2HVQA

Structure of adenylated full-length t4 rna ligase 2
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
329
structure length
316
Chain Sequence
SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFSEKKVELSEADNKLVGILACYVTLNRVNNVISKIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase
molecule keywords Hypothetical 37.6 kDa protein in Gp24-hoc intergenic region
total genus 91
structure length 316
sequence length 329
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvqA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvqA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvqA01
3PN1A 3RR5A 3TY9A 1S68A 4PZ8A 1VS0A 3BA9A 4EEQA 3BAAA 3JSNA 4UCSA 4UCRA 1CKNA 1P16A 4LH7A 5D1OA 4E6NA 3JSLA 1X9NA 2HVSA 1CKOA 4EFEA 3GB8B 1DGSA 1CKNB 2HVQA 3BA8A 3W1BA 3NC0B 4UCUA 4DRFA 5FPRA 2VUGA 1P8LA 3W5OA 4LH6A 4UCTA 4CC6A 1V9PA 4EQ5A 3S24A 3L2PA 1TAEA 5D1PA 3GDEA 3RTXA 2Q2TA 3BABA 4GLXA 1TA8A 2OWOA 1FVIA 1B04A 3UQ8A 2HVRA 4PZ7A 3QWUA 5DISC 3NBZB 2HIXA 1XDNA 4UCOA 2HIVA 4CC5A 2CFMA 3GJXB 4PZ6A 3TY8A 3VNNA 1XK5A 4UFZA 4EFBA 5D1OB 3NBYB 3W1GA 5FPOA 1A0IA 3TY5A 4UCVA 2Q2UA 3KYHC 1CKMA
chains in the Genus database with same CATH superfamily
1G4DA 3MKYB 3MFIA 3BQ2A 1V5FA 4HNTA 5TISC 3GO5A 1ZRDA 4DIMA 1R4NB 4YY3H 2PJRB 1LEAA 2BYVE 2XPWA 2Y9YA 4XSXF 1YE9A 4BBRJ 2NOGA 4OIQF 1WJCA 4E4TA 1C3OA 1XMOH 1LKXA 2ZO4A 1SD4A 3K4KA 1X19A 4CKBA 5K7HA 3BTCA 5FKKA 4KA4A 1KJIA 2YX7A 4G6TB 2FD5A 4UY8I 4ZI7F 1QZEA 3P5JA 4DR6H 2CWEA 3RKWA 3ECOA 3HSFA 1R9TJ 3SDGA 1YIOA 2EBIA 2PMHA 3IH3A 2P81A 3RSNA 2E2HJ 4PZ6A 1MBHA 3TP3A 1X3WB 3A0BC 2WY8Q 3M8FA 2GM4A 4QWQA 3HOUJ 1B6SA 5FPOA 4PSWA 4WXHA 1JTYA 4FFPA 2COGA 2CUZA 1V5EA 4B48A 3N05A 1VTNC 2FLLA 3HPHA 3DBLB 3OYDA 3TW7A 1OPCA 2K02A 4WX9A 3RYPA 1Y14B 5AONA 4JX5A 1U5TA 3VYSB 1RETA 4RU9A 4UVAA 3CJTB 1XGMA 2F6CA 1TQPA 2AXTC 4V2GA 4WK8F 3EYYA 1F1ZA 3MAJA 2CQYA 2OF7A 2NU7B 2OJED 2FKLA 2R92G 1VQLI 3OS2A 3NAUA 3FBNB 2JN6A 1ZR4A 1I1KA 2R8IA 2RDJA 3HHGA 2HTJA 3A1YA 2LRDA 3FXRA 4GO1A 4RAYA 3TL4X 2OTLI 4MV9A 2UU9H 5FJ8J 4IHVA 3K10A 4EGZA 5DDGA 4F92B 5D5UB 3OYFA 3PIPF 1FJLA 5JQWA 1NG6A 1RUNA 1ZN2A 4FE2A 4ECUA 2XRLA 2IVMA 2DT7B 1R1TA 5ICCA 2IT0A 1KT8A 2ASLA 5C4JJ 3BG7A 1OJLA 4P96A 5IPAA 1VQ6I 1ZGAA 3A2KA 2M87A 1AHDP 1PP7U 4NQWA 3CUOA 2A05A 4LH6A 1ON1A 3KTMA 3G6VA 3FHNA 2J5PA 3OS1A 2IAIA 2BQ3A 4JX6A 5F04A 3K4BA 4LSXA 3QU6A 3SFZA 3GMEA 2C6YA 2L2OA 5EG0B 3LNQA 3ZQCA 3OSPA 1L0OC 1G3YA 2KFDA 3J80Z 3NBYB 2K3PA 5J4VA 3HT5A 4DZJA 1JJ6C 2LTPA 2DA1A 4LG0B 1OCCH 1X4OA 4BL0B 4GCVA 5KVRA 5CQEA 2RKHA 3RPUA 5IP9G 2M8EA 2X1EA 2IP4A 4EBCA 1WGXA 2F4MB 3BR2A 2H8WA 4OAZA 4A3JG 1FMVA 2ZXJA 3CCSI 4E7KA 1K1SA 5DCMA 4XORA 5F0HA 2Y0SN 2X6WA 1W36C 4YHHH 2BBYA 1Y1WG 2R5YA 2ZCWA 3LSKA 2XB0X 4XM3A 4IZZA 1QBJA 3GTPA 4XLEA 3F8CA 4EVIA 1FBUA 4NHJA 5LOVF 3ZQ7A 5EDNA 3CUQA 2PX9A 1MNEA 4XLCA 5JVGF 1BC7C 2UXBH 2FNPA 3TKYA 3OSGA 3OIOA 4PJ0C 2PMZE 2K86A 3H5RA 3JRIA 2HHFB 3TGNA 3G8CA 3GIQA 2UVVA 2QBYA 4ZZLA 2K4BA 2EA4A 2VOOA 3QWLA 3VPBA 2HYGD 2VKDA 4J9RA 1GLNA 4JV1A 3GTQA 4RS8A 4CCKA 1R58A 4X62H 3KFWX 3S3NA 4IIJF 4LFUA 2OU2A 2YSRA 5I5XA 1OCPA 2IGKA 3ORRA 2OH2A 1I7NA 4XKCA 2ZJQF 2XPVA 1RKTA 1FBSA 1K6OA 1HCRA 1JI8A 4GRIA 2RVCA 4O81A 3JAMZ 2R85A 1L3LA 1XG1A 1E4FT 2RV8A 3GFMA 3LSMA 5FR9A 4JOMA 4FE7A 3I55I 5J6XA 3ORQA 1ETQA 4YJ3F 2BQUA 2DFEA 2O0YA 2VJIA 3T8TA 4BE0A 3VNNA 2ZXWH 2SCUB 3BJYA 4LF6H 4UUGA 2LC2A 4DV2H 5JHFA 3LA2A 2LKPA 4NC6A 2R7QA 4CCNA 1S68A 3LL7A 4RLFA 3L00A 1SD5A 1ONVA 5KG4A 2Q2EA 1ZRFA 2AGQA 4L5IA 2DA3A 5L1IA 4ZTFA 2YPRA 4DGWB 1J5YA 4EG0A 1UG0A 1HKQA 2G0EA 3L4KA 2EZIA 1XN7A 4ZC3A 2A6EF 1SYXB 5JR3A 4A3GJ 1G3SA 3GDEA 5FROA 1N36H 2CJJA 2XGDA 1Y39A 2HG8A 1I50J 2UUBH 3LAPA 1HDDC 1I1GA 4DV5H 3D1NI 2JEJA 1D1BA 2ZXHA 5LRRA 1IBLH 1L2ZA 1E3HA 2AU0A 2BR0A 3KZZA 4IZOA 2CO5A 3VOEA 2GA2A 5LEKA 2R7TA 5GTHC 5D8DA 2DK5A 5FKOA 3CDLA 3A02A 4KICA 4HX8A 4TQSA 3MR2A 2R7SA 3U1DA 3ZXSA 4P5OA 2M34A 4A69C 5DUIA 3DPTA 1MZBA 3E5NA 1SFUA 1Z6RA 2ECCA 5GAHJ 4KIFA 1DPUA 3VB2A 2ISZA 5LMUH 2VA3A 4U7DA 4ENMA 4JP0A 5BPDA 4S04A 2FJ1A 3H9JA 1IZ1A 2RNJA 3HDDA 3KREA 1SANA 3BG3A 1CF7A 2FPPB 1HNZH 2IS2A 4KMFA 3GUDA 1FEXA 3HOVJ 4ED6A 3ML6A 5IYDJ 1RRJA 4QIWE 2R7DA 4YRVA 3RJ0A 3U54A 4PK4A 1BI2A 3OMYA 2DQLA 3CP2A 1ETOA 1YX5A 3W6KB 3K5HA 3PO2J 3ASOH 4A6EA 2K85A 4IRIA 2NS8A 2Y75A 1FOXA 4LK1F 5E25A 3QQAA 3ZMDA 2C2EA 2CUEA 3PUFA 3VSLA 1D0YA 1FC3A 1XNRH 1MW7A 2HI3A 2M0MA 3K4NA 4Y3OA 4WCGA 3WU2C 3OUUA 1WSCA 4LLGF 3T5JA 2K5CA 1PUEE 4IKFA 4A93J 2W7OA 4R8UB 4UV9A 4U87A 1NHAA 1UB9A 2GZWA 3ZMTA 4TVIA 5IWAH 4CICA 3BR0A 2BE5F 1OCOH 2CZGA 3G6YA 4UCVA 1CGPA 3BR6A 3MWDA 3PN1A 1U2WA 2YU9A 1IXCA 2E1OA 3OYEA 2ZMEA 4BXUA 2VKHA 2BW3B 2IBDA 1U8RA 4N9HA 4AVZA 3JTHA 3HYIA 1IYDA 1TQMA 2QVOA 5LHGA 5A2QK 3AL0C 1LPQA 4IQ4A 3E6DA 4HF1A 4A5MA 1IRZA 3HBLA 2MA3A 3PSFA 4QTRA 3JRFA 4BGDA 5FFXA 2R7WA 2QYZA 5KFVA 2DJNA 2KZGA 1J09A 3E6MA 5JH7F 3L2VA 3S14J 2Y4RA 3SXYA 4OX9H 2EFPA 1ETKA 5FLMJ 2I10A 3JCUC 5C44J 1RR8C 5D6EA 5DQGA 4B3RH 3E5UA 1PJRA 3Q0UA 3IV5A 4BYYA 4C9YA 3DLLF 1V54H 2B9SA 4KDPA 4NZOA 4ZYGA 4M7EA 4XSZF 1D0XA 3L2WA 2VJ4A 2W85A 3BZ6A 3M8JA 2LY2A 2KIFA 2XSDC 4GKJH 3PO3J 3BA8A 4B8XA 1I27A 2VLAA 4BY7G 3M1EA 2PMUA 3REOA 3FDSA 2I5UA 1MGTA 4BDYA 3F9KA 5E18F 2XC9A 2XCPA 4HPQA 4F4XA 3H3ZA 2JA8J 2XF7A 3KP7A 1SVMA 3W2VA 5HODA 4XN0A 4NZMA 2IGOA 2DPUA 2KJBA 3SGIA 2W1OA 3W2WA 4IHXA 1X1BA 4IHYA 1ZREA 2DABA 2DYRH 4O4IF 4A3LG 4HF0A 2JVHA 4EFBA 3VA7A 1O3TA 2FSWA 3QFFA 3H3VK 2CQNA 4B47A 4B1RA 3SFIA 5C5JA 2HZDA 2RN7A 1MBGA 4KUMA 4UB6C 5F08A 2W25A 5DYMA 3T0YA 5HLHA 2R86A 1RJPA 3GIMA 2JA5J 3OYMA 5DGBA 4X66H 1VQNI 3TOBA 3B02A 2DZDA 3ERMA 5EOYA 4NLGA 2CW7A 3ZQGA 1WFXA 4JYAH 4A2AA 2W6OA 1OR7A 1ERDA 4ED7A 4GYGA 2A68F 3MR5A 4GLXA 1WVRA 4FISA 4UUSA 2R7LA 1EZ1A 2VBWA 3LSGA 2ZJ2A 2E5NA 4KJZA 1S3JA 4BACA 2MYSA 3QP5A 1RC9A 4BHBA 5FB2A 4D7MA 1OBDA 5HNEA 1R22A 3SE7A 3ABLH 1N77A 1P4AA 3I12A 5JVDF 2QF7A 1A0IA 2R3SA 4PGGA 3V7RA 3P9KA 2NUAB 3HUGA 1CE8A 2W82A 3VODA 3GLKA 4YIFA 2VJ5A 1H9GA 3FM5A 2M2EA 3CSWA 1N78A 2P5LC 1W5CC 1WCMA 1P16A 2DCEA 4YELA 1TL8A 4F7ZA 5HS8A 3OS0A 2W24A 4K0KH 1XSVA 2AQFA 3AKZA 3JRXA 2UUZA 3A03A 1ZLJA 2M4GA 4NC7A 1T38A 2EZLA 1TWFJ 2C00A 3LP8A 2KRCA 1IDZA 3GZ6A 2HQ5A 3IRRA 5CYVA 1V51A 4HN2A 5KFEA 3AYHB 3VDXA 4ZYHA 1WSUA 3B6AA 3HIFA 2E36A 4CH7A 3NUAA 4R7RA 3GTJA 2JA7A 3BY6A 1D0ZA 2V9KA 1MDMA 2EIKH 2Y69H 5CJ9A 1EH7A 5EEAA 4Q43A 4Q4DA 2XSJC 2ZJTA 3BJOA 2MC4A 1WJEA 1PP8F 4WXDA 4O3OA 3F8FA 3MN2A 3V7CA 2XF6A 2X85A 1P4WA 1EUCB 2EJ2A 2PMZA 4KYWA 2VPRA 3VYRB 4Q0YA 1XTAA 5F0FA 2DOAA 1OCZH 5JVTA 2FPIB 4FM9A 3RTXA 2EFQA 3T1YH 3KIOA 1M1EB 1UHMA 4CYCB 4XKWA 3M1CA 4II2A 3AG1H 1FOWA 2CFMA 2ZDHA 3NGDA 2ZNZA 2UVUA 4G7HF 1BJZA 1SMTA 1A3GA 2A61A 2WB1N 3IWZA 2WAEA 1VQKI 3C1DA 3K1PA 2O8KA 2L9SA 3T5XA 2ELHA 4XR6A 2P0AA 1DPRA 4I01A 3R6SA 5LP6F 5LL6b 1ETXA 3ZP5A 4H0EA 5EYRA 3N41B 5L1LA 4MTEA 1R1UA 3DKXA 4M3GA 4MA0A 1BL0A 2VPSA 1ZHSA 4WD3A 3JRWA 4YR2A 3Q9SA 3Q5FA 1X3UA 4XBFA 2E7XA 1STZA 1TWAJ 2IW5A 5KCMA 4D1QA 2KIQA 4X0GA 4G6DA 3K70C 3QWUA 2GXGA 4YIRX 5KG1A 1DU6A 1ZELA 1Y1WA 4HV5A 2O9LA 3BA9A 4PSXA 1S0NA 1U0JA 3GXOA 3L09A 4XRSA 4DOZA 2R7MA 4DV4H 3F22A 5HS9A 3PJRA 3FX3A 1OR7C 2ETHA 1W0TA 2CNQA 3JRGA 3K0LA 4C5CA 4EGJA 4DAAA 4AD9A 1XNQH 2Z3YA 4LOCA 1ZG5A 4A3DJ 2X6YA 2IRFG 3H20A 4D5CA 2HDDA 2HNHA 5DGIA 1LB2A 2MD0A 2DFHA 4CA0A 4P9FA 3LMMA 2D5VA 2NVQJ 1KJJA 1N56A 4GFBA 1OISA 3S2DJ 1BC8C 3L7WA 3M9OB 1Y1VG 2ID6A 3C2BA 3SDBA 1LE8A 2B63J 1IYEA 3DEUA 4DR1H 3OL4A 3DPUA 2OCCH 5KFRA 2JA5G 1JUMA 1LE8B 2CMPA 4RMNA 2VKVA 2E2IJ 2DN0A 5KT6A 2ALZA 4O7VA 3PZPA 1FIPA 2OZUA 3K70D 2A07F 4ASNA 2DLNA 3I4MJ 2ZM6H 1KJ8A 3HRMA 1OKRA 3FK7A 3OTOH 2DQRA 2ZKZA 4EYHB 1P4XA 3L2CA 3D0SA 1O3QA 4GC7A 1S10A 1QU3A 1B8IB 4YP3A 2COIA 3H0GG 4IXAA 2WV1A 1A6QA 4FGRA 4L18B 1EF4A 1WJAA 4IHTA 5I47A 1N33H 4PDBA 3HPGA 3ONQA 5BWVA 3X2QH 3CLQA 4A3KJ 1I6HJ 1DGWY 4FX0A 1T39A 2NU9B 2OPTA 1SAUA 5EEHA 1X58A 2ELKA 4BUPA 3V8KA 4DYCA 3JRBA 1K61A 1H88C 3N8DA 4EYIB 1I3AA 5K7FA 2HYFA 2X9DA 5AIQA 5HLIA 5BOXA 1BJAA 3T54A 1CKMA 2HTSA 2W4SA 1T8IA 4OIPF 3BZKA 4LF9H 1LQ1A 1FPQA 4RA2A 4MQ9F 4M3DA 2WAQA 4Y13A 1BBYA 1WJ5A 3OYCA 1UHSA 1EJ9A 3PVXA 2MSYA 1YITI 4NXMH 4LFBH 2JUGA 3BLYA 4P55A 3A01A 3VPCA 4JI8H 2VC1A 4KN7X 5DM7F 1C0WA 1T0FA 2HOEA 3EYIA 1A04A 3LSHA 2QSGX 5IP9J 3F6VA 5CVUA 4N0BA 1P7IA 4U7BA 5DLFA 4WWCA 2EV6A 3G2BA 2YU3A 3O8GA 3RBEA 2P8TA 4J9NA 1SFXA 1U9OA 3MKLA 2R7FA 3OYHA 4UFZA 2R7ZJ 2LF8A 1GXQA 4HX4A 1T6SA 3PFIA 4Y8VB 4ECSA 1R9TA 2VBXA 3H1CA 4L1KA 2V1NA 3ULQB 1AA7A 4YR3A 1T08B 4B3TH 4NB5A 1JT0A 3GF2A 5K1YA 2Z2SB 2M1BA 1CQJB 5BWUA 2RQQA 2Y0SE 2IA0A 4O2AF 5J2TF 2K9QA 3GEZA 4MFEA 4M6YA 2FE3A 2VQDA 3R9RA 3CF5F 5E20A 3T1HH 2QSHX 1HSJA 3BROA 4G7ZF 4K2EA 5KT3A 5ICEA 5DD4A 2XCAA 4HV6A 4MGRA 1REPC 2R7UA 4I4TF 3JRAA 2TRTA 4RZRA 2AQ4A 3GTOA 2PMZN 1IBKH 3JRDA 4RBOA 4HDVA 2HYJA 1W0UA 4RUAA 1E4GT 3RKXA 3QU3A 3TIIA 4JX4A 4R8UA 3VOTA 5B5EC 1Z7LA 3OIQA 3S2HJ 2V6CA 3BG5A 2ICWG 3CMAI 5KK1A 2C2RA 1OFCX 3U9GA 4EJOA 3M07A 5J1RA 1VQMI 5KFBA 4Z2YA 5D5WB 3T8RA 4XICA 4BEHB 4FFLA 2JA2A 2GXBA 5KS8A 4L0ZB 5J4YA 2DWCA 2R7ZA 2LR8A 1PX2A 1S9HA 4JV0A 1FY7A 4ZYAA 1A5JA 1KYWA 3KYDB 4W97A 1YJWI 2A1HA 2VQCA 3KEQA 2CNUA 2E5LH 1IAWA 3WWHA 1BI3A 2V5AA 4KFCA 1UG2A 2C35B 3ZQFA 2NNYA 1X1PA 1EUDB 3K3PA 1MJBA 5E17F 4RCNA 3OYNA 1F5TA 3O8HA 3WTVC 4Q8EA 1QZYA 4B3XA 5HDNA 2IMWP 2R7OA 4CMFA 3MKWB 4G12A 2FK2A 3ZQIA 1MH4A 3I59B 5DD8A 2W9CB 2JA5A 4MV1A 1NH3A 1T95A 2MW8A 1BNCA 1N75A 1XD7A 3D5RC 1ZAOA 3TO6A 2R7VA 4WXCA 1BJTA 5J47A 2PG4A 2QYOA 4G8XA 1FOKA 1BR4A 5CLSA 1IRFA 2FBIA 4J9MA 2JA6A 4CZZA 3Q3SA 2XASA 2DIKA 3WHBA 2V9VA 1ACIA 4RLQA 1FWZA 3IH2A 4RUCA 4FHTA 3L9FA 2UUAH 5GONF 2L7MP 3DTGA 2V4RA 3L2UA 2X51A 1R5GA 3NQOA 4BEHA 2EJRA 1M6VA 3KEYA 3JSLA 2MD5A 4M3BA 2ACJA 4HW0A 5D5XB 1IGNA 5DG7A 2H09A 2W00A 3GTPJ 4KT6A 2BW3A 2OCEA 1ZLKA 5L9XA 1J5EH 3C7JA 3FMAA 3V7SA 1XMXA 1RZ4A 2JPCA 3QP6A 2QENA 3D5LA 5H20A 4J9SA 2C28A 1SC7A 3KP6A 4AM3A 4U0VA 5ILSA 4XNFA 2EILH 3GIPA 4M9ZA 4A3MG 3AG2H 1XC5A 3CC4I 1MBFA 5DCFA 1TT5B 3IH4A 2Z9OA 4MQVA 3N6XA 1HR0H 1HDPA 1Q1VA 3P9IA 3LSRA 3GFIA 2KRHA 3ABTA 2CV0A 5C8YF 4BXXG 1JKQC 4DV7H 2E34A 3EUAA 1V55H 4X1EA 5JI6A 4KISA 1W7PD 2EZKA 3C18A 2FF4A 4EJUA 1BXRA 1WRJA 2J9GA 1USTA 4FT8A 3F0CA 1UC8A 1LFBA 2JSPA 1CF7B 3V42A 3Q0VA 3S1QJ 4MV8A 1RJQA 3KZIC 1G3TA 2UWMA 2LKSA 3RCOA 2FK1A 2CNVA 5KHDA 1MBKA 1XCBA 2DMNA 3OY9A 5K2MA 2VT2A 3UZBA 1K78A 5JUMA 3I56I 2MCTA 2XGPA 1TNSA 2CKZB 4IVNA 4DL7A 5GTIC 1LVAA 2VOBA 3CCVI 2XAQA 4RNNA 3IN5A 4EM2A 3EUKL 3G8DA 3PW4A 1KUTA 2Y0MA 3E5XA 2R93A 2W7PA 1YJ9I 2F2EA 4BJTA 4TV8F 4CC5A 2VODA 2UXNA 4PZJA 4MHGA 2RDPA 2VBZA 2KHMA 3GIDA 3CCRI 2Z1DA 1MMDA 2CS3A 4YR0A 1GYFA 5BYAA 2DA7A 2LFBA 1Y0NA 2XAFA 4DBRA 3HRUA 2WYOA 1I50A 2EV0A 2X48A 4O86A 5JVLA 5KFSA 3DU5A 1OMIA 1QO0D 5D1OA 3FXKA 1ZKGA 4J9KA 4X64H 5DCMB 3CCLI 2XHKA 5M5YJ 3G1LA 3M3YJ 4XIDA 4XL9A 4DL5A 3H3UA 4QWEA 1R7JA 3PO2G 1ETWA 4O7LA 3S16J 5GPCA 2QZ8A 4M74A 1KJQA 4RGUA 2ISYA 4Q4ZF 4TM5A 1J2XA 1YHQI 1HNWH 1J9IA 3I4NJ 2GIVA 2VUMJ 4JQFA 4Y33A 1XGNA 3SJMA 1A0GA 5I5WA 2X1DA 1T3NA 3MD2A 4A3GG 3W1GA 4A3MJ 1K78B 3H0GJ 5BR8H 2NXNB 4KITB 5K5OA 3HB9A 5FLXZ 2MG4A 3ZOBA 5IP7G 5D5VB 2GOMA 2V9PA 4R8HA 5DAAA 2YX4A 2Q8KA 3QPSA 2D1VA 3DTIA 1FMWA 2K4JA 4LSAA 3F8NA 1EV7A 4EATA 1I2LA 2EZHA 4TV9F 3MKZA 2H8RA 2G7UA 1HNXH 4C30A 1HKSA 2VOPA 4RNOA 3K6GA 1TZLA 1LDDA 3LSJA 5D1OB 4U6PA 3ZPLA 4HNUA 2EIJH 1U78A 4LB6B 3L4JA 3HTUA 4ECTA 4OU0A 4M71A 3V8LA 3FWEA 4U0YA 2EWNA 3L2QA 2R5YB 3KEOA 4RM2A 2ZNYA 4LF8H 3K4LA 2W8KA 2R8HA 3Q0WA 4ESFA 2F5VA 3DBHB 3E6CC 3HOSA 4E7SA 1D1CA 2YS7A 3ERED 5KT7A 2ZFWA 5F1JA 2JMWA 1S7EA 4L9JA 1S97A 4ZOLF 1EKEA 4UVBA 1F36A 5EEGA 2ZDQA 2LBFA 4E70A 4BE2A 4OAYA 2J6SA 3FK6A 4M9XA 5ED4A 4HX7A 4MEXF 2HR3A 1LFUP 2PJRA 3Q8SB 1ETYA 1GHCA 3T9FA 1B59A 3TP0A 1X1AA 4M72A 4C2UA 1E0EA 1GSOA 3I59A 4B09A 2EJ3A 3CMMA 1S72I 3CJRB 2K7LA 4EQQA 3BQ0A 1R23A 4BXXJ 3FBIB 5LHIA 4NNJA 4V19K 3U9TA 2F4VH 4A3BG 5BWTA 4UCUA 1JHFA 1V4RA 2HPIA 3BCAA 4DUZH 2HFHA 1R1VA 1KONA 2FOKA 4C2MA 1H0MA 1BN5A 2AQEA 3QYFA 3DEEA 1U5TC 2IP2A 3KHHA 1ZK8A 3GIIA 3GILA 2LSOA 4AC0A 2RF4A 2MH2A 1DGRM 4MV3A 4UXNA 3WWIA 1ET0A 5C1PA 3GTLA 3IAS2 4Q44A 3WGIA 1S0OA 4HA8A 3WNZA 3U9SA 4O3PA 5LYJF 2GQQA 4UV8A 3BR5A 3PR4A 3GZNB 1JDEA 2QWWA 4IWYA 2LOOA 3IWFA 3WE3A 4ZYDA 3UKGA 1FZPB 3LAJA 3DXJF 1KA8A 3FXJA 3AFHA 4LK0F 3OL3A 2P4WA 3NC0B 3T9DA 2O7OA 5CA1F 4KMUX 2QCOA 3DU6A 3N40P 3CO7C 4HSTA 2VN2A 2K3FA 3RQIA 5CKTA 5K5QA 3COAC 4BHCA 2OLSA 1FKAH 2Z04A 2DA6A 2DYSH 3WTZA 5L3GA 4O82A 1CS0A 4RNMA 1TT0A 5J8FA 5EZYF 1XB4A 3HTSB 2E2HA 3FIWA 5DUKA 2WY7Q 1D3YA 2HS5A 5E1XA 1VBHA 3H9GA 3W3CA 2FJZA 5CR5A 3K3VA 3HC7A 2Q1ZB 3RGXA 2HKXA 1VQPI 2P7CB 5LMNH 3HGYA 3GYHX 4II3A 3TO9A 4LG3A 2VQFH 3HKZA 4F91B 2L02A 4BBSJ 2DU9A 2JRTA 1H8AC 3EPGA 3M9AA 5TJJA 3FKJA 3N43B 2I8DA 4M73A 1S8NA 3CUQC 1IN8A 3BG6A 3S17J 2JJ7A 1FBQA 1KU7A 1W93A 4MTDA 2HIXA 1EH6A 3GTGJ 1KZHA 4MIMA 3HXLA 4OOIA 5HLGA 2PQ8A 3IKTA 4XYLB 3GCMA 2W57A 4Q47A 4MLOA 4PJMA 1S5LC 2P5KA 3BG9A 5HNFA 3LA7A 4JI3H 4JI7H 3WG7H 4NUBA 2QLZA 4A2UA 4IQJA 3KALA 2AO9A 3BJ6A 4ECQA 1SFEA 2DA2A 3NWSA 1HBXG 2JA7G 1IN4A 2JZYA 2KPMA 3GV8B 1XSDA 2IS1A 3M4IA 4G6QA 4FCYA 1PK8A 1P7JA 5KFDA 4RZQA 2C2DA 2V58A 3O2PE 5BNGA 1I3QJ 1ZGJA 2TCTA 4RB0A 4CZCA 4ECYA 4Q4CA 2ZMEC 3E7LA 2J5OA 1XDSA 4D0PA 2IS6A 2NU8B 1YW8A 1FTZA 1DIKA 3KE2A 4IRHA 3K9TA 4ITVA 3NBZB 1B6AA 2VQHA 1GV5A 2E5ZA 1Y1VA 2PBIA 5K3WA 2J6TA 4XN3A 2W6NA 3QYBA 3BC8A 1NG7A 4KHPH 4GLWA 4IOCF 4PJNA 2IA1A 3R5HA 1DV2A 3F21A 2QQAA 4CCMA 4CKEA 4HAMA 3Q1KA 4I2OA 3U21A 3LSPA 3E97A 3R60A 4IRKA 2Y2ZA 4O4JF 4IPAA 1FLIA 2WTEA 3FDYA 4IL6C 2DJIA 4XKVA 2LKXA 4NDLA 3MFKA 4ENKA 2NVTJ 2GOXB 3BR1A 4N9IA 1QNTA 2H6BA 3PL8A 2L7FP 3I58A 3HOTA 2DMUA 3HOYJ 3S24A 5ICFA 3DPLC 2V1DA 4HEA2 4UHTA 2Q2TA 4CHIA 4JI4H 3MQ0A 2FX0A 3RKYA 2FBKA 4Y17A 3VPDA 3CCJI 2MABA 3QOPA 5KKNB 3ECHA 1VBGA 2WWYA 1E3OC 4ED0A 2BHYA 5IT9W 2M4KA 3KYCB 4FFRA 2VJJA 2JA8G 4RGXA 3ZMSA 2EQRA 4RAZA 2NS0A 4FASD 4Y52J 3QQMA 4C2TA 3UFXB 4L9NA 1O7FA 4MV7A 1XX5A 1FP2A 4NXNH 1XCVA 3LOCA 3KCCA 2B0LA 3I4PA 4Q8FA 3R0AA 3K4JA 4LLLA 3OIPA 3ZMUA 1VQ7I 4FFOA 3FMRA 5C44G 3QPHA 3MCZA 2M3AA 1G2HA 5HBRB 3CDIA 3CTAA 1P92A 5K5RA 1TNTA 3FXQA 3I3LA 3K4CA 3MR6A 1WZ2A 4O7NA 2I87A 4D9JA 5IOZA 2JT1A 3ELKA 1U3EM 2FP4B 2HOSA 1PYVA 3IG0A 3S1RJ 1RIOH 2HDWA 5KFIA 2LREA 5GAGJ 2JEIA 3WTWC 3QYEA 4C3HJ 1U9NA 4FTHA 2XGCA 2ZB9A 4J9PA 4ME6A 3NARA 2HVSA 2OD5A 3WHCA 3HUGB 2GXAA 2VQEH 3GTMA 3RGZA 2WDTA 3HOVG 1IF1A 1X2MA 2QB5A 2HU9A 3ZGKA 5EG0A 3DFGA 2F5EA 1H89C 4A3DG 1JE8A 3FMQA 4EEYA 1SMYF 1QPIA 2WB1E 2QGUA 2EA2A 2XC7A 3QZ8A 2DLLA 5EGOB 1VAJA 3D5SC 1IUYA 4DV0H 1U5TB 5BWRA 2DMPA 5E3MA 5DGAA 3RDIA 2E60A 5HDKA 4ETSA 2PI0A 3OHBA 2HEOA 1E17A 4O83A 3SNOA 1IXRC 5DS9A 1MBEA 2EJ0A 3HOYG 5D6FA 1TWFA 4A3LJ 2COMA 1B9MA 4WF2A 4RGSA 3LULA 1WH5A 2O6GE 2KSWA 1JGSA 1Y6IA 1QVUA 1NTCA 3TEDA 1W36D 2W9BB 5GPAA 2RQPA 2CGPA 3R23A 2XGQA 3TW6A 4EBEA 4DW6A 3BCBA 3HHHA 2EIYA 2WAQN 4B3MH 1B04A 4BNCA 3JR9A 3J7YJ 3DBRB 2LY1A 3PO3G 3KAJA 1J75A 5IOYA 5FNVF 3HM5A 1K4SA 1DQUA 1Z0XA 4BS9A 3GTMJ 5KFZA 4DV1H 1KQ8A 2VL8A 2W6QA 4JI6H 4O7RA 2KT0A 1MMSA 2YUSA 2STWA 3TY5A 5KFXA 4AYBN 3T5HA 3IKVA 1O4XA 2BQRA 3DP7A 2R7NA 1JKRC 2JTVA 1B4AA 2XPUA 3AL0B 3RIRA 5KFUA 2KIUA 4ED3A 3OWTA 2VXDA 3IP4B 2FQ4A 4LGWA 3GQCA 3G73A 2A6TA 2CFXA 2JWTA 2V26A 3V6HA 3SZTA 4UB8C 4A0YA 3N4MA 2QKLB 1D5VA 1Z6TA 1MMGA 3FKIJ 1BOAA 1SVOA 2EH3A 5I5YA 2WBMA 1TWGJ 4J9OA 1MH3A 4O7YA 3O3KA 4AYBE 4LF7H 1AKHA 4DR4H 3KP2A 2IGMA 2ZXIA 1YTYA 5E1ZB 1SFOA 3TY8A 4JUZA 2P6SA 1U8BA 1N48A 1O75A 4IHSA 2R7KA 5FFZA 3TO7A 3KPHA 4ZDLA 4A3JJ 3HGGA 1QGPA 4YFNF 3BTIA 2IPQX 1JKOC 3PNVA 5DEQA 1OCTC 1MDMB 2STTA 1LNWA 1X3ZB 4PFPA 2VPLA 1R5HA 1BI0A 3B73A 4I98B 4QPOA 4EJVA 4UCRA 2KRFA 1AOYA 2RGRA 2ADUA 4DZPA 4AQYH 3LMLA 2Q0OA 1HW5A 4BH9A 5F0CA 1AWCA 4A3IG 1K83A 1VKZA 3PR5B 2RGVA 1A35A 5EGOA 1IN6A 2X4HA 2Z33A 3IAM2 1JGGA 2AXLA 3HOXG 2ZFUA 2G9WA 4ANJA 2HVRA 3PNYA 4EJTA 2WB1A 1WH7A 1JKJB 3RV4A 4F55A 4ESBA 3WU1B 3ZQQA 1YI2I 4F93B 4CMDA 3GJXB 4ZYEA 1WRVA 3E5QA 1O3SA 1D8KA 3HRSA 2W71A 5F64A 2X0SA 3B6CA 1XMAA 2E71A 1M7JA 3LSTA 5DM6F 1SFKA 4XX0B 4QW9A 4ZHQF 3F23A 2R8KA 3A01B 5CVRA 2ELJA 4B43A 4M9UA 2A3SA 2HGCA 4XLHA 1DP3A 3CEBA 4JV2A 4BQNA 4E7LA 3CESA 1G2WA 1R00A 2O8XA 1RK5A 2VQLA 4FQGA 2JRMA 1OYYA 1SCUB 2COJA 2GIZA 1E3PA 3BABA 5I5SA 3I54A 2KZVA 4ZH4F 1EKFA 2X1CA 1B8IA 2GA1A 1YYVA 5LRSA 1RJRA 5KFQA 1JT6A 2XKPA 2XVCA 4J9LA 1ZYRF 2KQRA 4I7HA 1BR2A 5L3BA 2DPDA 4BQAA 2M0CA 2R82A 4IR9A 2V1XA 3I0TA 3CLOA 2DMTA 3G4SI 2EINH 4HQEA 4IHJF 3CDHA 4O84A 5J8CA 3N42B 3OYGA 1T94A 4FETA 1SAXA 1XGSA 1WR2A 5DG9A 2JUCA 3J80W 1TBXA 2HOAA 3GBGA 2BY1A 4RM3A 2R7RA 2D1HA 1ZQ3P 4BJ5C 1V4YA 3OSNA 5B1BH 3A0HC 2NVXJ 5FKNA 3DQVC 1JX4A 2CSOA 3JREA 1V9PA 2GPSA 3MWMA 2V9WA 3TQTA 1ZHFA 2DT6A 5KFWA 2V1UA 4ED1A 3C2GA 4I02A 3E6BA 4ZDPA 5D8LB 1GXPA 5IY5H 3RQ4A 2WE6A 4JI2H 4EM0B 2RNGA 1Z67A 4O4LF 1P2FA 3T5LA 5KX5F 1N25A 2QSFX 3H5AA 3WU0A 1IC8A 4ECWA 4IF4A 3CO6C 3JSNA 2W6ZA 1YQAA 1YJNI 4J9QA 1RI7A 2OQGA 1MNDA 2XDVA 4RAFA 2XAGA 1BW5A 1KGSA 5LGUA 5GP9A 3HOUG 2GLTA 4DL3A 4O7ZA 3C3WA 2DAOA 3IC7A 1I1MA 4J01A 4E6KG 1YFHA 3CJNA 3S15J 2LMDA 5D1PA 5L3FA 2F4IA 3ZCOA 3OYBA 3CP8A 2CQKA 2FLPA 4EEFG 2UUCH 3F8MA 3BP8A 5F6FA 2NVXA 2MLGA 4ZTJA 2GQSA 3R5XA 4LFCH 1Z21A 1MNMC 2CV2A 3PNTA 4G3IA 1FJGH 4LLNA 2LY9A 4XOTA 4I50F 4DLKA 2YS9A 3KP4A 4LG0A 2Y31A 2L4MA 5FGMA 2KKOA 3G3ZA 5TGTA 5IT9Z 1FNNA 4EM1A 2HPMA 1MSEC 1UCRA 1W7PB 3SZGA 3RZDJ 1RKWA 1D5YA 1BIAA 2OAZA 2IGNA 3J7AO 2R5ZB 3LFUA 4QIWA 1KYZA 1X2NA 4LF4H 5IP7J 1B33N 3W2AA 2F5DA 1YRNB 5BPHA 3OYIA 3HOWG 3VSKA 1I6XA 1Z3YA 4BY7J 5E3OA 2K9NA 3BZCA 1KEEA 1YO5C 1LVKA 1VQ4I 3H0DA 2X5RA 3T9CA 5IYCG 3JW4A 3Q8QB 2ME6A 2VPQA 2L5QA 2YS6A 5BPIA 4Q5SF 4MV4A 1W5TA 1HW2A 4M0JA 2ZSIB 3SZPA 2JK3A 1TQIA 3HEFA 1DV1A 5KFYA 5HDGA 5F9LA 3C2HA 3H0GA 5CPRB 3HOWJ 4PCQA 2W48A 4GDFA 4DIQA 4ESJA 2FRHA 2OBPA 4O6JA 4HG2A 5F27A 3K2ZA 2K9LA 5KFJA 1FSHA 2RC4A 3ZQHA 3R61A 4BAYA 1FVIA 1IRXA 2KJCA 3V4SA 3UYYA 1SD6A 3QAHA 1ITYA 4Y4RA 3VMMA 1XSXA 4CO8A 1S9FA 5D4SA 1B6RA 4V2FA 3KHRA 5E8GA 1Y1WJ 2DTZA 3SHFA 4DJAA 2W6MA 3KXYT 1B72A 2I80A 3WTSC 1QVTA 1R49A 2NNNA 2R0QC 2R87A 5CQGA 5LFAA 2F5FA 1XGOA 3DTEA 2YZMA 1W4MA 4AVPA 1OBGA 5FJ8G 2ODTX 1CKNA 2CQ7A 5BWXA 5KFFA 5BMVF 5IYCJ 2M9HA 3ABKH 1UHWA 3F8BA 3KETA 2AHQA 3MZHA 1U6GA 2EB7A 5DTDA 2OTJI 3H92A 4M3EA 4CSWA 1S0MA 2CUFA 5FRMA 4BQQA 1JDBB 3U0GA 4HNVA 5KFMA 1TTYA 4LIVA 3BQZA 3H4DA 1GLVA 3QPLA 4B44A 2RAEA 2Y0SA 2W9BA 4DV3H 2DBBA 2NVYJ 3T5KA 5LA6F 1RPWA 3KYHC 1IN5A 3BPXA 3TBIA 2D45A 3TDZC 3HKZE 1LUJB 1YW9A 5BMZA 3V4GA 3CD6I 1X1DA 4AIJA 1K79A 3AAFA 5IYDG 5GAEJ 1MJ9A 2DFIA 2BY3A 1T0FC 3IL2A 4EFEA 2YZGA 4A3KG 2UXCH 4IJAA 1W1WE 1FYMA 3GWZA 3K2AA 4UCTA 2DA4A 4O5VA 2O5RA 3WTUC 2E1CA 2O61A 2IA2A 2V59A 3T1BA 2L7KA 2YCHA 2JEGA 3DV8A 1WI9A 4I0AA 2YU9J 2R7XA 3EUHC 3WE2A 1P9QC 2HIVA 5D8KB 5ILUA 1Z2PX 3G1MA 4PDKA 2JQ7A 2WC2A 4BBRG 3T9BA 4QSHA 1WJFA 1OLTA 3OYKA 3CCEI 2ESHA 5IT9K 3HSEA 1ZAUA 4HR7A 1OWTA 3RIZA 2DDAA 2G7HA 2M7AA 4RDUA 2FEZA 1TWAA 4IRGA 3RBDA 3RB0A 3RB6A 3HJEA 5E1WA 2YZNA 4UUTA 2B63G 3MVPA 4YG2F 2W9AA 4F50A 2X6OA 4AUXA 3J81W 3JRCA 5LXTF 3JSPA 4AIDA 4EV0A 1LJ9A 2UV1A 4ON0A 1LFPA 4W1UA 4CCJA 3F3XA 5FKLA 1NK3P 1ZHQA 4O3SA 2R7ZG 4LF5H 3OOUA 1Z9CA 2NS7A 2UXDH 4M6VA 1UJ8A 1W7PA 1Y8RB 1WJDA 4L0YB 4YB8B 3TDUC 1FYKA 2EV5A 3GV7B 5A2QZ 1VI0A 1I7LA 1VQOI 3V6JA 4S0HB 5KFCA 2BEOA 2UVRA 5KT5A 3KHLA 2XD4A 1G3WA 4NC8A 2R84A 2VT3A 3J81K 3GFLA 5KFTA 2ASDA 2WA0A 3WTXC 3TMOA 1VS0A 2YZLA 2XROA 4WHXA 3SYTA 3WODF 1J0RA 1ZH5A 5EZGA 3ZN1A 2DXIA 4AYBA 1HF0A 4O4HF 5ERIA 2XAJA 5IYZF 2JA6G 1K83J 4CYCA 3GB8B 4Z6YA 1MMAA 3W1BA 2W7NA 2I8CA 2XV4S 2JVGA 3L1PA 2DODA 2CFOA 4KIBA 3S2WA 1QQIA 3CF2A 4UNOA 5CAEB 2R92A 3I5UA 5L3DA 4MA5A 3GTKJ 3GIJA 3CQZJ 3K1MA 4R1HA 2HGWA 3SQNA 3SI8A 4HYKA 1KU3A 3L2RA 3ETHA 5K7ZA 4C2MJ 1YOVB 5KFHA 3BQYA 2AGOA 3FXOA 1BM9A 3KAKA 2VXZA 4XRSG 4JV5H 4EJWA 1UELB 4PWQA 2ZSHB 5M3MJ 4PZ8A 1QA6A 5CA0F 2XB5A 5DQHA 5FD6A 4XOPA 1B1BA 3OOPA 4L5JA 4F4WA 1FIAA 3CMYA 4YFXF 3FISA 3K4MA 4QW8A 5B3SH 5IYBJ 2Z16A 2VI6A 3W6JB 2M5WA 5HNHA 3PFYA 2QK4A 5KG0A 4APMA 3E1SA 2WTFA 2EFOA 3WGGA 3GTKA 1VQ8I 3WO1A 2K27A 5LLQA 1DU0A 3ASNH 4DV6H 3PIOF 4O7SA 1SEIA 3DTFA 4AWXB 2DTRA 1E4EA 3T99A 3UNGC 4S05A 1XPXA 1BI1A 3CMEI 1E4EB 4A3BJ 1HLVA 2Q2UA 4BY1G 2L3DA 3QOEA 3ABUA 5F9NA 1W96A 4BXFA 1JJ8C 2RDIA 2DOEA 1MKMA 2NRAC 1KU2A 4OIOF 3HO8A 1WCMG 5KG3A 2QQ8A 1HXDA 1Y56A 2QQ9A 2EFWA 2H1LA 2CG4A 2MFZA 1JLLB 1WJBA 1RYRA 1W5SA 1S6LA 2F48A 5CVJA 3QZ7A 2GWRA 5JFRA 2BY2A 4Q48A 1OYIA 3EPIA 2Q7DA 2JA6J 2XKOA 2EK5A 2O3FA 2ZJPF 4A3CJ 4D5FA 1IV8A 2WADA 5J40A 3P9CA 2D2WA 2P0WA 3BACA 2FNAA 1T36A 3TQ1A 3S1NJ 3WO0A 3CC7I 3OYAA 1WKMA 4XLPF 5KFGA 5KFNA 2VQGA 1YRNA 2DPJA 1X9NA 4IWXA 3F6OA 4I09A 1MMNA 2BY0A 4RB3C 1OQYA 4A2BA 1K1QA 3MFHA 2DMQA 4CCOA 2ZGIA 2MBFA 3GTGA 4QWAA 5L1KA 1XDUA 3J81Z 3E0JB 4O7WA 1MJAA 3U2RA 4CDGA 5H80A 2R8GA 3PSIA 2HQRA 1EHIA 5E79C 2XCLA 3JZFA 2IA6A 3BR3A 3BPVA 3CCUI 5C3EJ 4ENJA 2HQNA 1ZGWA 1A36A 1V5GA 3EUHA 2HXIA 4M6XA 2HDCA 1UAAA 3Q9VA 2VASA 1Y1VJ 3IRQA 5KG7A 3WG9A 1PDNC 1USSA 2Q2EB 2R4GA 5B1AH 5KAFC 3RPUD 1JHHA 5L3CA 2E2JJ 2JSCA 1ULYA 2CRGA 1F4KA 1YW7A 4DR5H 4LB5A 4CGZA 1HQCA 3BTJA 4YFKF 5HLTA 3S3MA 3M9MB 4OMZA 4FS2A 4O3RA 2NVYA 4K6NA 2H1KA 1EKVA 5M5XJ 2UZKA 5LHHA 4E7ZA 5LEJA 3MR3A 1JXLA 2E1MC 3PQJA 2FU4A 1WI3A 2H6CA 5JQGF 1YLFA 4GYIA 4XK4A 3TQNA 4EGYA 2ZDGA 5C4XJ 2E7WA 2VA2A 3NWTA 4JYKA 2A5WA 4GXOA 4J0MA 1KBLA 5FO5A 3G6EI 1FOYA 2FLNA 3OV8A 4OINF 2H27A 4G94A 4NZNA 2YR2A 4FS1A 2DK8A 1TP4A 4UUVA 4RB1A 4R79A 2HGSA 4EEQA 4O7TA 3FMSA 3OYLA 5E3LA 2IBKA 5CVIA 2WAFA 4DR7H 3U1KA 5KG5A 2XGXA 3S32A 5ICGA 2KDOA 2HVQA 2LF7A 4IEJA 4IRDA 2XRNA 3H40A 3VYTB 1GUUA 4CC6A 4TV7A 1M0WA 5KFOA 3GX4X 3AG3H 4IR1A 3JZ6A 1AU7A 4O3MA 4FE4A 2M05A 3TOAA 4HRIA 1IBMH 5B66C 3M8EA 5LD2C 4A3FG 4A3EG 2LDUA 2VC0A 3BWGA 2NVUB 4IX7A 2OA4A 2FMAA 3M9NB 3UZOA 3QPTA 3GZ5A 1Y0UA 3M7GA 5KFLA 4O3QA 3HG9A 4FBTA 2LLKA 5M3FJ 2V4JC 1KC7A 4U7CA 4TUYF 1FYLA 3R4KA 3JTGA 3DEWA 4M3FA 3HOXJ 2HDKA 4CKCA 4LH7A 2QUFA 1TW2A 4NQWB 2FB9A 3OUZA 2QA4I 1PUFA 5LGTA 4XLFA 2FBHA 2VBYA 2P7VB 1J59A 1X4PA 1P8LA 3TEKA 2UVWA 4IO9F 4DYRA 2LP0A 3FF5A 5BWWA 2CUJA 1E2XA 2DA5A 4DNCA 1I94H 1Z2OX 5DMXA 3KX2A 3R0JA 4HYEA 2Y30A 3QRFF 2JA7J 2FK3A 2K9SA 3HOZJ 2KDZA 1RK6A 2QQBA 1HW1A 3TY9A 3DKWA 4BHPA 5EDWA 1KTAA 3RV3A 4A93G 3BDDA 3G6XA 3MZ8A 4PBCA 2DAAA 4EMSA 2VONA 1R5ID 5E8IA 3N6RA 4JXUA 1K4TA 2AS5F 5TRDA 3ZMVA 4L9TA 2WAQE 1GGOA 4HOBA 1HKTA 1Z2NX 5EWEA 5A2QW 1DDNA 4E7JA 3ETJA 3LWFA 1TAEA 1I1LA 4DR3H 1V3FA 1CQIB 2DT5A 2ZC2A 4RB2C 4I55F 4F4YA 2PJPA 2L01A 5HOOA 4CHUA 3OR2C 2E2IA 3GLXA 1O57A 1GO3E 2VUMA 2V4QA 1T33A 2VE8A 3BTLA 4XZ3B 3OHAA 3RR5A 2XF5A 5F1RA 5E3NA 1MSFC 4C5AA 2HOTA 4BWSC 1IDYA 4A0XA 2DPIA 1JUPA 1OYWA 2KL4A 4ABZA 3GIKA 1GT0C 1VNDA 2R5ZA 1BA5A 1Z1DA 2R93G 2PEXA 2DO7A 3EPZA 1ZARA 1I6UA 2OUMA 1FP1D 3JAMW 1R36A 4GGGA 2MGQA 5FLMG 3I64A 3RFCA 3F72A 3UQ8A 2J6UA 2BZTA 3O6BB 5AIPA 4L5EA 3OYJA 5DQIA 2VIXA 3JSOA 4UCOA 2HXOA 5KFKA 2HHHH 4YJ2F 2KLOA 2PN6A 3KYLA 4Y15A 4YAKB 1IW7F 5T14A 1MBJA 4HLXA 2HHFA 4BQOA 1MD0A 1JXSA 2FOWA 5KT4A 2COBA 1JUSA 1T2KA 2RREA 1A31A 5LGNA 2R93J 4KNYA 3CQZA 1WH2A 1R6RA 4IRCA 1BR1A 4CE5A 1YG2A 2PBZA 5IP6A 1IUFA 3K5IA 3FKIA 4XKBA 4H4KC 1IV6A 3AG4H 1JTXA 3PUBA 5HS7A 1VQ9I 3V4ZA 3ISPA 3M4OJ 1F9NA 2ASJA 4DRFA 5J2UF 5JLWA 1EA3A 4O2BF 2KMUA 5FLXK 4HQ6A 2B63A 2K40A 2X0LA 4BY1J 3KLOA 1S29A 1DUXC 4MAMA 1R4MB 3DF8A 2QEXI 4BBSG 1M0TA 2GAUA 3T9AA 3K7AJ 1XMQH 4F4ZA 5EZHA 3P7NA 1B72B 2GLOA 3RUPA 3K69A 4AIHA 1X1CA 3HSRA 4E4HA 4HZFA 3RJPA 3T7AA 2NU6B 3MWEA 2X6XA 1UMQA 3N97A 4J00A 3S3OA 5JLXA 1TWHJ 2EIMH 3CUQB 4NBQA 2VB6A 3I9V2 3PQKA 4CYDA 3KP3A 2ZMEB 1T56A 3ZRGA 1TC3C 3ZN0A 1FTTA 2DFFA 3J80K 4A3FJ 2HQAA 2YRXA 2DW4A 3L2PA 3OR1C 4XRMA 2YL2A 3G71I 2H94A 2OWOA 1TA8A 5BPFA 1VQ5I 4PZ7A 3LSIA 2TDXA 3BJAA 1HA8A 3IUOA 2LNBA 3H5NA 3VPRA 1I2KA 3LQSA 4DR2H 3RAXA 1RYSA 4PUSA 1TW3A 4HQMA 4E7IA 3GTLJ 1P6RA 3SEQA 1H9TA 2KISA 4AIKA 1VFCA 4YIIA 1FSEA 4BU2A 3CCMI 4U88A 2PLYA 3VYUB 2HGXA 2W6PA 2XAHA 2DI3A 4QWBA 4JI0H 1GVDA 1TWGA 3R5FA 1S7AA 4XLNF 3RB3A 2R92J 2QM3A 3BQ1A 5KG6A 4CCLA 4ECVA 2FQ3A 4ECZA 4XLAA 3I4MG 2Z5UA 2QKMB 4U0WA 2JEFA 2NAZA 2LG4A 3FM3A 3KHGA 5C3EG 5IT3A 1DP7P 5DGHA 5J3LA 1BGWA 4B4CA 5J1UA 3H35A 5CE8A 1QZZA 3CZ6A 5DV5A 4J19A 1BIBA 4A0ZA 2PN1A 4QWDA 2KIMA 3LQRA 3NEUA 3HKZN 3OSFA 2Y9ZA 3H3VH 3E3VA 4LITA 4I76A 1NK2P 1YS6A 3CC2I 3KP5A 2ECBA 3ZQLA 1POGA 3KLNA 2L9NA 1AUXA 2ID3A 2P6TA 3EDPA 5L3EA 4PGHA 3JAMK 1UNNC 5KFAA 2VUMG 4UCSA 3DTKA 2Y48A 2YYAA 1GSAA 1C30A 2AGPA 4XYMB 4MEYF 1KU9A 3GTJJ 4DUYH 1Q1HA 3I71A 3RZOJ 2NYXA 4XONA 1WPKA 1KQ9A 2FUG2 3UR3C 1QHGA 2CYYA 3HZJA 4C5BA 1KQ0A 4EGQA 1YIJI 1Z05A 1GV2A 3GLLA 1K6YA 2MH9A 2OQRA 3ROUA 2W70A 2A6HF 3FHZA 5L1JA 2BGCA 4MNUA 4LMYA 1D8JA 2YRWA 3VEPA 4IAJA 4ECXA 3GTOJ 2W8LA 2BV6A 2K9MA 1Z3XA 4JBAA 3SEZA 4B3AA 3AW8A 4QWCA 4LIUA 3PM1A 3J7ZI 3RB4A 2FPGB 3QODA 5LBQA 4JI1H 2F5CA 4N4NB 4RGRA 1CKNB 3I4NG 4OWRB 1K7AA 4HDUA 2XGEA 1EYZA 2Z99A 2IXSA 2CV1A 2E1NA 4HBLA 1SVLA 4N4OB 1ULZA 4L9VA 4DQ2A 4ZJZA 3V6KA 4HLYA 5D4RA 4B3SH 5HVQC 2M7BA 1XS9A 2V7FA 2HKOA 2DDBA 1IOVA 2R8JA 3DLAA 1I5ZA 2L54A 5GADJ 5KFPA 1F43A 1WCMJ 3MMYB 3RPQA 2R6FA 2O03A 1IJWC 4OMYA 1SEUA 1T98A 4JK1X 2FMLA 1N34H 1I39A 4GKKH 5EF6A 4IOAF 1DGSA 2IJLA 3CCYA 3GFJA 3MZYA 4RAGA 2ABJA 2V6EA 2CQQA 5H2FC 5H6QA 4DYQA 3GTQJ 4F3QA 9ANTA 3AX6A 2CU7A 3FXUA 1Z7UA 2CW0F 3WTTC 2F4OB 6PAXA 2WV0A 5DISC 4MV6A 5CB4F 1LDKB 1PUFB 1R71A 4E7HA 4YQWA 4ED2A 1G8XA 3ZMZA 3DKYA 2ME0A 4XQFA 1RESA 2CH0A 1BOBA 2IEKA 4FU0A 3VFZA 2GPWA 3EQLF 1ZQ7A 2P5VA 1PVEA 2JPBA 2ZBKA 3GV5B 4YBZB 3CVZA 4PJLA 5H6RA 4A3IJ 3JZIA 4EBDA 1A6IA 1GVJA 1UFMA 2B7EA 2W84A 3DCFA 5I5TA 1ZETA 5FLXW 5KAIC 1ODDA 4GC6A 1TLHB 2OC6A 1EKPA 1TWCA 3LQQA 1RNLA 3ZR8X 2VUGA 5I5UA 4P1WA 1LDJA 2A5YB 1I1SA 2GQRA 4IHWA 2M8GX 1J7KA 1IXSB 3WWJA 2VKEA 3S93A 2XAUA 1ENHA 2OV7A 3JRHA 4ZDOA 4LJZF 4QIWN 3T9EA 1ZG1A 5CM0A 3PW2A 1OCRH 1I3QA 4BKXA 3S1MJ 1RR7A 5FD5A 3DAAA 4A12A 2A69F 3FZVA 1ZTRA 4YEJA 3Q2OA 4ED8A 4JI5H 5I5VA 1JKPC 3LFKA 2Z02A 4WBNF 4FX4A 1VF9A 3BAAA 2V79A 3TIGA 1A9XA 2VR1A 1RUOA 2M30A 2NOJB 3I53A 1IG7A 1HSTA 4C3IJ 4BE1A 4E6NA 3WTYC 5KG2A 1N32H 5EWFA 2C22A 1MIJA 1TWCJ 4F52A 4PFOA 3DWLE 1CQTA 2E35A 4QJFA 5KNLA 3ESWB 3V8JA 4AU7A 1LEBA 1XMKA 5FLVA 1DAAA 3HRTA 2FXAA 3MEXA 1QRYA 2UXXA 2HWVA 3GVAA 2N8GA 3PW5A 3U55A 3RKQA 1XDNA 2BXYA 2CQXA 5FKMA 3VWBA 4C3JJ 4M9SA 3S8PA 1S7OA 2CW8A 2ESNA 1SFOJ 2LK2A 3FXLA 2LBFB 1Y8QB 1B9NA 4UUSB 4ZQIA 3PW7A 2XUBA 4MO7A 2MLKA 4FFNA 3FKIG 1Z77A 4KT5C 4UVCA 3BT9A 1ZG3A 1IN7A 2L0KA 4KIGA 4A3CG 2MC3A 1ZR2A 1O7LA 5EJCA 3W6VA 5I60A 1VZ0A 3RYRA 3DF7A 4NYEA 3EETA 3LA3A 1ORKA 4I0BA 2QBYB 2VE9A 4HF2A 2BVMA 1GSHA 4EQ5A 4KN4X 4Y7NJ 1AN7A 4G9YA 4LD5A 1G6NA 3RF2A 3PW0A 2YW2A 2L9RA 4MFDA 4DQNA 5HV6A 3J7AY 2ZJRF 2PVPA 1ZRCA 2IS4A 4X65H 2W9CA 2E19A 4XRFA 4QLCU 4BJ6C 2BOLA 3A4CA 1Z91A 3K1NA 3MJFA 3C0FB 2E1MB 4PJJA 5C1OA 2LD5A 4P9UA 2M45A 3LWBA 3GW2A 4FBUA 1FT9A 3HOZG 1QPMA 2HZTA 3H36A 1CKOA 1AUVA 4TQRA 4A6DA 2GBYA 4DL4A 5DLGA 3W5OA 1D1AA 3BOQA 4CXFA 5CVVA 1A48A 3Q8PB 2BVLA 4DBQA 5IYBG 2HJWA 3N44B 1BW6A 1IOWA 1HC8A 4BDZA 2BHZA 2EFNA 2L9VA 2OZ6A 3KZYA 4YAJB 3RTRA 1WHUA 5BYBA 2FA5A 4ZZDA 1EH8A 4OIRF 3HL2A 2EPFA 1IO2A 5C4XG 4A3EJ 1HOMA 4LFAH 2FMYA 3NRVA 4CUGA 1YX3A 4I99C 1UZCA 5BS6A 1GDTA 5FPRA 4I6ZA 4DL2A 5J1YA 2PFBA 3H4BA 4HSRA 3CCQI 1ETVA 4D7NA 2LVSA 2XIGA 2KP6A 1ON2A 3PFFA 4QPQA 5DG8A 1KJ9A 3J7AK 1AKHB 4X6AJ 5BQTA 1G59A 3G1OA 1IRGA 2LYCA 2ATLA 3RI4A 5ILVA 4ENNA 3H9QA 1APLC 2L7ZA 1YS7A 5FRNA 3WGHA 4A5NA 5M5WJ 5JHUA 1SD7A 4FFMA 3Q8RB 2L4AA 3TINA 4Q45A 4DL6A 1WWXA 3IHUA 1WQ2A 4XMYA 3FXMA 1QHHD 4G7OF 3ABMH 5KT2A 1S03G 1UC9A 2YWVA 3CJQB 3RAQA 2DOFA 4O3NA 1FX7A 2BXZA 1XK5A 5EWGA 1JIHA 4ECRA 2LH9A 1O3RA 1TWHA
chains in the Genus database with same CATH topology
3MKYB 4ETSA 1V5FA 2W4SA 4HNTA 4RB1A 4R79A 2HGSA 4EEQA 4LF9H 4YY3H 2PJRB 3OYLA 1YE9A 2WAQA 1WJCA 1WJ5A 3OYCA 2WAFA 1XMOH 4DR7H 1LKXA 3S32A 3K4KA 1X19A 2KDOA 2KSWA 4NXMH 2HVQA 1Y6IA 4LFBH 2JUGA 3BLYA 1W36D 4JI8H 4G6TB 3VYTB 4CC6A 1M0WA 3BCBA 3LSHA 4B3MH 1B04A 2LY1A 4U7BA 4HRIA 3KAJA 1IBMH 4DV1H 1DQUA 4BS9A 3RSNA 3G2BA 5LD2C 4PZ6A 2VL8A 4UFZA 4JI6H 3OYHA 2WY8Q 4IX7A 5FPOA 3TY5A 4PSWA 2CUZA 3HG9A 1V5EA 2V1NA 1AA7A 3N05A 4B48A 2V4JC 3HPHA 3OYDA 3AL0B 4B3TH 4DV2H 2Z2SB 3OWTA 2VXDA 3IP4B 2RQQA 4LH7A 4NQWB 2A6TA 2V26A 3VYSB 4XLFA 2FE3A 2QKLB 2F6CA 1X4PA 1P8LA 1MMGA 3T1HH 3EYYA 2WBMA 2CUJA 3OS2A 1I94H 1Z2OX 3FBNB 2R7UA 3KX2A 4LF7H 4DR4H 2IGMA 1IBKH 3A1YA 3TL4X 2LRDA 2ZXIA 4RAYA 3TY8A 4MV9A 2UU9H 1E4GT 3K10A 1O75A 4F92B 3OYFA 1Z7LA 3OIQA 4ZDLA 1NG6A 3TY9A 3PNVA 2DT7B 4PFPA 2VPLA 4QPOA 4UCRA 2RGRA 3BG7A 4BEHB 2JA2A 4AQYH 3A2KA 1S9HA 3LMLA 4ZYAA 1Z2NX 5A2QW 4LH6A 2RGVA 2E5LH 4E7JA 2VQCA 3IAM2 3FHNA 3OS1A 1TAEA 4DR3H 2ZFUA 4ANJA 2HVRA 3PNYA 4APMA 2WB1A 3K4BA 4LSXA 4RB2C 4F55A 3J81W 3ZQQA 2L2OA 4F93B 3GJXB 5HOOA 3OR2C 3OYNA 4B3XA 3NBYB 2K3PA 2R7OA 3MKWB 3RR5A 2XF5A 1X4OA 4BL0B 4BWSC 5CQEA 1SFKA 1T95A 1N75A 2KL4A 2X1EA 3D5RC 2ELJA 4B43A 4OAZA 2R7VA 1FMVA 4XLHA 1DP3A 1BJTA 4E7KA 4BQNA 4E7LA 3CESA 4XORA 2X6WA 4YHHH 3EPZA 1W36C 1I6UA 2VQLA 2OUMA 3JAMW 1BR4A 3BABA 3LSKA 3UQ8A 4XM3A 4IZZA 2KZVA 3OYJA 2X1CA 4RLQA 4XLEA 2VIXA 2HHHH 4UCOA 2UUAH 2KQRA 4I7HA 2KLOA 1BR2A 3KYLA 3L2UA 2X51A 4XLCA 1MNEA 4BEHA 3KEYA 3JSLA 4BQOA 2UXBH 3H5RA 2W00A 2RREA 4KT6A 2BW3A 1WH2A 1R6RA 3N42B 1BR1A 3OYGA 4FETA 2VKDA 1J5EH 4XKBA 1GLNA 4H4KC 3FMAA 4CCKA 3PUBA 3J80W 3GBGA 4X62H 4RM3A 2R7RA 3S3NA 4DR6H 3D5LA 4BJ5C 4DRFA 2IGKA 3DQVC 1EA3A 4XKCA 4XNFA 2KMUA 1V9PA 1JI8A 4GRIA 3MWMA 3N6XA 1HR0H 2DT6A 1E4FT 2CV0A 3LSMA 2KRHA 3C2GA 4ZDPA 4JOMA 4DV7H 1M0TA 3RQ4A 3EUAA 4KISA 1XMQH 2VJIA 4BE0A 3VNNA 2WE6A 4JI2H 2RNGA 4LF6H 3H5AA 1X1CA 2JSPA 2LC2A 3V42A 5JHFA 4E4HA 2R7QA 4CCNA 1S68A 3LL7A 4RLFA 2UWMA 2X6XA 3JSNA 3RCOA 4J00A 3S3OA 1MNDA 2XDVA 5KHDA 3OY9A 2VB6A 3I9V2 4ZTFA 2MCTA 4DGWB 3ZRGA 1UG0A 2VOBA 3L4KA 2HQAA 4J01A 4ZC3A 4E6KG 1SYXB 3EUKL 3L2PA 3OR1C 5D1PA 3GDEA 2OWOA 5FROA 2F4IA 1N36H 1TA8A 3ZCOA 3OYBA 4PZ7A 3CP8A 2UUBH 2UUCH 3LSIA 4DV5H 4CC5A 4BJTA 1D1BA 2ZXHA 3IUOA 3H5NA 1HA8A 4DR2H 4ZTJA 1IBLH 1L2ZA 4PUSA 2KHMA 4E7IA 1Z21A 2Z1DA 4LFCH 1MMDA 3PNTA 2CS3A 3SEQA 2CV2A 1FJGH 1GYFA 4BU2A 2R7TA 4DBRA 2WYOA 3VYUB 4JI0H 4XOTA 3DU5A 2R7SA 3ZXSA 5TGTA 4P5OA 5D1OA 4CCLA 4X64H 3DPTA 2HPMA 4XLAA 1MZBA 2QKMB 3SZGA 2LG4A 2IGNA 4XL9A 5LMUH 3LFUA 4LF4H 3W2AA 3H9JA 1BGWA 3OYIA 3H35A 1HNZH 3VSKA 3CZ6A 1Z3YA 2IS2A 1HNWH 1LVKA 4JQFA 4Y33A 3H0DA 2X1DA 3MD2A 3W1GA 4LITA 3RJ0A 5BR8H 4YRVA 4PK4A 2L5QA 3OMYA 4KITB 3CP2A 2L9NA 1YX5A 1N32H 2ZSIB 2GOMA 4UCSA 3DTKA 3C2HA 5CPRB 4DUYH 4DIQA 3DTIA 1FMWA 4XONA 4LSAA 4HG2A 2FUG2 2K9LA 3UR3C 3F8NA 1QHGA 1D0YA 3VSLA 1XNRH 1MW7A 4EATA 2M0MA 3K4NA 4Y3OA 1FVIA 1IRXA 3MKZA 2K5CA 4IKFA 4Y4RA 4C30A 1HNXH 1K6YA 3K6GA 1TZLA 4U87A 5IWAH 5D1OB 4LMYA 4DJAA 4HNUA 3KXYT 4IAJA 4UCVA 3L4JA 3PN1A 2K9MA 1Z3XA 5CQGA 5LFAA 3SEZA 3DTEA 3L2QA 4LIUA 3OYEA 4RM2A 2VKHA 2BW3B 1CKNA 4LF8H 3K4LA 4AVZA 3QODA 4JI1H 4N4NB 3AL0C 2F5VA 1CKNB 4OWRB 4IQ4A 3HOSA 4E7SA 1D1CA 2IXSA 4CSWA 2CV1A 3PSFA 4BQQA 2R7WA 4N4OB 4BGDA 5FRMA 4ZJZA 4LIVA 4B3SH 5HVQC 1J09A 4B44A 2M7BA 2Y0SA 3L2VA 4DV3H 4OX9H 2LBFA 2V7FA 4BE2A 4OAYA 3DLAA 3MMYB 2PJRA 3KYHC 4B3RH 1PJRA 3TBIA 4C9YA 2O03A 1X1AA 4C2UA 4M7EA 1D0XA 3L2WA 1E0EA 1X1DA 2VJ4A 3CMMA 3CJRB 1N34H 3M8JA 2LY2A 3FBIB 4GKKH 4NNJA 1T0FC 4EFEA 2F4VH 4GKJH 1DGSA 3BA8A 2VLAA 4UCUA 2HPIA 4DUZH 2UXCH 3BCAA 2V6EA 4BDYA 3F9KA 1KONA 4UCTA 4HPQA 4F3QA 2O5RA 2AQEA 2XF7A 2L7KA 3QYFA 3DEEA 4XN0A 3W2VA 2YCHA 2IGOA 2R7XA 3EUHC 5DISC 1LDKB 1P9QC 4E7HA 2W1OA 3W2WA 2HIVA 1DGRM 1X1BA 1G8XA 3DKYA 1Z2PX 3IAS2 4XQFA 2CH0A 2JVHA 1BOBA 4EFBA 1WJFA 1OLTA 3OYKA 3RIZA 4B47A 3CVZA 2HZDA 4PJLA 2M7AA 2LOOA 3OYMA 4X66H 5FLXW 5EOYA 2CW7A 3AFHA 3OL3A 1WFXA 2OC6A 4JYAH 3NC0B 4A2AA 2VUGA 3ZR8X 1ERDA 4P1WA 3DU6A 2UV1A 4CCJA 1LFPA 3N40P 4HSTA 4GLXA 1ZHQA 5CKTA 4LF5H 4KJZA 3LSGA 2E5NA 3OOUA 3S93A 2XAUA 4BACA 2MYSA 2OV7A 4ZDOA 1FKAH 1WJDA 2UXDH 1TT0A 1N77A 5FD5A 1A0IA 4NC8A 4YEJA 2WY7Q 2W82A 3K3VA 3H9GA 2WA0A 3W3CA 3HC7A 3TMOA 1VS0A 2Q1ZB 3BAAA 3SYTA 2VJ5A 3RGXA 5LMNH 2DXIA 1N78A 4AYBA 2NOJB 4II3A 1P16A 4BE1A 2DCEA 4YELA 4LG3A 4E6NA 2VQFH 3HKZA 4F91B 3GB8B 4F52A 1MMAA 3DWLE 4PFOA 3OS0A 2W7NA 3W1BA 4K0KH 5KNLA 2AQFA 2JVGA 3AKZA 3FKJA 3N43B 2CFOA 2I8DA 2UUZA 3CF2A 4AU7A 2M4GA 4NC7A 2KRCA 3BG6A 3L2RA 2HIXA 1XDNA 4MTDA 3VWBA 3HXLA 3S8PA 3VDXA 2W57A 4PJMA 4MLOA 2VXZA 3KAKA 2CW8A 4CH7A 5HNFA 4R7RA 4JI3H 4JV5H 1D0ZA 1UELB 2V9KA 2LBFB 4JI7H 2ZSHB 4NUBA 4IQJA 4PZ8A 3KALA 5FD6A 4XOPA 2XSJC 3NWSA 2ZJTA 2KPMA 2MC4A 2IS1A 3K4MA 1WJEA 3M4IA 2Z16A 2XF6A 2X85A 4RZQA 1VZ0A 3DF7A 4CZCA 2PMZA 4RB0A 5HNHA 3PFYA 4Q0YA 3E1SA 3VYRB 4FM9A 2BVMA 2DOAA 4EQ5A 2IS6A 3RTXA 3T1YH 1AN7A 4ITVA 4DV6H 4XKWA 3NBZB 3RF2A 2VQHA 2E5ZA 3M1CA 4II2A 1SEIA 2CFMA 3J7AY 2IS4A 4XN3A 4X65H 3QYBA 3BC8A 1NG7A 3UNGC 4KHPH 2WAEA 2Q2UA 4BJ6C 4PJNA 2BOLA 3A4CA 3C0FB 2L9SA 2E1MB 3QOEA 4PJJA 4XR6A 4CCMA 4BXFA 3U21A 5LL6b 1CKOA 3N41B 1Y56A 3FDYA 4XKVA 2DJIA 4MTEA 2GOXB 3DKXA 1D1AA 2MFZA 3W5OA 2VPSA 3PL8A 1WJBA 1ZHSA 3HOTA 3S24A 3DPLC 2Q2TA 4HEA2 4D1QA 5KCMA 4JI4H 4X0GA 2BVLA 4DBQA 3K70C 3QWUA 3N44B 2MABA 1ZELA 2WADA 5IT9W 2M4KA 4BDZA 2P0WA 2VJJA 4PSXA 3BA9A 1U0JA 4RAZA 4DV4H 4DOZA 4FASD 4C2TA 3RTRA 3OYAA 3PJRA 1OR7C 4MV7A 2VQGA 3HL2A 1XNQH 4NXNH 1X9NA 4LFAH 2X6YA 1MMNA 4CUGA 1YX3A 3H20A 4RB3C 2HNHA 3K4JA 5FPRA 3OIPA 2MD0A 4A2BA 4CA0A 4CCOA 3LMMA 4HSRA 2M3AA 3E0JB 3I3LA 3K4CA 3SDBA 2XIGA 2KP6A 4D9JA 4DR1H 3OL4A 3PSIA 3DPUA 4QPQA 2CMPA 4RMNA 3J7AK 1V5GA 1PYVA 3IG0A 2HDWA 3K70D 1G59A 2VASA 2LREA 1UAAA 2LYCA 2ZM6H 2Q2EB 2R4GA 3QYEA 3RPUD 3H9QA 3OTOH 4DR5H 5FRNA 3S3MA 5HLTA 1QU3A 2HVSA 3HUGB 2VQEH 3RGZA 1WJAA 4E7ZA 2WDTA 4XMYA 1N33H 2E1MC 4PDBA 3HPGA 3ONQA 1QHHD 1S03G 2HU9A 3ZGKA 1DGWY 3CJQB 4JI5H 1SAUA 4BUPA 3NWTA 2A5WA 4J0MA 2XC7A 1XK5A 4DV0H 3D5SC 2LH9A 2E60A 1CKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PN1 A;  3RR5 A;  3TY9 A;  1S68 A;  4PZ8 A;  1VS0 A;  3BA9 A;  4EEQ A;  3BAA A;  3JSN A;  4UCS A;  4UCR A;  1CKN A;  1P16 A;  4LH7 A;  5D1O A;  4E6N A;  3JSL A;  1X9N A;  2HVS A;  1CKO A;  4EFE A;  3GB8 B;  1DGS A;  1CKN B;  2HVQ A;  3BA8 A;  3W1B A;  3NC0 B;  4UCU A;  4DRF A;  5FPR A;  2VUG A;  1P8L A;  3W5O A;  4LH6 A;  4UCT A;  4CC6 A;  1V9P A;  4EQ5 A;  3S24 A;  3L2P A;  1TAE A;  5D1P A;  3GDE A;  3RTX A;  2Q2T A;  3BAB A;  4GLX A;  1TA8 A;  2OWO A;  1FVI A;  1B04 A;  3UQ8 A;  2HVR A;  4PZ7 A;  3QWU A;  5DIS C;  3NBZ B;  2HIX A;  1XDN A;  4UCO A;  2HIV A;  4CC5 A;  2CFM A;  3GJX B;  4PZ6 A;  3TY8 A;  3VNN A;  1XK5 A;  4UFZ A;  4EFB A;  5D1O B;  3NBY B;  3W1G A;  5FPO A;  1A0I A;  3TY5 A;  4UCV A;  2Q2U A;  3KYH C;  1CKM A; 
#chains in the Genus database with same CATH topology
 1G4D A;  3MKY B;  3MFI A;  3BQ2 A;  1V5F A;  4HNT A;  5TIS C;  3GO5 A;  1ZRD A;  4DIM A;  1R4N B;  4YY3 H;  2PJR B;  1LEA A;  2BYV E;  2XPW A;  2Y9Y A;  4XSX F;  1YE9 A;  4BBR J;  2NOG A;  4OIQ F;  1WJC A;  4E4T A;  1C3O A;  1XMO H;  1LKX A;  2ZO4 A;  1SD4 A;  3K4K A;  1X19 A;  4CKB A;  5K7H A;  3BTC A;  5FKK A;  4KA4 A;  1KJI A;  2YX7 A;  4G6T B;  2FD5 A;  4UY8 I;  4ZI7 F;  1QZE A;  3P5J A;  4DR6 H;  2CWE A;  3RKW A;  3ECO A;  3HSF A;  1R9T J;  3SDG A;  1YIO A;  2EBI A;  2PMH A;  3IH3 A;  2P81 A;  3RSN A;  2E2H J;  4PZ6 A;  1MBH A;  3TP3 A;  1X3W B;  3A0B C;  2WY8 Q;  3M8F A;  2GM4 A;  4QWQ A;  3HOU J;  1B6S A;  5FPO A;  4PSW A;  4WXH A;  1JTY A;  4FFP A;  2COG A;  2CUZ A;  1V5E A;  4B48 A;  3N05 A;  1VTN C;  2FLL A;  3HPH A;  3DBL B;  3OYD A;  3TW7 A;  1OPC A;  2K02 A;  4WX9 A;  3RYP A;  1Y14 B;  5AON A;  4JX5 A;  1U5T A;  3VYS B;  1RET A;  4RU9 A;  4UVA A;  3CJT B;  1XGM A;  2F6C A;  1TQP A;  2AXT C;  4V2G A;  4WK8 F;  3EYY A;  1F1Z A;  3MAJ A;  2CQY A;  2OF7 A;  2NU7 B;  2OJE D;  2FKL A;  2R92 G;  1VQL I;  3OS2 A;  3NAU A;  3FBN B;  2JN6 A;  1ZR4 A;  1I1K A;  2R8I A;  2RDJ A;  3HHG A;  2HTJ A;  3A1Y A;  2LRD A;  3FXR A;  4GO1 A;  4RAY A;  3TL4 X;  2OTL I;  4MV9 A;  2UU9 H;  5FJ8 J;  4IHV A;  3K10 A;  4EGZ A;  5DDG A;  4F92 B;  5D5U B;  3OYF A;  3PIP F;  1FJL A;  5JQW A;  1NG6 A;  1RUN A;  1ZN2 A;  4FE2 A;  4ECU A;  2XRL A;  2IVM A;  2DT7 B;  1R1T A;  5ICC A;  2IT0 A;  1KT8 A;  2ASL A;  5C4J J;  3BG7 A;  1OJL A;  4P96 A;  5IPA A;  1VQ6 I;  1ZGA A;  3A2K A;  2M87 A;  1AHD P;  1PP7 U;  4NQW A;  3CUO A;  2A05 A;  4LH6 A;  1ON1 A;  3KTM A;  3G6V A;  3FHN A;  2J5P A;  3OS1 A;  2IAI A;  2BQ3 A;  4JX6 A;  5F04 A;  3K4B A;  4LSX A;  3QU6 A;  3SFZ A;  3GME A;  2C6Y A;  2L2O A;  5EG0 B;  3LNQ A;  3ZQC A;  3OSP A;  1L0O C;  1G3Y A;  2KFD A;  3J80 Z;  3NBY B;  2K3P A;  5J4V A;  3HT5 A;  4DZJ A;  1JJ6 C;  2LTP A;  2DA1 A;  4LG0 B;  1OCC H;  1X4O A;  4BL0 B;  4GCV A;  5KVR A;  5CQE A;  2RKH A;  3RPU A;  5IP9 G;  2M8E A;  2X1E A;  2IP4 A;  4EBC A;  1WGX A;  2F4M B;  3BR2 A;  2H8W A;  4OAZ A;  4A3J G;  1FMV A;  2ZXJ A;  3CCS I;  4E7K A;  1K1S A;  5DCM A;  4XOR A;  5F0H A;  2Y0S N;  2X6W A;  1W36 C;  4YHH H;  2BBY A;  1Y1W G;  2R5Y A;  2ZCW A;  3LSK A;  2XB0 X;  4XM3 A;  4IZZ A;  1QBJ A;  3GTP A;  4XLE A;  3F8C A;  4EVI A;  1FBU A;  4NHJ A;  5LOV F;  3ZQ7 A;  5EDN A;  3CUQ A;  2PX9 A;  1MNE A;  4XLC A;  5JVG F;  1BC7 C;  2UXB H;  2FNP A;  3TKY A;  3OSG A;  3OIO A;  4PJ0 C;  2PMZ E;  2K86 A;  3H5R A;  3JRI A;  2HHF B;  3TGN A;  3G8C A;  3GIQ A;  2UVV A;  2QBY A;  4ZZL A;  2K4B A;  2EA4 A;  2VOO A;  3QWL A;  3VPB A;  2HYG D;  2VKD A;  4J9R A;  1GLN A;  4JV1 A;  3GTQ A;  4RS8 A;  4CCK A;  1R58 A;  4X62 H;  3KFW X;  3S3N A;  4IIJ F;  4LFU A;  2OU2 A;  2YSR A;  5I5X A;  1OCP A;  2IGK A;  3ORR A;  2OH2 A;  1I7N A;  4XKC A;  2ZJQ F;  2XPV A;  1RKT A;  1FBS A;  1K6O A;  1HCR A;  1JI8 A;  4GRI A;  2RVC A;  4O81 A;  3JAM Z;  2R85 A;  1L3L A;  1XG1 A;  1E4F T;  2RV8 A;  3GFM A;  3LSM A;  5FR9 A;  4JOM A;  4FE7 A;  3I55 I;  5J6X A;  3ORQ A;  1ETQ A;  4YJ3 F;  2BQU A;  2DFE A;  2O0Y A;  2VJI A;  3T8T A;  4BE0 A;  3VNN A;  2ZXW H;  2SCU B;  3BJY A;  4LF6 H;  4UUG A;  2LC2 A;  4DV2 H;  5JHF A;  3LA2 A;  2LKP A;  4NC6 A;  2R7Q A;  4CCN A;  1S68 A;  3LL7 A;  4RLF A;  3L00 A;  1SD5 A;  1ONV A;  5KG4 A;  2Q2E A;  1ZRF A;  2AGQ A;  4L5I A;  2DA3 A;  5L1I A;  4ZTF A;  2YPR A;  4DGW B;  1J5Y A;  4EG0 A;  1UG0 A;  1HKQ A;  2G0E A;  3L4K A;  2EZI A;  1XN7 A;  4ZC3 A;  2A6E F;  1SYX B;  5JR3 A;  4A3G J;  1G3S A;  3GDE A;  5FRO A;  1N36 H;  2CJJ A;  2XGD A;  1Y39 A;  2HG8 A;  1I50 J;  2UUB H;  3LAP A;  1HDD C;  1I1G A;  4DV5 H;  3D1N I;  2JEJ A;  1D1B A;  2ZXH A;  5LRR A;  1IBL H;  1L2Z A;  1E3H A;  2AU0 A;  2BR0 A;  3KZZ A;  4IZO A;  2CO5 A;  3VOE A;  2GA2 A;  5LEK A;  2R7T A;  5GTH C;  5D8D A;  2DK5 A;  5FKO A;  3CDL A;  3A02 A;  4KIC A;  4HX8 A;  4TQS A;  3MR2 A;  2R7S A;  3U1D A;  3ZXS A;  4P5O A;  2M34 A;  4A69 C;  5DUI A;  3DPT A;  1MZB A;  3E5N A;  1SFU A;  1Z6R A;  2ECC A;  5GAH J;  4KIF A;  1DPU A;  3VB2 A;  2ISZ A;  5LMU H;  2VA3 A;  4U7D A;  4ENM A;  4JP0 A;  5BPD A;  4S04 A;  2FJ1 A;  3H9J A;  1IZ1 A;  2RNJ A;  3HDD A;  3KRE A;  1SAN A;  3BG3 A;  1CF7 A;  2FPP B;  1HNZ H;  2IS2 A;  4KMF A;  3GUD A;  1FEX A;  3HOV J;  4ED6 A;  3ML6 A;  5IYD J;  1RRJ A;  4QIW E;  2R7D A;  4YRV A;  3RJ0 A;  3U54 A;  4PK4 A;  1BI2 A;  3OMY A;  2DQL A;  3CP2 A;  1ETO A;  1YX5 A;  3W6K B;  3K5H A;  3PO2 J;  3ASO H;  4A6E A;  2K85 A;  4IRI A;  2NS8 A;  2Y75 A;  1FOX A;  4LK1 F;  5E25 A;  3QQA A;  3ZMD A;  2C2E A;  2CUE A;  3PUF A;  3VSL A;  1D0Y A;  1FC3 A;  1XNR H;  1MW7 A;  2HI3 A;  2M0M A;  3K4N A;  4Y3O A;  4WCG A;  3WU2 C;  3OUU A;  1WSC A;  4LLG F;  3T5J A;  2K5C A;  1PUE E;  4IKF A;  4A93 J;  2W7O A;  4R8U B;  4UV9 A;  4U87 A;  1NHA A;  1UB9 A;  2GZW A;  3ZMT A;  4TVI A;  5IWA H;  4CIC A;  3BR0 A;  2BE5 F;  1OCO H;  2CZG A;  3G6Y A;  4UCV A;  1CGP A;  3BR6 A;  3MWD A;  3PN1 A;  1U2W A;  2YU9 A;  1IXC A;  2E1O A;  3OYE A;  2ZME A;  4BXU A;  2VKH A;  2BW3 B;  2IBD A;  1U8R A;  4N9H A;  4AVZ A;  3JTH A;  3HYI A;  1IYD A;  1TQM A;  2QVO A;  5LHG A;  5A2Q K;  3AL0 C;  1LPQ A;  4IQ4 A;  3E6D A;  4HF1 A;  4A5M A;  1IRZ A;  3HBL A;  2MA3 A;  3PSF A;  4QTR A;  3JRF A;  4BGD A;  5FFX A;  2R7W A;  2QYZ A;  5KFV A;  2DJN A;  2KZG A;  1J09 A;  3E6M A;  5JH7 F;  3L2V A;  3S14 J;  2Y4R A;  3SXY A;  4OX9 H;  2EFP A;  1ETK A;  5FLM J;  2I10 A;  3JCU C;  5C44 J;  1RR8 C;  5D6E A;  5DQG A;  4B3R H;  3E5U A;  1PJR A;  3Q0U A;  3IV5 A;  4BYY A;  4C9Y A;  3DLL F;  1V54 H;  2B9S A;  4KDP A;  4NZO A;  4ZYG A;  4M7E A;  4XSZ F;  1D0X A;  3L2W A;  2VJ4 A;  2W85 A;  3BZ6 A;  3M8J A;  2LY2 A;  2KIF A;  2XSD C;  4GKJ H;  3PO3 J;  3BA8 A;  4B8X A;  1I27 A;  2VLA A;  4BY7 G;  3M1E A;  2PMU A;  3REO A;  3FDS A;  2I5U A;  1MGT A;  4BDY A;  3F9K A;  5E18 F;  2XC9 A;  2XCP A;  4HPQ A;  4F4X A;  3H3Z A;  2JA8 J;  2XF7 A;  3KP7 A;  1SVM A;  3W2V A;  5HOD A;  4XN0 A;  4NZM A;  2IGO A;  2DPU A;  2KJB A;  3SGI A;  2W1O A;  3W2W A;  4IHX A;  1X1B A;  4IHY A;  1ZRE A;  2DAB A;  2DYR H;  4O4I F;  4A3L G;  4HF0 A;  2JVH A;  4EFB A;  3VA7 A;  1O3T A;  2FSW A;  3QFF A;  3H3V K;  2CQN A;  4B47 A;  4B1R A;  3SFI A;  5C5J A;  2HZD A;  2RN7 A;  1MBG A;  4KUM A;  4UB6 C;  5F08 A;  2W25 A;  5DYM A;  3T0Y A;  5HLH A;  2R86 A;  1RJP A;  3GIM A;  2JA5 J;  3OYM A;  5DGB A;  4X66 H;  1VQN I;  3TOB A;  3B02 A;  2DZD A;  3ERM A;  5EOY A;  4NLG A;  2CW7 A;  3ZQG A;  1WFX A;  4JYA H;  4A2A A;  2W6O A;  1OR7 A;  1ERD A;  4ED7 A;  4GYG A;  2A68 F;  3MR5 A;  4GLX A;  1WVR A;  4FIS A;  4UUS A;  2R7L A;  1EZ1 A;  2VBW A;  3LSG A;  2ZJ2 A;  2E5N A;  4KJZ A;  1S3J A;  4BAC A;  2MYS A;  3QP5 A;  1RC9 A;  4BHB A;  5FB2 A;  4D7M A;  1OBD A;  5HNE A;  1R22 A;  3SE7 A;  3ABL H;  1N77 A;  1P4A A;  3I12 A;  5JVD F;  2QF7 A;  1A0I A;  2R3S A;  4PGG A;  3V7R A;  3P9K A;  2NUA B;  3HUG A;  1CE8 A;  2W82 A;  3VOD A;  3GLK A;  4YIF A;  2VJ5 A;  1H9G A;  3FM5 A;  2M2E A;  3CSW A;  1N78 A;  2P5L C;  1W5C C;  1WCM A;  1P16 A;  2DCE A;  4YEL A;  1TL8 A;  4F7Z A;  5HS8 A;  3OS0 A;  2W24 A;  4K0K H;  1XSV A;  2AQF A;  3AKZ A;  3JRX A;  2UUZ A;  3A03 A;  1ZLJ A;  2M4G A;  4NC7 A;  1T38 A;  2EZL A;  1TWF J;  2C00 A;  3LP8 A;  2KRC A;  1IDZ A;  3GZ6 A;  2HQ5 A;  3IRR A;  5CYV A;  1V51 A;  4HN2 A;  5KFE A;  3AYH B;  3VDX A;  4ZYH A;  1WSU A;  3B6A A;  3HIF A;  2E36 A;  4CH7 A;  3NUA A;  4R7R A;  3GTJ A;  2JA7 A;  3BY6 A;  1D0Z A;  2V9K A;  1MDM A;  2EIK H;  2Y69 H;  5CJ9 A;  1EH7 A;  5EEA A;  4Q43 A;  4Q4D A;  2XSJ C;  2ZJT A;  3BJO A;  2MC4 A;  1WJE A;  1PP8 F;  4WXD A;  4O3O A;  3F8F A;  3MN2 A;  3V7C A;  2XF6 A;  2X85 A;  1P4W A;  1EUC B;  2EJ2 A;  2PMZ A;  4KYW A;  2VPR A;  3VYR B;  4Q0Y A;  1XTA A;  5F0F A;  2DOA A;  1OCZ H;  5JVT A;  2FPI B;  4FM9 A;  3RTX A;  2EFQ A;  3T1Y H;  3KIO A;  1M1E B;  1UHM A;  4CYC B;  4XKW A;  3M1C A;  4II2 A;  3AG1 H;  1FOW A;  2CFM A;  2ZDH A;  3NGD A;  2ZNZ A;  2UVU A;  4G7H F;  1BJZ A;  1SMT A;  1A3G A;  2A61 A;  2WB1 N;  3IWZ A;  2WAE A;  1VQK I;  3C1D A;  3K1P A;  2O8K A;  2L9S A;  3T5X A;  2ELH A;  4XR6 A;  2P0A A;  1DPR A;  4I01 A;  3R6S A;  5LP6 F;  5LL6 b;  1ETX A;  3ZP5 A;  4H0E A;  5EYR A;  3N41 B;  5L1L A;  4MTE A;  1R1U A;  3DKX A;  4M3G A;  4MA0 A;  1BL0 A;  2VPS A;  1ZHS A;  4WD3 A;  3JRW A;  4YR2 A;  3Q9S A;  3Q5F A;  1X3U A;  4XBF A;  2E7X A;  1STZ A;  1TWA J;  2IW5 A;  5KCM A;  4D1Q A;  2KIQ A;  4X0G A;  4G6D A;  3K70 C;  3QWU A;  2GXG A;  4YIR X;  5KG1 A;  1DU6 A;  1ZEL A;  1Y1W A;  4HV5 A;  2O9L A;  3BA9 A;  4PSX A;  1S0N A;  1U0J A;  3GXO A;  3L09 A;  4XRS A;  4DOZ A;  2R7M A;  4DV4 H;  3F22 A;  5HS9 A;  3PJR A;  3FX3 A;  1OR7 C;  2ETH A;  1W0T A;  2CNQ A;  3JRG A;  3K0L A;  4C5C A;  4EGJ A;  4DAA A;  4AD9 A;  1XNQ H;  2Z3Y A;  4LOC A;  1ZG5 A;  4A3D J;  2X6Y A;  2IRF G;  3H20 A;  4D5C A;  2HDD A;  2HNH A;  5DGI A;  1LB2 A;  2MD0 A;  2DFH A;  4CA0 A;  4P9F A;  3LMM A;  2D5V A;  2NVQ J;  1KJJ A;  1N56 A;  4GFB A;  1OIS A;  3S2D J;  1BC8 C;  3L7W A;  3M9O B;  1Y1V G;  2ID6 A;  3C2B A;  3SDB A;  1LE8 A;  2B63 J;  1IYE A;  3DEU A;  4DR1 H;  3OL4 A;  3DPU A;  2OCC H;  5KFR A;  2JA5 G;  1JUM A;  1LE8 B;  2CMP A;  4RMN A;  2VKV A;  2E2I J;  2DN0 A;  5KT6 A;  2ALZ A;  4O7V A;  3PZP A;  1FIP A;  2OZU A;  3K70 D;  2A07 F;  4ASN A;  2DLN A;  3I4M J;  2ZM6 H;  1KJ8 A;  3HRM A;  1OKR A;  3FK7 A;  3OTO H;  2DQR A;  2ZKZ A;  4EYH B;  1P4X A;  3L2C A;  3D0S A;  1O3Q A;  4GC7 A;  1S10 A;  1QU3 A;  1B8I B;  4YP3 A;  2COI A;  3H0G G;  4IXA A;  2WV1 A;  1A6Q A;  4FGR A;  4L18 B;  1EF4 A;  1WJA A;  4IHT A;  5I47 A;  1N33 H;  4PDB A;  3HPG A;  3ONQ A;  5BWV A;  3X2Q H;  3CLQ A;  4A3K J;  1I6H J;  1DGW Y;  4FX0 A;  1T39 A;  2NU9 B;  2OPT A;  1SAU A;  5EEH A;  1X58 A;  2ELK A;  4BUP A;  3V8K A;  4DYC A;  3JRB A;  1K61 A;  1H88 C;  3N8D A;  4EYI B;  1I3A A;  5K7F A;  2HYF A;  2X9D A;  5AIQ A;  5HLI A;  5BOX A;  1BJA A;  3T54 A;  1CKM A;  2HTS A;  2W4S A;  1T8I A;  4OIP F;  3BZK A;  4LF9 H;  1LQ1 A;  1FPQ A;  4RA2 A;  4MQ9 F;  4M3D A;  2WAQ A;  4Y13 A;  1BBY A;  1WJ5 A;  3OYC A;  1UHS A;  1EJ9 A;  3PVX A;  2MSY A;  1YIT I;  4NXM H;  4LFB H;  2JUG A;  3BLY A;  4P55 A;  3A01 A;  3VPC A;  4JI8 H;  2VC1 A;  4KN7 X;  5DM7 F;  1C0W A;  1T0F A;  2HOE A;  3EYI A;  1A04 A;  3LSH A;  2QSG X;  5IP9 J;  3F6V A;  5CVU A;  4N0B A;  1P7I A;  4U7B A;  5DLF A;  4WWC A;  2EV6 A;  3G2B A;  2YU3 A;  3O8G A;  3RBE A;  2P8T A;  4J9N A;  1SFX A;  1U9O A;  3MKL A;  2R7F A;  3OYH A;  4UFZ A;  2R7Z J;  2LF8 A;  1GXQ A;  4HX4 A;  1T6S A;  3PFI A;  4Y8V B;  4ECS A;  1R9T A;  2VBX A;  3H1C A;  4L1K A;  2V1N A;  3ULQ B;  1AA7 A;  4YR3 A;  1T08 B;  4B3T H;  4NB5 A;  1JT0 A;  3GF2 A;  5K1Y A;  2Z2S B;  2M1B A;  1CQJ B;  5BWU A;  2RQQ A;  2Y0S E;  2IA0 A;  4O2A F;  5J2T F;  2K9Q A;  3GEZ A;  4MFE A;  4M6Y A;  2FE3 A;  2VQD A;  3R9R A;  3CF5 F;  5E20 A;  3T1H H;  2QSH X;  1HSJ A;  3BRO A;  4G7Z F;  4K2E A;  5KT3 A;  5ICE A;  5DD4 A;  2XCA A;  4HV6 A;  4MGR A;  1REP C;  2R7U A;  4I4T F;  3JRA A;  2TRT A;  4RZR A;  2AQ4 A;  3GTO A;  2PMZ N;  1IBK H;  3JRD A;  4RBO A;  4HDV A;  2HYJ A;  1W0U A;  4RUA A;  1E4G T;  3RKX A;  3QU3 A;  3TII A;  4JX4 A;  4R8U A;  3VOT A;  5B5E C;  1Z7L A;  3OIQ A;  3S2H J;  2V6C A;  3BG5 A;  2ICW G;  3CMA I;  5KK1 A;  2C2R A;  1OFC X;  3U9G A;  4EJO A;  3M07 A;  5J1R A;  1VQM I;  5KFB A;  4Z2Y A;  5D5W B;  3T8R A;  4XIC A;  4BEH B;  4FFL A;  2JA2 A;  2GXB A;  5KS8 A;  4L0Z B;  5J4Y A;  2DWC A;  2R7Z A;  2LR8 A;  1PX2 A;  1S9H A;  4JV0 A;  1FY7 A;  4ZYA A;  1A5J A;  1KYW A;  3KYD B;  4W97 A;  1YJW I;  2A1H A;  2VQC A;  3KEQ A;  2CNU A;  2E5L H;  1IAW A;  3WWH A;  1BI3 A;  2V5A A;  4KFC A;  1UG2 A;  2C35 B;  3ZQF A;  2NNY A;  1X1P A;  1EUD B;  3K3P A;  1MJB A;  5E17 F;  4RCN A;  3OYN A;  1F5T A;  3O8H A;  3WTV C;  4Q8E A;  1QZY A;  4B3X A;  5HDN A;  2IMW P;  2R7O A;  4CMF A;  3MKW B;  4G12 A;  2FK2 A;  3ZQI A;  1MH4 A;  3I59 B;  5DD8 A;  2W9C B;  2JA5 A;  4MV1 A;  1NH3 A;  1T95 A;  2MW8 A;  1BNC A;  1N75 A;  1XD7 A;  3D5R C;  1ZAO A;  3TO6 A;  2R7V A;  4WXC A;  1BJT A;  5J47 A;  2PG4 A;  2QYO A;  4G8X A;  1FOK A;  1BR4 A;  5CLS A;  1IRF A;  2FBI A;  4J9M A;  2JA6 A;  4CZZ A;  3Q3S A;  2XAS A;  2DIK A;  3WHB A;  2V9V A;  1ACI A;  4RLQ A;  1FWZ A;  3IH2 A;  4RUC A;  4FHT A;  3L9F A;  2UUA H;  5GON F;  2L7M P;  3DTG A;  2V4R A;  3L2U A;  2X51 A;  1R5G A;  3NQO A;  4BEH A;  2EJR A;  1M6V A;  3KEY A;  3JSL A;  2MD5 A;  4M3B A;  2ACJ A;  4HW0 A;  5D5X B;  1IGN A;  5DG7 A;  2H09 A;  2W00 A;  3GTP J;  4KT6 A;  2BW3 A;  2OCE A;  1ZLK A;  5L9X A;  1J5E H;  3C7J A;  3FMA A;  3V7S A;  1XMX A;  1RZ4 A;  2JPC A;  3QP6 A;  2QEN A;  3D5L A;  5H20 A;  4J9S A;  2C28 A;  1SC7 A;  3KP6 A;  4AM3 A;  4U0V A;  5ILS A;  4XNF A;  2EIL H;  3GIP A;  4M9Z A;  4A3M G;  3AG2 H;  1XC5 A;  3CC4 I;  1MBF A;  5DCF A;  1TT5 B;  3IH4 A;  2Z9O A;  4MQV A;  3N6X A;  1HR0 H;  1HDP A;  1Q1V A;  3P9I A;  3LSR A;  3GFI A;  2KRH A;  3ABT A;  2CV0 A;  5C8Y F;  4BXX G;  1JKQ C;  4DV7 H;  2E34 A;  3EUA A;  1V55 H;  4X1E A;  5JI6 A;  4KIS A;  1W7P D;  2EZK A;  3C18 A;  2FF4 A;  4EJU A;  1BXR A;  1WRJ A;  2J9G A;  1UST A;  4FT8 A;  3F0C A;  1UC8 A;  1LFB A;  2JSP A;  1CF7 B;  3V42 A;  3Q0V A;  3S1Q J;  4MV8 A;  1RJQ A;  3KZI C;  1G3T A;  2UWM A;  2LKS A;  3RCO A;  2FK1 A;  2CNV A;  5KHD A;  1MBK A;  1XCB A;  2DMN A;  3OY9 A;  5K2M A;  2VT2 A;  3UZB A;  1K78 A;  5JUM A;  3I56 I;  2MCT A;  2XGP A;  1TNS A;  2CKZ B;  4IVN A;  4DL7 A;  5GTI C;  1LVA A;  2VOB A;  3CCV I;  2XAQ A;  4RNN A;  3IN5 A;  4EM2 A;  3EUK L;  3G8D A;  3PW4 A;  1KUT A;  2Y0M A;  3E5X A;  2R93 A;  2W7P A;  1YJ9 I;  2F2E A;  4BJT A;  4TV8 F;  4CC5 A;  2VOD A;  2UXN A;  4PZJ A;  4MHG A;  2RDP A;  2VBZ A;  2KHM A;  3GID A;  3CCR I;  2Z1D A;  1MMD A;  2CS3 A;  4YR0 A;  1GYF A;  5BYA A;  2DA7 A;  2LFB A;  1Y0N A;  2XAF A;  4DBR A;  3HRU A;  2WYO A;  1I50 A;  2EV0 A;  2X48 A;  4O86 A;  5JVL A;  5KFS A;  3DU5 A;  1OMI A;  1QO0 D;  5D1O A;  3FXK A;  1ZKG A;  4J9K A;  4X64 H;  5DCM B;  3CCL I;  2XHK A;  5M5Y J;  3G1L A;  3M3Y J;  4XID A;  4XL9 A;  4DL5 A;  3H3U A;  4QWE A;  1R7J A;  3PO2 G;  1ETW A;  4O7L A;  3S16 J;  5GPC A;  2QZ8 A;  4M74 A;  1KJQ A;  4RGU A;  2ISY A;  4Q4Z F;  4TM5 A;  1J2X A;  1YHQ I;  1HNW H;  1J9I A;  3I4N J;  2GIV A;  2VUM J;  4JQF A;  4Y33 A;  1XGN A;  3SJM A;  1A0G A;  5I5W A;  2X1D A;  1T3N A;  3MD2 A;  4A3G G;  3W1G A;  4A3M J;  1K78 B;  3H0G J;  5BR8 H;  2NXN B;  4KIT B;  5K5O A;  3HB9 A;  5FLX Z;  2MG4 A;  3ZOB A;  5IP7 G;  5D5V B;  2GOM A;  2V9P A;  4R8H A;  5DAA A;  2YX4 A;  2Q8K A;  3QPS A;  2D1V A;  3DTI A;  1FMW A;  2K4J A;  4LSA A;  3F8N A;  1EV7 A;  4EAT A;  1I2L A;  2EZH A;  4TV9 F;  3MKZ A;  2H8R A;  2G7U A;  1HNX H;  4C30 A;  1HKS A;  2VOP A;  4RNO A;  3K6G A;  1TZL A;  1LDD A;  3LSJ A;  5D1O B;  4U6P A;  3ZPL A;  4HNU A;  2EIJ H;  1U78 A;  4LB6 B;  3L4J A;  3HTU A;  4ECT A;  4OU0 A;  4M71 A;  3V8L A;  3FWE A;  4U0Y A;  2EWN A;  3L2Q A;  2R5Y B;  3KEO A;  4RM2 A;  2ZNY A;  4LF8 H;  3K4L A;  2W8K A;  2R8H A;  3Q0W A;  4ESF A;  2F5V A;  3DBH B;  3E6C C;  3HOS A;  4E7S A;  1D1C A;  2YS7 A;  3ERE D;  5KT7 A;  2ZFW A;  5F1J A;  2JMW A;  1S7E A;  4L9J A;  1S97 A;  4ZOL F;  1EKE A;  4UVB A;  1F36 A;  5EEG A;  2ZDQ A;  2LBF A;  4E70 A;  4BE2 A;  4OAY A;  2J6S A;  3FK6 A;  4M9X A;  5ED4 A;  4HX7 A;  4MEX F;  2HR3 A;  1LFU P;  2PJR A;  3Q8S B;  1ETY A;  1GHC A;  3T9F A;  1B59 A;  3TP0 A;  1X1A A;  4M72 A;  4C2U A;  1E0E A;  1GSO A;  3I59 A;  4B09 A;  2EJ3 A;  3CMM A;  1S72 I;  3CJR B;  2K7L A;  4EQQ A;  3BQ0 A;  1R23 A;  4BXX J;  3FBI B;  5LHI A;  4NNJ A;  4V19 K;  3U9T A;  2F4V H;  4A3B G;  5BWT A;  4UCU A;  1JHF A;  1V4R A;  2HPI A;  3BCA A;  4DUZ H;  2HFH A;  1R1V A;  1KON A;  2FOK A;  4C2M A;  1H0M A;  1BN5 A;  2AQE A;  3QYF A;  3DEE A;  1U5T C;  2IP2 A;  3KHH A;  1ZK8 A;  3GII A;  3GIL A;  2LSO A;  4AC0 A;  2RF4 A;  2MH2 A;  1DGR M;  4MV3 A;  4UXN A;  3WWI A;  1ET0 A;  5C1P A;  3GTL A;  3IAS 2;  4Q44 A;  3WGI A;  1S0O A;  4HA8 A;  3WNZ A;  3U9S A;  4O3P A;  5LYJ F;  2GQQ A;  4UV8 A;  3BR5 A;  3PR4 A;  3GZN B;  1JDE A;  2QWW A;  4IWY A;  2LOO A;  3IWF A;  3WE3 A;  4ZYD A;  3UKG A;  1FZP B;  3LAJ A;  3DXJ F;  1KA8 A;  3FXJ A;  3AFH A;  4LK0 F;  3OL3 A;  2P4W A;  3NC0 B;  3T9D A;  2O7O A;  5CA1 F;  4KMU X;  2QCO A;  3DU6 A;  3N40 P;  3CO7 C;  4HST A;  2VN2 A;  2K3F A;  3RQI A;  5CKT A;  5K5Q A;  3COA C;  4BHC A;  2OLS A;  1FKA H;  2Z04 A;  2DA6 A;  2DYS H;  3WTZ A;  5L3G A;  4O82 A;  1CS0 A;  4RNM A;  1TT0 A;  5J8F A;  5EZY F;  1XB4 A;  3HTS B;  2E2H A;  3FIW A;  5DUK A;  2WY7 Q;  1D3Y A;  2HS5 A;  5E1X A;  1VBH A;  3H9G A;  3W3C A;  2FJZ A;  5CR5 A;  3K3V A;  3HC7 A;  2Q1Z B;  3RGX A;  2HKX A;  1VQP I;  2P7C B;  5LMN H;  3HGY A;  3GYH X;  4II3 A;  3TO9 A;  4LG3 A;  2VQF H;  3HKZ A;  4F91 B;  2L02 A;  4BBS J;  2DU9 A;  2JRT A;  1H8A C;  3EPG A;  3M9A A;  5TJJ A;  3FKJ A;  3N43 B;  2I8D A;  4M73 A;  1S8N A;  3CUQ C;  1IN8 A;  3BG6 A;  3S17 J;  2JJ7 A;  1FBQ A;  1KU7 A;  1W93 A;  4MTD A;  2HIX A;  1EH6 A;  3GTG J;  1KZH A;  4MIM A;  3HXL A;  4OOI A;  5HLG A;  2PQ8 A;  3IKT A;  4XYL B;  3GCM A;  2W57 A;  4Q47 A;  4MLO A;  4PJM A;  1S5L C;  2P5K A;  3BG9 A;  5HNF A;  3LA7 A;  4JI3 H;  4JI7 H;  3WG7 H;  4NUB A;  2QLZ A;  4A2U A;  4IQJ A;  3KAL A;  2AO9 A;  3BJ6 A;  4ECQ A;  1SFE A;  2DA2 A;  3NWS A;  1HBX G;  2JA7 G;  1IN4 A;  2JZY A;  2KPM A;  3GV8 B;  1XSD A;  2IS1 A;  3M4I A;  4G6Q A;  4FCY A;  1PK8 A;  1P7J A;  5KFD A;  4RZQ A;  2C2D A;  2V58 A;  3O2P E;  5BNG A;  1I3Q J;  1ZGJ A;  2TCT A;  4RB0 A;  4CZC A;  4ECY A;  4Q4C A;  2ZME C;  3E7L A;  2J5O A;  1XDS A;  4D0P A;  2IS6 A;  2NU8 B;  1YW8 A;  1FTZ A;  1DIK A;  3KE2 A;  4IRH A;  3K9T A;  4ITV A;  3NBZ B;  1B6A A;  2VQH A;  1GV5 A;  2E5Z A;  1Y1V A;  2PBI A;  5K3W A;  2J6T A;  4XN3 A;  2W6N A;  3QYB A;  3BC8 A;  1NG7 A;  4KHP H;  4GLW A;  4IOC F;  4PJN A;  2IA1 A;  3R5H A;  1DV2 A;  3F21 A;  2QQA A;  4CCM A;  4CKE A;  4HAM A;  3Q1K A;  4I2O A;  3U21 A;  3LSP A;  3E97 A;  3R60 A;  4IRK A;  2Y2Z A;  4O4J F;  4IPA A;  1FLI A;  2WTE A;  3FDY A;  4IL6 C;  2DJI A;  4XKV A;  2LKX A;  4NDL A;  3MFK A;  4ENK A;  2NVT J;  2GOX B;  3BR1 A;  4N9I A;  1QNT A;  2H6B A;  3PL8 A;  2L7F P;  3I58 A;  3HOT A;  2DMU A;  3HOY J;  3S24 A;  5ICF A;  3DPL C;  2V1D A;  4HEA 2;  4UHT A;  2Q2T A;  4CHI A;  4JI4 H;  3MQ0 A;  2FX0 A;  3RKY A;  2FBK A;  4Y17 A;  3VPD A;  3CCJ I;  2MAB A;  3QOP A;  5KKN B;  3ECH A;  1VBG A;  2WWY A;  1E3O C;  4ED0 A;  2BHY A;  5IT9 W;  2M4K A;  3KYC B;  4FFR A;  2VJJ A;  2JA8 G;  4RGX A;  3ZMS A;  2EQR A;  4RAZ A;  2NS0 A;  4FAS D;  4Y52 J;  3QQM A;  4C2T A;  3UFX B;  4L9N A;  1O7F A;  4MV7 A;  1XX5 A;  1FP2 A;  4NXN H;  1XCV A;  3LOC A;  3KCC A;  2B0L A;  3I4P A;  4Q8F A;  3R0A A;  3K4J A;  4LLL A;  3OIP A;  3ZMU A;  1VQ7 I;  4FFO A;  3FMR A;  5C44 G;  3QPH A;  3MCZ A;  2M3A A;  1G2H A;  5HBR B;  3CDI A;  3CTA A;  1P92 A;  5K5R A;  1TNT A;  3FXQ A;  3I3L A;  3K4C A;  3MR6 A;  1WZ2 A;  4O7N A;  2I87 A;  4D9J A;  5IOZ A;  2JT1 A;  3ELK A;  1U3E M;  2FP4 B;  2HOS A;  1PYV A;  3IG0 A;  3S1R J;  1RIO H;  2HDW A;  5KFI A;  2LRE A;  5GAG J;  2JEI A;  3WTW C;  3QYE A;  4C3H J;  1U9N A;  4FTH A;  2XGC A;  2ZB9 A;  4J9P A;  4ME6 A;  3NAR A;  2HVS A;  2OD5 A;  3WHC A;  3HUG B;  2GXA A;  2VQE H;  3GTM A;  3RGZ A;  2WDT A;  3HOV G;  1IF1 A;  1X2M A;  2QB5 A;  2HU9 A;  3ZGK A;  5EG0 A;  3DFG A;  2F5E A;  1H89 C;  4A3D G;  1JE8 A;  3FMQ A;  4EEY A;  1SMY F;  1QPI A;  2WB1 E;  2QGU A;  2EA2 A;  2XC7 A;  3QZ8 A;  2DLL A;  5EGO B;  1VAJ A;  3D5S C;  1IUY A;  4DV0 H;  1U5T B;  5BWR A;  2DMP A;  5E3M A;  5DGA A;  3RDI A;  2E60 A;  5HDK A;  4ETS A;  2PI0 A;  3OHB A;  2HEO A;  1E17 A;  4O83 A;  3SNO A;  1IXR C;  5DS9 A;  1MBE A;  2EJ0 A;  3HOY G;  5D6F A;  1TWF A;  4A3L J;  2COM A;  1B9M A;  4WF2 A;  4RGS A;  3LUL A;  1WH5 A;  2O6G E;  2KSW A;  1JGS A;  1Y6I A;  1QVU A;  1NTC A;  3TED A;  1W36 D;  2W9B B;  5GPA A;  2RQP A;  2CGP A;  3R23 A;  2XGQ A;  3TW6 A;  4EBE A;  4DW6 A;  3BCB A;  3HHH A;  2EIY A;  2WAQ N;  4B3M H;  1B04 A;  4BNC A;  3JR9 A;  3J7Y J;  3DBR B;  2LY1 A;  3PO3 G;  3KAJ A;  1J75 A;  5IOY A;  5FNV F;  3HM5 A;  1K4S A;  1DQU A;  1Z0X A;  4BS9 A;  3GTM J;  5KFZ A;  4DV1 H;  1KQ8 A;  2VL8 A;  2W6Q A;  4JI6 H;  4O7R A;  2KT0 A;  1MMS A;  2YUS A;  2STW A;  3TY5 A;  5KFX A;  4AYB N;  3T5H A;  3IKV A;  1O4X A;  2BQR A;  3DP7 A;  2R7N A;  1JKR C;  2JTV A;  1B4A A;  2XPU A;  3AL0 B;  3RIR A;  5KFU A;  2KIU A;  4ED3 A;  3OWT A;  2VXD A;  3IP4 B;  2FQ4 A;  4LGW A;  3GQC A;  3G73 A;  2A6T A;  2CFX A;  2JWT A;  2V26 A;  3V6H A;  3SZT A;  4UB8 C;  4A0Y A;  3N4M A;  2QKL B;  1D5V A;  1Z6T A;  1MMG A;  3FKI J;  1BOA A;  1SVO A;  2EH3 A;  5I5Y A;  2WBM A;  1TWG J;  4J9O A;  1MH3 A;  4O7Y A;  3O3K A;  4AYB E;  4LF7 H;  1AKH A;  4DR4 H;  3KP2 A;  2IGM A;  2ZXI A;  1YTY A;  5E1Z B;  1SFO A;  3TY8 A;  4JUZ A;  2P6S A;  1U8B A;  1N48 A;  1O75 A;  4IHS A;  2R7K A;  5FFZ A;  3TO7 A;  3KPH A;  4ZDL A;  4A3J J;  3HGG A;  1QGP A;  4YFN F;  3BTI A;  2IPQ X;  1JKO C;  3PNV A;  5DEQ A;  1OCT C;  1MDM B;  2STT A;  1LNW A;  1X3Z B;  4PFP A;  2VPL A;  1R5H A;  1BI0 A;  3B73 A;  4I98 B;  4QPO A;  4EJV A;  4UCR A;  2KRF A;  1AOY A;  2RGR A;  2ADU A;  4DZP A;  4AQY H;  3LML A;  2Q0O A;  1HW5 A;  4BH9 A;  5F0C A;  1AWC A;  4A3I G;  1K83 A;  1VKZ A;  3PR5 B;  2RGV A;  1A35 A;  5EGO A;  1IN6 A;  2X4H A;  2Z33 A;  3IAM 2;  1JGG A;  2AXL A;  3HOX G;  2ZFU A;  2G9W A;  4ANJ A;  2HVR A;  3PNY A;  4EJT A;  2WB1 A;  1WH7 A;  1JKJ B;  3RV4 A;  4F55 A;  4ESB A;  3WU1 B;  3ZQQ A;  1YI2 I;  4F93 B;  4CMD A;  3GJX B;  4ZYE A;  1WRV A;  3E5Q A;  1O3S A;  1D8K A;  3HRS A;  2W71 A;  5F64 A;  2X0S A;  3B6C A;  1XMA A;  2E71 A;  1M7J A;  3LST A;  5DM6 F;  1SFK A;  4XX0 B;  4QW9 A;  4ZHQ F;  3F23 A;  2R8K A;  3A01 B;  5CVR A;  2ELJ A;  4B43 A;  4M9U A;  2A3S A;  2HGC A;  4XLH A;  1DP3 A;  3CEB A;  4JV2 A;  4BQN A;  4E7L A;  3CES A;  1G2W A;  1R00 A;  2O8X A;  1RK5 A;  2VQL A;  4FQG A;  2JRM A;  1OYY A;  1SCU B;  2COJ A;  2GIZ A;  1E3P A;  3BAB A;  5I5S A;  3I54 A;  2KZV A;  4ZH4 F;  1EKF A;  2X1C A;  1B8I A;  2GA1 A;  1YYV A;  5LRS A;  1RJR A;  5KFQ A;  1JT6 A;  2XKP A;  2XVC A;  4J9L A;  1ZYR F;  2KQR A;  4I7H A;  1BR2 A;  5L3B A;  2DPD A;  4BQA A;  2M0C A;  2R82 A;  4IR9 A;  2V1X A;  3I0T A;  3CLO A;  2DMT A;  3G4S I;  2EIN H;  4HQE A;  4IHJ F;  3CDH A;  4O84 A;  5J8C A;  3N42 B;  3OYG A;  1T94 A;  4FET A;  1SAX A;  1XGS A;  1WR2 A;  5DG9 A;  2JUC A;  3J80 W;  1TBX A;  2HOA A;  3GBG A;  2BY1 A;  4RM3 A;  2R7R A;  2D1H A;  1ZQ3 P;  4BJ5 C;  1V4Y A;  3OSN A;  5B1B H;  3A0H C;  2NVX J;  5FKN A;  3DQV C;  1JX4 A;  2CSO A;  3JRE A;  1V9P A;  2GPS A;  3MWM A;  2V9W A;  3TQT A;  1ZHF A;  2DT6 A;  5KFW A;  2V1U A;  4ED1 A;  3C2G A;  4I02 A;  3E6B A;  4ZDP A;  5D8L B;  1GXP A;  5IY5 H;  3RQ4 A;  2WE6 A;  4JI2 H;  4EM0 B;  2RNG A;  1Z67 A;  4O4L F;  1P2F A;  3T5L A;  5KX5 F;  1N25 A;  2QSF X;  3H5A A;  3WU0 A;  1IC8 A;  4ECW A;  4IF4 A;  3CO6 C;  3JSN A;  2W6Z A;  1YQA A;  1YJN I;  4J9Q A;  1RI7 A;  2OQG A;  1MND A;  2XDV A;  4RAF A;  2XAG A;  1BW5 A;  1KGS A;  5LGU A;  5GP9 A;  3HOU G;  2GLT A;  4DL3 A;  4O7Z A;  3C3W A;  2DAO A;  3IC7 A;  1I1M A;  4J01 A;  4E6K G;  1YFH A;  3CJN A;  3S15 J;  2LMD A;  5D1P A;  5L3F A;  2F4I A;  3ZCO A;  3OYB A;  3CP8 A;  2CQK A;  2FLP A;  4EEF G;  2UUC H;  3F8M A;  3BP8 A;  5F6F A;  2NVX A;  2MLG A;  4ZTJ A;  2GQS A;  3R5X A;  4LFC H;  1Z21 A;  1MNM C;  2CV2 A;  3PNT A;  4G3I A;  1FJG H;  4LLN A;  2LY9 A;  4XOT A;  4I50 F;  4DLK A;  2YS9 A;  3KP4 A;  4LG0 A;  2Y31 A;  2L4M A;  5FGM A;  2KKO A;  3G3Z A;  5TGT A;  5IT9 Z;  1FNN A;  4EM1 A;  2HPM A;  1MSE C;  1UCR A;  1W7P B;  3SZG A;  3RZD J;  1RKW A;  1D5Y A;  1BIA A;  2OAZ A;  2IGN A;  3J7A O;  2R5Z B;  3LFU A;  4QIW A;  1KYZ A;  1X2N A;  4LF4 H;  5IP7 J;  1B33 N;  3W2A A;  2F5D A;  1YRN B;  5BPH A;  3OYI A;  3HOW G;  3VSK A;  1I6X A;  1Z3Y A;  4BY7 J;  5E3O A;  2K9N A;  3BZC A;  1KEE A;  1YO5 C;  1LVK A;  1VQ4 I;  3H0D A;  2X5R A;  3T9C A;  5IYC G;  3JW4 A;  3Q8Q B;  2ME6 A;  2VPQ A;  2L5Q A;  2YS6 A;  5BPI A;  4Q5S F;  4MV4 A;  1W5T A;  1HW2 A;  4M0J A;  2ZSI B;  3SZP A;  2JK3 A;  1TQI A;  3HEF A;  1DV1 A;  5KFY A;  5HDG A;  5F9L A;  3C2H A;  3H0G A;  5CPR B;  3HOW J;  4PCQ A;  2W48 A;  4GDF A;  4DIQ A;  4ESJ A;  2FRH A;  2OBP A;  4O6J A;  4HG2 A;  5F27 A;  3K2Z A;  2K9L A;  5KFJ A;  1FSH A;  2RC4 A;  3ZQH A;  3R61 A;  4BAY A;  1FVI A;  1IRX A;  2KJC A;  3V4S A;  3UYY A;  1SD6 A;  3QAH A;  1ITY A;  4Y4R A;  3VMM A;  1XSX A;  4CO8 A;  1S9F A;  5D4S A;  1B6R A;  4V2F A;  3KHR A;  5E8G A;  1Y1W J;  2DTZ A;  3SHF A;  4DJA A;  2W6M A;  3KXY T;  1B72 A;  2I80 A;  3WTS C;  1QVT A;  1R49 A;  2NNN A;  2R0Q C;  2R87 A;  5CQG A;  5LFA A;  2F5F A;  1XGO A;  3DTE A;  2YZM A;  1W4M A;  4AVP A;  1OBG A;  5FJ8 G;  2ODT X;  1CKN A;  2CQ7 A;  5BWX A;  5KFF A;  5BMV F;  5IYC J;  2M9H A;  3ABK H;  1UHW A;  3F8B A;  3KET A;  2AHQ A;  3MZH A;  1U6G A;  2EB7 A;  5DTD A;  2OTJ I;  3H92 A;  4M3E A;  4CSW A;  1S0M A;  2CUF A;  5FRM A;  4BQQ A;  1JDB B;  3U0G A;  4HNV A;  5KFM A;  1TTY A;  4LIV A;  3BQZ A;  3H4D A;  1GLV A;  3QPL A;  4B44 A;  2RAE A;  2Y0S A;  2W9B A;  4DV3 H;  2DBB A;  2NVY J;  3T5K A;  5LA6 F;  1RPW A;  3KYH C;  1IN5 A;  3BPX A;  3TBI A;  2D45 A;  3TDZ C;  3HKZ E;  1LUJ B;  1YW9 A;  5BMZ A;  3V4G A;  3CD6 I;  1X1D A;  4AIJ A;  1K79 A;  3AAF A;  5IYD G;  5GAE J;  1MJ9 A;  2DFI A;  2BY3 A;  1T0F C;  3IL2 A;  4EFE A;  2YZG A;  4A3K G;  2UXC H;  4IJA A;  1W1W E;  1FYM A;  3GWZ A;  3K2A A;  4UCT A;  2DA4 A;  4O5V A;  2O5R A;  3WTU C;  2E1C A;  2O61 A;  2IA2 A;  2V59 A;  3T1B A;  2L7K A;  2YCH A;  2JEG A;  3DV8 A;  1WI9 A;  4I0A A;  2YU9 J;  2R7X A;  3EUH C;  3WE2 A;  1P9Q C;  2HIV A;  5D8K B;  5ILU A;  1Z2P X;  3G1M A;  4PDK A;  2JQ7 A;  2WC2 A;  4BBR G;  3T9B A;  4QSH A;  1WJF A;  1OLT A;  3OYK A;  3CCE I;  2ESH A;  5IT9 K;  3HSE A;  1ZAU A;  4HR7 A;  1OWT A;  3RIZ A;  2DDA A;  2G7H A;  2M7A A;  4RDU A;  2FEZ A;  1TWA A;  4IRG A;  3RBD A;  3RB0 A;  3RB6 A;  3HJE A;  5E1W A;  2YZN A;  4UUT A;  2B63 G;  3MVP A;  4YG2 F;  2W9A A;  4F50 A;  2X6O A;  4AUX A;  3J81 W;  3JRC A;  5LXT F;  3JSP A;  4AID A;  4EV0 A;  1LJ9 A;  2UV1 A;  4ON0 A;  1LFP A;  4W1U A;  4CCJ A;  3F3X A;  5FKL A;  1NK3 P;  1ZHQ A;  4O3S A;  2R7Z G;  4LF5 H;  3OOU A;  1Z9C A;  2NS7 A;  2UXD H;  4M6V A;  1UJ8 A;  1W7P A;  1Y8R B;  1WJD A;  4L0Y B;  4YB8 B;  3TDU C;  1FYK A;  2EV5 A;  3GV7 B;  5A2Q Z;  1VI0 A;  1I7L A;  1VQO I;  3V6J A;  4S0H B;  5KFC A;  2BEO A;  2UVR A;  5KT5 A;  3KHL A;  2XD4 A;  1G3W A;  4NC8 A;  2R84 A;  2VT3 A;  3J81 K;  3GFL A;  5KFT A;  2ASD A;  2WA0 A;  3WTX C;  3TMO A;  1VS0 A;  2YZL A;  2XRO A;  4WHX A;  3SYT A;  3WOD F;  1J0R A;  1ZH5 A;  5EZG A;  3ZN1 A;  2DXI A;  4AYB A;  1HF0 A;  4O4H F;  5ERI A;  2XAJ A;  5IYZ F;  2JA6 G;  1K83 J;  4CYC A;  3GB8 B;  4Z6Y A;  1MMA A;  3W1B A;  2W7N A;  2I8C A;  2XV4 S;  2JVG A;  3L1P A;  2DOD A;  2CFO A;  4KIB A;  3S2W A;  1QQI A;  3CF2 A;  4UNO A;  5CAE B;  2R92 A;  3I5U A;  5L3D A;  4MA5 A;  3GTK J;  3GIJ A;  3CQZ J;  3K1M A;  4R1H A;  2HGW A;  3SQN A;  3SI8 A;  4HYK A;  1KU3 A;  3L2R A;  3ETH A;  5K7Z A;  4C2M J;  1YOV B;  5KFH A;  3BQY A;  2AGO A;  3FXO A;  1BM9 A;  3KAK A;  2VXZ A;  4XRS G;  4JV5 H;  4EJW A;  1UEL B;  4PWQ A;  2ZSH B;  5M3M J;  4PZ8 A;  1QA6 A;  5CA0 F;  2XB5 A;  5DQH A;  5FD6 A;  4XOP A;  1B1B A;  3OOP A;  4L5J A;  4F4W A;  1FIA A;  3CMY A;  4YFX F;  3FIS A;  3K4M A;  4QW8 A;  5B3S H;  5IYB J;  2Z16 A;  2VI6 A;  3W6J B;  2M5W A;  5HNH A;  3PFY A;  2QK4 A;  5KG0 A;  4APM A;  3E1S A;  2WTF A;  2EFO A;  3WGG A;  3GTK A;  1VQ8 I;  3WO1 A;  2K27 A;  5LLQ A;  1DU0 A;  3ASN H;  4DV6 H;  3PIO F;  4O7S A;  1SEI A;  3DTF A;  4AWX B;  2DTR A;  1E4E A;  3T99 A;  3UNG C;  4S05 A;  1XPX A;  1BI1 A;  3CME I;  1E4E B;  4A3B J;  1HLV A;  2Q2U A;  4BY1 G;  2L3D A;  3QOE A;  3ABU A;  5F9N A;  1W96 A;  4BXF A;  1JJ8 C;  2RDI A;  2DOE A;  1MKM A;  2NRA C;  1KU2 A;  4OIO F;  3HO8 A;  1WCM G;  5KG3 A;  2QQ8 A;  1HXD A;  1Y56 A;  2QQ9 A;  2EFW A;  2H1L A;  2CG4 A;  2MFZ A;  1JLL B;  1WJB A;  1RYR A;  1W5S A;  1S6L A;  2F48 A;  5CVJ A;  3QZ7 A;  2GWR A;  5JFR A;  2BY2 A;  4Q48 A;  1OYI A;  3EPI A;  2Q7D A;  2JA6 J;  2XKO A;  2EK5 A;  2O3F A;  2ZJP F;  4A3C J;  4D5F A;  1IV8 A;  2WAD A;  5J40 A;  3P9C A;  2D2W A;  2P0W A;  3BAC A;  2FNA A;  1T36 A;  3TQ1 A;  3S1N J;  3WO0 A;  3CC7 I;  3OYA A;  1WKM A;  4XLP F;  5KFG A;  5KFN A;  2VQG A;  1YRN A;  2DPJ A;  1X9N A;  4IWX A;  3F6O A;  4I09 A;  1MMN A;  2BY0 A;  4RB3 C;  1OQY A;  4A2B A;  1K1Q A;  3MFH A;  2DMQ A;  4CCO A;  2ZGI A;  2MBF A;  3GTG A;  4QWA A;  5L1K A;  1XDU A;  3J81 Z;  3E0J B;  4O7W A;  1MJA A;  3U2R A;  4CDG A;  5H80 A;  2R8G A;  3PSI A;  2HQR A;  1EHI A;  5E79 C;  2XCL A;  3JZF A;  2IA6 A;  3BR3 A;  3BPV A;  3CCU I;  5C3E J;  4ENJ A;  2HQN A;  1ZGW A;  1A36 A;  1V5G A;  3EUH A;  2HXI A;  4M6X A;  2HDC A;  1UAA A;  3Q9V A;  2VAS A;  1Y1V J;  3IRQ A;  5KG7 A;  3WG9 A;  1PDN C;  1USS A;  2Q2E B;  2R4G A;  5B1A H;  5KAF C;  3RPU D;  1JHH A;  5L3C A;  2E2J J;  2JSC A;  1ULY A;  2CRG A;  1F4K A;  1YW7 A;  4DR5 H;  4LB5 A;  4CGZ A;  1HQC A;  3BTJ A;  4YFK F;  5HLT A;  3S3M A;  3M9M B;  4OMZ A;  4FS2 A;  4O3R A;  2NVY A;  4K6N A;  2H1K A;  1EKV A;  5M5X J;  2UZK A;  5LHH A;  4E7Z A;  5LEJ A;  3MR3 A;  1JXL A;  2E1M C;  3PQJ A;  2FU4 A;  1WI3 A;  2H6C A;  5JQG F;  1YLF A;  4GYI A;  4XK4 A;  3TQN A;  4EGY A;  2ZDG A;  5C4X J;  2E7W A;  2VA2 A;  3NWT A;  4JYK A;  2A5W A;  4GXO A;  4J0M A;  1KBL A;  5FO5 A;  3G6E I;  1FOY A;  2FLN A;  3OV8 A;  4OIN F;  2H27 A;  4G94 A;  4NZN A;  2YR2 A;  4FS1 A;  2DK8 A;  1TP4 A;  4UUV A;  4RB1 A;  4R79 A;  2HGS A;  4EEQ A;  4O7T A;  3FMS A;  3OYL A;  5E3L A;  2IBK A;  5CVI A;  2WAF A;  4DR7 H;  3U1K A;  5KG5 A;  2XGX A;  3S32 A;  5ICG A;  2KDO A;  2HVQ A;  2LF7 A;  4IEJ A;  4IRD A;  2XRN A;  3H40 A;  3VYT B;  1GUU A;  4CC6 A;  4TV7 A;  1M0W A;  5KFO A;  3GX4 X;  3AG3 H;  4IR1 A;  3JZ6 A;  1AU7 A;  4O3M A;  4FE4 A;  2M05 A;  3TOA A;  4HRI A;  1IBM H;  5B66 C;  3M8E A;  5LD2 C;  4A3F G;  4A3E G;  2LDU A;  2VC0 A;  3BWG A;  2NVU B;  4IX7 A;  2OA4 A;  2FMA A;  3M9N B;  3UZO A;  3QPT A;  3GZ5 A;  1Y0U A;  3M7G A;  5KFL A;  4O3Q A;  3HG9 A;  4FBT A;  2LLK A;  5M3F J;  2V4J C;  1KC7 A;  4U7C A;  4TUY F;  1FYL A;  3R4K A;  3JTG A;  3DEW A;  4M3F A;  3HOX J;  2HDK A;  4CKC A;  4LH7 A;  2QUF A;  1TW2 A;  4NQW B;  2FB9 A;  3OUZ A;  2QA4 I;  1PUF A;  5LGT A;  4XLF A;  2FBH A;  2VBY A;  2P7V B;  1J59 A;  1X4P A;  1P8L A;  3TEK A;  2UVW A;  4IO9 F;  4DYR A;  2LP0 A;  3FF5 A;  5BWW A;  2CUJ A;  1E2X A;  2DA5 A;  4DNC A;  1I94 H;  1Z2O X;  5DMX A;  3KX2 A;  3R0J A;  4HYE A;  2Y30 A;  3QRF F;  2JA7 J;  2FK3 A;  2K9S A;  3HOZ J;  2KDZ A;  1RK6 A;  2QQB A;  1HW1 A;  3TY9 A;  3DKW A;  4BHP A;  5EDW A;  1KTA A;  3RV3 A;  4A93 G;  3BDD A;  3G6X A;  3MZ8 A;  4PBC A;  2DAA A;  4EMS A;  2VON A;  1R5I D;  5E8I A;  3N6R A;  4JXU A;  1K4T A;  2AS5 F;  5TRD A;  3ZMV A;  4L9T A;  2WAQ E;  1GGO A;  4HOB A;  1HKT A;  1Z2N X;  5EWE A;  5A2Q W;  1DDN A;  4E7J A;  3ETJ A;  3LWF A;  1TAE A;  1I1L A;  4DR3 H;  1V3F A;  1CQI B;  2DT5 A;  2ZC2 A;  4RB2 C;  4I55 F;  4F4Y A;  2PJP A;  2L01 A;  5HOO A;  4CHU A;  3OR2 C;  2E2I A;  3GLX A;  1O57 A;  1GO3 E;  2VUM A;  2V4Q A;  1T33 A;  2VE8 A;  3BTL A;  4XZ3 B;  3OHA A;  3RR5 A;  2XF5 A;  5F1R A;  5E3N A;  1MSF C;  4C5A A;  2HOT A;  4BWS C;  1IDY A;  4A0X A;  2DPI A;  1JUP A;  1OYW A;  2KL4 A;  4ABZ A;  3GIK A;  1GT0 C;  1VND A;  2R5Z A;  1BA5 A;  1Z1D A;  2R93 G;  2PEX A;  2DO7 A;  3EPZ A;  1ZAR A;  1I6U A;  2OUM A;  1FP1 D;  3JAM W;  1R36 A;  4GGG A;  2MGQ A;  5FLM G;  3I64 A;  3RFC A;  3F72 A;  3UQ8 A;  2J6U A;  2BZT A;  3O6B B;  5AIP A;  4L5E A;  3OYJ A;  5DQI A;  2VIX A;  3JSO A;  4UCO A;  2HXO A;  5KFK A;  2HHH H;  4YJ2 F;  2KLO A;  2PN6 A;  3KYL A;  4Y15 A;  4YAK B;  1IW7 F;  5T14 A;  1MBJ A;  4HLX A;  2HHF A;  4BQO A;  1MD0 A;  1JXS A;  2FOW A;  5KT4 A;  2COB A;  1JUS A;  1T2K A;  2RRE A;  1A31 A;  5LGN A;  2R93 J;  4KNY A;  3CQZ A;  1WH2 A;  1R6R A;  4IRC A;  1BR1 A;  4CE5 A;  1YG2 A;  2PBZ A;  5IP6 A;  1IUF A;  3K5I A;  3FKI A;  4XKB A;  4H4K C;  1IV6 A;  3AG4 H;  1JTX A;  3PUB A;  5HS7 A;  1VQ9 I;  3V4Z A;  3ISP A;  3M4O J;  1F9N A;  2ASJ A;  4DRF A;  5J2U F;  5JLW A;  1EA3 A;  4O2B F;  2KMU A;  5FLX K;  4HQ6 A;  2B63 A;  2K40 A;  2X0L A;  4BY1 J;  3KLO A;  1S29 A;  1DUX C;  4MAM A;  1R4M B;  3DF8 A;  2QEX I;  4BBS G;  1M0T A;  2GAU A;  3T9A A;  3K7A J;  1XMQ H;  4F4Z A;  5EZH A;  3P7N A;  1B72 B;  2GLO A;  3RUP A;  3K69 A;  4AIH A;  1X1C A;  3HSR A;  4E4H A;  4HZF A;  3RJP A;  3T7A A;  2NU6 B;  3MWE A;  2X6X A;  1UMQ A;  3N97 A;  4J00 A;  3S3O A;  5JLX A;  1TWH J;  2EIM H;  3CUQ B;  4NBQ A;  2VB6 A;  3I9V 2;  3PQK A;  4CYD A;  3KP3 A;  2ZME B;  1T56 A;  3ZRG A;  1TC3 C;  3ZN0 A;  1FTT A;  2DFF A;  3J80 K;  4A3F J;  2HQA A;  2YRX A;  2DW4 A;  3L2P A;  3OR1 C;  4XRM A;  2YL2 A;  3G71 I;  2H94 A;  2OWO A;  1TA8 A;  5BPF A;  1VQ5 I;  4PZ7 A;  3LSI A;  2TDX A;  3BJA A;  1HA8 A;  3IUO A;  2LNB A;  3H5N A;  3VPR A;  1I2K A;  3LQS A;  4DR2 H;  3RAX A;  1RYS A;  4PUS A;  1TW3 A;  4HQM A;  4E7I A;  3GTL J;  1P6R A;  3SEQ A;  1H9T A;  2KIS A;  4AIK A;  1VFC A;  4YII A;  1FSE A;  4BU2 A;  3CCM I;  4U88 A;  2PLY A;  3VYU B;  2HGX A;  2W6P A;  2XAH A;  2DI3 A;  4QWB A;  4JI0 H;  1GVD A;  1TWG A;  3R5F A;  1S7A A;  4XLN F;  3RB3 A;  2R92 J;  2QM3 A;  3BQ1 A;  5KG6 A;  4CCL A;  4ECV A;  2FQ3 A;  4ECZ A;  4XLA A;  3I4M G;  2Z5U A;  2QKM B;  4U0W A;  2JEF A;  2NAZ A;  2LG4 A;  3FM3 A;  3KHG A;  5C3E G;  5IT3 A;  1DP7 P;  5DGH A;  5J3L A;  1BGW A;  4B4C A;  5J1U A;  3H35 A;  5CE8 A;  1QZZ A;  3CZ6 A;  5DV5 A;  4J19 A;  1BIB A;  4A0Z A;  2PN1 A;  4QWD A;  2KIM A;  3LQR A;  3NEU A;  3HKZ N;  3OSF A;  2Y9Z A;  3H3V H;  3E3V A;  4LIT A;  4I76 A;  1NK2 P;  1YS6 A;  3CC2 I;  3KP5 A;  2ECB A;  3ZQL A;  1POG A;  3KLN A;  2L9N A;  1AUX A;  2ID3 A;  2P6T A;  3EDP A;  5L3E A;  4PGH A;  3JAM K;  1UNN C;  5KFA A;  2VUM G;  4UCS A;  3DTK A;  2Y48 A;  2YYA A;  1GSA A;  1C30 A;  2AGP A;  4XYM B;  4MEY F;  1KU9 A;  3GTJ J;  4DUY H;  1Q1H A;  3I71 A;  3RZO J;  2NYX A;  4XON A;  1WPK A;  1KQ9 A;  2FUG 2;  3UR3 C;  1QHG A;  2CYY A;  3HZJ A;  4C5B A;  1KQ0 A;  4EGQ A;  1YIJ I;  1Z05 A;  1GV2 A;  3GLL A;  1K6Y A;  2MH9 A;  2OQR A;  3ROU A;  2W70 A;  2A6H F;  3FHZ A;  5L1J A;  2BGC A;  4MNU A;  4LMY A;  1D8J A;  2YRW A;  3VEP A;  4IAJ A;  4ECX A;  3GTO J;  2W8L A;  2BV6 A;  2K9M A;  1Z3X A;  4JBA A;  3SEZ A;  4B3A A;  3AW8 A;  4QWC A;  4LIU A;  3PM1 A;  3J7Z I;  3RB4 A;  2FPG B;  3QOD A;  5LBQ A;  4JI1 H;  2F5C A;  4N4N B;  4RGR A;  1CKN B;  3I4N G;  4OWR B;  1K7A A;  4HDU A;  2XGE A;  1EYZ A;  2Z99 A;  2IXS A;  2CV1 A;  2E1N A;  4HBL A;  1SVL A;  4N4O B;  1ULZ A;  4L9V A;  4DQ2 A;  4ZJZ A;  3V6K A;  4HLY A;  5D4R A;  4B3S H;  5HVQ C;  2M7B A;  1XS9 A;  2V7F A;  2HKO A;  2DDB A;  1IOV A;  2R8J A;  3DLA A;  1I5Z A;  2L54 A;  5GAD J;  5KFP A;  1F43 A;  1WCM J;  3MMY B;  3RPQ A;  2R6F A;  2O03 A;  1IJW C;  4OMY A;  1SEU A;  1T98 A;  4JK1 X;  2FML A;  1N34 H;  1I39 A;  4GKK H;  5EF6 A;  4IOA F;  1DGS A;  2IJL A;  3CCY A;  3GFJ A;  3MZY A;  4RAG A;  2ABJ A;  2V6E A;  2CQQ A;  5H2F C;  5H6Q A;  4DYQ A;  3GTQ J;  4F3Q A;  9ANT A;  3AX6 A;  2CU7 A;  3FXU A;  1Z7U A;  2CW0 F;  3WTT C;  2F4O B;  6PAX A;  2WV0 A;  5DIS C;  4MV6 A;  5CB4 F;  1LDK B;  1PUF B;  1R71 A;  4E7H A;  4YQW A;  4ED2 A;  1G8X A;  3ZMZ A;  3DKY A;  2ME0 A;  4XQF A;  1RES A;  2CH0 A;  1BOB A;  2IEK A;  4FU0 A;  3VFZ A;  2GPW A;  3EQL F;  1ZQ7 A;  2P5V A;  1PVE A;  2JPB A;  2ZBK A;  3GV5 B;  4YBZ B;  3CVZ A;  4PJL A;  5H6R A;  4A3I J;  3JZI A;  4EBD A;  1A6I A;  1GVJ A;  1UFM A;  2B7E A;  2W84 A;  3DCF A;  5I5T A;  1ZET A;  5FLX W;  5KAI C;  1ODD A;  4GC6 A;  1TLH B;  2OC6 A;  1EKP A;  1TWC A;  3LQQ A;  1RNL A;  3ZR8 X;  2VUG A;  5I5U A;  4P1W A;  1LDJ A;  2A5Y B;  1I1S A;  2GQR A;  4IHW A;  2M8G X;  1J7K A;  1IXS B;  3WWJ A;  2VKE A;  3S93 A;  2XAU A;  1ENH A;  2OV7 A;  3JRH A;  4ZDO A;  4LJZ F;  4QIW N;  3T9E A;  1ZG1 A;  5CM0 A;  3PW2 A;  1OCR H;  1I3Q A;  4BKX A;  3S1M J;  1RR7 A;  5FD5 A;  3DAA A;  4A12 A;  2A69 F;  3FZV A;  1ZTR A;  4YEJ A;  3Q2O A;  4ED8 A;  4JI5 H;  5I5V A;  1JKP C;  3LFK A;  2Z02 A;  4WBN F;  4FX4 A;  1VF9 A;  3BAA A;  2V79 A;  3TIG A;  1A9X A;  2VR1 A;  1RUO A;  2M30 A;  2NOJ B;  3I53 A;  1IG7 A;  1HST A;  4C3I J;  4BE1 A;  4E6N A;  3WTY C;  5KG2 A;  1N32 H;  5EWF A;  2C22 A;  1MIJ A;  1TWC J;  4F52 A;  4PFO A;  3DWL E;  1CQT A;  2E35 A;  4QJF A;  5KNL A;  3ESW B;  3V8J A;  4AU7 A;  1LEB A;  1XMK A;  5FLV A;  1DAA A;  3HRT A;  2FXA A;  3MEX A;  1QRY A;  2UXX A;  2HWV A;  3GVA A;  2N8G A;  3PW5 A;  3U55 A;  3RKQ A;  1XDN A;  2BXY A;  2CQX A;  5FKM A;  3VWB A;  4C3J J;  4M9S A;  3S8P A;  1S7O A;  2CW8 A;  2ESN A;  1SFO J;  2LK2 A;  3FXL A;  2LBF B;  1Y8Q B;  1B9N A;  4UUS B;  4ZQI A;  3PW7 A;  2XUB A;  4MO7 A;  2MLK A;  4FFN A;  3FKI G;  1Z77 A;  4KT5 C;  4UVC A;  3BT9 A;  1ZG3 A;  1IN7 A;  2L0K A;  4KIG A;  4A3C G;  2MC3 A;  1ZR2 A;  1O7L A;  5EJC A;  3W6V A;  5I60 A;  1VZ0 A;  3RYR A;  3DF7 A;  4NYE A;  3EET A;  3LA3 A;  1ORK A;  4I0B A;  2QBY B;  2VE9 A;  4HF2 A;  2BVM A;  1GSH A;  4EQ5 A;  4KN4 X;  4Y7N J;  1AN7 A;  4G9Y A;  4LD5 A;  1G6N A;  3RF2 A;  3PW0 A;  2YW2 A;  2L9R A;  4MFD A;  4DQN A;  5HV6 A;  3J7A Y;  2ZJR F;  2PVP A;  1ZRC A;  2IS4 A;  4X65 H;  2W9C A;  2E19 A;  4XRF A;  4QLC U;  4BJ6 C;  2BOL A;  3A4C A;  1Z91 A;  3K1N A;  3MJF A;  3C0F B;  2E1M B;  4PJJ A;  5C1O A;  2LD5 A;  4P9U A;  2M45 A;  3LWB A;  3GW2 A;  4FBU A;  1FT9 A;  3HOZ G;  1QPM A;  2HZT A;  3H36 A;  1CKO A;  1AUV A;  4TQR A;  4A6D A;  2GBY A;  4DL4 A;  5DLG A;  3W5O A;  1D1A A;  3BOQ A;  4CXF A;  5CVV A;  1A48 A;  3Q8P B;  2BVL A;  4DBQ A;  5IYB G;  2HJW A;  3N44 B;  1BW6 A;  1IOW A;  1HC8 A;  4BDZ A;  2BHZ A;  2EFN A;  2L9V A;  2OZ6 A;  3KZY A;  4YAJ B;  3RTR A;  1WHU A;  5BYB A;  2FA5 A;  4ZZD A;  1EH8 A;  4OIR F;  3HL2 A;  2EPF A;  1IO2 A;  5C4X G;  4A3E J;  1HOM A;  4LFA H;  2FMY A;  3NRV A;  4CUG A;  1YX3 A;  4I99 C;  1UZC A;  5BS6 A;  1GDT A;  5FPR A;  4I6Z A;  4DL2 A;  5J1Y A;  2PFB A;  3H4B A;  4HSR A;  3CCQ I;  1ETV A;  4D7N A;  2LVS A;  2XIG A;  2KP6 A;  1ON2 A;  3PFF A;  4QPQ A;  5DG8 A;  1KJ9 A;  3J7A K;  1AKH B;  4X6A J;  5BQT A;  1G59 A;  3G1O A;  1IRG A;  2LYC A;  2ATL A;  3RI4 A;  5ILV A;  4ENN A;  3H9Q A;  1APL C;  2L7Z A;  1YS7 A;  5FRN A;  3WGH A;  4A5N A;  5M5W J;  5JHU A;  1SD7 A;  4FFM A;  3Q8R B;  2L4A A;  3TIN A;  4Q45 A;  4DL6 A;  1WWX A;  3IHU A;  1WQ2 A;  4XMY A;  3FXM A;  1QHH D;  4G7O F;  3ABM H;  5KT2 A;  1S03 G;  1UC9 A;  2YWV A;  3CJQ B;  3RAQ A;  2DOF A;  4O3N A;  1FX7 A;  2BXZ A;  1XK5 A;  5EWG A;  1JIH A;  4ECR A;  2LH9 A;  1O3R A;  1TWH A; 
#chains in the Genus database with same CATH homology
 3MKY B;  4ETS A;  1V5F A;  2W4S A;  4HNT A;  4RB1 A;  4R79 A;  2HGS A;  4EEQ A;  4LF9 H;  4YY3 H;  2PJR B;  3OYL A;  1YE9 A;  2WAQ A;  1WJC A;  1WJ5 A;  3OYC A;  2WAF A;  1XMO H;  4DR7 H;  1LKX A;  3S32 A;  3K4K A;  1X19 A;  2KDO A;  2KSW A;  4NXM H;  2HVQ A;  1Y6I A;  4LFB H;  2JUG A;  3BLY A;  1W36 D;  4JI8 H;  4G6T B;  3VYT B;  4CC6 A;  1M0W A;  3BCB A;  3LSH A;  4B3M H;  1B04 A;  2LY1 A;  4U7B A;  4HRI A;  3KAJ A;  1IBM H;  4DV1 H;  1DQU A;  4BS9 A;  3RSN A;  3G2B A;  5LD2 C;  4PZ6 A;  2VL8 A;  4UFZ A;  4JI6 H;  3OYH A;  2WY8 Q;  4IX7 A;  5FPO A;  3TY5 A;  4PSW A;  2CUZ A;  3HG9 A;  1V5E A;  2V1N A;  1AA7 A;  3N05 A;  4B48 A;  2V4J C;  3HPH A;  3OYD A;  3AL0 B;  4B3T H;  4DV2 H;  2Z2S B;  3OWT A;  2VXD A;  3IP4 B;  2RQQ A;  4LH7 A;  4NQW B;  2A6T A;  2V26 A;  3VYS B;  4XLF A;  2FE3 A;  2QKL B;  2F6C A;  1X4P A;  1P8L A;  1MMG A;  3T1H H;  3EYY A;  2WBM A;  2CUJ A;  3OS2 A;  1I94 H;  1Z2O X;  3FBN B;  2R7U A;  3KX2 A;  4LF7 H;  4DR4 H;  2IGM A;  1IBK H;  3A1Y A;  3TL4 X;  2LRD A;  2ZXI A;  4RAY A;  3TY8 A;  4MV9 A;  2UU9 H;  1E4G T;  3K10 A;  1O75 A;  4F92 B;  3OYF A;  1Z7L A;  3OIQ A;  4ZDL A;  1NG6 A;  3TY9 A;  3PNV A;  2DT7 B;  4PFP A;  2VPL A;  4QPO A;  4UCR A;  2RGR A;  3BG7 A;  4BEH B;  2JA2 A;  4AQY H;  3A2K A;  1S9H A;  3LML A;  4ZYA A;  1Z2N X;  5A2Q W;  4LH6 A;  2RGV A;  2E5L H;  4E7J A;  2VQC A;  3IAM 2;  3FHN A;  3OS1 A;  1TAE A;  4DR3 H;  2ZFU A;  4ANJ A;  2HVR A;  3PNY A;  4APM A;  2WB1 A;  3K4B A;  4LSX A;  4RB2 C;  4F55 A;  3J81 W;  3ZQQ A;  2L2O A;  4F93 B;  3GJX B;  5HOO A;  3OR2 C;  3OYN A;  4B3X A;  3NBY B;  2K3P A;  2R7O A;  3MKW B;  3RR5 A;  2XF5 A;  1X4O A;  4BL0 B;  4BWS C;  5CQE A;  1SFK A;  1T95 A;  1N75 A;  2KL4 A;  2X1E A;  3D5R C;  2ELJ A;  4B43 A;  4OAZ A;  2R7V A;  1FMV A;  4XLH A;  1DP3 A;  1BJT A;  4E7K A;  4BQN A;  4E7L A;  3CES A;  4XOR A;  2X6W A;  4YHH H;  3EPZ A;  1W36 C;  1I6U A;  2VQL A;  2OUM A;  3JAM W;  1BR4 A;  3BAB A;  3LSK A;  3UQ8 A;  4XM3 A;  4IZZ A;  2KZV A;  3OYJ A;  2X1C A;  4RLQ A;  4XLE A;  2VIX A;  2HHH H;  4UCO A;  2UUA H;  2KQR A;  4I7H A;  2KLO A;  1BR2 A;  3KYL A;  3L2U A;  2X51 A;  4XLC A;  1MNE A;  4BEH A;  3KEY A;  3JSL A;  4BQO A;  2UXB H;  3H5R A;  2W00 A;  2RRE A;  4KT6 A;  2BW3 A;  1WH2 A;  1R6R A;  3N42 B;  1BR1 A;  3OYG A;  4FET A;  2VKD A;  1J5E H;  4XKB A;  1GLN A;  4H4K C;  3FMA A;  4CCK A;  3PUB A;  3J80 W;  3GBG A;  4X62 H;  4RM3 A;  2R7R A;  3S3N A;  4DR6 H;  3D5L A;  4BJ5 C;  4DRF A;  2IGK A;  3DQV C;  1EA3 A;  4XKC A;  4XNF A;  2KMU A;  1V9P A;  1JI8 A;  4GRI A;  3MWM A;  3N6X A;  1HR0 H;  2DT6 A;  1E4F T;  2CV0 A;  3LSM A;  2KRH A;  3C2G A;  4ZDP A;  4JOM A;  4DV7 H;  1M0T A;  3RQ4 A;  3EUA A;  4KIS A;  1XMQ H;  2VJI A;  4BE0 A;  3VNN A;  2WE6 A;  4JI2 H;  2RNG A;  4LF6 H;  3H5A A;  1X1C A;  2JSP A;  2LC2 A;  3V42 A;  5JHF A;  4E4H A;  2R7Q A;  4CCN A;  1S68 A;  3LL7 A;  4RLF A;  2UWM A;  2X6X A;  3JSN A;  3RCO A;  4J00 A;  3S3O A;  1MND A;  2XDV A;  5KHD A;  3OY9 A;  2VB6 A;  3I9V 2;  4ZTF A;  2MCT A;  4DGW B;  3ZRG A;  1UG0 A;  2VOB A;  3L4K A;  2HQA A;  4J01 A;  4ZC3 A;  4E6K G;  1SYX B;  3EUK L;  3L2P A;  3OR1 C;  5D1P A;  3GDE A;  2OWO A;  5FRO A;  2F4I A;  1N36 H;  1TA8 A;  3ZCO A;  3OYB A;  4PZ7 A;  3CP8 A;  2UUB H;  2UUC H;  3LSI A;  4DV5 H;  4CC5 A;  4BJT A;  1D1B A;  2ZXH A;  3IUO A;  3H5N A;  1HA8 A;  4DR2 H;  4ZTJ A;  1IBL H;  1L2Z A;  4PUS A;  2KHM A;  4E7I A;  1Z21 A;  2Z1D A;  4LFC H;  1MMD A;  3PNT A;  2CS3 A;  3SEQ A;  2CV2 A;  1FJG H;  1GYF A;  4BU2 A;  2R7T A;  4DBR A;  2WYO A;  3VYU B;  4JI0 H;  4XOT A;  3DU5 A;  2R7S A;  3ZXS A;  5TGT A;  4P5O A;  5D1O A;  4CCL A;  4X64 H;  3DPT A;  2HPM A;  4XLA A;  1MZB A;  2QKM B;  3SZG A;  2LG4 A;  2IGN A;  4XL9 A;  5LMU H;  3LFU A;  4LF4 H;  3W2A A;  3H9J A;  1BGW A;  3OYI A;  3H35 A;  1HNZ H;  3VSK A;  3CZ6 A;  1Z3Y A;  2IS2 A;  1HNW H;  1LVK A;  4JQF A;  4Y33 A;  3H0D A;  2X1D A;  3MD2 A;  3W1G A;  4LIT A;  3RJ0 A;  5BR8 H;  4YRV A;  4PK4 A;  2L5Q A;  3OMY A;  4KIT B;  3CP2 A;  2L9N A;  1YX5 A;  1N32 H;  2ZSI B;  2GOM A;  4UCS A;  3DTK A;  3C2H A;  5CPR B;  4DUY H;  4DIQ A;  3DTI A;  1FMW A;  4XON A;  4LSA A;  4HG2 A;  2FUG 2;  2K9L A;  3UR3 C;  3F8N A;  1QHG A;  1D0Y A;  3VSL A;  1XNR H;  1MW7 A;  4EAT A;  2M0M A;  3K4N A;  4Y3O A;  1FVI A;  1IRX A;  3MKZ A;  2K5C A;  4IKF A;  4Y4R A;  4C30 A;  1HNX H;  1K6Y A;  3K6G A;  1TZL A;  4U87 A;  5IWA H;  5D1O B;  4LMY A;  4DJA A;  4HNU A;  3KXY T;  4IAJ A;  4UCV A;  3L4J A;  3PN1 A;  2K9M A;  1Z3X A;  5CQG A;  5LFA A;  3SEZ A;  3DTE A;  3L2Q A;  4LIU A;  3OYE A;  4RM2 A;  2VKH A;  2BW3 B;  1CKN A;  4LF8 H;  3K4L A;  4AVZ A;  3QOD A;  4JI1 H;  4N4N B;  3AL0 C;  2F5V A;  1CKN B;  4OWR B;  4IQ4 A;  3HOS A;  4E7S A;  1D1C A;  2IXS A;  4CSW A;  2CV1 A;  3PSF A;  4BQQ A;  2R7W A;  4N4O B;  4BGD A;  5FRM A;  4ZJZ A;  4LIV A;  4B3S H;  5HVQ C;  1J09 A;  4B44 A;  2M7B A;  2Y0S A;  3L2V A;  4DV3 H;  4OX9 H;  2LBF A;  2V7F A;  4BE2 A;  4OAY A;  3DLA A;  3MMY B;  2PJR A;  3KYH C;  4B3R H;  1PJR A;  3TBI A;  4C9Y A;  2O03 A;  1X1A A;  4C2U A;  4M7E A;  1D0X A;  3L2W A;  1E0E A;  1X1D A;  2VJ4 A;  3CMM A;  3CJR B;  1N34 H;  3M8J A;  2LY2 A;  3FBI B;  4GKK H;  4NNJ A;  1T0F C;  4EFE A;  2F4V H;  4GKJ H;  1DGS A;  3BA8 A;  2VLA A;  4UCU A;  2HPI A;  4DUZ H;  2UXC H;  3BCA A;  2V6E A;  4BDY A;  3F9K A;  1KON A;  4UCT A;  4HPQ A;  4F3Q A;  2O5R A;  2AQE A;  2XF7 A;  2L7K A;  3QYF A;  3DEE A;  4XN0 A;  3W2V A;  2YCH A;  2IGO A;  2R7X A;  3EUH C;  5DIS C;  1LDK B;  1P9Q C;  4E7H A;  2W1O A;  3W2W A;  2HIV A;  1DGR M;  1X1B A;  1G8X A;  3DKY A;  1Z2P X;  3IAS 2;  4XQF A;  2CH0 A;  2JVH A;  1BOB A;  4EFB A;  1WJF A;  1OLT A;  3OYK A;  3RIZ A;  4B47 A;  3CVZ A;  2HZD A;  4PJL A;  2M7A A;  2LOO A;  3OYM A;  4X66 H;  5FLX W;  5EOY A;  2CW7 A;  3AFH A;  3OL3 A;  1WFX A;  2OC6 A;  4JYA H;  3NC0 B;  4A2A A;  2VUG A;  3ZR8 X;  1ERD A;  4P1W A;  3DU6 A;  2UV1 A;  4CCJ A;  1LFP A;  3N40 P;  4HST A;  4GLX A;  1ZHQ A;  5CKT A;  4LF5 H;  4KJZ A;  3LSG A;  2E5N A;  3OOU A;  3S93 A;  2XAU A;  4BAC A;  2MYS A;  2OV7 A;  4ZDO A;  1FKA H;  1WJD A;  2UXD H;  1TT0 A;  1N77 A;  5FD5 A;  1A0I A;  4NC8 A;  4YEJ A;  2WY7 Q;  2W82 A;  3K3V A;  3H9G A;  2WA0 A;  3W3C A;  3HC7 A;  3TMO A;  1VS0 A;  2Q1Z B;  3BAA A;  3SYT A;  2VJ5 A;  3RGX A;  5LMN H;  2DXI A;  1N78 A;  4AYB A;  2NOJ B;  4II3 A;  1P16 A;  4BE1 A;  2DCE A;  4YEL A;  4LG3 A;  4E6N A;  2VQF H;  3HKZ A;  4F91 B;  3GB8 B;  4F52 A;  1MMA A;  3DWL E;  4PFO A;  3OS0 A;  2W7N A;  3W1B A;  4K0K H;  5KNL A;  2AQF A;  2JVG A;  3AKZ A;  3FKJ A;  3N43 B;  2CFO A;  2I8D A;  2UUZ A;  3CF2 A;  4AU7 A;  2M4G A;  4NC7 A;  2KRC A;  3BG6 A;  3L2R A;  2HIX A;  1XDN A;  4MTD A;  3VWB A;  3HXL A;  3S8P A;  3VDX A;  2W57 A;  4PJM A;  4MLO A;  2VXZ A;  3KAK A;  2CW8 A;  4CH7 A;  5HNF A;  4R7R A;  4JI3 H;  4JV5 H;  1D0Z A;  1UEL B;  2V9K A;  2LBF B;  4JI7 H;  2ZSH B;  4NUB A;  4IQJ A;  4PZ8 A;  3KAL A;  5FD6 A;  4XOP A;  2XSJ C;  3NWS A;  2ZJT A;  2KPM A;  2MC4 A;  2IS1 A;  3K4M A;  1WJE A;  3M4I A;  2Z16 A;  2XF6 A;  2X85 A;  4RZQ A;  1VZ0 A;  3DF7 A;  4CZC A;  2PMZ A;  4RB0 A;  5HNH A;  3PFY A;  4Q0Y A;  3E1S A;  3VYR B;  4FM9 A;  2BVM A;  2DOA A;  4EQ5 A;  2IS6 A;  3RTX A;  3T1Y H;  1AN7 A;  4ITV A;  4DV6 H;  4XKW A;  3NBZ B;  3RF2 A;  2VQH A;  2E5Z A;  3M1C A;  4II2 A;  1SEI A;  2CFM A;  3J7A Y;  2IS4 A;  4XN3 A;  4X65 H;  3QYB A;  3BC8 A;  1NG7 A;  3UNG C;  4KHP H;  2WAE A;  2Q2U A;  4BJ6 C;  4PJN A;  2BOL A;  3A4C A;  3C0F B;  2L9S A;  2E1M B;  3QOE A;  4PJJ A;  4XR6 A;  4CCM A;  4BXF A;  3U21 A;  5LL6 b;  1CKO A;  3N41 B;  1Y56 A;  3FDY A;  4XKV A;  2DJI A;  4MTE A;  2GOX B;  3DKX A;  1D1A A;  2MFZ A;  3W5O A;  2VPS A;  3PL8 A;  1WJB A;  1ZHS A;  3HOT A;  3S24 A;  3DPL C;  2Q2T A;  4HEA 2;  4D1Q A;  5KCM A;  4JI4 H;  4X0G A;  2BVL A;  4DBQ A;  3K70 C;  3QWU A;  3N44 B;  2MAB A;  1ZEL A;  2WAD A;  5IT9 W;  2M4K A;  4BDZ A;  2P0W A;  2VJJ A;  4PSX A;  3BA9 A;  1U0J A;  4RAZ A;  4DV4 H;  4DOZ A;  4FAS D;  4C2T A;  3RTR A;  3OYA A;  3PJR A;  1OR7 C;  4MV7 A;  2VQG A;  3HL2 A;  1XNQ H;  4NXN H;  1X9N A;  4LFA H;  2X6Y A;  1MMN A;  4CUG A;  1YX3 A;  3H20 A;  4RB3 C;  2HNH A;  3K4J A;  5FPR A;  3OIP A;  2MD0 A;  4A2B A;  4CA0 A;  4CCO A;  3LMM A;  4HSR A;  2M3A A;  3E0J B;  3I3L A;  3K4C A;  3SDB A;  2XIG A;  2KP6 A;  4D9J A;  4DR1 H;  3OL4 A;  3PSI A;  3DPU A;  4QPQ A;  2CMP A;  4RMN A;  3J7A K;  1V5G A;  1PYV A;  3IG0 A;  2HDW A;  3K70 D;  1G59 A;  2VAS A;  2LRE A;  1UAA A;  2LYC A;  2ZM6 H;  2Q2E B;  2R4G A;  3QYE A;  3RPU D;  3H9Q A;  3OTO H;  4DR5 H;  5FRN A;  3S3M A;  5HLT A;  1QU3 A;  2HVS A;  3HUG B;  2VQE H;  3RGZ A;  1WJA A;  4E7Z A;  2WDT A;  4XMY A;  1N33 H;  2E1M C;  4PDB A;  3HPG A;  3ONQ A;  1QHH D;  1S03 G;  2HU9 A;  3ZGK A;  1DGW Y;  3CJQ B;  4JI5 H;  1SAU A;  4BUP A;  3NWT A;  2A5W A;  4J0M A;  2XC7 A;  1XK5 A;  4DV0 H;  3D5S C;  2LH9 A;  2E60 A;  1CKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...