2E19 A;  1V51 A;  4ED6 A;  2ALZ A;  1XGO A;  2GLO A;  3DTF A;  2RQP A;  1O3S A;  4M7E A;  5LMN H;  2GA1 A;  3KYD B;  2OWO A;  3MD2 A;  5L1L A;  4C2U A;  2YZM A;  3SYT A;  5BWT A;  3AG1 H;  2C2R A;  3DCF A;  3GCM A;  4A3G J;  2YSR A;  1W96 A;  3H36 A;  3QOE A;  2WWY A;  2XSD C;  1IOW A;  1VF9 A;  1PJR A;  3EUK L;  3NUA A;  1TQP A;  1ON1 A;  3CLQ A;  3KLO A;  1RK5 A;  1S8N A;  5FD6 A;  5CPR B;  5KFT A;  4O4I F;  3ELK A;  5KG2 A;  1V5G A;  1WCM J;  1S72 I;  4AVP A;  1PX2 A;  2ZDG A;  1SAN A;  3GXO A;  2EFQ A;  3L2P A;  4QJF A;  4LFU A;  3HOT A;  4HPQ A;  3JRX A;  3ORR A;  5EEA A;  5FKK A;  4EJT A;  2IS6 A;  2V58 A;  2WB1 E;  2YCH A;  2K86 A;  5IYB G;  4RNM A;  4UY8 I;  3CQZ A;  2IGM A;  1G3W A;  1IRF A;  4Q4Z F;  3DTG A;  2LBF A;  5FLM G;  3OYH A;  2PMZ N;  2HYJ A;  3ESW B;  3KIO A;  3S2D J;  3WGI A;  2YW2 A;  1QGP A;  2B63 J;  3LSI A;  2JVG A;  2BQ3 A;  1MSF C;  4OMZ A;  3CDL A;  4M6Y A;  3VEP A;  4AIK A;  1W0T A;  3JRB A;  2G7H A;  1F43 A;  2C28 A;  3P9K A;  4A2B A;  5J4V A;  2Y0S E;  2D2W A;  3AAF A;  2CFO A;  3DQV C;  3HRM A;  3IAM 2;  1IXR C;  1WJD A;  1X1A A;  4L9J A;  2GIZ A;  4LG3 A;  5KT2 A;  2M4G A;  2TCT A;  2LFB A;  4MGR A;  4Q45 A;  4FE4 A;  2PX9 A;  1Q1V A;  1RZ4 A;  2DCE A;  3L2C A;  1UAA A;  1D8J A;  3E5N A;  2DMU A;  1R58 A;  5D5X B;  5EZY F;  2QZ8 A;  1S5L C;  4B43 A;  1I3Q J;  3MZH A;  3HOX J;  2HTS A;  4AIJ A;  4PZJ A;  2DAO A;  2RGV A;  3CC4 I;  4PZ8 A;  3KXY T;  2FK2 A;  2EA2 A;  4LIT A;  1DV2 A;  3T5L A;  3CCY A;  4ESB A;  5C3E G;  1QVT A;  3DBR B;  3PM1 A;  5HV6 A;  4DR7 H;  4CCK A;  4EJO A;  1P6R A;  3SJM A;  2WV1 A;  2PJR A;  3FIW A;  4F4X A;  5DMX A;  1STZ A;  3ORQ A;  2KIS A;  1X1C A;  3I5U A;  4PDK A;  1WH2 A;  4XYM B;  3CES A;  3HXL A;  4DZP A;  1S9F A;  2W8K A;  3KAK A;  5FLV A;  2L3D A;  4EVI A;  4UVB A;  4AYB N;  4YFX F;  5GP9 A;  3PVX A;  1A48 A;  4QIW E;  5L3F A;  2PMZ A;  5F0H A;  3RB0 A;  2V79 A;  3HIF A;  3RKX A;  4CO8 A;  4A93 G;  3F8M A;  2NOJ B;  3GX4 X;  1RUN A;  2H1L A;  1D5V A;  5DM6 F;  3GTM A;  3WWI A;  2IGK A;  1N75 A;  1ZHF A;  4EJU A;  1YW8 A;  1NG7 A;  2ZC2 A;  3HOW J;  3R23 A;  2DPI A;  1UG0 A;  3AL0 C;  1ZG3 A;  1SYX B;  1T0F C;  3N40 P;  1AKH B;  4ENM A;  3QFF A;  4GXO A;  3BAB A;  3FXM A;  5J6X A;  3T1H H;  4MIM A;  1Y1V J;  3HM5 A;  3CP2 A;  2EJR A;  1FIP A;  2M34 A;  3FKJ A;  4XSX F;  2FA5 A;  3T9E A;  5CA0 F;  2DQR A;  4P9U A;  4IRI A;  1T39 A;  4JP0 A;  3CJN A;  4FT8 A;  4C3J J;  1EH8 A;  4BYY A;  2XF5 A;  2Z1D A;  3PO2 J;  3KYC B;  2LKX A;  1U8B A;  3VA7 A;  4DR1 H;  2E5L H;  4ED7 A;  4XNF A;  3SI8 A;  3DPU A;  3N4M A;  3NGD A;  2E7X A;  3U0G A;  5I60 A;  1BGW A;  1EV7 A;  5I5X A;  4Q5S F;  4QSH A;  3P5J A;  1WHU A;  2COB A;  4II2 A;  4D5F A;  2XB5 A;  5CM0 A;  4IR9 A;  2EFN A;  5DD4 A;  4J9P A;  5EWG A;  1BI0 A;  3FZV A;  1A9X A;  1X3Z B;  3KYL A;  2FOW A;  3L00 A;  5ERI A;  3OIQ A;  5HOD A;  3RZD J;  4HST A;  2DK8 A;  4ESF A;  1FEX A;  1N48 A;  2LP0 A;  4IEJ A;  4FAS D;  4L1K A;  4A3I J;  3WG7 H;  4G6T B;  3Q5F A;  3K3P A;  3LSJ A;  4NZN A;  1JTX A;  4B47 A;  3I4M G;  2KT0 A;  1WRJ A;  4M6X A;  3ZMZ A;  2IPQ X;  2E2H J;  4EGY A;  5IP9 G;  2IS4 A;  2FNP A;  1FJG H;  1Z05 A;  1X4O A;  3M3Y J;  2VON A;  2Y0S A;  4ED1 A;  3ZMT A;  3K7A J;  5BWU A;  4HRI A;  1T56 A;  1F4K A;  4QWC A;  2R7V A;  5IT3 A;  4DIM A;  1N32 H;  1XMX A;  4BQQ A;  2GM4 A;  5HNF A;  2R92 J;  3LQQ A;  2V6E A;  2MC4 A;  2NVY A;  1Q1H A;  2BZT A;  4PZ6 A;  4MAM A;  3BQ0 A;  1V4Y A;  3BJO A;  1IBK H;  2VL8 A;  2R7O A;  4X64 H;  1I50 J;  2HU9 A;  4E6K G;  5DDG A;  2GPW A;  2ASJ A;  4HF1 A;  1P4X A;  3FXO A;  2B7E A;  2ZGI A;  4O7R A;  4EGZ A;  3BR5 A;  1Y1V G;  1P7J A;  2IGN A;  3OS1 A;  4HX4 A;  5D1O B;  3F6O A;  4ECV A;  2DPU A;  2RNG A;  4JI2 H;  4M3E A;  3HOU J;  3TII A;  5AIQ A;  5EJC A;  1Y56 A;  2Q7D A;  4FFM A;  3H3V K;  2HGC A;  1DGW Y;  4MV1 A;  3PL8 A;  2ME0 A;  2CMP A;  1Y6I A;  2RVC A;  3G3Z A;  2QSH X;  2LH9 A;  1Z3Y A;  2KIQ A;  4BEH B;  2FML A;  1TWC A;  1YS7 A;  4DV2 H;  1XGN A;  4E4T A;  4KIS A;  3PFI A;  2O7O A;  3JRA A;  3DAA A;  2W9A A;  3HOU G;  2LF8 A;  3SDG A;  3S14 J;  2WY7 Q;  1T95 A;  1XSV A;  3NQO A;  2V1N A;  2HVS A;  3AX6 A;  4RUA A;  2KPM A;  4XKB A;  3GTQ J;  4EYH B;  2M45 A;  3HOV J;  4CC5 A;  2UUZ A;  3BAC A;  3LA3 A;  2LYC A;  2H1K A;  4ZYE A;  2YRW A;  3K4K A;  3GEZ A;  1VQ7 I;  4WBN F;  2ZJT A;  1G2W A;  1T08 B;  3GTP J;  2VBZ A;  4WD3 A;  2OC6 A;  1T33 A;  3GZ6 A;  3WWH A;  1EKE A;  2VOO A;  1G4D A;  2O0Y A;  3DBH B;  4YG2 F;  3WWJ A;  3PO2 G;  2KDO A;  3IUO A;  1MH4 A;  2UXN A;  3RQ4 A;  4BAC A;  2L9V A;  2DMQ A;  5K5Q A;  2H8R A;  1I3A A;  2IMW P;  2D1V A;  1XNR H;  3DPL C;  2OPT A;  3KLN A;  2R93 G;  3S93 A;  4BGD A;  4KT6 A;  2JA2 A;  4QIW A;  1JKJ B;  5IY5 H;  3F8F A;  5ICG A;  3K9T A;  4J9K A;  3OYK A;  1TT0 A;  1C30 A;  5DGA A;  3AG3 H;  2XRL A;  3E6M A;  5IP7 J;  2P6S A;  4I4T F;  3L7W A;  2JSP A;  2R7F A;  3G1O A;  1IG7 A;  2STT A;  4UB6 C;  2D5V A;  2RV8 A;  1D0Y A;  3K1P A;  4GO1 A;  3RTR A;  3WOD F;  4FU0 A;  5HDN A;  1UHS A;  3FKI J;  3RI4 A;  4EFE A;  2HQN A;  1A04 A;  2W6P A;  3IHU A;  2Y30 A;  1WKM A;  1TWA A;  5KFA A;  2IVM A;  3ZQ7 A;  4FFO A;  4JK1 X;  1E3P A;  2XPV A;  4I99 C;  4QW8 A;  5GTH C;  4S04 A;  2IRF G;  4IHS A;  3GTO J;  1SMY F;  4CC6 A;  2ZXW H;  5LL6 b;  3H4D A;  4F4W A;  2V1U A;  1IN4 A;  2CUJ A;  4O4L F;  3S32 A;  2WDT A;  4A3E G;  1MDM A;  4HYE A;  1JKO C;  3LST A;  2XAH A;  3E5X A;  3FHN A;  1G3T A;  3DKW A;  1WVR A;  4M3D A;  5K2M A;  4EG0 A;  2XGC A;  1OYI A;  2WTF A;  4FM9 A;  1W7P B;  2Q0O A;  2E71 A;  2LDU A;  3IH4 A;  3Q9V A;  2VBW A;  1GDT A;  4EQQ A;  1W7P A;  3RJP A;  1ZG5 A;  3CCS I;  1ETY A;  4AM3 A;  5LXT F;  2R7Q A;  2HXO A;  3OL3 A;  2VLA A;  2NU6 B;  4IHJ F;  3MJF A;  1VQ9 I;  3ZMS A;  1T38 A;  2W84 A;  3CCL I;  5M5W J;  3D5L A;  1KON A;  4V19 K;  4D0P A;  2GIV A;  3L2V A;  3RB6 A;  2HOS A;  5KFM A;  1VI0 A;  4O7S A;  4DV1 H;  4W1U A;  4XKV A;  1VQP I;  5JVL A;  2DA4 A;  3OYM A;  2QBY A;  4ZI7 F;  3GTM J;  1LFP A;  2CV0 A;  2P6T A;  3I4M J;  5C8Y F;  3HL2 A;  2R0Q C;  4X66 H;  4JOM A;  2R92 A;  1JI8 A;  1T36 A;  2C2D A;  1YYV A;  4APM A;  3LAP A;  3OYB A;  1F5T A;  2AO9 A;  2AXL A;  2CQQ A;  5J2T F;  5E17 F;  2HHF B;  3B73 A;  4E4H A;  4N4O B;  1YIO A;  2L9R A;  5J1U A;  1KJQ A;  1BJA A;  1IW7 F;  3I54 A;  5FPO A;  3N41 B;  5DG9 A;  1ZK8 A;  3PQJ A;  2OQR A;  4FHT A;  1KZH A;  4BXU A;  5JUM A;  1N33 H;  2B0L A;  2E1M B;  1I27 A;  3IAS 2;  3FMQ A;  5BWW A;  3GTL A;  2NS7 A;  3JAM Z;  4XL9 A;  4HX8 A;  4ENK A;  1P7I A;  1R23 A;  4ETS A;  2MCT A;  3KAL A;  4UVC A;  1U0J A;  5CVR A;  3PNV A;  1MSE C;  2EFW A;  3U1K A;  3LSP A;  1ZGA A;  2ZFU A;  3L2Q A;  1ZEL A;  2Y4R A;  3RGX A;  3KRE A;  2DFI A;  2HFH A;  3BG5 A;  5FLM J;  1MNM C;  1I6H J;  2BEO A;  5KG5 A;  2MH9 A;  1G59 A;  1FJL A;  3PR5 B;  3BCA A;  1OLT A;  2JA5 G;  2X9D A;  2GPS A;  3GWZ A;  3CSW A;  2FMA A;  4DYQ A;  5J4Y A;  2CG4 A;  1J59 A;  2E2H A;  3CJT B;  2A1H A;  1HLV A;  1D1C A;  3WU1 B;  2OBP A;  4L5J A;  2B9S A;  5I5Y A;  4NB5 A;  4ZYA A;  3TY5 A;  2BHZ A;  5LD2 C;  4OU0 A;  3KZI C;  1XS9 A;  1SC7 A;  2OA4 A;  3SGI A;  2XUB A;  4IXA A;  3GIP A;  4KIG A;  5D6F A;  3MR5 A;  4HBL A;  4S05 A;  5KFW A;  5EDN A;  4EEQ A;  3BR3 A;  5JQG F;  2CZG A;  2HEO A;  5M5Y J;  4W97 A;  3C2B A;  3RUP A;  2JA5 A;  3H4B A;  1U2W A;  3A2K A;  3QQA A;  2KRC A;  3QWL A;  4RLF A;  2BW3 B;  3VPC A;  4JX4 A;  2FJZ A;  1UZC A;  3M1C A;  4XK4 A;  3SXY A;  2V26 A;  2HOA A;  2EZH A;  3MQ0 A;  3KZY A;  4NC7 A;  2M2E A;  3R9R A;  2WA0 A;  3M07 A;  5TGT A;  2L7M P;  4XIC A;  2V9V A;  2ZJQ F;  4MFD A;  2JJ7 A;  3RKW A;  5FB2 A;  1CKO A;  4CDG A;  4BU2 A;  1OBG A;  2Q2E A;  1M0T A;  1OCR H;  2FSW A;  2V5A A;  3J80 K;  2YX4 A;  3RIZ A;  2AXT C;  1NTC A;  3J7A Y;  5FNV F;  3MWE A;  4QWQ A;  2CS3 A;  5IYB J;  2F48 A;  1PVE A;  1AA7 A;  5BPD A;  4A3F J;  1XX5 A;  1BC7 C;  4JX6 A;  4GLW A;  5K7F A;  2MA3 A;  3QRF F;  1FPQ A;  5IT9 Z;  1SD5 A;  1GLN A;  1JKR C;  5F27 A;  1FBS A;  2PBI A;  3GID A;  2OD5 A;  4BY1 J;  3Q8R B;  1SCU B;  1WI3 A;  3GTK A;  2UZK A;  4HLY A;  3T9D A;  2EK5 A;  2W9C A;  4B48 A;  3S3M A;  2AGO A;  1FMV A;  2R85 A;  1RNL A;  1DPR A;  2UWM A;  1RK6 A;  4RDU A;  1XG1 A;  1VQO I;  2FOK A;  3VNN A;  1Y8Q B;  3GYH X;  4CYC B;  1TC3 C;  4C5C A;  3TMO A;  3OYJ A;  1IDZ A;  4JV1 A;  4HNU A;  4GGG A;  2QQ9 A;  3OS2 A;  4BBS G;  3GF2 A;  1XMK A;  2JTV A;  1K1S A;  2XF7 A;  4RAG A;  5LBQ A;  3G71 I;  1SFK A;  4JI8 H;  5CVU A;  2XAU A;  4HNV A;  5L3E A;  4EGJ A;  1CGP A;  5I5V A;  1FYK A;  2O03 A;  5DUK A;  3WU0 A;  2KIF A;  5HS7 A;  1HKQ A;  4A0Z A;  3RBE A;  1N34 H;  2G7U A;  1EKP A;  1JUS A;  1UJ8 A;  2R5Y A;  1XGS A;  3JR9 A;  1ULY A;  3C2H A;  5KK1 A;  4A2U A;  5F1R A;  4LH6 A;  4J9S A;  2DJI A;  3HUG A;  4XRS G;  3I53 A;  4EM1 A;  3OUZ A;  1P4A A;  2K9M A;  3F3X A;  1TLH B;  3GIL A;  1HR0 H;  2R93 A;  3BRO A;  4GFB A;  3DF8 A;  3F21 A;  5DLG A;  2P7V B;  5FGM A;  3HDD A;  1R4M B;  1S0N A;  3L2R A;  1MZB A;  3CP8 A;  1XDU A;  2VQG A;  4PWQ A;  2KJB A;  4DL3 A;  2A5W A;  3UNG C;  1HNZ H;  2MD5 A;  3GTG A;  1X4P A;  2VKV A;  4D9J A;  2DA1 A;  2LF7 A;  5LHI A;  1HKS A;  1E0E A;  3SZP A;  4BH9 A;  4XZ3 B;  1VAJ A;  2C22 A;  3BDD A;  1IN7 A;  5C4X G;  4TUY F;  2H6C A;  3HKZ E;  2PMU A;  4YII A;  2M8G X;  4Y17 A;  3CF5 F;  3L2U A;  3RGZ A;  2MBF A;  1TWA J;  2Q2E B;  1EF4 A;  1MMG A;  3HSE A;  3RQI A;  3SFZ A;  2D1H A;  2DIK A;  5C1P A;  5DQH A;  3WO0 A;  2KZV A;  5KFP A;  2K9Q A;  4UV9 A;  4DBR A;  2FF4 A;  2E35 A;  4S0H B;  2GLT A;  4CZZ A;  3QQM A;  5KFK A;  5HLH A;  1X2M A;  3V4G A;  2O8K A;  4ED3 A;  1REP C;  1I5Z A;  3IL2 A;  4LIU A;  3GIM A;  2DA5 A;  3BY6 A;  3BWG A;  3J7A O;  3T9F A;  4HX7 A;  3ZQQ A;  1D5Y A;  1VND A;  2HHH H;  1PUE E;  3KP2 A;  5KFJ A;  4EBD A;  4NQW A;  3NAU A;  4O4H F;  2DA3 A;  5F08 A;  1WJB A;  1O3T A;  1H9G A;  1QZZ A;  1JIH A;  1N36 H;  1JT0 A;  2W9B B;  1HW5 A;  1Y0U A;  4M3F A;  1TWF J;  2R7Z G;  2DYS H;  5HOO A;  2FJ1 A;  5IWA H;  2LKP A;  1AUV A;  2L2O A;  2RC4 A;  2ISY A;  2BVL A;  1EUC B;  5ICF A;  4UCS A;  2RDI A;  2BXZ A;  4CCJ A;  4UV8 A;  1FTT A;  2M4K A;  1I2K A;  3SNO A;  2CQX A;  4BL0 B;  4P96 A;  4OIN F;  5K7Z A;  1G2H A;  1DV1 A;  1AN7 A;  2W7O A;  4NXM H;  3E7L A;  3AKZ A;  5L1I A;  2AQE A;  5CA1 F;  1HBX G;  2FD5 A;  3V6K A;  4O6J A;  2JEF A;  1IN8 A;  1RUO A;  3BA8 A;  4PZ7 A;  1WR2 A;  4DUZ H;  2R5Z A;  1IC8 A;  5KFB A;  2UXD H;  4IRH A;  1S7A A;  2OZU A;  1UFM A;  3KPH A;  5TIS C;  1BW5 A;  1BBY A;  4UCT A;  4OIO F;  3V4S A;  4XSZ F;  1R00 A;  1ZLJ A;  2EV0 A;  3NWT A;  3R5X A;  2JUC A;  1NK2 P;  5DAA A;  2WY8 Q;  3HHH A;  2K7L A;  3T9A A;  2GOM A;  5DCM B;  1YO5 C;  1FOX A;  1DGS A;  2NVX J;  2V1X A;  2K5C A;  4QPQ A;  1ZN2 A;  3OMY A;  2A68 F;  5D1P A;  2LTP A;  1W4M A;  1FBU A;  1V54 H;  3U9G A;  2Z33 A;  1K6O A;  2J6T A;  1XDS A;  3PNY A;  3S1Q J;  1K1Q A;  2BQR A;  3K6G A;  3CQZ J;  3MZY A;  3Q8S B;  3CUQ B;  2VOD A;  5CYV A;  3LSH A;  3AG2 H;  1EZ1 A;  1A0I A;  3Q8P B;  2WAD A;  5F6F A;  1YJN I;  1TP4 A;  3ETH A;  5EGO A;  2Q2T A;  2DT7 B;  2ZXH A;  1ETO A;  1OBD A;  4CYD A;  2M3A A;  2HNH A;  3FIS A;  3R60 A;  3A02 A;  2Z04 A;  1WH7 A;  1K78 B;  2W24 A;  2C00 A;  2A07 F;  4OAZ A;  4PUS A;  2QBY B;  2KL4 A;  3E5U A;  1O3R A;  1HCR A;  1O7F A;  2VT3 A;  2DPD A;  1W93 A;  2KFD A;  1HDP A;  5DCF A;  2BBY A;  2QQA A;  3HSR A;  5KVR A;  3UR3 C;  3C0F B;  4E7Z A;  2E1M C;  1BL0 A;  3L1P A;  2YX7 A;  1VQ4 I;  2JVH A;  3LFU A;  4WHX A;  3CDI A;  4MFE A;  5H6R A;  2B63 A;  3Q0V A;  1XGM A;  1K4T A;  3T5H A;  1EH7 A;  1OR7 A;  2M8E A;  3JCU C;  3PIP F;  2VUM G;  5J8C A;  1ZQ3 P;  3LA2 A;  4ZQI A;  2XSJ C;  3RPU A;  2UVR A;  4RAY A;  5EF6 A;  6PAX A;  1HXD A;  4XID A;  4LFB H;  5EEG A;  1Z0X A;  5LA6 F;  3TP0 A;  3CCQ I;  2COI A;  4QWD A;  2JA7 G;  1HSJ A;  1MBE A;  2HVR A;  2AU0 A;  1Y1W J;  4AYB E;  1BIB A;  2QSF X;  1B33 N;  2QWW A;  5L3C A;  2E2I J;  3WO1 A;  4DR3 H;  1IUF A;  4ZDO A;  1IYE A;  1GHC A;  5F9N A;  2HZD A;  1MJ9 A;  4CIC A;  5J1Y A;  3ISP A;  5C5J A;  1Z7L A;  3WGH A;  3S8P A;  3ZQL A;  2LRD A;  3OYD A;  3BR6 A;  4C3I J;  4A3B J;  1N56 A;  3RFC A;  4FGR A;  1S10 A;  1MGT A;  2XKP A;  1Z6T A;  4ASN A;  1F9N A;  4R8U A;  4G7O F;  4BEH A;  4RMN A;  3H0D A;  3WHB A;  2VUG A;  3JRF A;  1KQ0 A;  4TM5 A;  3FBN B;  1BOA A;  4IOA F;  1I1G A;  2CGP A;  2RDP A;  3RAX A;  5CVV A;  3DKX A;  1ZRE A;  1KA8 A;  5EZH A;  5KFV A;  1TNT A;  4KDP A;  3V8J A;  4NXN H;  3I64 A;  1K78 A;  3UZO A;  3PW4 A;  5DV5 A;  1D0X A;  1Z67 A;  3A01 B;  3IWZ A;  3PO3 J;  1I1S A;  2GBY A;  1KT8 A;  2ESN A;  3JRW A;  4EM0 B;  4JI1 H;  1PYV A;  2CW0 F;  3FMS A;  5CVI A;  2HHF A;  1KTA A;  1B59 A;  4AVZ A;  1RIO H;  1CKN A;  2UXB H;  1OFC X;  4XRS A;  1ZTR A;  2JT1 A;  3IKV A;  4MTD A;  1HOM A;  4KMU X;  2VI6 A;  1W0U A;  2CWE A;  3TW6 A;  4HG2 A;  2I5U A;  4Y8V B;  3P9C A;  4XLC A;  4KN4 X;  2M7B A;  2NRA C;  2PN6 A;  4V2G A;  2CW8 A;  1AOY A;  4O3O A;  4ECQ A;  4JV0 A;  4O81 A;  4Q47 A;  3KHL A;  3M8J A;  5ICC A;  4RZQ A;  1PP8 F;  2ELK A;  1U9N A;  3GFL A;  5TJJ A;  3IH3 A;  1A36 A;  4ANJ A;  3V6J A;  1FLI A;  2YU3 A;  1UCR A;  2XCP A;  3S15 J;  1R71 A;  2WC2 A;  1JTY A;  3S2W A;  1TA8 A;  3PR4 A;  1E3H A;  3ETJ A;  3KHG A;  2ZFW A;  3KEY A;  2V59 A;  1Y8R B;  4JBA A;  1LDD A;  2LY1 A;  3S3O A;  2V4Q A;  1P16 A;  3DTK A;  3OSF A;  5CR5 A;  4LF7 H;  1UST A;  4O7L A;  3GV5 B;  3AFH A;  1C3O A;  4O84 A;  2XC9 A;  1CKM A;  3N42 B;  2ADU A;  4Q0Y A;  1EH6 A;  2R7K A;  5EG0 A;  2ZXJ A;  3HRU A;  1R9T A;  3H5A A;  3LOC A;  2A6E F;  3RKY A;  4JV5 H;  2FPG B;  5EGO B;  4R8U B;  4F91 B;  2XCL A;  2I10 A;  1AWC A;  5HS9 A;  3GFM A;  3VYS B;  5D5V B;  2VQH A;  1KQ8 A;  2FPI B;  4AWX B;  3EUH A;  1BXR A;  4RNN A;  1R1V A;  4HOB A;  3CVZ A;  4U88 A;  1R5I D;  2CNU A;  1VZ0 A;  4XKC A;  2LNB A;  4JI4 H;  2M30 A;  3OYE A;  2EPF A;  2COJ A;  3TIG A;  1KQ9 A;  2ZNZ A;  4IWX A;  4LB5 A;  4A5M A;  3KTM A;  2YR2 A;  2FBI A;  4Y13 A;  4IHT A;  1TWF A;  3FXR A;  3V8L A;  1FP2 A;  1TZL A;  4K2E A;  5D8K B;  2R7M A;  1ETW A;  1TNS A;  4DNC A;  3OYG A;  3WTT C;  5BR8 H;  1LVK A;  4BY1 G;  2PI0 A;  1T94 A;  3H40 A;  1J5E H;  5B5E C;  4HR7 A;  1F1Z A;  3W6K B;  4E7K A;  3VDX A;  4A3D G;  3GII A;  3M9N B;  4ZJZ A;  1V3F A;  1U6G A;  3RAQ A;  4A3J J;  4RNO A;  5KG1 A;  4DR2 H;  4CCM A;  2OCC H;  1WJC A;  2R3S A;  3QP6 A;  3M7G A;  1HDD C;  4ZDL A;  2WV0 A;  4IQ4 A;  1TWG A;  5KFO A;  2Y69 H;  2LRE A;  4EV0 A;  4IHY A;  1QVU A;  3F72 A;  2OTJ I;  4HNT A;  2OLS A;  3GME A;  4ENN A;  4F4Z A;  2BV6 A;  4EGQ A;  2X0S A;  3BG9 A;  1YFH A;  4KMF A;  3J81 Z;  1ET0 A;  1YW7 A;  2HDW A;  3KET A;  2EFO A;  3TBI A;  3DLL F;  4IHX A;  3BG6 A;  2W6O A;  5GPA A;  3BTC A;  5D8D A;  5EOY A;  3BJA A;  4O7V A;  3Q0U A;  4XOP A;  5F1J A;  3L4J A;  5AIP A;  1HF0 A;  2COM A;  1A6I A;  1ZAO A;  3ROU A;  2GOX B;  3K1M A;  2R7W A;  4U6P A;  3FXQ A;  4JX5 A;  4ZTF A;  5D4S A;  2X0L A;  1BR1 A;  2W6M A;  4MQ9 F;  4C2M J;  4OIR F;  4DYC A;  5HNH A;  2M7A A;  4IQJ A;  1ZRD A;  2HYF A;  4M72 A;  3JSP A;  2DFF A;  4XLN F;  4C5B A;  3P7N A;  3HGG A;  2DOF A;  3H5R A;  3UZB A;  1EYZ A;  1LNW A;  5JVT A;  2ME6 A;  2DFE A;  1J7K A;  4TVI A;  2VQC A;  1U5T A;  4MNU A;  5E3O A;  4KJZ A;  2JEI A;  3EUA A;  1F36 A;  4LG0 A;  2HJW A;  2W8L A;  1LJ9 A;  1M1E B;  4O83 A;  5LYJ F;  2I87 A;  3Q2O A;  2X85 A;  1VQL I;  2DXI A;  3S2H J;  2NS8 A;  3WG9 A;  2IP4 A;  1FIA A;  4U0V A;  2PJR B;  1JKP C;  3H20 A;  1Z7U A;  4XOR A;  3RR5 A;  2W9B A;  4I50 F;  5K5O A;  3M8F A;  1H9T A;  2GWR A;  3WTV C;  2NXN B;  1X1D A;  5CB4 F;  3A1Y A;  4L0Z B;  4F52 A;  1RET A;  4DV0 H;  1WI9 A;  2VJ4 A;  3Q8Q B;  3EQL F;  5FJ8 G;  4FX4 A;  2YS6 A;  4UCR A;  2DWC A;  1GO3 E;  4PJM A;  4CHI A;  2OJE D;  2XKO A;  1UNN C;  1JT6 A;  3J7Z I;  5LRR A;  3JSN A;  2EIK H;  3RYP A;  4EJV A;  1LQ1 A;  4NYE A;  4RGX A;  5KFQ A;  4RM3 A;  4RB1 A;  4A3L J;  4GC7 A;  1CF7 A;  3ZQH A;  4YP3 A;  3QYB A;  2J5O A;  3R4K A;  3VSL A;  4NBQ A;  5LHH A;  1LE8 B;  2R82 A;  5DTD A;  5KHD A;  3J81 K;  3COA C;  2EIY A;  1SFE A;  1B6A A;  2C6Y A;  2STW A;  2O5R A;  4O3N A;  5FLX K;  2ISZ A;  2XDV A;  1UEL B;  1G3S A;  2IAI A;  2P8T A;  4NDL A;  5L3D A;  2ZDH A;  4CKC A;  3RZO J;  2RRE A;  3QZ8 A;  2AGQ A;  4IOC F;  3X2Q H;  3PSI A;  4M9S A;  4UXN A;  2R86 A;  2VKD A;  4TQS A;  2CQK A;  3SFI A;  5HLT A;  5BYA A;  4ED2 A;  2XAJ A;  3TW7 A;  2Z9O A;  5L1K A;  3H9Q A;  2HIX A;  4LK1 F;  2KIU A;  2DMT A;  3E6C C;  3GO5 A;  1U9O A;  4TV9 F;  2JPB A;  2UVV A;  2UXX A;  4B44 A;  4PBC A;  2EIN H;  3VOT A;  1R5H A;  3MVP A;  1USS A;  4FS1 A;  3K69 A;  4F55 A;  1X3U A;  4IHV A;  4I2O A;  2DYR H;  3HUG B;  4JQF A;  3REO A;  3V7R A;  2XV4 S;  3EET A;  3HOV G;  2OTL I;  3RKQ A;  3I4N J;  2VC1 A;  2Y9Y A;  4MEY F;  3DEU A;  4PFO A;  2IJL A;  3B02 A;  1RR7 A;  2LMD A;  3JAM K;  3CCE I;  4L0Y B;  1Z2P X;  4N4N B;  4IVN A;  2P0A A;  3HZJ A;  1HQC A;  3ABK H;  4GLX A;  1KU3 A;  2E1N A;  2HI3 A;  4IPA A;  3PSF A;  1U78 A;  4FFR A;  2ZM6 H;  1XSD A;  2K9N A;  1LE8 A;  4PJN A;  5LMU H;  4ECS A;  4WXC A;  4CYC A;  4IX7 A;  1QA6 A;  3ERE D;  4KN7 X;  3FBI B;  4B3S H;  2MYS A;  3DU5 A;  1KGS A;  2YU9 A;  3T8T A;  4B3A A;  4EM2 A;  2RNJ A;  5GAE J;  5E3N A;  1Y0N A;  4R7R A;  4PDB A;  1V4R A;  1R36 A;  3W1B A;  5LGT A;  2VXZ A;  2X6Y A;  2CFM A;  4RAZ A;  3GW2 A;  1MIJ A;  2IA1 A;  4UUS B;  2L7Z A;  2JA7 A;  2FUG 2;  2QYO A;  1WQ2 A;  2JA8 G;  3HTU A;  2NNY A;  3BR0 A;  2M5W A;  2HZT A;  2QYZ A;  2LR8 A;  5F0F A;  5DQI A;  4ED8 A;  3ULQ B;  1W5S A;  4JI0 H;  1VTN C;  5E18 F;  3LUL A;  4G9Y A;  5IYC G;  1LDJ A;  4I01 A;  5ED4 A;  1WFX A;  1QQI A;  1WJ5 A;  3C1D A;  5HDK A;  1B8I A;  3JZF A;  1LVA A;  2K9L A;  2Z2S B;  2MLK A;  1XK5 A;  2R8I A;  3OYL A;  1KJ9 A;  4A0X A;  4B3X A;  4FE7 A;  1I39 A;  3NRV A;  4WCG A;  4FQG A;  3G1M A;  2PVP A;  2UVW A;  2JRM A;  5E8G A;  2Q8K A;  3GIJ A;  4EAT A;  2QA4 I;  1E4F T;  1QHG A;  2L9S A;  2KJC A;  2LG4 A;  4I7H A;  1ZKG A;  3FM3 A;  1V9P A;  4BWS C;  2M1B A;  3I71 A;  2YYA A;  4J19 A;  3LSM A;  5J40 A;  1KC7 A;  2R4G A;  4A3B G;  2JA6 J;  2VA2 A;  5E8I A;  3HOY G;  2IP2 A;  1X1P A;  2ZSI B;  1RC9 A;  4JYK A;  1K4S A;  1ZH5 A;  5BPF A;  1OWT A;  2KLO A;  1YOV B;  4V2F A;  2IA0 A;  3OS0 A;  2HQ5 A;  5ILU A;  5I5S A;  2OCE A;  3BZC A;  2BQU A;  1E4E B;  4Y33 A;  3FXJ A;  1KJ8 A;  3ECO A;  3S3N A;  3FHZ A;  4MTE A;  5FPR A;  1RJQ A;  2AGP A;  2BE5 F;  4LSX A;  1TQI A;  2W9C B;  4RS8 A;  2XC7 A;  3JRI A;  3PQK A;  3G8D A;  3TO7 A;  2QKL B;  4XRF A;  2W6Z A;  4XLE A;  1RPW A;  1NH3 A;  1JLL B;  1MBF A;  1OIS A;  1O57 A;  2KIM A;  1SEU A;  5FRN A;  1ODD A;  2ZB9 A;  3K4J A;  5I5T A;  2HPI A;  3K70 C;  2V4R A;  1GLV A;  2Z3Y A;  2R84 A;  5DLF A;  1H89 C;  4M73 A;  2GXG A;  2HKO A;  3OYF A;  4BBR J;  2KRH A;  5F64 A;  3H9J A;  4P5O A;  3V7C A;  2BYV E;  4A3F G;  1K6Y A;  2WTE A;  3W6J B;  2X5R A;  1TBX A;  3IKT A;  3SEQ A;  1YRN B;  4JXU A;  3RB3 A;  3BA9 A;  2KDZ A;  5F0C A;  4DR5 H;  3FX3 A;  4DL2 A;  3HRT A;  4U0Y A;  1A31 A;  1XC5 A;  2GQQ A;  2X6O A;  3S17 J;  2EA4 A;  3TEK A;  4DRF A;  3I58 A;  3TKY A;  1JKQ C;  1JGS A;  5LP6 F;  2L0K A;  2G9W A;  2SCU B;  5KT4 A;  4XMY A;  1KU2 A;  2LBF B;  4EQ5 A;  5J1R A;  4FCY A;  4PGH A;  3GUD A;  2BR0 A;  5C4X J;  1SFO J;  1RKW A;  4BBS J;  5FKL A;  1KYW A;  2C2E A;  4DL6 A;  2XAG A;  3HC7 A;  1I7L A;  1XCB A;  3KHR A;  1GVJ A;  4HA8 A;  4IR1 A;  5H20 A;  4HDV A;  1GV5 A;  3FXL A;  2E60 A;  1B9N A;  1PK8 A;  4M3B A;  1T8I A;  2L4A A;  4U7B A;  4QWB A;  5LFA A;  2R93 J;  4LIV A;  2BGC A;  5DGI A;  3Q1K A;  2DA6 A;  4BJT A;  2W6N A;  4DV6 H;  5BWR A;  1YQA A;  2X51 A;  3K10 A;  1ZHQ A;  1DQU A;  1JX4 A;  3VPR A;  4O4J F;  5E3L A;  1Y1W G;  4WK8 F;  3WTX C;  2KHM A;  3I12 A;  5C44 G;  3M1E A;  4M9Z A;  2EJ3 A;  3BTL A;  3SHF A;  2UV1 A;  4QW9 A;  3E6D A;  1OQY A;  3RB4 A;  2YS9 A;  1LEA A;  3TO6 A;  4BS9 A;  5BMZ A;  2EZL A;  3S1M J;  1PDN C;  4E7L A;  1ZGW A;  1N25 A;  4O5V A;  3F8B A;  4RLQ A;  4HYK A;  4K0K H;  3LSG A;  1LPQ A;  1ZGJ A;  4JUZ A;  4DOZ A;  1RYR A;  1LDK B;  3CEB A;  3FK7 A;  1BW6 A;  3IWF A;  5KFY A;  2W4S A;  2HGX A;  2K4J A;  1T6S A;  2PN1 A;  4G94 A;  4G7Z F;  2I80 A;  3MFK A;  5EWE A;  3OUU A;  2XCA A;  1L2Z A;  3GVA A;  1IXC A;  2LOO A;  4KIF A;  1J0R A;  4A3C J;  4UVA A;  3MKZ A;  5KS8 A;  5KCM A;  1APL C;  4M6V A;  1X1B A;  3KP3 A;  5BNG A;  5JFR A;  3I9V 2;  2K3F A;  3OYC A;  3TGN A;  5FO5 A;  3ZQF A;  4ECW A;  2UUC H;  1Z9C A;  5KFH A;  2NS0 A;  2L02 A;  2CH0 A;  4Q43 A;  4J9M A;  5EZG A;  1GXP A;  2XGD A;  4BQA A;  1ERD A;  1K83 A;  3ZRG A;  3OYI A;  4DUY H;  1MJA A;  3F6V A;  2ABJ A;  1MMA A;  3A0B C;  3QOD A;  5KG0 A;  4NZM A;  4I0B A;  3EPI A;  3V6H A;  3GV7 B;  3H35 A;  1IBL H;  2MAB A;  2VUM J;  4RCN A;  2BHY A;  1GYF A;  1JJ6 C;  4GYG A;  3OSG A;  3JRC A;  4R79 A;  2O6G E;  2OV7 A;  2MW8 A;  1XB4 A;  3I4P A;  3RDI A;  3SQN A;  4I55 F;  1YTY A;  2CV2 A;  1OPC A;  4MA5 A;  3RV4 A;  2FK1 A;  3CCM I;  4FS2 A;  3BJY A;  3BP8 A;  1RYS A;  5KFE A;  2VKH A;  4UHT A;  5KAF C;  1IAW A;  4HAM A;  1ETX A;  2NVY J;  1R5G A;  4IJA A;  4DJA A;  4OIQ F;  5E25 A;  1GXQ A;  2DBB A;  5HVQ C;  1SD6 A;  2UUA H;  3D1N I;  3LSK A;  2WAQ E;  4MV8 A;  1POG A;  1FBQ A;  4UUT A;  1BOB A;  2ECC A;  2QEN A;  1LB2 A;  1KJJ A;  1JXL A;  3QPH A;  2J6S A;  3O3K A;  3TED A;  2OUM A;  3SEZ A;  5IYD G;  4RAF A;  2NVX A;  3WE2 A;  4H0E A;  2DDA A;  3SZT A;  4BHB A;  3F8N A;  3CJQ B;  3Q0W A;  5GTI C;  1ETK A;  3HEF A;  1L3L A;  2DFH A;  1ACI A;  2BY3 A;  3HOZ J;  4BXX G;  4GC6 A;  1JGG A;  1FWZ A;  2P4W A;  3UFX B;  1DU6 A;  4BE0 A;  2FLP A;  4JYA H;  3RPQ A;  2B63 G;  2X6X A;  1WPK A;  4A5N A;  4KFC A;  3IN5 A;  1K61 A;  1S7E A;  4A12 A;  1BM9 A;  1WJA A;  3F23 A;  2VOB A;  2IA6 A;  2Y75 A;  3MN2 A;  4KUM A;  4I0A A;  4Q44 A;  3LA7 A;  3LL7 A;  3W5O A;  1S3J A;  3RV3 A;  3ZPL A;  1S68 A;  3T9B A;  5E20 A;  4BE1 A;  2LY9 A;  3S24 A;  4ON0 A;  2R87 A;  3T7A A;  5IT9 W;  1BR2 A;  2XB0 X;  4CSW A;  1HNX H;  3GIK A;  4EBE A;  4MV7 A;  4N9H A;  3V8K A;  4Q8E A;  4O86 A;  2NNN A;  5BOX A;  2IS1 A;  5DIS C;  4X65 H;  1J9I A;  5L1J A;  2EQR A;  4PGG A;  5FD5 A;  3H92 A;  2ZSH B;  3R6S A;  5JVG F;  5IP6 A;  3OSP A;  4DL7 A;  2PFB A;  2YPR A;  4Y4R A;  2GZW A;  2J9G A;  2LVS A;  4MA0 A;  2VPS A;  3FM5 A;  2RAE A;  3FK6 A;  1D3Y A;  2LY2 A;  5BS6 A;  2ID3 A;  2EJ0 A;  4B3R H;  4MEX F;  4YAK B;  1SD7 A;  4I6Z A;  4DR6 H;  4ABZ A;  2HS5 A;  4HF2 A;  2RDJ A;  1B1B A;  1GSO A;  2M87 A;  4L9N A;  5KFC A;  2P81 A;  2GAU A;  2A69 F;  1QRY A;  3HG9 A;  1B04 A;  1I1L A;  4L9V A;  4GCV A;  5K5R A;  3EYI A;  4CA0 A;  4Z6Y A;  4HV6 A;  5A2Q Z;  4J00 A;  1HC8 A;  2TRT A;  1CE8 A;  2VXD A;  3ERM A;  3VMM A;  3MFI A;  1W5C C;  2DLL A;  5DGH A;  2HR3 A;  3FKI G;  1MBK A;  1U5T B;  3I0T A;  1VFC A;  2V4J C;  1BA5 A;  1TL8 A;  2XGP A;  5KG6 A;  1OMI A;  2Q1Z B;  2ETH A;  5L3G A;  1HA8 A;  3G6V A;  1JUM A;  5IP7 G;  3BQ2 A;  4RGR A;  3ABU A;  3BZK A;  2NOG A;  2O8X A;  4Y3O A;  2JQ7 A;  1FSH A;  4M74 A;  4TV8 F;  1KEE A;  4ED0 A;  2VBY A;  2LK2 A;  2OQG A;  3NWS A;  2UVU A;  1JXS A;  1V5E A;  2GXA A;  2W82 A;  2DJN A;  5B1A H;  1E3O C;  2QSG X;  4NC8 A;  3OYA A;  2VKE A;  1R49 A;  1MND A;  4KIC A;  3HPG A;  5H2F C;  2P0W A;  2MH2 A;  2VBX A;  3GQC A;  3CJR B;  1IJW C;  4F4Y A;  1ORK A;  1JHF A;  1OCC H;  3T1B A;  2VR1 A;  3RCO A;  1LFU P;  3OHA A;  3ZMV A;  1GGO A;  4NNJ A;  2E2I A;  2VA3 A;  3G2B A;  3ABT A;  3CUQ C;  4RBO A;  2R7S A;  4YFK F;  5K1Y A;  5IP9 J;  5F04 A;  3WTZ A;  4O82 A;  2QGU A;  4B8X A;  4X0G A;  1IF1 A;  3QOP A;  2VJJ A;  3U54 A;  2ECB A;  4DL4 A;  1UC9 A;  5DM7 F;  3CCJ I;  4X1E A;  1X2N A;  3KCC A;  4G6D A;  4EFB A;  4YFN F;  3TY9 A;  4IRG A;  1K83 J;  3HSF A;  3N43 B;  2F5C A;  4ZYG A;  3TQT A;  5DYM A;  2EZI A;  2QM3 A;  2E1C A;  3VWB A;  5B3S H;  2UU9 H;  1E4E A;  4L9T A;  4C30 A;  2R8J A;  3KP7 A;  2Z5U A;  5FKM A;  3H9G A;  2DMP A;  2EIM H;  3HBL A;  2RGR A;  2NU7 B;  3DF7 A;  2DA2 A;  1FOK A;  4B3T H;  4YR2 A;  3MWM A;  2IEK A;  1MNE A;  2ZJP F;  2CFX A;  2Y31 A;  2R7U A;  3WE3 A;  5M3M J;  5D5U B;  4B1R A;  4YIF A;  4YRV A;  1JHH A;  4CGZ A;  3G1L A;  2QQB A;  4RB0 A;  5LEK A;  1BN5 A;  2PEX A;  4L5E A;  4RB3 C;  4HV5 A;  2K9S A;  4J01 A;  4DR4 H;  2UUB H;  1QU3 A;  3N05 A;  4LFA H;  2CYY A;  1IXS B;  2W00 A;  1S29 A;  3TDZ C;  1ENH A;  5D8L B;  4JI7 H;  2QB5 A;  2DI3 A;  4OOI A;  3H0G A;  3U9T A;  2RF4 A;  4BXF A;  2CNQ A;  3B6C A;  1J5Y A;  5D4R A;  4L18 B;  4M0J A;  3CMM A;  5D1O A;  2JA6 A;  2WBM A;  1HW2 A;  1Z1D A;  5KFG A;  2YZG A;  3HOW G;  2V7F A;  3IH2 A;  2FE3 A;  3AW8 A;  3PW7 A;  2QK4 A;  3CC7 I;  3DKY A;  3T5X A;  5E1W A;  4EBC A;  2HTJ A;  3K4B A;  2V1D A;  4D7M A;  4E6N A;  1X58 A;  2W85 A;  3C3W A;  5TRD A;  4IAJ A;  5IYD J;  3PUB A;  1EJ9 A;  3M9A A;  4EMS A;  2HXI A;  1I7N A;  2ZDQ A;  3BPX A;  2XAF A;  2DU9 A;  3G6E I;  5KFF A;  2EFP A;  5EYR A;  4O3P A;  3JSL A;  1AHD P;  2HOE A;  2ZKZ A;  1PP7 U;  2DMN A;  3T99 A;  4Q4C A;  2VQL A;  1QZE A;  1EA3 A;  3V42 A;  4DZJ A;  3KHH A;  3WTS C;  2HIV A;  2H27 A;  3ZN1 A;  4J9L A;  3PZP A;  1NK3 P;  2EIL H;  4LJZ F;  3ZOB A;  4IZZ A;  3N97 A;  2JA8 J;  3PUF A;  1R9T J;  1XSX A;  2GQS A;  4PFP A;  1FVI A;  2L7K A;  3DWL E;  4TV7 A;  5LEJ A;  3WGG A;  2IA2 A;  1B8I B;  1QPM A;  2ZJ2 A;  1ITY A;  3MMY B;  3TOB A;  3M8E A;  2D45 A;  4DV7 H;  4G12 A;  2QLZ A;  3BJ6 A;  4UFZ A;  2NUA B;  1YJ9 I;  1U3E M;  1IGN A;  4YEL A;  4IHW A;  2J5P A;  3VOD A;  3BTI A;  3ZXS A;  4KA4 A;  1Z21 A;  2IXS A;  3PN1 A;  4QWE A;  4ZYH A;  1G6N A;  4MV3 A;  1D8K A;  2IS2 A;  1YLF A;  1SVM A;  1GVD A;  4MHG A;  3HYI A;  4WF2 A;  3G6X A;  3FKI A;  1DU0 A;  4D1Q A;  4UNO A;  1LEB A;  2PBZ A;  3KX2 A;  3T9C A;  3CC2 I;  1IOV A;  2IBD A;  1SD4 A;  3A0H C;  3L4K A;  3GFJ A;  4ZZD A;  2VQD A;  3OSN A;  2DQL A;  4O3S A;  2VPR A;  4XLP F;  2QUF A;  3LAJ A;  3LP8 A;  1VQN I;  2VJI A;  2M05 A;  1GSA A;  3I59 B;  1MJB A;  4ECT A;  3GZ5 A;  4LF5 H;  1MH3 A;  1LFB A;  3WHC A;  3FMA A;  1DPU A;  5DGB A;  1I6U A;  4NC6 A;  3LWB A;  3KP6 A;  4DYR A;  2TDX A;  4CZC A;  2QF7 A;  1HKT A;  1A6Q A;  3MAJ A;  1KYZ A;  2BW3 A;  2M0M A;  1MMN A;  3CME I;  3G8C A;  4HZF A;  1RJP A;  3H3V H;  4YHH H;  5FJ8 J;  4DAA A;  2F5D A;  2H6B A;  1ZRF A;  4C3H J;  3HKZ N;  2ZNY A;  3J7Y J;  3K70 D;  3TP3 A;  1IUY A;  3BAA A;  2YUS A;  2FBK A;  2N8G A;  1I94 H;  5BMV F;  2F6C A;  4DIQ A;  4C2T A;  1IV8 A;  3LNQ A;  2R6F A;  1ETV A;  3PFF A;  4OIP F;  2XD4 A;  1UHM A;  1P9Q C;  3ZQC A;  2X4H A;  3CUQ A;  1RJR A;  4DV4 H;  3VYU B;  4N9I A;  3GTJ A;  5JR3 A;  4QLC U;  1WRV A;  2WYO A;  5HLG A;  1R4N B;  5DG7 A;  2FLN A;  4C2M A;  3TQN A;  3ZP5 A;  3QYF A;  3OR1 C;  3F22 A;  5GON F;  3GB8 B;  3IRQ A;  4CMD A;  3IG0 A;  5LRS A;  2DO7 A;  2W48 A;  1YG2 A;  2QCO A;  5CLS A;  4LLG F;  3RTX A;  2EH3 A;  5KG4 A;  1JE8 A;  1P8L A;  4YBZ B;  1IN6 A;  3C18 A;  3VFZ A;  4BDY A;  1IRX A;  1OCO H;  1YHQ I;  4U7C A;  1TQM A;  5H80 A;  2F4V H;  3R5H A;  2R7R A;  2IBK A;  2A6H F;  1KJI A;  3VOE A;  3MCZ A;  4LK0 F;  2W7N A;  5BPI A;  4UCV A;  3GLX A;  4PSW A;  4LH7 A;  2XRN A;  1NG6 A;  1VQ8 I;  5BWV A;  1YX5 A;  5J2U F;  1MMS A;  2WAQ N;  3QPL A;  1QPI A;  4YR3 A;  2ZCW A;  1GV2 A;  4C9Y A;  1S0M A;  2HGW A;  4GDF A;  4LD5 A;  1WZ2 A;  2JPC A;  5KFL A;  3HKZ A;  3JAM W;  2DTZ A;  2R7X A;  4YR0 A;  4E7J A;  2I8C A;  1B6R A;  3L2W A;  3QWU A;  3H0G J;  1ZET A;  2Z99 A;  4RU9 A;  4EYI B;  1P92 A;  5FLX Z;  5FLX W;  2DOA A;  1XN7 A;  1VQK I;  3A01 A;  4HSR A;  1FOY A;  4ECY A;  4LSA A;  2FP4 B;  5DS9 A;  5CKT A;  2JUG A;  4HDU A;  4IIJ F;  5CE8 A;  4LF8 H;  4Q4D A;  3RF2 A;  4KT5 C;  2CKZ B;  2Q2U A;  4F3Q A;  2YU9 J;  1Z2N X;  4B09 A;  3O8H A;  4MQV A;  2PMH A;  4O7Z A;  2OF7 A;  2NVQ J;  3BR1 A;  4P1W A;  2CRG A;  3IV5 A;  3BTJ A;  4O7T A;  1XMO H;  4ECU A;  2PJP A;  2KMU A;  4O3M A;  3BOQ A;  3CDH A;  1BJZ A;  4CCN A;  4J9N A;  3LMM A;  4U7D A;  5K7H A;  4CXF A;  4ZC3 A;  1CQI B;  5BYB A;  4M9X A;  3V4Z A;  1YW9 A;  4I09 A;  2HDK A;  3F9K A;  3GFI A;  4YEJ A;  1GT0 C;  4NZO A;  2VQF H;  2ASD A;  2I8D A;  1IV6 A;  1FC3 A;  2AQF A;  3H3U A;  3S1N J;  2RN7 A;  5D5W B;  1V5F A;  2XPU A;  2VAS A;  2W6Q A;  1SVL A;  1A3G A;  2XIG A;  5EWF A;  4G6Q A;  4P55 A;  5KFX A;  5JHF A;  4IZO A;  2FLL A;  1MMD A;  3QPT A;  3DU6 A;  1X3W B;  2E5N A;  3E97 A;  2R8K A;  3WTW C;  2DN0 A;  2RQQ A;  4E70 A;  1YIT I;  3JZI A;  3MFH A;  1KUT A;  1UG2 A;  2QQ8 A;  4NQW B;  4FTH A;  4HQ6 A;  2VJ5 A;  1I3Q A;  3BQZ A;  3HB9 A;  2C35 B;  3U1D A;  3O8G A;  1S6L A;  1QNT A;  4XOT A;  4XR6 A;  2FXA A;  4ECZ A;  3OYN A;  5EEH A;  4MV9 A;  4HQM A;  4ZTJ A;  4P9F A;  4E7S A;  1Z77 A;  2PMZ E;  2XHK A;  3OWT A;  4RB2 C;  4LMY A;  3ECH A;  3E5Q A;  4M71 A;  5E1X A;  2VT2 A;  1CQJ B;  3U2R A;  4IRD A;  5ICE A;  4E7H A;  3CMA I;  4XKW A;  1K7A A;  2HYG D;  1FMW A;  4A3M G;  3GJX B;  3K4M A;  3MKL A;  1I2L A;  3HHG A;  3SZG A;  4ZH4 F;  3ASO H;  4YIR X;  3VPB A;  2O9L A;  1RRJ A;  2HG8 A;  3W1G A;  2GA2 A;  3I56 I;  4NHJ A;  1XDN A;  3KAJ A;  4RUC A;  5DQG A;  3K2A A;  3VYT B;  1IDY A;  2FU4 A;  1IBM H;  2EWN A;  3FXU A;  1VQ6 I;  3CD6 I;  4A3L G;  1Z3X A;  1P2F A;  1V55 H;  2HKX A;  5M3F J;  3K2Z A;  1R1T A;  4KIB A;  5K3W A;  3ABL H;  4MO7 A;  4RA2 A;  3D0S A;  3AYH B;  1LKX A;  2ASL A;  1FOW A;  1SFX A;  2WAE A;  1CKN B;  4JI6 H;  2W70 A;  1EHI A;  2HQR A;  2LSO A;  4FET A;  2W57 A;  1W1W E;  1UHW A;  3OV8 A;  1S0O A;  3E6B A;  1DIK A;  1VKZ A;  3MZ8 A;  4MV6 A;  3T8R A;  4A3G G;  2JEG A;  2NU9 B;  4A3K J;  2CV1 A;  1JUP A;  3ML6 A;  3KZZ A;  2COG A;  3T5K A;  3N8D A;  4R8H A;  2QVO A;  4IL6 C;  3ZCO A;  2CUE A;  5FKN A;  3HT5 A;  4MV4 A;  1H88 C;  2Y9Z A;  3VYR B;  3R0J A;  2VIX A;  3P9I A;  4DV5 H;  4BJ5 C;  1YJW I;  3N6X A;  4HLX A;  4A0Y A;  1N77 A;  1OCT C;  4UUV A;  1M7J A;  3AL0 B;  1S97 A;  5DEQ A;  1FT9 A;  2FNA A;  5KG3 A;  1SAX A;  1JDB B;  3DEW A;  1M6V A;  3H1C A;  3WTY C;  3CCU I;  3G6Y A;  5CJ9 A;  2LD5 A;  3RYR A;  2DDB A;  2VN2 A;  3FF5 A;  2CJJ A;  3I4N G;  3UQ8 A;  4TQR A;  3Q3S A;  3EYY A;  2K4B A;  5KNL A;  3DP7 A;  4OX9 H;  2ZXI A;  2VB6 A;  4BBR G;  3J81 W;  1W36 D;  1HW1 A;  4XLF A;  2WAF A;  3BG7 A;  4BHC A;  4BAY A;  1HNW H;  5C4J J;  3JSO A;  2VPQ A;  4BY7 J;  4YJ3 F;  1XMQ H;  2FRH A;  3R5F A;  2XGQ A;  2FPP B;  5KT7 A;  3HRS A;  4YJ2 F;  2Y2Z A;  2YRX A;  2KSW A;  4O3Q A;  4X6A J;  3QAH A;  2EJ2 A;  3W6V A;  1R7J A;  2K85 A;  4AIH A;  2M9H A;  4G7H F;  2NAZ A;  3DV8 A;  2VQE H;  5I47 A;  1LUJ B;  3DLA A;  5CVJ A;  1OJL A;  2RKH A;  5LLQ A;  3W2A A;  2DAB A;  3K4C A;  2UXC H;  3MWD A;  3RIR A;  3OY9 A;  5L9X A;  2K02 A;  1BI3 A;  4XX0 B;  3NEU A;  1NHA A;  1O3Q A;  3EPZ A;  4FFL A;  3EPG A;  4QPO A;  4GKJ H;  2PQ8 A;  1DP3 A;  3M9O B;  2JWT A;  2F4O B;  4A3E J;  2FB9 A;  2VC0 A;  3UYY A;  4M3G A;  2HWV A;  5FFX A;  5DG8 A;  4DW6 A;  1O4X A;  4O7N A;  1EKF A;  4JI5 H;  5B66 C;  5AON A;  3W3C A;  3RBD A;  2XAQ A;  3L09 A;  3NAR A;  2XVC A;  4BQO A;  4HQE A;  4B3M H;  2AS5 F;  3HOY J;  2BY2 A;  2O3F A;  1C0W A;  3TQ1 A;  2JA6 G;  2E36 A;  1S03 G;  3NBZ B;  2CSO A;  5L3B A;  5JH7 F;  2OH2 A;  1YE9 A;  1YI2 I;  2H94 A;  1TW2 A;  3I55 I;  1IRG A;  3HJE A;  1TWH A;  3HTS B;  1MBG A;  1WH5 A;  4IO9 F;  3LFK A;  3KP4 A;  3LQS A;  4FFP A;  4FBU A;  2IW5 A;  3CLO A;  2K27 A;  4BKX A;  3MKY B;  1I1K A;  1SAU A;  4I76 A;  1TAE A;  2X1C A;  3CCV I;  2XF6 A;  3A03 A;  3V7S A;  1VQ5 I;  2W25 A;  1I1M A;  2L01 A;  2W7P A;  3E3V A;  4EEY A;  4WWC A;  1AUX A;  3ZMU A;  3JW4 A;  4GRI A;  2QEX I;  4BE2 A;  2F5F A;  1G3Y A;  3GDE A;  2BXY A;  4R1H A;  1RKT A;  2Y48 A;  2EV6 A;  5GAH J;  4IWY A;  3BCB A;  4FFN A;  1QBJ A;  5E1Z B;  3K4L A;  2OU2 A;  1SEI A;  3QP5 A;  5EDW A;  2CUZ A;  4CE5 A;  4ECR A;  2FQ4 A;  3GTQ A;  4DBQ A;  2R5Z B;  3GZN B;  5DD8 A;  3VB2 A;  1ZLK A;  1DDN A;  4C5A A;  5FKO A;  1XMA A;  2V6C A;  3M4I A;  2P5L C;  4PSX A;  2L4M A;  4J9O A;  2K3P A;  1QHH D;  3K5H A;  1YS6 A;  3JRH A;  1XD7 A;  5ILS A;  3QZ7 A;  3E0J B;  3CO6 C;  1TWC J;  2ODT X;  3C2G A;  1FKA H;  5A2Q W;  4DQ2 A;  3DXJ F;  3A4C A;  3OIO A;  3G4S I;  3OTO H;  3AG4 H;  4XN0 A;  4U87 A;  1Z6R A;  1WJF A;  2VUM A;  1OYY A;  4AQY H;  1RR8 C;  2JK3 A;  2JMW A;  4BQN A;  5GAD J;  2KP6 A;  2V9K A;  1Y14 B;  3K3V A;  1S9H A;  5I5U A;  4A3M J;  4HW0 A;  4F92 B;  5HS8 A;  2DOD A;  1Y1W A;  2H09 A;  4UUS A;  1AKH A;  3BG3 A;  2PG4 A;  3WNZ A;  2W1O A;  2HDC A;  1VS0 A;  3I3L A;  2DLN A;  1FZP B;  5HBR B;  4LF9 H;  4GYI A;  1BI1 A;  1WCM G;  2R5Y B;  5H6Q A;  4O7W A;  4J0M A;  2XPW A;  1E17 A;  4CKE A;  1M0W A;  3H0G G;  1FYM A;  2R7T A;  1IN5 A;  4AC0 A;  1OCZ H;  1TWG J;  5FFZ A;  5LHG A;  3D5S C;  4QTR A;  2NYX A;  3I59 A;  2R8G A;  3RJ0 A;  2W71 A;  4XN3 A;  9ANT A;  2XRO A;  1DP7 P;  1ON2 A;  1G8X A;  1A0G A;  3PW0 A;  2CQN A;  1YIJ I;  1Y39 A;  3J80 W;  5I5W A;  5BQT A;  3K1N A;  2ZME C;  4II3 A;  2F5E A;  3ZN0 A;  3EUH C;  1EUD B;  5CQG A;  5KFZ A;  1GSH A;  2IGO A;  4PCQ A;  3BR2 A;  4ESJ A;  3DTI A;  4Q48 A;  3HO8 A;  3KE2 A;  3OR2 C;  4Z2Y A;  1SVO A;  4KYW A;  3K5I A;  5KKN B;  1KBL A;  5KFS A;  1OR7 C;  3N6R A;  2JN6 A;  3TL4 X;  5A2Q K;  1ZAR A;  1WSC A;  5KT3 A;  4DV3 H;  4LFC H;  1H8A C;  1TW3 A;  1T3N A;  2BVM A;  4A3I G;  1WJE A;  2HGS A;  3PJR A;  4LF4 H;  3OIP A;  3PO3 G;  4A3J G;  2E5Z A;  2XGE A;  1W7P D;  2CO5 A;  3F0C A;  4RGS A;  4WXD A;  2FEZ A;  2VPL A;  4XBF A;  3BLY A;  4RM2 A;  1ONV A;  3UKG A;  2ELH A;  1BJT A;  4XQF A;  2DPJ A;  5KFR A;  3WU2 C;  2FBH A;  4IRK A;  1DAA A;  4KHP H;  1CQT A;  3JRD A;  1CS0 A;  4O3R A;  5IOZ A;  3CUO A;  1R1U A;  1IRZ A;  1BC8 C;  1FP1 D;  3GTO A;  1R6R A;  3O2P E;  2EV5 A;  4CUG A;  2VE8 A;  4PJL A;  5BWX A;  4U0W A;  5CQE A;  2XGX A;  2MG4 A;  2EB7 A;  1N78 A;  3HOS A;  1WSU A;  1X9N A;  3MKW B;  1ZYR F;  4XM3 A;  3ZMD A;  5LGU A;  2O61 A;  3KYH C;  5BPH A;  4YAJ B;  5LOV F;  4AU7 A;  3K0L A;  1WWX A;  1IZ1 A;  4HN2 A;  2KKO A;  2GXB A;  4OMY A;  2DZD A;  1TTY A;  4CCL A;  2WAQ A;  4IKF A;  3RPU D;  4J9R A;  1D1B A;  1SMT A;  4AUX A;  4O7Y A;  3BQY A;  1OYW A;  3RSN A;  4D5C A;  4ME6 A;  3FXK A;  5IOY A;  3WTU C;  4Y7N J;  4LG0 B;  2F4I A;  3JZ6 A;  4YQW A;  3TY8 A;  4FBT A;  2E7W A;  2JRT A;  3MR3 A;  4XLH A;  1D0Z A;  4A3C G;  1TWH J;  2FQ3 A;  5KX5 F;  5KT6 A;  4I02 A;  2X6W A;  2VOP A;  2LC2 A;  1IYD A;  1OCP A;  3ZR8 X;  2IT0 A;  2P5V A;  2F2E A;  1ZR2 A;  2YZN A;  4OAY A;  4B4C A;  3QYE A;  2Y0S N;  3BPV A;  3SDB A;  3BC8 A;  2JA5 J;  3J7A K;  4N0B A;  4YB8 B;  1XCV A;  1Y1V A;  4NLG A;  4BJ6 C;  3KFW X;  1KU9 A;  1Z2O X;  3E1S A;  1L0O C;  3QU3 A;  1ZAU A;  3U21 A;  4LLN A;  4O2A F;  1J2X A;  2ICW G;  2NU8 B;  2HQA A;  2A3S A;  2Y0M A;  3OL4 A;  3OOP A;  5C44 J;  1RES A;  4BY7 G;  3GIQ A;  1WCM A;  3GLL A;  3ZGK A;  4AD9 A;  5C1O A;  4EEF G;  1W5T A;  4CKB A;  2MD0 A;  2NVU B;  4LF6 H;  3N44 B;  3O6B B;  2FKL A;  3PW5 A;  1MW7 A;  1RI7 A;  1R22 A;  3MEX A;  3VSK A;  3LSR A;  5KG7 A;  4ZDP A;  1AU7 A;  3VPD A; 
#chains in the Genus database with same CATH homology
 4UFZ A;  4JOM A;  2PJR B;  3H20 A;  4XOR A;  4YEL A;  1JI8 A;  3RR5 A;  3ZXS A;  4APM A;  1Z21 A;  2IXS A;  3PN1 A;  3OYB A;  2HVQ A;  4X62 H;  2IS2 A;  1X1D A;  3PNT A;  4N4O B;  3A1Y A;  4E4H A;  3K4N A;  4F52 A;  3DTE A;  2HPM A;  4DV0 H;  5FRM A;  3GBG A;  5FPO A;  3N41 B;  2VJ4 A;  4KIT B;  4D1Q A;  3KX2 A;  1N33 H;  3IAS 2;  2E1M B;  4UCR A;  2A6T A;  3L4K A;  4PJM A;  4XL9 A;  2VJI A;  4ETS A;  3JSN A;  2MCT A;  3LML A;  3KAL A;  4F93 B;  4RM3 A;  4RB1 A;  1U0J A;  4LF5 H;  3PNV A;  3QYB A;  3VSL A;  3FMA A;  4DV7 H;  4E7I A;  4PJJ A;  5KHD A;  1I6U A;  2ZFU A;  2O5R A;  4CZC A;  1ZEL A;  3L2Q A;  3RGX A;  3T1Y H;  2XDV A;  3NBY B;  1UEL B;  2BW3 A;  1MMN A;  2M0M A;  3IP4 B;  4YHH H;  2RRE A;  1G59 A;  3PSI A;  3BCA A;  2VKD A;  1OLT A;  5HLT A;  2DT6 A;  3K70 D;  3H9Q A;  3BAA A;  2HIX A;  1D1C A;  1W36 C;  1I94 H;  1YX3 A;  4ZYA A;  3TY5 A;  2F6C A;  4DIQ A;  5LD2 C;  4C2T A;  2X1D A;  4B44 A;  3HPH A;  4CH7 A;  4F55 A;  1P9Q C;  3HUG B;  4JQF A;  3VYU B;  4DV4 H;  2BOL A;  4EEQ A;  2WYO A;  4PFO A;  1Z2P X;  3QYF A;  3OR1 C;  3A2K A;  3IG0 A;  3GB8 B;  2KRC A;  2L9N A;  4N4N B;  2BW3 B;  4RLF A;  4GLX A;  4ITV A;  3M1C A;  3PSF A;  4MLO A;  4H4K C;  3RTX A;  4YY3 H;  2ZM6 H;  2V26 A;  1X19 A;  1P8L A;  2QKM B;  4BDY A;  4A2A A;  1IRX A;  4NC7 A;  4PJN A;  5LMU H;  2WA0 A;  5TGT A;  2R7R A;  2F4V H;  4XLA A;  1ZHS A;  4IX7 A;  1XNQ H;  1CKO A;  3FBI B;  4B3S H;  2MYS A;  3DU5 A;  2W7N A;  4BU2 A;  4PSW A;  4OWR B;  1O75 A;  4LH7 A;  1M0T A;  1NG6 A;  1YX5 A;  4R7R A;  4PDB A;  3RIZ A;  3J7A Y;  3W1B A;  3PFY A;  2VXZ A;  2X6Y A;  2CS3 A;  4C9Y A;  2CFM A;  1DGR M;  4RAZ A;  3OOU A;  1D1A A;  3HKZ A;  3JAM W;  1AA7 A;  2R7X A;  4E7J A;  2ELJ A;  2FUG 2;  3L2W A;  3QWU A;  1GLN A;  5FLX W;  2DOA A;  4PK4 A;  4NUB A;  2X1E A;  4JI0 H;  4HSR A;  4HEA 2;  4B48 A;  4LSA A;  3FDY A;  3S3M A;  5CKT A;  1WFX A;  1WJ5 A;  1FMV A;  2JUG A;  3D5R C;  4UCU A;  1E4G T;  2K9L A;  2UWM A;  2Z2S B;  4LF8 H;  1XK5 A;  3OYL A;  2Q2U A;  3VNN A;  4F3Q A;  2WE6 A;  4B3X A;  1Z2N X;  3TMO A;  3OYJ A;  3CZ6 A;  4HNU A;  3OS2 A;  4P1W A;  3H5N A;  2XF7 A;  4EAT A;  1E4F T;  1XMO H;  1SFK A;  1QHG A;  2L9S A;  2LG4 A;  4I7H A;  2WB1 A;  4JI8 H;  2KMU A;  1V9P A;  4BWS C;  2CW7 A;  2XAU A;  4CCN A;  3LSM A;  2L5Q A;  2R4G A;  3LMM A;  2O03 A;  4JI3 H;  4ZC3 A;  1N34 H;  2Z16 A;  2ZSI B;  3F9K A;  2KLO A;  4YEJ A;  4AYB A;  3OS0 A;  2VQF H;  3C2H A;  2I8D A;  4LH6 A;  4GKK H;  3W2V A;  2DJI A;  4BDZ A;  2F5V A;  1J09 A;  2AQF A;  2K9M A;  4Y33 A;  1HR0 H;  3S3N A;  3NC0 B;  2DXI A;  1V5F A;  4DGW B;  2VAS A;  4MTE A;  5FPR A;  4BUP A;  2XIG A;  4LSX A;  3L2R A;  2MFZ A;  2XC7 A;  2UXB H;  1MZB A;  2QKL B;  3CP8 A;  5JHF A;  4UCO A;  3DEE A;  2VQG A;  4XLE A;  1MMD A;  3DU6 A;  4XON A;  2E5N A;  2A5W A;  3UNG C;  1HNZ H;  2RQQ A;  1X4P A;  5FRN A;  4D9J A;  3K4J A;  4NQW B;  2HPI A;  4CCO A;  1E0E A;  3K70 C;  2VJ5 A;  3ONQ A;  2KQR A;  3W2W A;  4XOT A;  4XR6 A;  3OYF A;  2KRH A;  3CF2 A;  3H9J A;  3OYN A;  4P5O A;  4MV9 A;  4ZTJ A;  1K6Y A;  3L2U A;  3RGZ A;  3SEQ A;  2Q2E B;  4E7S A;  1MMG A;  3OWT A;  3BA9 A;  4RB2 C;  4DR5 H;  4LMY A;  2KZV A;  4DBR A;  3DPT A;  5FRO A;  4DRF A;  4E7H A;  4XKW A;  1BR4 A;  1FMW A;  3GJX B;  4LIU A;  3K4M A;  4XMY A;  2LBF B;  4EQ5 A;  3SZG A;  3W1G A;  4M7E A;  5LMN H;  3KAJ A;  1XDN A;  2OWO A;  3MD2 A;  3ZQQ A;  4C2U A;  2HHH H;  3SYT A;  3VYT B;  1IBM H;  3HC7 A;  1Z3X A;  3QOE A;  1WJB A;  1N36 H;  1PJR A;  3EUK L;  2E60 A;  5HOO A;  5IWA H;  5FD6 A;  5CPR B;  2L2O A;  4U7B A;  5LFA A;  1LKX A;  1V5G A;  2BVL A;  4LIV A;  2WAE A;  1CKN B;  4JI6 H;  4UCS A;  3L2P A;  4CCJ A;  4BJT A;  4DV6 H;  3HOT A;  4HPQ A;  2M4K A;  4FET A;  2X51 A;  3K10 A;  1ZHQ A;  1DQU A;  2W57 A;  4BL0 B;  2IS6 A;  2KHM A;  2YCH A;  4NXM H;  1AN7 A;  2UV1 A;  3AKZ A;  2CV1 A;  2IGM A;  2AQE A;  4BS9 A;  2LBF A;  4E7L A;  3ZCO A;  4RLQ A;  3OYH A;  3BA8 A;  4PZ7 A;  4DUZ H;  4K0K H;  2UXD H;  3LSG A;  3LSI A;  2JVG A;  3VYR B;  4DOZ A;  2VIX A;  4DV5 H;  1LDK B;  4BJ5 C;  3N6X A;  4UCT A;  1N77 A;  3NWT A;  2W4S A;  4A2B A;  3AL0 B;  2WY8 Q;  2GOM A;  2CFO A;  1L2Z A;  3IAM 2;  3DQV C;  2LOO A;  1DGS A;  1X1A A;  1WJD A;  3MKZ A;  2K5C A;  4LG3 A;  5KCM A;  2M4G A;  4QPQ A;  3OMY A;  1X1B A;  3I9V 2;  3OYC A;  5D1P A;  2DCE A;  1UAA A;  2UUC H;  3UQ8 A;  3PNY A;  3EYY A;  4B43 A;  5KNL A;  3K6G A;  3KXY T;  4OX9 H;  2CH0 A;  2VB6 A;  2ZXI A;  4PZ8 A;  2RGV A;  3LSH A;  1W36 D;  3J81 W;  4LIT A;  1ERD A;  4XLF A;  2WAD A;  3ZRG A;  1A0I A;  2WAF A;  3BG7 A;  3OYI A;  4DUY H;  1HNW H;  2Q2T A;  4DR7 H;  1MMA A;  2DT7 B;  2ZXH A;  3QOD A;  4CCK A;  2PJR A;  1XMQ H;  2M3A A;  2HNH A;  1IBL H;  3H35 A;  1X1C A;  1WH2 A;  2MAB A;  3CES A;  3HXL A;  2KSW A;  4OAZ A;  4PUS A;  1GYF A;  2KL4 A;  3KAK A;  4R79 A;  2VQE H;  2OV7 A;  2CV2 A;  3DLA A;  2PMZ A;  3UR3 C;  3W2A A;  3C0F B;  3K4C A;  4E7Z A;  2E1M C;  2UXC H;  2NOJ B;  2VKH A;  3OY9 A;  2JVH A;  4GKJ H;  2IGK A;  3EPZ A;  1N75 A;  4QPO A;  4DJA A;  3LFU A;  1DP3 A;  1NG7 A;  5HVQ C;  1UG0 A;  3AL0 C;  1SYX B;  2UUA H;  1T0F C;  3N40 P;  3LSK A;  3BAB A;  2XSJ C;  3T1H H;  4JI5 H;  4RAY A;  3CP2 A;  1BOB A;  3W3C A;  4LFB H;  3FKJ A;  2OUM A;  3SEZ A;  4BQO A;  2HVR A;  4B3M H;  2XF5 A;  1S03 G;  2Z1D A;  3NBZ B;  3CJQ B;  3F8N A;  4DR1 H;  2E5L H;  1YE9 A;  4XNF A;  3DPU A;  4DR3 H;  4ZDO A;  4DR4 H;  4JYA H;  4BE0 A;  2HZD A;  1BGW A;  1Z7L A;  2X6X A;  3S8P A;  2LRD A;  3OYD A;  4II2 A;  1WJA A;  3MKY B;  2VOB A;  1SAU A;  1TAE A;  2X1C A;  4BEH A;  3LL7 A;  4RMN A;  3W5O A;  2XF6 A;  3H0D A;  2VUG A;  3KYL A;  1S68 A;  3OIQ A;  4HST A;  4BE1 A;  3S24 A;  4GRI A;  4FAS D;  4BE2 A;  5IT9 W;  4G6T B;  1BR2 A;  3FBN B;  4CSW A;  3GDE A;  1HNX H;  4B47 A;  4MV7 A;  3BCB A;  3K4L A;  1SEI A;  2IS1 A;  5DIS C;  4X65 H;  2CUZ A;  2IS4 A;  3DKX A;  1FJG H;  1X4O A;  2Y0S A;  5FD5 A;  2ZSH B;  4DBQ A;  4NXN H;  4HRI A;  1D0X A;  4Y4R A;  2R7V A;  1N32 H;  4BQQ A;  3M4I A;  2VPS A;  5HNF A;  4PSX A;  2LY2 A;  2V6E A;  2K3P A;  1QHH D;  2MC4 A;  4JI1 H;  4B3R H;  1PYV A;  4DR6 H;  4PZ6 A;  3E0J B;  4AVZ A;  1CKN A;  1IBK H;  3C2G A;  1FKA H;  5A2Q W;  3OTO H;  3A4C A;  2VL8 A;  4MTD A;  2R7O A;  3HG9 A;  4XN0 A;  2HU9 A;  4U87 A;  4E6K G;  1B04 A;  4X64 H;  4HG2 A;  1WJF A;  4CA0 A;  4XLC A;  4J00 A;  4AQY H;  4BQN A;  3RF2 A;  2VXD A;  2KP6 A;  2IGN A;  2M7B A;  2V9K A;  1S9H A;  3OS1 A;  2CW8 A;  5D1O B;  4F92 B;  3K3V A;  3M8J A;  2RNG A;  4JI2 H;  4RZQ A;  2W1O A;  1VS0 A;  3I3L A;  4LF9 H;  2V4J C;  1Y56 A;  2Q1Z B;  1HA8 A;  4J0M A;  4ANJ A;  1DGW Y;  1M0W A;  4Y3O A;  2R7T A;  1TA8 A;  3D5S C;  3PL8 A;  3RJ0 A;  4XN3 A;  2CMP A;  3KEY A;  1Y6I A;  3NWS A;  1G8X A;  1V5E A;  2LY1 A;  3S3O A;  2LH9 A;  1Z3Y A;  2W82 A;  4BEH B;  4DV2 H;  4NC8 A;  3OYA A;  1P16 A;  3DTK A;  3J80 W;  1MND A;  4KIS A;  3HPG A;  4LF7 H;  2P0W A;  3AFH A;  3CJR B;  4II3 A;  1CKM A;  3N42 B;  4Q0Y A;  3EUH C;  2WY7 Q;  5CQG A;  1T95 A;  2IGO A;  3RCO A;  4JV5 H;  3H5A A;  4NNJ A;  2V1N A;  3DTI A;  2HVS A;  3G2B A;  2KPM A;  3OR2 C;  4XKB A;  2R7S A;  4CC5 A;  4F91 B;  2UUZ A;  4X0G A;  2VJJ A;  2LYC A;  3VYS B;  2VQH A;  1OR7 C;  3TL4 X;  3K4K A;  4DV3 H;  3CVZ A;  4LFC H;  2ZJT A;  4EFB A;  4DR2 H;  1VZ0 A;  4XKC A;  2BVM A;  4JI4 H;  3OYE A;  3TY9 A;  1WJE A;  2HGS A;  3PJR A;  4LF4 H;  3N43 B;  3OIP A;  2E5Z A;  2OC6 A;  3VWB A;  2UU9 H;  4C30 A;  2VPL A;  3BLY A;  4RM2 A;  1BJT A;  3H9G A;  4XQF A;  1TZL A;  2RGR A;  3DF7 A;  4KHP H;  4B3T H;  2KDO A;  3IUO A;  4BAC A;  3RQ4 A;  3OYG A;  3MWM A;  5BR8 H;  1LVK A;  1MNE A;  2R7U A;  4YRV A;  1J5E H;  1R6R A;  1XNR H;  3DPL C;  4E7K A;  4RB0 A;  3VDX A;  4CUG A;  4PJL A;  3S93 A;  4BGD A;  4KT6 A;  2JA2 A;  4ZJZ A;  5CQE A;  4RB3 C;  1N78 A;  3HOS A;  4CCM A;  1X9N A;  3MKW B;  1WJC A;  3OYK A;  4XM3 A;  4J01 A;  1TT0 A;  4ZDL A;  1QU3 A;  4IQ4 A;  3N05 A;  3KYH C;  2UUB H;  4LFA H;  2W00 A;  4JI7 H;  4AU7 A;  2LRE A;  2JSP A;  4BXF A;  3RTR A;  1D0Y A;  4HNT A;  5D1O A;  3CMM A;  2WBM A;  4CCL A;  4EFE A;  2V7F A;  2WAQ A;  4IKF A;  3RPU D;  2FE3 A;  1D1B A;  3DKY A;  3RSN A;  2HDW A;  3TBI A;  4E6N A;  3K4B A;  2F4I A;  3TY8 A;  4IAJ A;  3BG6 A;  4CC6 A;  3PUB A;  5EOY A;  5LL6 b;  4XLH A;  2CUJ A;  1D0Z A;  4XOP A;  3S32 A;  2WDT A;  3L4J A;  3FHN A;  2GOX B;  2R7W A;  2X6W A;  2LC2 A;  4ZTF A;  3JSL A;  3ZR8 X;  4FM9 A;  1BR1 A;  4OAY A;  5HNH A;  3QYE A;  3J7A K;  3SDB A;  4UCV A;  2M7A A;  3BC8 A;  4IQJ A;  2VQL A;  1EA3 A;  3V42 A;  2R7Q A;  3OL3 A;  2HIV A;  4BJ6 C;  2VLA A;  1Z2O X;  3E1S A;  3U21 A;  3H5R A;  3D5L A;  1KON A;  2HQA A;  4IZZ A;  3OL4 A;  3L2V A;  2VQC A;  4PFP A;  1FVI A;  2L7K A;  3DWL E;  3ZGK A;  4DV1 H;  4KJZ A;  3EUA A;  2MD0 A;  4XKV A;  4LF6 H;  3N44 B;  3OYM A;  3MMY B;  1MW7 A;  1LFP A;  2X85 A;  2CV0 A;  3VSK A;  4ZDP A;  3HL2 A;  4X66 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...