2HVQA

Structure of adenylated full-length t4 rna ligase 2
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
329
structure length
316
Chain Sequence
SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFSEKKVELSEADNKLVGILACYVTLNRVNNVISKIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase
molecule keywords Hypothetical 37.6 kDa protein in Gp24-hoc intergenic region
total genus 91
structure length 316
sequence length 329
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvqA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvqA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvqA01
3BAAA 4EQ5A 2Q2TA 2HVSA 4EEQA 3GB8B 2OWOA 2CFMA 4PZ6A 3BABA 5FPOA 1FVIA 3NBZB 5D1OB 1XDNA 3NBYB 5DISC 3GJXB 3BA8A 4UCSA 3VNNA 3S24A 4UCUA 1DGSA 3W5OA 2Q2UA 3GDEA 2HVRA 3TY5A 5D1PA 3TY9A 1VS0A 1TA8A 5FPRA 1XK5A 4UCRA 1V9PA 3QWUA 3TY8A 4LH6A 4PZ8A 3NC0B 3W1BA 4E6NA 1X9NA 4GLXA 4DRFA 2HVQA 4PZ7A 3RR5A 3JSNA 4UFZA 1CKOA 1P16A 1B04A 3W1GA 1S68A 4UCOA 4EFEA 4CC6A 3BA9A 1CKMA 2VUGA 2HIVA 1CKNB 3PN1A 4UCVA 5D1OA 3UQ8A 3JSLA 3RTXA 2HIXA 3KYHC 4CC5A 4UCTA 1TAEA 1CKNA 4EFBA 4LH7A 1P8LA 1A0IA 3L2PA
chains in the Genus database with same CATH superfamily
2IJLA 4GRIA 2HZTA 4YELA 5M5WJ 4XKCA 4A3EJ 3W2WA 1S5LC 1W5TA 2W24A 2C6YA 3HOZJ 3TIGA 4XOTA 2JEGA 1I1LA 3ZQGA 4PGHA 4E7SA 2HKXA 3FBIB 3KHGA 4IHVA 2IA0A 2FLPA 2CU7A 4KHPH 5C44G 3R4KA 3I56I 4BXUA 4IRHA 1KZHA 1IAWA 3I4MG 1WVRA 4A0ZA 4KDPA 4CCOA 4ED3A 4PSXA 2R3SA 3E6BA 3NRVA 4D0PA 1ZQ3P 2JEFA 2M0CA 3P9IA 2W7OA 1ZTRA 2GIZA 3K4MA 1G3TA 4PK4A 3QU3A 2BGCA 3MN2A 1UHSA 3TQNA 5B66C 1G8XA 3Q8RB 3G4SI 2OV7A 3FX3A 4XN0A 1EF4A 3AG1H 4A12A 1FMWA 4J9RA 2R92A 3GIQA 1IZ1A 1XDNA 4UCSA 2R93J 4C5BA 1YFHA 2NU6B 1VQNI 5LFAA 3CTAA 2X6WA 3FKIA 5I5XA 1O3SA 2BEOA 2VOPA 3NQOA 2R92G 2BY2A 5EG0A 3R5FA 4NZNA 3A0BC 1QRYA 4WD3A 3T8TA 2KP6A 3S3NA 1P92A 2ZC2A 4M6XA 3LFKA 4CCKA 4O7NA 1W5CC 2FF4A 5FROA 3CO6C 3GTMA 1N78A 3HGGA 4GC6A 1HXDA 4L9JA 2YZMA 3ABUA 3KHHA 2MW8A 1R5ID 3GTLJ 2I87A 4HQEA 1GUUA 2VQCA 1J09A 1ZG3A 2WADA 1X1AA 2DA6A 3BTLA 3FXLA 2LREA 4DYRA 1IF1A 3PIPF 3RCOA 2XF6A 2PBIA 4M9SA 1JJ8C 1BC8C 3J81K 1K1SA 2VPRA 4EJWA 4KJZA 1VQMI 2A07F 2M4GA 2YS7A 5FD5A 1ZLJA 1FLIA 2KRHA 2M0MA 5D5XB 5HOOA 4HZFA 5JUMA 5FLMG 2VBZA 3A1YA 2H27A 1LFUP 5BPFA 4BY7J 2GQSA 3HOXG 2K40A 4BUPA 5J47A 5FB2A 2GQRA 5GPAA 1FT9A 4NNJA 3BWGA 2R86A 2VUGA 2VL8A 3QP6A 3KCCA 4MEYF 1O3QA 3R0AA 2O5RA 4DR6H 4KIBA 1QGPA 3PFIA 2E71A 3T5LA 1B6SA 1Y8RB 1MJAA 4LFUA 1KBLA 3OUUA 3PSIA 2O0YA 4Q47A 3WO1A 2DT5A 3LSHA 4TV7A 2YU3A 2H1KA 3H36A 4F4ZA 2XAUA 2WY7Q 3S16J 2W71A 2E2IA 5BR8H 1DGRM 1XGNA 4ECQA 1VS0A 4O83A 3RPUA 1YYVA 2DJIA 4ME6A 5EEHA 2LYCA 2VJ4A 2XHKA 4EVIA 1AOYA 4ESJA 4X1EA 4EEYA 3G8CA 1R9TA 2R7ZA 1Z6RA 2FMYA 5L1IA 3FMAA 4M6VA 2BYVE 3V4GA 1BIAA 3E5XA 4AUXA 4O86A 5IWAH 2EV0A 2UVRA 4DZJA 4DR1H 2XUBA 2MH2A 2OLSA 3A0HC 5JHFA 1X1BA 2IEKA 3I59B 2H8WA 1JKOC 4NHJA 5I5UA 4IKFA 1VF9A 1ONVA 3OHAA 2W9BB 4EYHB 1DGWY 2ZDQA 4R8UA 1TWHJ 3ZMUA 2QKLB 1IXRC 2L4MA 3V8LA 2LSOA 1FOXA 3G1MA 3MR5A 1I39A 2R7OA 3Q8QB 1W0TA 3J7AY 4C9YA 4N9IA 2VBYA 5EEAA 2JA7A 3M07A 4XORA 4GYIA 2E1MB 4XSXF 2PMZA 3OY9A 3I54A 2JK3A 1WSUA 3B02A 3CCLI 1KQ9A 1WJFA 3TO9A 1ZKGA 3E3VA 1H9TA 1KU9A 2LC2A 4Z6YA 2NVTJ 4YHHH 4IRDA 2Y69H 1XB4A 2P4WA 3HXLA 4XRSG 1FTTA 1I6UA 1E4FT 3GZNB 3CESA 4MAMA 4ZDLA 5J4VA 4IO9F 3OL3A 5IP7G 4PUSA 3P7NA 3BAAA 5D6FA 1EKPA 2ESHA 4XRSA 3GB8B 4EEQA 4JV5H 1BI2A 4A93J 4BBSJ 2YZNA 3BABA 5HV6A 1QNTA 3HKZE 4CDGA 2ZGIA 5E8IA 4LJZF 3RJ0A 3I64A 1S97A 5DS9A 5ILUA 3BR3A 5CLSA 3BQ1A 1EUDB 2HG8A 2IA2A 4HF0A 1S0NA 1MIJA 3OOUA 2COIA 5FD6A 5EWFA 2V5AA 3G8DA 1B9NA 2RC4A 2QQ9A 2UWMA 3CJNA 1XS9A 1K79A 1ACIA 4LSXA 4MFDA 2XPVA 3DU6A 5J2TF 4XNFA 4MTEA 1R71A 2W6NA 2KHMA 3DEUA 4E4HA 3ZQFA 3HOYJ 5I5VA 2C22A 2I8DA 5GPCA 1SFUA 1AHDP 4B4CA 2JA5G 5FJ8J 1KU2A 3BY6A 5HODA 5B1AH 2ZO4A 2PLYA 2HHFB 2CQXA 4Y3OA 2IGMA 4BH9A 1SFKA 3L7WA 4P9FA 1C0WA 1APLC 5GADJ 4MV6A 2NXNB 2V1XA 4FM9A 2LBFA 4O7VA 1X1CA 2CFOA 5GP9A 2GM4A 1ZG5A 2HTSA 2WV1A 4A3LJ 5I47A 4FISA 4P55A 1N32H 1RPWA 4IL6C 2CYYA 4FFRA 2P81A 1TWHA 3R6SA 3UR3C 4BS9A 2HIVA 4TUYF 2MCTA 2RNGA 2FNPA 3Q0UA 1W1WE 2K4BA 3MWDA 2R7VA 1KU3A 5JQWA 1S7EA 4ZH4F 4FU0A 4ZYEA 3V7SA 1IYDA 2LOOA 5LBQA 2ZJRF 3VOTA 1SANA 4EJVA 1BGWA 2E5ZA 4KICA 4NB5A 5D4RA 4M74A 3WO0A 2QZ8A 3PSFA 1PVEA 5CKTA 5KFBA 1VQ9I 4CA0A 3R23A 4ED1A 3AG3H 2ASJA 2DODA 2XKPA 2M7AA 2FKLA 5KG5A 5EG0B 2F4MB 4QWAA 1T08B 3LSRA 1G59A 1WCMJ 4NC8A 3RB3A 1GDTA 3RIZA 4M3DA 3GXOA 1RNLA 3TQ1A 3E1SA 3K4BA 2XGPA 3DEEA 4M3GA 1ZG1A 1NK2P 5C4XJ 3RB0A 3B73A 1ZR4A 3GTQJ 2HYGD 3OYEA 2VI6A 1OPCA 2ELKA 3BZCA 2XSDC 5LHHA 2VKEA 3EUKL 3M9OB 1T3NA 3MZ8A 2KFDA 5LGUA 2GA1A 2FSWA 3QU6A 5FKLA 5E3OA 3OYFA 3W6VA 2L7MP 5KFYA 4TQSA 2C2RA 3OYBA 5F0HA 1QPMA 4R79A 2Y9YA 5FPRA 1V5GA 4D7NA 2JA7G 4JX6A 5BWXA 1I3QA 3FXQA 1WJEA 2GA2A 1ET0A 1FYLA 4GGGA 4M72A 4YB8B 2HYJA 3Q5FA 2HOTA 3DF8A 1EZ1A 3S8PA 4LITA 1S6LA 3JCUC 3N6RA 4IHJF 4PBCA 4RNOA 4A3DG 4C2MA 3ASNH 2ZDHA 3LNQA 4Q8EA 2CGPA 2CQ7A 3MKYB 2D45A 4O4HF 1P4XA 1P9QC 1HNXH 2CFXA 4RAZA 5CVJA 1BNCA 1U78A 3GIJA 2ZM6H 3K0LA 1R1VA 2IVMA 1T39A 1Z6TA 2Y9ZA 1O57A 1ETWA 1IN5A 2R7RA 2R87A 3GZ5A 1IJWC 5E1ZB 4N9HA 2R7KA 3ORRA 3HYIA 4G3IA 4HYKA 4L9TA 1VKZA 2QCOA 1U6GA 4OU0A 4RNNA 3K1MA 2R7NA 3IUOA 3Q9VA 1T2KA 2JZYA 1BBYA 3DPTA 4RLQA 5HDNA 2JN6A 4HLXA 5LEJA 3CCRI 3HOUG 2JVGA 3QQAA 3RGZA 3J7ZI 2EFOA 3KAJA 3KP2A 2R8JA 1XGSA 2LKSA 3E5UA 3D5LA 3OYDA 4AVZA 3LAPA 4RZQA 3PUBA 4CMDA 2R7TA 4EG0A 3HOVG 5F9NA 3S15J 3J81W 3ONQA 2BXZA 1GO3E 5J6XA 1PUFA 3ABMH 2SCUB 3GJXB 5E20A 1AN7A 1Y14B 5LXTF 3GTKA 4PWQA 1HNWH 3AG2H 2DMUA 1I1GA 2GLTA 1E4GT 3DTEA 1H8AC 3AKZA 4EGYA 1HF0A 4QW8A 5EDWA 4IQJA 2LK2A 1WH2A 5IYCG 4K0KH 3IWZA 1IN6A 3PW0A 3IHUA 5LL6b 3QYFA 1YRNA 4IHTA 1R4MB 3ULQB 3E7LA 3BR5A 4L18B 2IBKA 4DQ2A 1GVDA 1LPQA 1KJIA 4DIQA 1AKHB 3T5JA 2VC1A 3EPZA 3U1KA 4IWXA 5L3DA 1IN4A 5JVDF 4O81A 4O7LA 4WCGA 1D3YA 1JDEA 3HPHA 3ESWB 5KFOA 1NTCA 4D1QA 2MGQA 2OAZA 1YIJI 4GCVA 5IP9J 2CW8A 2J9GA 2GXAA 3LULA 4CGZA 4MV4A 4N4OB 2YU9J 1WWXA 1BR1A 2JA2A 1I1MA 2C28A 1N36H 4BDYA 1DU6A 4MEXF 2WY8Q 2KJCA 2W4SA 2VPLA 2L9VA 1TA8A 4MTDA 2HHHH 1V5FA 2LKXA 1HLVA 1VQ6I 1RJQA 3ZMTA 3FM3A 5ICCA 1YIOA 4DYQA 1LUJB 5FKNA 3SXYA 1Y1WJ 2W6PA 5K3WA 1KYWA 3CUOA 3H5RA 4KITB 2Y48A 4CKBA 2PJRB 1W5SA 2FK2A 2B63G 5HS8A 1IBLH 3DAAA 3BG3A 1YW8A 3Q3SA 3ZMSA 3U55A 2AGPA 4A3BG 3S14J 1XD7A 1TC3C 5L3EA 1T0FA 3CP2A 4OMZA 3S1MJ 3T9EA 4EBDA 3VYTB 3TY5A 3TY9A 2M05A 1IBKH 2VJJA 3KFWX 1XSDA 4L9NA 4LD5A 4N4NB 3CCEI 5IYBG 1K4TA 1RUOA 2KRFA 1K4SA 1A31A 5K1YA 2HJWA 3H3ZA 2MFZA 3W1GA 2UU9H 5BYAA 5ICGA 2NRAC 2NUAB 4W1UA 4BHPA 1WPKA 1JLLB 1ULZA 3EUAA 1YO5C 2QSGX 1CKMA 1ZAUA 3T54A 2FMAA 2W7PA 3HHHA 5A2QW 3I5UA 1FP1D 1U5TA 2B7EA 2TRTA 4BACA 3SQNA 4ZYAA 3F8BA 5E8GA 1GSOA 3PR5B 2W9CA 2QYOA 2G7HA 4E7IA 3BR6A 1RESA 3WE2A 3X2QH 1KU7A 1E4EA 1X58A 3KALA 2LFBA 4KUMA 4FT8A 1A9XA 2R85A 5FPOA 1TWCJ 1EYZA 3DEWA 2DA5A 3OTOH 4NC7A 1VQKI 5J1UA 4F4WA 1JGSA 1FBUA 2ZNYA 3S17J 3LOCA 4M0JA 4ZQIA 1Y8QB 2E19A 2MLGA 3W6JB 2C2DA 2F4OB 3WGGA 1WR2A 1OCCH 3JZFA 2VQFH 2GXGA 4KNYA 3CCYA 5KFLA 3CMEI 4JV1A 3PN1A 2RVCA 1BC7C 1J7KA 2MABA 4W97A 4C2TA 4O7YA 2LY2A 2ZJQF 3VPCA 3K10A 2YPRA 2W7NA 2H8RA 1KTAA 2RGRA 4U0WA 3H3UA 1HDPA 1ZELA 5C1OA 3GTOJ 3P9CA 3H40A 5KT5A 3SEQA 1OBDA 3MFIA 1W7PD 4KIFA 2FLNA 2OZ6A 1HW1A 1XMKA 4JK1X 2HEOA 2BHYA 2RDPA 5JVTA 4AYBN 2C2EA 2CQKA 1RI7A 2K7LA 5EYRA 1UFMA 2EB7A 3GLLA 3G1OA 3CVZA 4B3TH 2FBHA 4F92B 4NUBA 2V1DA 3AL0B 4Q4CA 3UQ8A 3ETHA 3DXJF 3TEDA 3F8CA 1ZH5A 1DPUA 2FB9A 2R5YA 1V5EA 2XC9A 1O7LA 1GXPA 3TOBA 2BVLA 2OCCH 2KKOA 3DTKA 3D5RC 3DCFA 4EJUA 2DK8A 4ZYDA 3CCSI 5HDGA 2CNVA 3LSGA 5B5EC 4Y52J 4WHXA 4IR9A 3CZ6A 5CYVA 5D1PA 4HQ6A 3PNYA 4PCQA 4YJ2F 3H0GG 5KG3A 5DGAA 1P7JA 5JH7F 1R6RA 1HSTA 2HVQA 3P9KA 2XGEA 2CNQA 4DIMA 2HDWA 2Y0SA 3WTWC 2M3AA 2K27A 1NG6A 2PMZE 3HKZA 2M34A 1JI8A 4E7LA 3H0GA 5KG1A 4UCVA 3C2BA 3DKXA 3RAQA 1WRJA 2ISYA 1WCMG 4ECTA 3VODA 1UELB 4A3CJ 5IT9W 4LK0F 3OS1A 2UXNA 3C18A 3ZN0A 1LKXA 3JAMK 2AGQA 5CE8A 3M8EA 2GIVA 2JUCA 3D1NI 3KP6A 4B48A 3NBZB 2XROA 1MW7A 3RV4A 3LMLA 4UV8A 4EATA 1STZA 3UNGC 2CZGA 3KZIC 2FEZA 1DP3A 2XGDA 5IT9K 4RBOA 1Y0NA 4D5FA 4XQFA 2CWEA 3WTTC 1JT6A 4E7HA 3JTGA 4E70A 2EFPA 5KFIA 2F5DA 2QWWA 1W93A 4RB0A 2UZKA 2JA7J 2E5LH 1P7IA 4DV2H 5LYJF 3PNVA 2LF7A 2JA5J 2IS1A 4BE2A 4TQRA 3PO2J 4BXFA 3ZQLA 3JSOA 4J00A 3FK7A 4QW9A 4UV9A 1P8LA 2ELHA 1UNNC 1OBGA 1OFCX 2HQ5A 5HNFA 1MNMC 4Q5SF 2KMUA 3FXMA 1CGPA 3DKYA 1B72A 3I9V2 3K4KA 5EGOA 2CNUA 4Q43A 4LFBH 1FZPB 1D0YA 2EIJH 4ZDPA 4PZ7A 2OU2A 3G2BA 4QPQA 1NH3A 2F5FA 2E34A 3OV8A 4JYKA 2PJRA 4X62H 4TV9F 4DR3H 2CQNA 2FJ1A 1R36A 2NNNA 3L9FA 4F7ZA 4PJLA 4XN3A 2HIXA 3OYLA 4B44A 1IXSB 2XPUA 1X4OA 3LSJA 2G9WA 3GEZA 3MEXA 5D6EA 5EJCA 1JX4A 2LKPA 2X1DA 2NOGA 3H5NA 3RKXA 2XCPA 5E17F 4YJ3F 2HOAA 3JREA 1UC9A 4XKBA 4I09A 3OYKA 5D1OB 2VQDA 2W9AA 4HNTA 1BR4A 2KL4A 3BCAA 2CQYA 3WTXC 2XAHA 3G6VA 5IYZF 3BQZA 4I98B 1O3TA 1OYIA 3QYBA 4LH6A 4A5NA 1MSEC 1LFPA 1P16A 2FMLA 3GBGA 1U9OA 4Y17A 4S0HB 3CMYA 2HDDA 2QM3A 3BG7A 2ID3A 4LG0B 3JRBA 4O4LF 2VOBA 1S9FA 3WHCA 4YFXF 4NQWA 3CDLA 5DQGA 4I6ZA 3GF2A 5D8KB 3GTKJ 3VPRA 2V9VA 2VQLA 3HOXJ 1HKSA 2EIMH 2FX0A 3K2ZA 3IWFA 3IKVA 4PFPA 3HL2A 2XF7A 5FLXW 4DR2H 4AQYH 2V4RA 4WWCA 4R8UB 1AU7A 3JAMW 2CUFA 2YZGA 1S10A 4M3EA 1QHGA 3FXUA 3ZMDA 1BA5A 4BL0B 3ORQA 5FO5A 1VI0A 2A6HF 3ZXSA 2Y0MA 5D4SA 5IT3A 5K5RA 2WYOA 3HRUA 4EJTA 2WTEA 5J8FA 4XL9A 5H2FC 3FM5A 4ZZDA 4YG2F 4JQFA 4UCOA 4JV0A 3PO2G 1QHHD 5KFSA 4LF7H 3KEOA 2BE5F 1IG7A 3SE7A 4KT6A 2DT7B 5K7FA 3VYUB 3ELKA 3GMEA 3WE3A 3VYSB 1YOVB 1R1TA 3FXOA 1PP7U 1IRGA 3MZHA 4BQOA 4UNOA 1QU3A 2R5YB 3Q2OA 1FSHA 1SFOA 2DZDA 4B3MH 1VQ4I 3TW7A 1QBJA 1D5YA 3S24A 3BROA 3IH4A 3HM5A 4WF2A 4XMYA 4A5MA 5KKNB 2I80A 4IZZA 1HQCA 3Q1KA 2J5OA 2Z16A 3K1PA 4BHCA 1ITYA 3RAXA 5DMXA 2IGOA 3V42A 3UZBA 2OCEA 2WE6A 2R7WA 2CJJA 1ZLKA 1X1DA 4L0YB 3CSWA 5L1LA 5JR3A 1BI1A 1XSVA 1JGGA 1SAXA 2FNAA 1ULYA 1UHWA 2IGKA 2MBFA 1R5HA 3NEUA 4C3HJ 1R5GA 5JLXA 1JKJB 2V9KA 2XGCA 1FNNA 3K2AA 4U7CA 3QODA 2IBDA 2Y75A 3LMMA 2O8XA 5T14A 3U9TA 2Z99A 3U2RA 2NOJB 3M8JA 2YS9A 4CCJA 3FF5A 3CJRB 4AYBE 3T9AA 1E3OC 2FQ3A 1PX2A 3WU2C 3NWSA 1KA8A 2W00A 4L9VA 2WB1N 3RUPA 3GTMJ 2L9SA 3RKYA 5E3NA 1VBHA 2LNBA 1IOWA 3DTIA 4B8XA 4AIKA 2Z2SB 1EH7A 2FOKA 2Z5UA 2QSHX 1BW5A 1CF7A 2J6UA 3ETJA 4DR4H 1MD0A 4KA4A 5FLVA 1BJAA 1UG0A 3I4MJ 2ECCA 5DQHA 4M9UA 1YW9A 3LWBA 1TWAJ 5LD2C 4ZI7F 3T9BA 4DV1H 2F4VH 1K83J 2LY9A 2ZCWA 2C35B 4DV3H 5F0CA 1I2KA 2R8GA 5JI6A 4EQQA 3CDIA 2W6MA 3AW8A 3OR2C 2H09A 5HNEA 1WFXA 2QYZA 2R8IA 5KAIC 2X0LA 5AIPA 5FFZA 2QVOA 4LFCH 2XGQA 3BQ2A 4BGDA 3TY8A 4O7ZA 2QQAA 4HLYA 3M4IA 4I0AA 4XONA 4HNVA 5I5TA 3S93A 3HRSA 1HBXG 3ZQQA 4ECYA 3LSMA 1YQAA 2Z33A 1RRJA 2LTPA 3C2GA 5KFWA 4XRMA 5FRNA 4DW6A 4RCNA 4ECVA 1ETOA 3RPUD 3W3CA 3TINA 4FE7A 4XLEA 2VUMJ 4ECZA 3ABLH 3GV7B 4X0GA 3GTJA 4LF5H 4MV3A 2M9HA 2A6EF 1LDKB 4BU2A 5DM7F 4QWEA 3OMYA 1HC8A 2ASLA 2HYFA 2V1UA 1RJPA 2IP2A 1Z67A 3MWMA 4CYCA 3J7YJ 1UB9A 3KPHA 4LFAH 2IMWP 1R7JA 4FETA 4NQWB 3Q8PB 1XCVA 2YU9A 4YFNF 3OSGA 2EWNA 2P5KA 4YIFA 4X6AJ 5HLHA 5C1PA 4A2UA 2UV1A 4ED7A 3IV5A 3S2HJ 2VJIA 4MLOA 2HI3A 2MC4A 2LMDA 2UUZA 1X3WB 2VOOA 3HOWJ 4MO7A 4U7BA 2E35A 1PJRA 5A2QZ 4KISA 2DAAA 1SMTA 2E1MC 3F8NA 2W9BA 4I50F 2OWOA 4HA8A 1MMGA 2EZLA 4X66H 4A3MG 4PJMA 1PUEE 3H3VK 2KIQA 3E6CC 1D0XA 3SZPA 3HG9A 1RR8C 3O6BB 4JI5H 3HOWG 4OAZA 3ZQHA 2W48A 4F93B 2HVRA 1YG2A 3HSFA 2GOXB 3BLYA 4BAYA 3L09A 4XYLB 2ZMEC 3T1HH 4BQNA 2JA8G 1O3RA 2M2EA 2JQ7A 2YUSA 2PX9A 2EJ3A 4O7WA 2I10A 2OBPA 3Q0WA 3GV5B 3JTHA 2NVUB 1SD5A 2R7XA 1AKHA 3LA7A 1MBKA 2XSJC 2LLKA 4B3AA 3RBDA 5TISC 3TBIA 2G7UA 2FK3A 2CUZA 2N8GA 5FJ8G 2HS5A 3H4DA 2AGOA 2E7WA 1KC7A 3WU0A 5E1WA 3LSPA 4DV0H 3GTQA 5DTDA 4HX7A 2W25A 4FGRA 1ZGJA 2YCHA 3BJOA 3RKWA 2HTJA 1M1EB 3ROUA 5TGTA 4C5CA 2UXCH 4HBLA 3FMRA 1IW7F 4EM2A 2X6XA 2Z9OA 1O7FA 4CMFA 3BPVA 4CHUA 2JA6A 2R8KA 4RU9A 1K61A 1YS7A 5LRRA 5H20A 2EA2A 2E1NA 3BG5A 4EM0B 4G6QA 4GLWA 4UHTA 4CO8A 5KFVA 3EPGA 2ETHA 3Q9SA 3VSKA 4F4XA 1IO2A 2F2EA 2V7FA 3CDHA 3TW6A 3MD2A 2DPDA 2O9LA 2KJBA 3RI4A 4L1KA 1Y1VG 2YL2A 2KRCA 5LMUH 1LQ1A 2CFMA 1ZR2A 5KT2A 2JJ7A 3SDBA 2WTFA 3BR0A 4NXMH 3WWIA 4U87A 2ID6A 2O6GE 2KZGA 4PFOA 2WB1A 5CJ9A 3QFFA 1CF7B 4RLFA 4RM2A 2M87A 3RJPA 3L2UA 4UCRA 1ZHQA 1XDSA 3LQRA 3RBEA 3GTPA 1S29A 3JAMZ 4A3GG 4DV7H 4JX5A 1R4NB 4ZJZA 1I50A 3GTLA 1B6AA 3HO8A 1JHFA 4D7MA 5KFMA 2QBYB 4F4YA 2RV8A 4AVPA 3HHGA 3V7CA 5IP9G 1ETVA 4Q4ZF 5HBRB 4ECRA 1S9HA 1IRFA 4IEJA 3E6DA 4A3MJ 4ZYGA 4YAJB 1WRVA 3I4NJ 4O2AF 2AQ4A 3BOQA 4R1HA 4OX9H 4II2A 4KYWA 4LF4H 2R8HA 4IWYA 2CV0A 1HW5A 5F27A 2YRWA 3GFMA 3VYRB 3BG6A 3VFZA 2D1VA 3FIWA 1SFOJ 2KPMA 3R61A 2IS2A 2ODTX 3GO5A 4CH7A 1C30A 5KG7A 4BQAA 4ECWA 2UUCH 4FQGA 4XKVA 1P4AA 3RQ4A 1V54H 4JBAA 3GCMA 1TTYA 1SAUA 4ZC3A 2CW7A 3KP3A 1XX5A 4RGSA 2Q1ZB 3GQCA 5CA0F 2NS8A 2VPQA 3FDSA 4DR5H 1MH3A 3L2RA 1TWCA 1G3YA 4CSWA 1SFEA 1I2LA 2PVPA 5DCMA 2BW3B 4C2UA 5DISC 1X19A 5GTHC 4JI1H 1R9TJ 2W82A 2NS7A 3GLKA 4DQNA 1SCUB 4XLPF 2DMTA 4OIPF 1Z2PX 4BKXA 3GLXA 1B1BA 5I5WA 3AYHB 2UXDH 2BOLA 3GFIA 2DFEA 3HB9A 1IYEA 1AUXA 1JKQC 2VE8A 3KZYA 2FE3A 3WNZA 5I60A 1ZETA 5IYBJ 4MV1A 1GLVA 3GTOA 4TM5A 5BS6A 3BT9A 1AA7A 3FHZA 2VR1A 1XCBA 2HPMA 1IN7A 2DPJA 2OQGA 1SC7A 2XF5A 4Y15A 3WWHA 1SD4A 2K5CA 3PQKA 1FVIA 4ZZLA 1OCOH 5IYCJ 3S1NJ 3WWJA 4BE0A 5JLWA 1IDYA 3MFHA 4U7DA 4B43A 2YX7A 3ML6A 2ZXIA 3SNOA 5KS8A 2QENA 1WJBA 2OPTA 3IH3A 4NZOA 4LLGF 3BJYA 2EV5A 2L7ZA 3ZOBA 2HGXA 2RAEA 1QO0D 5CPRB 4HX8A 2DJNA 4BDZA 2QB5A 4HSTA 2ECBA 3CCUI 3J7AK 3GIMA 3IRQA 4XKWA 3BR2A 2Z04A 2VA3A 3LQQA 2V59A 2ADUA 2AQFA 3F9KA 4M9ZA 1J0RA 5EF6A 4IRIA 1IDZA 5D8DA 2MC3A 3IG0A 1B59A 1FWZA 2VONA 1MNEA 5IY5H 4HYEA 3K70D 3ZN1A 3PO3J 3F3XA 1A0GA 3KEYA 1QQIA 3RKQA 2DTZA 2HGWA 4G7HF 3HJEA 4V19K 1MJ9A 1LE8A 3OSFA 2B9SA 4IF4A 2QA4I 2QK4A 2VIXA 3LSTA 4O4JF 1ERDA 4Q45A 2FA5A 2DFFA 2EFWA 1U0JA 3FZVA 1BXRA 4IHXA 4MA5A 3A01A 4Y8VB 4B3RH 2EZKA 3KTMA 5FKOA 4NLGA 9ANTA 4FFNA 4PDKA 1B9MA 1TNSA 1HW2A 2PJPA 2ZDGA 1Q1HA 3JRFA 3GX4X 4L5JA 4DAAA 2VA2A 1Y1VJ 2BR0A 5BPDA 3K4LA 2X0SA 3NUAA 3VB2A 2NU8B 3HOVJ 4V2GA 3HUGA 5LGTA 3MMYB 2V79A 4BY1G 1MBJA 3SYTA 5GAHJ 4MFEA 3CLQA 1S0OA 3JRDA 5B3SH 2V58A 4HOBA 2X5RA 4A2BA 4WBNF 1Q1VA 5DDGA 5K5QA 3EYYA 2OTLI 5DGHA 3ABTA 5KFXA 2CV2A 3JRIA 3V6KA 3ABKH 2DMNA 1L3LA 1BJZA 3H35A 3BZ6A 1T33A 1ZN2A 5FLMJ 1R1UA 4AIDA 3CCQI 3MQ0A 2GQQA 1BR2A 4HV6A 4I7HA 4NXNH 2VB6A 1ETYA 1K6YA 5ILVA 1BI3A 1RKTA 2MSYA 3IP4B 4G94A 3O3KA 4F3QA 2VASA 5D5WB 2EIYA 3T5KA 2BBYA 3A03A 1UCRA 3H9JA 4J9KA 1ZAOA 1TZLA 5L3BA 5DG8A 2KIMA 5IPAA 5KG6A 2F5EA 3SDGA 5K5OA 2PMUA 1USSA 4J0MA 2MD0A 1HCRA 2WAEA 1TQMA 4PGGA 3DV8A 5LEKA 3JSPA 3HOZG 3H9GA 5D5VB 1ZGAA 2VT2A 1N25A 1QZEA 3ZR8X 1U8BA 3EYIA 4O84A 2V9WA 2LVSA 3F6OA 2OZUA 4HQMA 1OCZH 3HPGA 3TDUC 4ETSA 2O61A 3M1EA 1XMXA 3L4KA 2DQRA 2K9NA 5FKKA 3TOAA 2X51A 3N05A 2L02A 3OIOA 2FPIB 1V51A 3S2WA 2CSOA 3I4PA 3N41B 2HZDA 4GDFA 2VBWA 3R60A 3U9SA 1A35A 2V6CA 2K3PA 3VEPA 1GLNA 3RQIA 4FE4A 4YQWA 5HLGA 3ZQCA 1E2XA 4IHWA 1V9PA 1AUVA 3V4SA 1S03G 3FBNB 2O03A 1SVOA 4YY3H 1ON1A 3ZGKA 1TQIA 4XBFA 2XKOA 1OJLA 1RK6A 4YRVA 2CW0F 2BZTA 4A6DA 5IP6A 4G6DA 3SZTA 4A3JJ 3PM1A 2NVQJ 2R7FA 2M45A 2RF4A 4YP3A 4ECSA 3WTYC 4IJAA 3MZYA 2IAIA 4AD9A 2E5NA 4XIDA 4CKCA 3GW2A 2X6YA 1D0ZA 2Y2ZA 3KLOA 4A3JG 2JA5A 2DPIA 1WJ5A 5ILSA 5L3GA 4P5OA 3KLNA 3MKZA 1EHIA 4RAYA 1N48A 3L4JA 1BOBA 5KT6A 1Z3XA 1LEAA 3E0JB 5E18F 5EOYA 5KFPA 3IRRA 4JI4H 1TP4A 4JI8H 3QQMA 5A2QK 4H4KC 1PUFB 5F6FA 3ECHA 3I59A 3G73A 2DDBA 4HF1A 1DIKA 4LF6H 5BPHA 3N6XA 2VKHA 4KFCA 1EKVA 4II3A 2E7XA 2GPSA 4A3GJ 3KYHC 1D1CA 1K1QA 2DYSH 2DOFA 2ICWG 5FNVF 2FQ4A 3FHNA 3T1YH 1OQYA 1I6HJ 4CCNA 1LVKA 4CZCA 2DOAA 4J19A 4FS1A 1VNDA 3HIFA 5DCMB 1MMAA 2STWA 1IRZA 1U5TB 3HTSB 2DMQA 3JW4A 1BJTA 2WC2A 2IPQX 2AO9A 4QTRA 1XGOA 4H0EA 5DYMA 4B09A 3J80Z 1XMQH 3V8KA 4FCYA 1V3FA 1EH6A 4Q4DA 5LRSA 2KZVA 4FFLA 4IHYA 3VSLA 4A2AA 1R58A 4FTHA 1I94H 4GYGA 4J9PA 4ED8A 1HOMA 1OR7A 2DO7A 4BE1A 2STTA 4OMYA 3U0GA 2WAFA 2F48A 3T99A 3DU5A 1JTXA 1WJDA 1XSXA 4QSHA 2DFHA 2FXAA 4I02A 3CCMI 2NNYA 2W9CB 4B3SH 2ELJA 1T6SA 3A01B 1DAAA 2B0LA 1TBXA 1ZGWA 5J1YA 4LF8H 2DA4A 2RREA 5C5JA 2NVYJ 5F9LA 3ASOH 2IA6A 3BZKA 3QWLA 2A61A 3BTIA 1LJ9A 4BY1J 3MWEA 3L2CA 5L1KA 1T36A 4C3JJ 1VQLI 4DL6A 1UAAA 3ZQIA 4X64H 5FLXZ 3C1DA 2XPWA 4M71A 3FXKA 3MVPA 5IP7J 4M7EA 2DW4A 5LOVF 1W7PA 3RTXA 4UVAA 3H9QA 4Y33A 3HTUA 1A36A 4TV8F 3L1PA 4QJFA 3JZ6A 1CQTA 3H0DA 3GVAA 3ERMA 4AM3A 2L2OA 2WDTA 2PQ8A 2E2HA 1OKRA 1H88C 2DCEA 3BG9A 2DU9A 1FP2A 2DIKA 2ATLA 2R7QA 2HOEA 1JUSA 4UB8C 5LHIA 2FP4B 2V4QA 4ENKA 1CS0A 2V9PA 1WI9A 5KFRA 1B4AA 4UB6C 4A0XA 1EJ9A 3K7AJ 5DQIA 5L1JA 1Z7UA 4J9SA 4KT5C 4L5EA 2VQHA 2HU9A 2WA0A 3GZ6A 1J75A 4NYEA 3D0SA 3T5HA 2BQ3A 3KYLA 1FSEA 1RZ4A 1F43A 3RR5A 1ODDA 3LSIA 3MJFA 3QRFF 2CS3A 5KAFC 3KP5A 5E79C 2ME0A 2EZHA 2E2IJ 2OTJI 3GIKA 4MQ9F 3OS2A 4BEHB 2CV1A 1KONA 1QA6A 4LB6B 2XC7A 2A69F 1GSHA 5BQTA 2HGCA 4YAKB 1EKFA 4A3IJ 4RNMA 5F1JA 1GV5A 3M8FA 3KAKA 1OCRH 3LA2A 4YBZB 2ZJPF 2WAQE 4ZDOA 2JMWA 2JEJA 4CKEA 1SVLA 2HWVA 2HPIA 2LH9A 3G6YA 1A04A 1VZ0A 3SHFA 2D2WA 5KK1A 2HXIA 2EFNA 2VPSA 4XICA 1LDDA 2RDIA 1MMNA 2V6EA 4RZRA 3MR2A 2CUJA 3HOYG 4LOCA 1IRXA 3EETA 2HQNA 1HKQA 2EH3A 2LRDA 3PL8A 4WXDA 2HQAA 1F36A 5CVVA 3UZOA 2XV4S 3P5JA 2DAOA 1HR0H 3KYCB 4ABZA 5GAEJ 3GILA 1NK3P 1TWFJ 4Y4RA 2ZB9A 3PO3G 3R9RA 2ZMEA 2ZFWA 3WG9A 2R84A 5KG0A 5F1RA 4NZMA 4EJOA 3A4CA 2L3DA 4CYCB 2YRXA 2C00A 2H6BA 3GIPA 1Z7LA 3R5XA 1L2ZA 4HF2A 2EPFA 2F5CA 2CH0A 4XM3A 3I12A 4UY8I 5CQEA 3WGHA 1M0TA 1K83A 1JUPA 1G3SA 1P4WA 3BA8A 1UMQA 3CC4I 4HSRA 4WX9A 2KDZA 1UC8A 3VMMA 4DLKA 3ZCOA 4RGRA 3QPLA 1FOWA 2IRFG 4EM1A 5FR9A 1MBGA 3F6VA 1WJAA 1HKTA 1JDBB 2D5VA 3UFXB 2DI3A 1HDDC 5GAGJ 1G3WA 2M7BA 4LGWA 3FK6A 3TQTA 1XGMA 3TO6A 3E5QA 4XX0B 2B63A 2K9SA 3JRAA 3K3VA 5DV5A 2ZXHA 2UVWA 2JA6G 3RYRA 4O3MA 4Q0YA 2BXYA 3CF5F 2UVVA 2Q2EA 5AONA 2PBZA 2QF7A 4YR2A 2R7DA 2QUFA 3A2KA 1F1ZA 1Z0XA 1RKWA 3K3PA 3MR6A 2BV6A 4ZYHA 4QLCU 3F21A 1SEUA 4DL5A 1WGXA 3TO7A 3K70C 4PZ8A 5I5SA 4A69C 1W4MA 3DFGA 3B6CA 4PJ0C 4OINF 1YW7A 5BNGA 2YX4A 2XD4A 2K9QA 2YW2A 4EGQA 1EKEA 2P5VA 2P5LC 1EUCB 1EV7A 3TMOA 1BN5A 2X9DA 5TJJA 2E1CA 2BVMA 3COAC 3FKIJ 4JYAH 5D5UB 1G2HA 2P7CB 3W2VA 3WTVC 3ERED 1N56A 4DR7H 1XDUA 4HRIA 1GVJA 1GT0C 2EFQA 1QPIA 2AXTC 2L01A 5EZHA 5DD8A 2DOEA 1BW6A 1WJCA 1REPC 3TP0A 3K5IA 5EZYF 3FKIG 1ETXA 2R5ZB 2COJA 5J2UF 3SEZA 4JP0A 4GFBA 4LLLA 2Q7DA 2R7MA 3CEBA 2DPUA 1VFCA 3DF7A 3R0JA 1O4XA 2Z02A 1OISA 4MA0A 2J6TA 4I4TF 2HXOA 5KNLA 1DPRA 3GYHX 2KT0A 3MFKA 1MMSA 2TCTA 1I1KA 4LF9H 3BC8A 3KZZA 2RQPA 5J3LA 1TWAA 1PP8F 4EGJA 2JUGA 3C0FB 3T9DA 1SMYF 3SZGA 4DL2A 2MA3A 3V7RA 1FYKA 3CUQC 4QWBA 2R6FA 2PN1A 2WWYA 3RB6A 4WXHA 5C8YF 5IYDG 2GZWA 1E17A 1BL0A 3TGNA 2K4JA 2FRHA 4XLCA 4X65H 2YSRA 2ZKZA 3CMMA 5KFEA 4RAFA 1E3HA 1YRNB 1SYXB 1KT8A 4MV8A 4DNCA 1X4PA 4CUGA 1XMAA 2K85A 4KIGA 4QIWN 4DV4H 1B6RA 1F9NA 4I55F 3RSNA 1WQ2A 1ZHFA 2QSFX 2X6OA 4BWSC 5EWEA 5HS7A 4JXUA 3M4OJ 1MKMA 1U8RA 1LDJA 3DBLB 2OQRA 5E3MA 2X1CA 4M3BA 3KIOA 2DA1A 4XOPA 1NG7A 4DUYH 2W85A 5IT9Z 5M3MJ 2W8KA 4Q44A 2P6TA 5L3CA 1V55H 3RPQA 1MGTA 1IUYA 1FEXA 2R7ZJ 1A0IA 2H6CA 5ICFA 4QWCA 3L00A 1S7OA 3LSKA 4DGWB 4E7KA 3FMSA 1VQ8I 1F4KA 3E5NA 1UJ8A 1RC9A 4I99C 4UUVA 2A1HA 3NGDA 1J5EH 3KREA 2M8EA 3S32A 2IGNA 3I4NG 2EA4A 1T38A 3OYGA 3FWEA 2OC6A 3QP5A 1JTYA 5ICEA 3M3YJ 4APMA 3JRHA 3C3WA 4NDLA 2J6SA 2F5VA 4OIOF 2BY0A 4PJJA 3V6JA 4A3DJ 1RK5A 3SI8A 3I55I 5HLTA 1FMVA 4BEHA 2L9NA 3OWTA 3QAHA 4MHGA 1I50J 3DBRB 5KT7A 1JT0A 3GIIA 2VBXA 1YTYA 4A3KJ 4IAJA 2KIUA 2X1EA 3OYIA 2ZMEB 2YYAA 1TT0A 2PN6A 3PFFA 2FUG2 2K86A 2OUMA 2FBIA 2XAQA 4KMUX 1OR7C 3T1BA 1XPXA 4DUZH 4JX4A 1PDNC 4E7ZA 4O7RA 1LFBA 1MDMB 1J5YA 3JR9A 3HOTA 2ASDA 2M5WA 4AWXB 4RA2A 2WB1E 2HDKA 4DOZA 2EBIA 2ZSIB 3FMQA 1VQOI 2ACJA 2RNJA 3BP8A 3LFUA 3HRMA 2A5YB 5KCMA 3MKWB 2EK5A 1T8IA 5JVLA 5DLGA 3KP7A 4GLXA 3KP4A 1FOKA 4O5VA 3SFIA 5KFUA 2Y0SE 1QVUA 4IVNA 2COGA 2HDCA 4MGRA 2VJ5A 3HOSA 4ESBA 5HNHA 5HVQC 2Q2EB 2E1OA 3FISA 3K4JA 4A3FG 3N4MA 4IRGA 2EJ2A 4KN7X 2FLLA 4IPAA 4KN4X 5LMNH 1Y0UA 3KXYT 4XLAA 4ENJA 4O3SA 1Y39A 3DWLE 4CYDA 2R5ZA 3PZPA 1IXCA 4CZZA 4XR6A 1Z2OX 1FY7A 2E60A 3F8FA 4DZPA 3CMAI 1FPQA 3CJTB 3NBYB 2JA6J 4F50A 2X85A 5L3FA 3I71A 3WGIA 5IOYA 4TVIA 1MZBA 4DRFA 2V1NA 2L7KA 2XRLA 4IX7A 2AXLA 1CKOA 3DQVC 3PUFA 2ME6A 5FRMA 3QOPA 2IXSA 5F64A 3PW7A 1CKNB 1IUFA 3S1RJ 1FIPA 2YWVA 1TWGA 2W6ZA 1KJ9A 2EILH 2O7OA 1O75A 1T95A 3J80K 2CO5A 3PR4A 4F55A 3OS0A 4HR7A 2VODA 2P0WA 2WV0A 3HBLA 3D5SC 4G7ZF 1D5VA 4EQ5A 1YX3A 2DBBA 3OYNA 1FBQA 5J8CA 3IL2A 1K78A 2HVSA 3ZMZA 5KFKA 3N8DA 4BJTA 2R7SA 3HEFA 1Y1WG 4ANJA 1XMOH 1P6RA 2R93G 4NC6A 3OR1C 3OUZA 1JKRC 3TL4X 3U1DA 1ON2A 2FD5A 3O2PE 5LGNA 3Q0VA 1W0UA 1SFXA 2VXDA 1AWCA 1GHCA 5KFGA 1S0MA 3GTGA 1B8IB 4DL3A 4U0YA 3M9MB 4WK8F 4J9LA 5KT4A 5BPIA 3FKJA 1ZRDA 1X3ZB 2ALZA 3C2HA 1M7JA 1YJ9I 2UXXA 4F91B 4JUZA 1YE9A 2LG4A 4CICA 1RETA 5CM0A 2P8TA 4J9NA 5IYDJ 2J5PA 2L54A 3TEKA 4G9YA 4HG2A 5AIQA 3W6KB 2W8LA 5C4JJ 4QIWA 5DG7A 3KX2A 4DL4A 2XGXA 2F4IA 5BYBA 5KG2A 3MR3A 2JPBA 1MNDA 2I8CA 3GIDA 1CQIB 2VUMA 1WI3A 2YR2A 3DTFA 2P6SA 1Z21A 2XCAA 3WHBA 3JRXA 3HKZN 1FX7A 2JVHA 4A3CG 4P96A 3GTJJ 4ED2A 2Y0SN 1DV2A 2KSWA 3HT5A 2A05A 5KFFA 5EEGA 4OOIA 2L9RA 2DK5A 1ZYRF 2HQRA 3CP8A 5H6QA 5ED4A 4IQ4A 1MBFA 1MBEA 2GAUA 4WXCA 5ERIA 3M9NB 1BI0A 3L2PA 3REOA 2DWCA 3WTSC 4RGXA 2L4AA 3N42B 2ZJ2A 3RF2A 1W7PB 4HDVA 2FPPB 2Q2UA 3OSNA 1FBSA 4E7JA 2LF8A 1MMDA 4HX4A 2VQEH 1TW2A 2HNHA 2FJZA 2ZNZA 3QZ7A 4EV0A 2HOSA 4A3EG 1BM9A 3N40P 3KHRA 2KQRA 3EUHC 3S1QJ 1B04A 2NYXA 5M5YJ 2CMPA 2IA1A 1Y6IA 4RGUA 5KT3A 1UZCA 4LLNA 1GGOA 5D1OA 1MDMA 3RZOJ 3FXRA 3UYYA 1TAEA 3HDDA 2EJ0A 3TP3A 3T5XA 2QKMB 4FBTA 1WZ2A 3QZ8A 3S3OA 1R23A 4I01A 1X3UA 1H89C 1U9NA 2CQQA 2A68F 4PJNA 1K6OA 3CQZA 3U9GA 4P9UA 5CR5A 3I58A 2DLLA 4V2FA 4BJ6C 4OWRB 3J7AO 1XTAA 5E3LA 4AU7A 2XAJA 2IS4A 5DD4A 1C3OA 2NU9B 3CUQB 4BBRJ 4R7RA 1XNQH 4U0VA 2K9MA 5EGOB 2ESNA 2LY1A 5BWUA 1S3JA 5EWGA 4YR0A 2DMPA 4OAYA 2X4HA 2EIKH 1RIOH 4LIUA 3RYPA 1IOVA 3ISPA 2ABJA 1YX5A 4OIQF 4FHTA 1A3GA 2Z1DA 2EV6A 3M9AA 4ECUA 2QEXI 4MV9A 2M8GX 4BQQA 1M6VA 3AX6A 2XRNA 2V26A 3DPLC 1JKPC 2UUBH 4G8XA 1RYRA 1YS6A 4FASD 4UUTA 3LAJA 3H0GJ 3ECOA 5TRDA 5J4YA 4BY7G 2I5UA 3DLLF 1CQJB 2UUAH 5L9XA 5C3EJ 5BOXA 2O8KA 3BJ6A 4GKKH 2R93A 2O3FA 3VA7A 4JV2A 4I76A 1D1BA 1FOYA 4ZHQF 3PW4A 1MSFC 3OOPA 3ZMVA 2G0EA 4ON0A 2Y30A 4BNCA 4RUCA 3IN5A 1Z9CA 3OHBA 5KFNA 3PFYA 1T94A 1Z05A 3ZQ7A 1DV1A 4FS2A 4KMFA 3LL7A 3R5HA 4AIHA 4MQVA 3W2AA 1CKNA 1ETKA 1X2NA 4LH7A 5J1RA 1A48A 1ZHSA 2VT3A 4B47A 1JXSA 3WU1B 4A3BJ 2EQRA 3PIOF 3S2DJ 4DJAA 2RN7A 3WTZA 1KJ8A 5K2MA 1IBMH 1V4RA 2W57A 1IN8A 4GC7A 2LP0A 5E25A 1IGNA 3W1BA 1OYWA 5F04A 3CCVI 1D8JA 3K69A 1OCTC 3K9TA 3PW2A 3JSNA 1SD6A 4O3RA 3T8RA 4UUSA 4I2OA 4EFEA 5HS9A 3CQZJ 5GTIC 2L5QA 3K6GA 1LB2A 3CCJI 4A3LG 1WH5A 1KYZA 3F8MA 1USTA 2W1OA 1TT5B 2ZXWH 3CJQB 3BTJA 4M6YA 1BOAA 5DUKA 3GFJA 4C30A 3TIIA 1NHAA 3FXJA 6PAXA 4XRFA 4EFBA 2E36A 2HFHA 4RAGA 1JUMA 1P2FA 1LNWA 2YZLA 1YJNI 4M9XA 4AC0A 3PQJA 3VWBA 4R8HA 1YI2I 1GXQA 1DGSA 1TQPA 4Y7NJ 4O82A 2D1HA 3EUHA 2PI0A 2MG4A 3IH2A 4L0ZB 1S7AA 2MYSA 1V4YA 1KGSA 4XZ3B 4RB3C 3DTGA 3A02A 1OWTA 2GOMA 3H4BA 1JJ6C 1A6IA 1I7NA 3SFZA 1POGA 3V4ZA 1I3QJ 1ETQA 5JQGF 2XVCA 3OIPA 4B3XA 1KQ8A 2ZJTA 3KHLA 3SGIA 4BJ5C 4Q48A 4J9OA 4K6NA 4LB5A 4LMYA 5LLQA 1JIHA 2JEIA 4IHSA 1M0WA 2WBMA 4NBQA 1G6NA 5C4XG 5CA1F 1I5ZA 2L0KA 4C2MJ 3MKLA 1T0FC 4D5CA 2RKHA 3W5OA 4LSAA 3QPHA 3H1CA 2IT0A 4IRKA 2DXIA 2XAGA 5FKMA 4UVBA 4O3PA 1XK5A 4JI2H 1YITI 4FBUA 1TL8A 1QZYA 4ENNA 4Z2YA 3DPUA 5F0FA 3RV3A 2DFIA 3EDPA 4O7SA 1MBHA 2LBFB 4EGZA 1B33N 1U3EM 4U6PA 4DYCA 5C44J 5M3FJ 2L7FP 5JFRA 3DLAA 2XAFA 5CVIA 2MD5A 2DDAA 2EJRA 2R4GA 2ZXJA 1N77A 4Y13A 5KFQA 3GV8B 4XLNF 3QPSA 1XG1A 3OYAA 2DT6A 1E4EB 2VXZA 3LWFA 2ZFUA 1RUNA 1F5TA 4PZJA 3EPIA 2Q2TA 2VC0A 5KG4A 3RIRA 5IOZA 1I6XA 3V6HA 2QGUA 2JSPA 3CLOA 1JHHA 4P1WA 4A3IG 3T9CA 3G71I 3UKGA 1WCMA 2DQLA 2FOWA 4YFKF 3HGYA 3HZJA 2JSCA 2WAQN 3G6XA 1ZARA 2R82A 5FFXA 4S04A 5JVGF 4HAMA 4EEFG 3CC7I 4CCMA 5BMVF 2B63J 3CO7C 4A3KG 3RGXA 4MIMA 1L0OC 1SVMA 2H1LA 3RZDJ 1X2MA 3BQYA 3N44B 4O3QA 3F72A 1PYVA 2DTRA 1U5TC 1TW3A 3H5AA 1R00A 3HUGB 1I1SA 2JRTA 2K02A 4QPOA 4JI6H 3BACA 3QOEA 2ZBKA 4OIRF 4LIVA 3L2VA 4UUSB 1ZRCA 4ED6A 1X1PA 3AFHA 3OYCA 5K7ZA 2IP4A 2RQQA 2NU7B 4PZ6A 1ZQ7A 2BQUA 3GFLA 2CRGA 1G4DA 4FFMA 1A6QA 3BTCA 2DN0A 1YHQI 1IC8A 4IZOA 1X9NA 4QIWE 1FJGH 4YIIA 1E0EA 3BDDA 1Z91A 1DUXC 3JZIA 3LA3A 1UG2A 3PJRA 3JRCA 1Y56A 2BHZA 4HDUA 2YS6A 4DV6H 2JWTA 4K2EA 1DU0A 1G2WA 4YIRX 1Y1VA 1MH4A 2KDOA 4HEA2 3J81Z 3K5HA 1TWFA 2RDJA 2GBYA 1T56A 1D8KA 1OMIA 3VDXA 4J01A 4CE5A 3U21A 1Y1WA 5DCFA 2XASA 2IW5A 5CAEB 2OH2A 3GTPJ 3M7GA 5HDKA 2BY3A 5KHDA 2BY1A 1WSCA 5H80A 2PFBA 3HC7A 2PEXA 1FIAA 2AQEA 1MJBA 1XN7A 3LQSA 4JI7H 2COMA 4G6TB 4RDUA 4PSWA 1KQ0A 2R7LA 1IV8A 3IAM2 3BJAA 3CD6I 5BWVA 1QZZA 2FBKA 3H92A 4UVCA 1EH8A 1OYYA 4G12A 5KFDA 1S8NA 1Z77A 4ZOLF 1DDNA 2DA3A 2XCLA 3HSRA 4U88A 4E4TA 5LP6F 2IS6A 2DA7A 4ENMA 1W96A 5DM6F 3EQLF 3BCBA 1A5JA 3AG4H 4A6EA 4AYBA 1W36D 1B72B 3I3LA 4F52A 2P7VB 3C7JA 4HV5A 3G6EI 2Q8KA 1J59A 2HR3A 3I53A 3F0CA 3K1NA 5CQGA 4BHBA 3OSPA 2DYRH 5B1BH 1RJRA 5DUIA 5KFTA 5FGMA 3I0TA 5KVRA 1GYFA 3S3MA 4I0BA 3Q8SB 1FTZA 3QWUA 2KISA 2VQGA 4GXOA 2AHQA 3OYJA 5DLFA 4ITVA 2WAQA 5DGIA 2EINH 4FX4A 2OF7A 4IOAF 1S68A 4O6JA 2R7UA 3OL4A 1I3AA 3BA9A 4C5AA 2FK1A 1VQPI 2OJED 2QQBA 4HPQA 2XB5A 4MNUA 2R92J 1XC5A 4L5IA 2A3SA 2HGSA 4J9MA 1UHMA 3DKWA 2F6CA 4UXNA 3E97A 2VKVA 1CE8A 1SEIA 2RGVA 4HNUA 2BW3A 4A3FJ 3T9FA 5C3EG 5F08A 3GWZA 2LD5A 1I7LA 1JE8A 4XYMB 4CHIA 2V4JC 3ZP5A 5J40A 2JPCA 3PW5A 5JHUA 5DG9A 4QWQA 3PVXA 4HW0A 3GUDA 2GPWA 2CKZB 1E3PA 3KEQA 5KFAA 4RUAA 3B6AA 4BBSG 4A93G 1N75A 2VKDA 5DGBA 4ZTFA 1XNRH 5M5XJ 4IR1A 2EZIA 1TLHB 3OYMA 1FC3A 3G3ZA 2XB0X 4ED0A 4M3FA 3JSLA 3H20A 2MLKA 3QPTA 3VOEA 4A0YA 4B1RA 1R49A 2GXBA 4O7TA 3N43B 1WHUA 2PG4A 4ECXA 4RB1A 3AL0C 2COBA 2TDXA 3M1CA 3GDEA 1DP7P 2R7ZG 3DP7A 4ZTJA 3L2WA 1H9GA 4CXFA 2LR8A 3U54A 2QQ8A 1KUTA 4O4IF 1SD7A 2GLOA 3MCZA 4XK4A 3BR1A 3BPXA 2MH9A 3RB4A 2H94A 4LK1F 2AU0A 3N97A 2NVXA 1FKAH 4FE2A 1ORKA 4UCTA 4JOMA 1J2XA 4FFPA 1QVTA 5KFHA 3O8HA 2DABA 4BYYA 1IV6A 4BXXJ 1PK8A 3O8GA 4EYIB 4ASNA 1OLTA 1ENHA 5CVRA 1Z2NX 2W70A 2X48A 4DBQA 4IOCF 4XSZF 2QBYA 2P0AA 4LG0A 3F22A 3VNNA 4M73A 4RB2C 1KJJA 4D9JA 2Y4RA 4EBCA 3IKTA 4J9QA 4XLHA 2FU4A 3RDIA 3NC0B 4DL7A 3ZRGA 5LHGA 2W6OA 3HOUJ 3T7AA 1K78B 4XLFA 2A6TA 1B8IA 1TWGJ 5D8LB 3TKYA 3JRWA 3HSEA 2NAZA 4CC6A 3MAJA 1HNZH 4Q8FA 3KYDB 3JRGA 3T0YA 1RR7A 2VE9A 5GONF 2DA2A 2CG4A 4GKJH 3FDYA 2Y31A 2M30A 2NVYA 5H6RA 1VQ5I 3LP8A 1W36C 4HN2A 5I5YA 5DEQA 2PMHA 3L2QA 5BMZA 1FYMA 1YLFA 3VPBA 1KJQA 1WKMA 1N34H 1YJWI 1OCPA 3RTRA 3TDZC 2QLZA 4QWDA 1FJLA 4O3OA 1N33H 1U2WA 5BWRA 5KFJA 3E6MA 1S72I 2AS5F 2DLNA 1RYSA 3KE2A 3V8JA 3F23A 2K9LA 1H0MA 2BQRA 2GWRA 2OA4A 2W6QA 5K7HA 3ZPLA 4ESFA 1I27A 2LDUA 4LG3A 1DQUA 1LE8B 2E2HJ 2JA8J 2FPGB 2R0QC 4EBEA 2UXBH 3K4CA 1HA8A 3G1LA 3IAS2 3K4NA 4RS8A 1LEBA 4CC5A 5HLIA 3DBHB 4RM3A 3HRTA 2W84A 4RMNA 2JT1A 2CUEA 5CB4F 2ISZA 3VPDA 2KIFA 4C3IJ 1K7AA 2M1BA 5EDNA 2Q0OA 4O3NA 5EZGA 5KFZA 4S05A 3NARA 4AIJA 1GSAA 4UUGA 3IC7A 5CVUA 3NAUA 4E6KG 3CC2I 5BWTA 1VQ7I 2NS0A 3J80W 3PNTA 4E6NA 4IRCA 3WODF 4FX0A 1T98A 1ZREA 2A5WA 3H3VH 4MV7A 3RFCA 1HSJA 1VTNC 4BBRG 5E1XA 3CUQA 5KFCA 2XDVA 4DV5H 1TNTA 4BXXG 1GV2A 4N0BA 3AAFA 1EA3A 2K3FA 3OIQA 1VBGA 4O2BF 3KETA 4YR3A 1ZRFA 2NVXJ 1ZK8A 4JI0H 2OD5A 2PMZN 5FLXK 4FFOA 2HHFA 3CF2A 2VUMG 1KEEA 1JXLA 1WH7A 4PDBA 4UCUA 2KLOA 1VAJA 4CCLA 3OYHA 2Z3YA 3NWTA 1BIBA 4G7OF 1J9IA 3WTUC 2VLAA 2E2JJ 2UVUA 4YEJA 1Z3YA 2HKOA 4IIJF 4UFZA 4JI3H 3WG7H 5LA6F 4GO1A 5BWWA 3BQ0A 4DBRA 5DAAA 2ZSHB 5KX5F 2JRMA 3SJMA 4EMSA 1D1AA 1Z1DA 2XIGA 2VN2A 3QYEA 4IXAA 3GTGJ 1LVAA 2JTVA 2M4KA 1R22A
chains in the Genus database with same CATH topology
1LKXA 2VASA 4GRIA 4YELA 4XKCA 3N42B 3H9JA 3RF2A 3W2WA 4B48A 3NBZB 2Q2UA 1TZLA 1MW7A 4XOTA 4E7JA 3LMLA 4EATA 3UNGC 2VQEH 1MMDA 1L2ZA 1DP3A 4E7SA 3FBIB 4J0MA 2MD0A 2HNHA 2WAEA 4KHPH 4XQFA 3N40P 2KQRA 4E7HA 3H9GA 3EUHC 1B04A 3ZR8X 2CMPA 1Y6IA 4RB0A 4CCOA 4ETSA 3HPGA 5D1OA 2E5LH 4PSXA 4DV2H 3PNVA 2IS1A 4BE2A 1TAEA 2X51A 3K4MA 3N05A 4PK4A 4BXFA 4J00A 2QKMB 1P8LA 1G8XA 3N41B 2OV7A 3S3OA 4XN0A 2HZDA 1FMWA 5HNFA 2K3PA 4PJNA 1XDNA 2KMUA 4UCSA 1GLNA 3DKYA 4BJ6C 5LFAA 3I9V2 3K4KA 2X6WA 4OWRB 1V9PA 4AU7A 2IS4A 1S03G 4LFBH 3FBNB 2O03A 1D0YA 4R7RA 4ZDPA 4YY3H 1XNQH 4PZ7A 3ZGKA 3G2BA 2K9MA 4QPQA 2LY1A 4YRVA 2KP6A 2PJRA 3S3NA 4X62H 4DR3H 4OAYA 4CCKA 4LIUA 1YX5A 4PJLA 4XN3A 5FROA 2HIXA 3OYLA 1N78A 2Z1DA 4B44A 2E5NA 1X4OA 4MV9A 4BQQA 2X1DA 2V26A 3H5NA 1D0ZA 2X6YA 2VQCA 3DPLC 1J09A 2UUBH 2WADA 1X1AA 1WJ5A 4XKBA 4FASD 2LREA 3OYKA 5D1OB 4P5OA 3MKZA 3RCOA 2XF6A 4HNTA 1BR4A 4RAYA 2KL4A 3BCAA 3L4JA 1BOBA 2UUAH 4KJZA 1Z3XA 3E0JB 5EOYA 2M4GA 4JI4H 4JI8H 3QYBA 5FD5A 4LH6A 4GKKH 2KRHA 2M0MA 5HOOA 1D1BA 3A1YA 4H4KC 1LFPA 1P16A 3GBGA 4LF6H 4BUPA 2UXBH 3BG7A 2VKHA 2VOBA 3PFYA 3N6XA 4NNJA 2VUGA 2VL8A 4II3A 3LL7A 3KYHC 2O5RA 1D1CA 4DR6H 3W2AA 1CKNA 2VQLA 4LH7A 3FHNA 1ZHSA 3PSIA 3T1YH 4B47A 4CCNA 3LSHA 1LVKA 4PFPA 3HL2A 2XF7A 5FLXW 4DJAA 2DOAA 4CZCA 4DR2H 4AQYH 2XAUA 1IBMH 2WY7Q 3JAMW 1MMAA 5BR8H 1DGRM 2W57A 1BJTA 1VS0A 1QHGA 4BL0B 2DJIA 3W1BA 3ZXSA 2WYOA 1XMQH 2LYCA 2VJ4A 3JSNA 4XL9A 4JQFA 4UCOA 2KZVA 4EFEA 3VSLA 1QHHD 4A2AA 4LF7H 2L5QA 3K6GA 3FMAA 1I94H 4BE1A 2W1OA 4KT6A 2DT7B 5IWAH 3L4KA 3CJQB 2WAFA 3VYUB 4C30A 4DR1H 3DU5A 3VYSB 4EFBA 1WJDA 4BQOA 1X1BA 5JHFA 4B3SH 1QU3A 2ELJA 4IKFA 4B3MH 1DGWY 4LF8H 3VWBA 2RREA 3S24A 2QKLB 1DGSA 4XMYA 2R7OA 4IZZA 3J7AY 4C9YA 2Z16A 2MYSA 4XORA 2E1MB 2IGOA 2PMZA 3V42A 3OY9A 4RB3C 2GOMA 2WE6A 1UAAA 2R7WA 1X1DA 1WJFA 4X64H 2LC2A 4M7EA 2ZJTA 4YHHH 3OIPA 3HXLA 4B3XA 3RTXA 2IGKA 4BJ5C 1I6UA 1E4FT 3H9QA 4Y33A 2V9KA 4LMYA 3CESA 4ZDLA 2WDTA 3H0DA 3OL3A 3QODA 2WBMA 2L2OA 4PUSA 1M0WA 3LMMA 3BAAA 4JV5H 4EEQA 2DCEA 3GB8B 2NOJB 3M8JA 4CCJA 3BABA 1T0FC 2R7QA 3CJRB 3W5OA 4LSAA 2DXIA 3RJ0A 4JI2H 1XK5A 2VQHA 2HU9A 2WA0A 3NWSA 2W00A 3KYLA 3DPUA 3RR5A 2L9SA 3LSIA 3OOUA 2LBFB 2CS3A 3DTIA 5FD6A 2Z2SB 3OS2A 3DLAA 4BEHB 2CV1A 1KONA 2UWMA 2R4GA 2XC7A 4DR4H 1N77A 4LSXA 1UG0A 3OYAA 2DT6A 3DU6A 4XNFA 3KAKA 2VXZA 4MTEA 2ZFUA 5LD2C 4ZDOA 2KHMA 4E4HA 4DV1H 2F4VH 2I8DA 4DV3H 2Q2TA 2HPIA 2LH9A 2JSPA 1VZ0A 4P1WA 3OR2C 1WFXA 2VPSA 4Y3OA 2IGMA 4LFCH 1MMNA 2V6EA 1SFKA 2CUJA 1IRXA 4BGDA 2LRDA 3PL8A 3TY8A 2HQAA 3M4IA 4XONA 4FM9A 2LBFA 1HR0H 1X1CA 2CFOA 3S93A 4CCMA 3ZQQA 1N32H 3LSMA 4Y4RA 3C2GA 3RGXA 4BS9A 3UR3C 5FRNA 2HIVA 3N44B 2MCTA 2RNGA 3RPUD 1PYVA 3W3CA 4XLEA 3H5AA 2R7VA 3HUGB 3A4CA 4QPOA 4JI6H 3QOEA 4X0GA 1Z7LA 4LIVA 3L2VA 4LF5H 4XM3A 2LOOA 2CH0A 1LDKB 4BU2A 3AFHA 3OYCA 4PZ6A 2E5ZA 2RQQA 3OMYA 5CQEA 1BGWA 1M0TA 3PSFA 3BA8A 3MWMA 5CKTA 4HSRA 4CA0A 4LFAH 3ZCOA 2M7AA 1FJGH 1X9NA 4FETA 4NQWB 1E0EA 3PJRA 1G59A 1WJAA 4NC8A 1J5EH 1Y56A 3RIZA 4DV6H 2M7BA 2UV1A 2VJIA 4MLOA 3E1SA 3K4BA 3DEEA 2KDOA 4HEA2 2MC4A 4J01A 3K3VA 2UUZA 3VDXA 2ZXHA 3U21A 3OYEA 4U7BA 1PJRA 4Q0YA 4KISA 5KHDA 3EUKL 3F8NA 2E1MC 2OWOA 1MMGA 4X66H 3HC7A 4PJMA 3OYFA 1D0XA 4JI5H 3HG9A 2AQEA 3A2KA 4OAZA 4F93B 3OYBA 2HVRA 4G6TB 3BLYA 4JI7H 2GOXB 4PSWA 3T1HH 4R79A 5FPRA 1V5GA 3IAM2 3K70C 4BQNA 4PZ8A 1WJEA 2R7XA 3TMOA 2XSJC 2BVMA 4LITA 3S8PA 2IS6A 4JYAH 3TBIA 3W2VA 3BCBA 2CUZA 4DR7H 4AYBA 1W36D 4HRIA 3I3LA 3MKYB 1HNXH 1P9QC 4F52A 1WJCA 4RAZA 4DV0H 5CQGA 2ZM6H 2YCHA 3SEZA 2R7RA 2UXCH 5TGTA 1GYFA 3S3MA 3DF7A 2X6XA 3QWUA 2VQGA 3OYJA 4ITVA 2WAQA 5KNLA 3IUOA 1S68A 2R7UA 4LF9H 3BC8A 3OL4A 3DPTA 4RLQA 3BA9A 4HPQA 2JVGA 2JUGA 3C0FB 3RGZA 3SZGA 3VSKA 2HGSA 3KAJA 2F6CA 3OYDA 2V7FA 3D5LA 1SEIA 3MD2A 4AVZA 4RZQA 3PUBA 4HNUA 2RGVA 2BW3A 2R7TA 2KRCA 3J81W 3ONQA 4XLCA 4X65H 5LMUH 2CFMA 3SDBA 2V4JC 3CMMA 3GJXB 1AN7A 4NXMH 1HNWH 4U87A 1SYXB 1E4GT 3DTEA 3AKZA 4PFOA 2WB1A 4IQJA 4UCRA 1X4PA 4RLFA 4RM2A 4CUGA 3L2UA 1WH2A 1ZHQA 4DV4H 1N75A 4K0KH 2VKDA 3RSNA 5LL6b 4ZTFA 4DV7H 1XNRH 3QYFA 4BWSC 4ZJZA 3OYMA 2X1CA 4XOPA 4DUYH 1NG7A 4DIQA 3JSLA 3H20A 3EPZA 1S9HA 3N43B 3HPHA 1A0IA 4D1QA 4OX9H 4II2A 3LSKA 4RB1A 2CW8A 4DGWB 4E7KA 4LF4H 2CV0A 3AL0C 4N4OB 2JA2A 1BR1A 1N36H 3M1CA 4BDYA 3GDEA 2WY8Q 2W4SA 2IGNA 3S32A 3VYRB 4ZTJA 3OYGA 2VPLA 2OC6A 3BG6A 3L2WA 1TA8A 1V5FA 4APMA 4MTDA 2HHHH 2KPMA 2IS2A 2F5VA 4CH7A 2UUCH 4PJJA 4XKVA 5HLTA 1FMVA 4BEHA 3RQ4A 3H5RA 2L9NA 3OWTA 4KITB 2PJRB 1SAUA 4ZC3A 2CW7A 2Q1ZB 1FKAH 4UCTA 4IAJA 4JOMA 2X1EA 3OYIA 4DR5H 1IBLH 1TT0A 2FUG2 2OUMA 3L2RA 1OR7C 4CSWA 1OLTA 1Z2NX 4DUZH 4E7ZA 4DBQA 3HOTA 2BW3B 4C2UA 5DISC 1X19A 3VNNA 4JI1H 3CP2A 2W82A 3VYTB 4DOZA 4RB2C 4D9JA 2ZSIB 3TY5A 3TY9A 1IBKH 2VJJA 4XLHA 3LFUA 5KCMA 3MKWB 3NC0B 3ZRGA 4N4NB 1Z2PX 4GLXA 2UXDH 2BOLA 4XLFA 2A6TA 2MFZA 3W1GA 2UU9H 1HNZH 4CC6A 2FE3A 3EUAA 1CKMA 2VJ5A 3HOSA 5HNHA 5HVQC 2Q2EB 3K4JA 5A2QW 4BACA 4GKJH 3FDYA 4ZYAA 5LMNH 1AA7A 3KXYT 4XLAA 1W36C 2HPMA 4E7IA 3DWLE 3L2QA 3KALA 2XF5A 1N34H 4XR6A 1Z2OX 1N33H 2E60A 3RTRA 2K5CA 5FPOA 1FVIA 3OTOH 3NBYB 4NC7A 4BE0A 2X85A 4B43A 2ZXIA 2K9LA 1WJBA 1MZBA 4DRFA 2V1NA 2L7KA 4IX7A 1CKOA 3DQVC 4LG3A 1DQUA 2VQFH 5FRMA 5CPRB 2IXSA 4BDZA 3K4CA 1HA8A 1CKNB 3PN1A 2MABA 3IAS2 4HSTA 3K4NA 4C2TA 2LY2A 3J7AK 3K10A 4CC5A 4XKWA 2W7NA 4RM3A 4RMNA 1O75A 1T95A 2RGRA 4F55A 3OS0A 1ZELA 2P0WA 2AQFA 3D5SC 3F9KA 4EQ5A 1YX3A 3OYNA 2HVSA 3SEQA 3IG0A 4BJTA 2R7SA 4E6KG 1MNEA 3J80W 3K70D 3PNTA 4ANJA 4E6NA 1XMOH 3KEYA 3OR1C 2A5WA 4MV7A 3TL4X 2VIXA 3CVZA 4B3TH 4F92B 4NUBA 2VXDA 3AL0B 1ERDA 2XDVA 3UQ8A 4DV5H 1U0JA 1V5EA 3FKJA 1EA3A 3OIQA 3C2HA 4B3RH 4F91B 1YE9A 2BVLA 2LG4A 4JI0H 3DTKA 3D5RC 3CF2A 3K4LA 4PDBA 4HG2A 4UCUA 3LSGA 2KLOA 3MMYB 3CZ6A 3KX2A 3SYTA 4CCLA 3OYHA 5D1PA 3NWTA 3PNYA 2F4IA 4A2BA 2VLAA 3EYYA 1MNDA 4YEJA 1R6RA 1Z3YA 2HVQA 2CV2A 4UFZA 4JI3H 1Z21A 2HDWA 2Y0SA 2JVHA 2M3AA 1NG6A 3H35A 4DBRA 3HKZA 2ZSHB 2KSWA 1JI8A 4E7LA 1BR2A 4UCVA 4I7HA 3DKXA 1D1AA 3CP8A 4NXNH 2VB6A 4IQ4A 2XIGA 1K6YA 1UELB 3QYEA 5IT9W 2M4KA 3IP4B 3OS1A 3L2PA 4F3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BAA A;  4EQ5 A;  2Q2T A;  2HVS A;  4EEQ A;  3GB8 B;  2OWO A;  2CFM A;  4PZ6 A;  3BAB A;  5FPO A;  1FVI A;  3NBZ B;  5D1O B;  1XDN A;  3NBY B;  5DIS C;  3GJX B;  3BA8 A;  4UCS A;  3VNN A;  3S24 A;  4UCU A;  1DGS A;  3W5O A;  2Q2U A;  3GDE A;  2HVR A;  3TY5 A;  5D1P A;  3TY9 A;  1VS0 A;  1TA8 A;  5FPR A;  1XK5 A;  4UCR A;  1V9P A;  3QWU A;  3TY8 A;  4LH6 A;  4PZ8 A;  3NC0 B;  3W1B A;  4E6N A;  1X9N A;  4GLX A;  4DRF A;  2HVQ A;  4PZ7 A;  3RR5 A;  3JSN A;  4UFZ A;  1CKO A;  1P16 A;  1B04 A;  3W1G A;  1S68 A;  4UCO A;  4EFE A;  4CC6 A;  3BA9 A;  1CKM A;  2VUG A;  2HIV A;  1CKN B;  3PN1 A;  4UCV A;  5D1O A;  3UQ8 A;  3JSL A;  3RTX A;  2HIX A;  3KYH C;  4CC5 A;  4UCT A;  1TAE A;  1CKN A;  4EFB A;  4LH7 A;  1P8L A;  1A0I A;  3L2P A; 
#chains in the Genus database with same CATH topology
 2IJL A;  4GRI A;  2HZT A;  4YEL A;  5M5W J;  4XKC A;  4A3E J;  3W2W A;  1S5L C;  1W5T A;  2W24 A;  2C6Y A;  3HOZ J;  3TIG A;  4XOT A;  2JEG A;  1I1L A;  3ZQG A;  4PGH A;  4E7S A;  2HKX A;  3FBI B;  3KHG A;  4IHV A;  2IA0 A;  2FLP A;  2CU7 A;  4KHP H;  5C44 G;  3R4K A;  3I56 I;  4BXU A;  4IRH A;  1KZH A;  1IAW A;  3I4M G;  1WVR A;  4A0Z A;  4KDP A;  4CCO A;  4ED3 A;  4PSX A;  2R3S A;  3E6B A;  3NRV A;  4D0P A;  1ZQ3 P;  2JEF A;  2M0C A;  3P9I A;  2W7O A;  1ZTR A;  2GIZ A;  3K4M A;  1G3T A;  4PK4 A;  3QU3 A;  2BGC A;  3MN2 A;  1UHS A;  3TQN A;  5B66 C;  1G8X A;  3Q8R B;  3G4S I;  2OV7 A;  3FX3 A;  4XN0 A;  1EF4 A;  3AG1 H;  4A12 A;  1FMW A;  4J9R A;  2R92 A;  3GIQ A;  1IZ1 A;  1XDN A;  4UCS A;  2R93 J;  4C5B A;  1YFH A;  2NU6 B;  1VQN I;  5LFA A;  3CTA A;  2X6W A;  3FKI A;  5I5X A;  1O3S A;  2BEO A;  2VOP A;  3NQO A;  2R92 G;  2BY2 A;  5EG0 A;  3R5F A;  4NZN A;  3A0B C;  1QRY A;  4WD3 A;  3T8T A;  2KP6 A;  3S3N A;  1P92 A;  2ZC2 A;  4M6X A;  3LFK A;  4CCK A;  4O7N A;  1W5C C;  2FF4 A;  5FRO A;  3CO6 C;  3GTM A;  1N78 A;  3HGG A;  4GC6 A;  1HXD A;  4L9J A;  2YZM A;  3ABU A;  3KHH A;  2MW8 A;  1R5I D;  3GTL J;  2I87 A;  4HQE A;  1GUU A;  2VQC A;  1J09 A;  1ZG3 A;  2WAD A;  1X1A A;  2DA6 A;  3BTL A;  3FXL A;  2LRE A;  4DYR A;  1IF1 A;  3PIP F;  3RCO A;  2XF6 A;  2PBI A;  4M9S A;  1JJ8 C;  1BC8 C;  3J81 K;  1K1S A;  2VPR A;  4EJW A;  4KJZ A;  1VQM I;  2A07 F;  2M4G A;  2YS7 A;  5FD5 A;  1ZLJ A;  1FLI A;  2KRH A;  2M0M A;  5D5X B;  5HOO A;  4HZF A;  5JUM A;  5FLM G;  2VBZ A;  3A1Y A;  2H27 A;  1LFU P;  5BPF A;  4BY7 J;  2GQS A;  3HOX G;  2K40 A;  4BUP A;  5J47 A;  5FB2 A;  2GQR A;  5GPA A;  1FT9 A;  4NNJ A;  3BWG A;  2R86 A;  2VUG A;  2VL8 A;  3QP6 A;  3KCC A;  4MEY F;  1O3Q A;  3R0A A;  2O5R A;  4DR6 H;  4KIB A;  1QGP A;  3PFI A;  2E71 A;  3T5L A;  1B6S A;  1Y8R B;  1MJA A;  4LFU A;  1KBL A;  3OUU A;  3PSI A;  2O0Y A;  4Q47 A;  3WO1 A;  2DT5 A;  3LSH A;  4TV7 A;  2YU3 A;  2H1K A;  3H36 A;  4F4Z A;  2XAU A;  2WY7 Q;  3S16 J;  2W71 A;  2E2I A;  5BR8 H;  1DGR M;  1XGN A;  4ECQ A;  1VS0 A;  4O83 A;  3RPU A;  1YYV A;  2DJI A;  4ME6 A;  5EEH A;  2LYC A;  2VJ4 A;  2XHK A;  4EVI A;  1AOY A;  4ESJ A;  4X1E A;  4EEY A;  3G8C A;  1R9T A;  2R7Z A;  1Z6R A;  2FMY A;  5L1I A;  3FMA A;  4M6V A;  2BYV E;  3V4G A;  1BIA A;  3E5X A;  4AUX A;  4O86 A;  5IWA H;  2EV0 A;  2UVR A;  4DZJ A;  4DR1 H;  2XUB A;  2MH2 A;  2OLS A;  3A0H C;  5JHF A;  1X1B A;  2IEK A;  3I59 B;  2H8W A;  1JKO C;  4NHJ A;  5I5U A;  4IKF A;  1VF9 A;  1ONV A;  3OHA A;  2W9B B;  4EYH B;  1DGW Y;  2ZDQ A;  4R8U A;  1TWH J;  3ZMU A;  2QKL B;  1IXR C;  2L4M A;  3V8L A;  2LSO A;  1FOX A;  3G1M A;  3MR5 A;  1I39 A;  2R7O A;  3Q8Q B;  1W0T A;  3J7A Y;  4C9Y A;  4N9I A;  2VBY A;  5EEA A;  2JA7 A;  3M07 A;  4XOR A;  4GYI A;  2E1M B;  4XSX F;  2PMZ A;  3OY9 A;  3I54 A;  2JK3 A;  1WSU A;  3B02 A;  3CCL I;  1KQ9 A;  1WJF A;  3TO9 A;  1ZKG A;  3E3V A;  1H9T A;  1KU9 A;  2LC2 A;  4Z6Y A;  2NVT J;  4YHH H;  4IRD A;  2Y69 H;  1XB4 A;  2P4W A;  3HXL A;  4XRS G;  1FTT A;  1I6U A;  1E4F T;  3GZN B;  3CES A;  4MAM A;  4ZDL A;  5J4V A;  4IO9 F;  3OL3 A;  5IP7 G;  4PUS A;  3P7N A;  3BAA A;  5D6F A;  1EKP A;  2ESH A;  4XRS A;  3GB8 B;  4EEQ A;  4JV5 H;  1BI2 A;  4A93 J;  4BBS J;  2YZN A;  3BAB A;  5HV6 A;  1QNT A;  3HKZ E;  4CDG A;  2ZGI A;  5E8I A;  4LJZ F;  3RJ0 A;  3I64 A;  1S97 A;  5DS9 A;  5ILU A;  3BR3 A;  5CLS A;  3BQ1 A;  1EUD B;  2HG8 A;  2IA2 A;  4HF0 A;  1S0N A;  1MIJ A;  3OOU A;  2COI A;  5FD6 A;  5EWF A;  2V5A A;  3G8D A;  1B9N A;  2RC4 A;  2QQ9 A;  2UWM A;  3CJN A;  1XS9 A;  1K79 A;  1ACI A;  4LSX A;  4MFD A;  2XPV A;  3DU6 A;  5J2T F;  4XNF A;  4MTE A;  1R71 A;  2W6N A;  2KHM A;  3DEU A;  4E4H A;  3ZQF A;  3HOY J;  5I5V A;  2C22 A;  2I8D A;  5GPC A;  1SFU A;  1AHD P;  4B4C A;  2JA5 G;  5FJ8 J;  1KU2 A;  3BY6 A;  5HOD A;  5B1A H;  2ZO4 A;  2PLY A;  2HHF B;  2CQX A;  4Y3O A;  2IGM A;  4BH9 A;  1SFK A;  3L7W A;  4P9F A;  1C0W A;  1APL C;  5GAD J;  4MV6 A;  2NXN B;  2V1X A;  4FM9 A;  2LBF A;  4O7V A;  1X1C A;  2CFO A;  5GP9 A;  2GM4 A;  1ZG5 A;  2HTS A;  2WV1 A;  4A3L J;  5I47 A;  4FIS A;  4P55 A;  1N32 H;  1RPW A;  4IL6 C;  2CYY A;  4FFR A;  2P81 A;  1TWH A;  3R6S A;  3UR3 C;  4BS9 A;  2HIV A;  4TUY F;  2MCT A;  2RNG A;  2FNP A;  3Q0U A;  1W1W E;  2K4B A;  3MWD A;  2R7V A;  1KU3 A;  5JQW A;  1S7E A;  4ZH4 F;  4FU0 A;  4ZYE A;  3V7S A;  1IYD A;  2LOO A;  5LBQ A;  2ZJR F;  3VOT A;  1SAN A;  4EJV A;  1BGW A;  2E5Z A;  4KIC A;  4NB5 A;  5D4R A;  4M74 A;  3WO0 A;  2QZ8 A;  3PSF A;  1PVE A;  5CKT A;  5KFB A;  1VQ9 I;  4CA0 A;  3R23 A;  4ED1 A;  3AG3 H;  2ASJ A;  2DOD A;  2XKP A;  2M7A A;  2FKL A;  5KG5 A;  5EG0 B;  2F4M B;  4QWA A;  1T08 B;  3LSR A;  1G59 A;  1WCM J;  4NC8 A;  3RB3 A;  1GDT A;  3RIZ A;  4M3D A;  3GXO A;  1RNL A;  3TQ1 A;  3E1S A;  3K4B A;  2XGP A;  3DEE A;  4M3G A;  1ZG1 A;  1NK2 P;  5C4X J;  3RB0 A;  3B73 A;  1ZR4 A;  3GTQ J;  2HYG D;  3OYE A;  2VI6 A;  1OPC A;  2ELK A;  3BZC A;  2XSD C;  5LHH A;  2VKE A;  3EUK L;  3M9O B;  1T3N A;  3MZ8 A;  2KFD A;  5LGU A;  2GA1 A;  2FSW A;  3QU6 A;  5FKL A;  5E3O A;  3OYF A;  3W6V A;  2L7M P;  5KFY A;  4TQS A;  2C2R A;  3OYB A;  5F0H A;  1QPM A;  4R79 A;  2Y9Y A;  5FPR A;  1V5G A;  4D7N A;  2JA7 G;  4JX6 A;  5BWX A;  1I3Q A;  3FXQ A;  1WJE A;  2GA2 A;  1ET0 A;  1FYL A;  4GGG A;  4M72 A;  4YB8 B;  2HYJ A;  3Q5F A;  2HOT A;  3DF8 A;  1EZ1 A;  3S8P A;  4LIT A;  1S6L A;  3JCU C;  3N6R A;  4IHJ F;  4PBC A;  4RNO A;  4A3D G;  4C2M A;  3ASN H;  2ZDH A;  3LNQ A;  4Q8E A;  2CGP A;  2CQ7 A;  3MKY B;  2D45 A;  4O4H F;  1P4X A;  1P9Q C;  1HNX H;  2CFX A;  4RAZ A;  5CVJ A;  1BNC A;  1U78 A;  3GIJ A;  2ZM6 H;  3K0L A;  1R1V A;  2IVM A;  1T39 A;  1Z6T A;  2Y9Z A;  1O57 A;  1ETW A;  1IN5 A;  2R7R A;  2R87 A;  3GZ5 A;  1IJW C;  5E1Z B;  4N9H A;  2R7K A;  3ORR A;  3HYI A;  4G3I A;  4HYK A;  4L9T A;  1VKZ A;  2QCO A;  1U6G A;  4OU0 A;  4RNN A;  3K1M A;  2R7N A;  3IUO A;  3Q9V A;  1T2K A;  2JZY A;  1BBY A;  3DPT A;  4RLQ A;  5HDN A;  2JN6 A;  4HLX A;  5LEJ A;  3CCR I;  3HOU G;  2JVG A;  3QQA A;  3RGZ A;  3J7Z I;  2EFO A;  3KAJ A;  3KP2 A;  2R8J A;  1XGS A;  2LKS A;  3E5U A;  3D5L A;  3OYD A;  4AVZ A;  3LAP A;  4RZQ A;  3PUB A;  4CMD A;  2R7T A;  4EG0 A;  3HOV G;  5F9N A;  3S15 J;  3J81 W;  3ONQ A;  2BXZ A;  1GO3 E;  5J6X A;  1PUF A;  3ABM H;  2SCU B;  3GJX B;  5E20 A;  1AN7 A;  1Y14 B;  5LXT F;  3GTK A;  4PWQ A;  1HNW H;  3AG2 H;  2DMU A;  1I1G A;  2GLT A;  1E4G T;  3DTE A;  1H8A C;  3AKZ A;  4EGY A;  1HF0 A;  4QW8 A;  5EDW A;  4IQJ A;  2LK2 A;  1WH2 A;  5IYC G;  4K0K H;  3IWZ A;  1IN6 A;  3PW0 A;  3IHU A;  5LL6 b;  3QYF A;  1YRN A;  4IHT A;  1R4M B;  3ULQ B;  3E7L A;  3BR5 A;  4L18 B;  2IBK A;  4DQ2 A;  1GVD A;  1LPQ A;  1KJI A;  4DIQ A;  1AKH B;  3T5J A;  2VC1 A;  3EPZ A;  3U1K A;  4IWX A;  5L3D A;  1IN4 A;  5JVD F;  4O81 A;  4O7L A;  4WCG A;  1D3Y A;  1JDE A;  3HPH A;  3ESW B;  5KFO A;  1NTC A;  4D1Q A;  2MGQ A;  2OAZ A;  1YIJ I;  4GCV A;  5IP9 J;  2CW8 A;  2J9G A;  2GXA A;  3LUL A;  4CGZ A;  4MV4 A;  4N4O B;  2YU9 J;  1WWX A;  1BR1 A;  2JA2 A;  1I1M A;  2C28 A;  1N36 H;  4BDY A;  1DU6 A;  4MEX F;  2WY8 Q;  2KJC A;  2W4S A;  2VPL A;  2L9V A;  1TA8 A;  4MTD A;  2HHH H;  1V5F A;  2LKX A;  1HLV A;  1VQ6 I;  1RJQ A;  3ZMT A;  3FM3 A;  5ICC A;  1YIO A;  4DYQ A;  1LUJ B;  5FKN A;  3SXY A;  1Y1W J;  2W6P A;  5K3W A;  1KYW A;  3CUO A;  3H5R A;  4KIT B;  2Y48 A;  4CKB A;  2PJR B;  1W5S A;  2FK2 A;  2B63 G;  5HS8 A;  1IBL H;  3DAA A;  3BG3 A;  1YW8 A;  3Q3S A;  3ZMS A;  3U55 A;  2AGP A;  4A3B G;  3S14 J;  1XD7 A;  1TC3 C;  5L3E A;  1T0F A;  3CP2 A;  4OMZ A;  3S1M J;  3T9E A;  4EBD A;  3VYT B;  3TY5 A;  3TY9 A;  2M05 A;  1IBK H;  2VJJ A;  3KFW X;  1XSD A;  4L9N A;  4LD5 A;  4N4N B;  3CCE I;  5IYB G;  1K4T A;  1RUO A;  2KRF A;  1K4S A;  1A31 A;  5K1Y A;  2HJW A;  3H3Z A;  2MFZ A;  3W1G A;  2UU9 H;  5BYA A;  5ICG A;  2NRA C;  2NUA B;  4W1U A;  4BHP A;  1WPK A;  1JLL B;  1ULZ A;  3EUA A;  1YO5 C;  2QSG X;  1CKM A;  1ZAU A;  3T54 A;  2FMA A;  2W7P A;  3HHH A;  5A2Q W;  3I5U A;  1FP1 D;  1U5T A;  2B7E A;  2TRT A;  4BAC A;  3SQN A;  4ZYA A;  3F8B A;  5E8G A;  1GSO A;  3PR5 B;  2W9C A;  2QYO A;  2G7H A;  4E7I A;  3BR6 A;  1RES A;  3WE2 A;  3X2Q H;  1KU7 A;  1E4E A;  1X58 A;  3KAL A;  2LFB A;  4KUM A;  4FT8 A;  1A9X A;  2R85 A;  5FPO A;  1TWC J;  1EYZ A;  3DEW A;  2DA5 A;  3OTO H;  4NC7 A;  1VQK I;  5J1U A;  4F4W A;  1JGS A;  1FBU A;  2ZNY A;  3S17 J;  3LOC A;  4M0J A;  4ZQI A;  1Y8Q B;  2E19 A;  2MLG A;  3W6J B;  2C2D A;  2F4O B;  3WGG A;  1WR2 A;  1OCC H;  3JZF A;  2VQF H;  2GXG A;  4KNY A;  3CCY A;  5KFL A;  3CME I;  4JV1 A;  3PN1 A;  2RVC A;  1BC7 C;  1J7K A;  2MAB A;  4W97 A;  4C2T A;  4O7Y A;  2LY2 A;  2ZJQ F;  3VPC A;  3K10 A;  2YPR A;  2W7N A;  2H8R A;  1KTA A;  2RGR A;  4U0W A;  3H3U A;  1HDP A;  1ZEL A;  5C1O A;  3GTO J;  3P9C A;  3H40 A;  5KT5 A;  3SEQ A;  1OBD A;  3MFI A;  1W7P D;  4KIF A;  2FLN A;  2OZ6 A;  1HW1 A;  1XMK A;  4JK1 X;  2HEO A;  2BHY A;  2RDP A;  5JVT A;  4AYB N;  2C2E A;  2CQK A;  1RI7 A;  2K7L A;  5EYR A;  1UFM A;  2EB7 A;  3GLL A;  3G1O A;  3CVZ A;  4B3T H;  2FBH A;  4F92 B;  4NUB A;  2V1D A;  3AL0 B;  4Q4C A;  3UQ8 A;  3ETH A;  3DXJ F;  3TED A;  3F8C A;  1ZH5 A;  1DPU A;  2FB9 A;  2R5Y A;  1V5E A;  2XC9 A;  1O7L A;  1GXP A;  3TOB A;  2BVL A;  2OCC H;  2KKO A;  3DTK A;  3D5R C;  3DCF A;  4EJU A;  2DK8 A;  4ZYD A;  3CCS I;  5HDG A;  2CNV A;  3LSG A;  5B5E C;  4Y52 J;  4WHX A;  4IR9 A;  3CZ6 A;  5CYV A;  5D1P A;  4HQ6 A;  3PNY A;  4PCQ A;  4YJ2 F;  3H0G G;  5KG3 A;  5DGA A;  1P7J A;  5JH7 F;  1R6R A;  1HST A;  2HVQ A;  3P9K A;  2XGE A;  2CNQ A;  4DIM A;  2HDW A;  2Y0S A;  3WTW C;  2M3A A;  2K27 A;  1NG6 A;  2PMZ E;  3HKZ A;  2M34 A;  1JI8 A;  4E7L A;  3H0G A;  5KG1 A;  4UCV A;  3C2B A;  3DKX A;  3RAQ A;  1WRJ A;  2ISY A;  1WCM G;  4ECT A;  3VOD A;  1UEL B;  4A3C J;  5IT9 W;  4LK0 F;  3OS1 A;  2UXN A;  3C18 A;  3ZN0 A;  1LKX A;  3JAM K;  2AGQ A;  5CE8 A;  3M8E A;  2GIV A;  2JUC A;  3D1N I;  3KP6 A;  4B48 A;  3NBZ B;  2XRO A;  1MW7 A;  3RV4 A;  3LML A;  4UV8 A;  4EAT A;  1STZ A;  3UNG C;  2CZG A;  3KZI C;  2FEZ A;  1DP3 A;  2XGD A;  5IT9 K;  4RBO A;  1Y0N A;  4D5F A;  4XQF A;  2CWE A;  3WTT C;  1JT6 A;  4E7H A;  3JTG A;  4E70 A;  2EFP A;  5KFI A;  2F5D A;  2QWW A;  1W93 A;  4RB0 A;  2UZK A;  2JA7 J;  2E5L H;  1P7I A;  4DV2 H;  5LYJ F;  3PNV A;  2LF7 A;  2JA5 J;  2IS1 A;  4BE2 A;  4TQR A;  3PO2 J;  4BXF A;  3ZQL A;  3JSO A;  4J00 A;  3FK7 A;  4QW9 A;  4UV9 A;  1P8L A;  2ELH A;  1UNN C;  1OBG A;  1OFC X;  2HQ5 A;  5HNF A;  1MNM C;  4Q5S F;  2KMU A;  3FXM A;  1CGP A;  3DKY A;  1B72 A;  3I9V 2;  3K4K A;  5EGO A;  2CNU A;  4Q43 A;  4LFB H;  1FZP B;  1D0Y A;  2EIJ H;  4ZDP A;  4PZ7 A;  2OU2 A;  3G2B A;  4QPQ A;  1NH3 A;  2F5F A;  2E34 A;  3OV8 A;  4JYK A;  2PJR A;  4X62 H;  4TV9 F;  4DR3 H;  2CQN A;  2FJ1 A;  1R36 A;  2NNN A;  3L9F A;  4F7Z A;  4PJL A;  4XN3 A;  2HIX A;  3OYL A;  4B44 A;  1IXS B;  2XPU A;  1X4O A;  3LSJ A;  2G9W A;  3GEZ A;  3MEX A;  5D6E A;  5EJC A;  1JX4 A;  2LKP A;  2X1D A;  2NOG A;  3H5N A;  3RKX A;  2XCP A;  5E17 F;  4YJ3 F;  2HOA A;  3JRE A;  1UC9 A;  4XKB A;  4I09 A;  3OYK A;  5D1O B;  2VQD A;  2W9A A;  4HNT A;  1BR4 A;  2KL4 A;  3BCA A;  2CQY A;  3WTX C;  2XAH A;  3G6V A;  5IYZ F;  3BQZ A;  4I98 B;  1O3T A;  1OYI A;  3QYB A;  4LH6 A;  4A5N A;  1MSE C;  1LFP A;  1P16 A;  2FML A;  3GBG A;  1U9O A;  4Y17 A;  4S0H B;  3CMY A;  2HDD A;  2QM3 A;  3BG7 A;  2ID3 A;  4LG0 B;  3JRB A;  4O4L F;  2VOB A;  1S9F A;  3WHC A;  4YFX F;  4NQW A;  3CDL A;  5DQG A;  4I6Z A;  3GF2 A;  5D8K B;  3GTK J;  3VPR A;  2V9V A;  2VQL A;  3HOX J;  1HKS A;  2EIM H;  2FX0 A;  3K2Z A;  3IWF A;  3IKV A;  4PFP A;  3HL2 A;  2XF7 A;  5FLX W;  4DR2 H;  4AQY H;  2V4R A;  4WWC A;  4R8U B;  1AU7 A;  3JAM W;  2CUF A;  2YZG A;  1S10 A;  4M3E A;  1QHG A;  3FXU A;  3ZMD A;  1BA5 A;  4BL0 B;  3ORQ A;  5FO5 A;  1VI0 A;  2A6H F;  3ZXS A;  2Y0M A;  5D4S A;  5IT3 A;  5K5R A;  2WYO A;  3HRU A;  4EJT A;  2WTE A;  5J8F A;  4XL9 A;  5H2F C;  3FM5 A;  4ZZD A;  4YG2 F;  4JQF A;  4UCO A;  4JV0 A;  3PO2 G;  1QHH D;  5KFS A;  4LF7 H;  3KEO A;  2BE5 F;  1IG7 A;  3SE7 A;  4KT6 A;  2DT7 B;  5K7F A;  3VYU B;  3ELK A;  3GME A;  3WE3 A;  3VYS B;  1YOV B;  1R1T A;  3FXO A;  1PP7 U;  1IRG A;  3MZH A;  4BQO A;  4UNO A;  1QU3 A;  2R5Y B;  3Q2O A;  1FSH A;  1SFO A;  2DZD A;  4B3M H;  1VQ4 I;  3TW7 A;  1QBJ A;  1D5Y A;  3S24 A;  3BRO A;  3IH4 A;  3HM5 A;  4WF2 A;  4XMY A;  4A5M A;  5KKN B;  2I80 A;  4IZZ A;  1HQC A;  3Q1K A;  2J5O A;  2Z16 A;  3K1P A;  4BHC A;  1ITY A;  3RAX A;  5DMX A;  2IGO A;  3V42 A;  3UZB A;  2OCE A;  2WE6 A;  2R7W A;  2CJJ A;  1ZLK A;  1X1D A;  4L0Y B;  3CSW A;  5L1L A;  5JR3 A;  1BI1 A;  1XSV A;  1JGG A;  1SAX A;  2FNA A;  1ULY A;  1UHW A;  2IGK A;  2MBF A;  1R5H A;  3NEU A;  4C3H J;  1R5G A;  5JLX A;  1JKJ B;  2V9K A;  2XGC A;  1FNN A;  3K2A A;  4U7C A;  3QOD A;  2IBD A;  2Y75 A;  3LMM A;  2O8X A;  5T14 A;  3U9T A;  2Z99 A;  3U2R A;  2NOJ B;  3M8J A;  2YS9 A;  4CCJ A;  3FF5 A;  3CJR B;  4AYB E;  3T9A A;  1E3O C;  2FQ3 A;  1PX2 A;  3WU2 C;  3NWS A;  1KA8 A;  2W00 A;  4L9V A;  2WB1 N;  3RUP A;  3GTM J;  2L9S A;  3RKY A;  5E3N A;  1VBH A;  2LNB A;  1IOW A;  3DTI A;  4B8X A;  4AIK A;  2Z2S B;  1EH7 A;  2FOK A;  2Z5U A;  2QSH X;  1BW5 A;  1CF7 A;  2J6U A;  3ETJ A;  4DR4 H;  1MD0 A;  4KA4 A;  5FLV A;  1BJA A;  1UG0 A;  3I4M J;  2ECC A;  5DQH A;  4M9U A;  1YW9 A;  3LWB A;  1TWA J;  5LD2 C;  4ZI7 F;  3T9B A;  4DV1 H;  2F4V H;  1K83 J;  2LY9 A;  2ZCW A;  2C35 B;  4DV3 H;  5F0C A;  1I2K A;  2R8G A;  5JI6 A;  4EQQ A;  3CDI A;  2W6M A;  3AW8 A;  3OR2 C;  2H09 A;  5HNE A;  1WFX A;  2QYZ A;  2R8I A;  5KAI C;  2X0L A;  5AIP A;  5FFZ A;  2QVO A;  4LFC H;  2XGQ A;  3BQ2 A;  4BGD A;  3TY8 A;  4O7Z A;  2QQA A;  4HLY A;  3M4I A;  4I0A A;  4XON A;  4HNV A;  5I5T A;  3S93 A;  3HRS A;  1HBX G;  3ZQQ A;  4ECY A;  3LSM A;  1YQA A;  2Z33 A;  1RRJ A;  2LTP A;  3C2G A;  5KFW A;  4XRM A;  5FRN A;  4DW6 A;  4RCN A;  4ECV A;  1ETO A;  3RPU D;  3W3C A;  3TIN A;  4FE7 A;  4XLE A;  2VUM J;  4ECZ A;  3ABL H;  3GV7 B;  4X0G A;  3GTJ A;  4LF5 H;  4MV3 A;  2M9H A;  2A6E F;  1LDK B;  4BU2 A;  5DM7 F;  4QWE A;  3OMY A;  1HC8 A;  2ASL A;  2HYF A;  2V1U A;  1RJP A;  2IP2 A;  1Z67 A;  3MWM A;  4CYC A;  3J7Y J;  1UB9 A;  3KPH A;  4LFA H;  2IMW P;  1R7J A;  4FET A;  4NQW B;  3Q8P B;  1XCV A;  2YU9 A;  4YFN F;  3OSG A;  2EWN A;  2P5K A;  4YIF A;  4X6A J;  5HLH A;  5C1P A;  4A2U A;  2UV1 A;  4ED7 A;  3IV5 A;  3S2H J;  2VJI A;  4MLO A;  2HI3 A;  2MC4 A;  2LMD A;  2UUZ A;  1X3W B;  2VOO A;  3HOW J;  4MO7 A;  4U7B A;  2E35 A;  1PJR A;  5A2Q Z;  4KIS A;  2DAA A;  1SMT A;  2E1M C;  3F8N A;  2W9B A;  4I50 F;  2OWO A;  4HA8 A;  1MMG A;  2EZL A;  4X66 H;  4A3M G;  4PJM A;  1PUE E;  3H3V K;  2KIQ A;  3E6C C;  1D0X A;  3SZP A;  3HG9 A;  1RR8 C;  3O6B B;  4JI5 H;  3HOW G;  4OAZ A;  3ZQH A;  2W48 A;  4F93 B;  2HVR A;  1YG2 A;  3HSF A;  2GOX B;  3BLY A;  4BAY A;  3L09 A;  4XYL B;  2ZME C;  3T1H H;  4BQN A;  2JA8 G;  1O3R A;  2M2E A;  2JQ7 A;  2YUS A;  2PX9 A;  2EJ3 A;  4O7W A;  2I10 A;  2OBP A;  3Q0W A;  3GV5 B;  3JTH A;  2NVU B;  1SD5 A;  2R7X A;  1AKH A;  3LA7 A;  1MBK A;  2XSJ C;  2LLK A;  4B3A A;  3RBD A;  5TIS C;  3TBI A;  2G7U A;  2FK3 A;  2CUZ A;  2N8G A;  5FJ8 G;  2HS5 A;  3H4D A;  2AGO A;  2E7W A;  1KC7 A;  3WU0 A;  5E1W A;  3LSP A;  4DV0 H;  3GTQ A;  5DTD A;  4HX7 A;  2W25 A;  4FGR A;  1ZGJ A;  2YCH A;  3BJO A;  3RKW A;  2HTJ A;  1M1E B;  3ROU A;  5TGT A;  4C5C A;  2UXC H;  4HBL A;  3FMR A;  1IW7 F;  4EM2 A;  2X6X A;  2Z9O A;  1O7F A;  4CMF A;  3BPV A;  4CHU A;  2JA6 A;  2R8K A;  4RU9 A;  1K61 A;  1YS7 A;  5LRR A;  5H20 A;  2EA2 A;  2E1N A;  3BG5 A;  4EM0 B;  4G6Q A;  4GLW A;  4UHT A;  4CO8 A;  5KFV A;  3EPG A;  2ETH A;  3Q9S A;  3VSK A;  4F4X A;  1IO2 A;  2F2E A;  2V7F A;  3CDH A;  3TW6 A;  3MD2 A;  2DPD A;  2O9L A;  2KJB A;  3RI4 A;  4L1K A;  1Y1V G;  2YL2 A;  2KRC A;  5LMU H;  1LQ1 A;  2CFM A;  1ZR2 A;  5KT2 A;  2JJ7 A;  3SDB A;  2WTF A;  3BR0 A;  4NXM H;  3WWI A;  4U87 A;  2ID6 A;  2O6G E;  2KZG A;  4PFO A;  2WB1 A;  5CJ9 A;  3QFF A;  1CF7 B;  4RLF A;  4RM2 A;  2M87 A;  3RJP A;  3L2U A;  4UCR A;  1ZHQ A;  1XDS A;  3LQR A;  3RBE A;  3GTP A;  1S29 A;  3JAM Z;  4A3G G;  4DV7 H;  4JX5 A;  1R4N B;  4ZJZ A;  1I50 A;  3GTL A;  1B6A A;  3HO8 A;  1JHF A;  4D7M A;  5KFM A;  2QBY B;  4F4Y A;  2RV8 A;  4AVP A;  3HHG A;  3V7C A;  5IP9 G;  1ETV A;  4Q4Z F;  5HBR B;  4ECR A;  1S9H A;  1IRF A;  4IEJ A;  3E6D A;  4A3M J;  4ZYG A;  4YAJ B;  1WRV A;  3I4N J;  4O2A F;  2AQ4 A;  3BOQ A;  4R1H A;  4OX9 H;  4II2 A;  4KYW A;  4LF4 H;  2R8H A;  4IWY A;  2CV0 A;  1HW5 A;  5F27 A;  2YRW A;  3GFM A;  3VYR B;  3BG6 A;  3VFZ A;  2D1V A;  3FIW A;  1SFO J;  2KPM A;  3R61 A;  2IS2 A;  2ODT X;  3GO5 A;  4CH7 A;  1C30 A;  5KG7 A;  4BQA A;  4ECW A;  2UUC H;  4FQG A;  4XKV A;  1P4A A;  3RQ4 A;  1V54 H;  4JBA A;  3GCM A;  1TTY A;  1SAU A;  4ZC3 A;  2CW7 A;  3KP3 A;  1XX5 A;  4RGS A;  2Q1Z B;  3GQC A;  5CA0 F;  2NS8 A;  2VPQ A;  3FDS A;  4DR5 H;  1MH3 A;  3L2R A;  1TWC A;  1G3Y A;  4CSW A;  1SFE A;  1I2L A;  2PVP A;  5DCM A;  2BW3 B;  4C2U A;  5DIS C;  1X19 A;  5GTH C;  4JI1 H;  1R9T J;  2W82 A;  2NS7 A;  3GLK A;  4DQN A;  1SCU B;  4XLP F;  2DMT A;  4OIP F;  1Z2P X;  4BKX A;  3GLX A;  1B1B A;  5I5W A;  3AYH B;  2UXD H;  2BOL A;  3GFI A;  2DFE A;  3HB9 A;  1IYE A;  1AUX A;  1JKQ C;  2VE8 A;  3KZY A;  2FE3 A;  3WNZ A;  5I60 A;  1ZET A;  5IYB J;  4MV1 A;  1GLV A;  3GTO A;  4TM5 A;  5BS6 A;  3BT9 A;  1AA7 A;  3FHZ A;  2VR1 A;  1XCB A;  2HPM A;  1IN7 A;  2DPJ A;  2OQG A;  1SC7 A;  2XF5 A;  4Y15 A;  3WWH A;  1SD4 A;  2K5C A;  3PQK A;  1FVI A;  4ZZL A;  1OCO H;  5IYC J;  3S1N J;  3WWJ A;  4BE0 A;  5JLW A;  1IDY A;  3MFH A;  4U7D A;  4B43 A;  2YX7 A;  3ML6 A;  2ZXI A;  3SNO A;  5KS8 A;  2QEN A;  1WJB A;  2OPT A;  3IH3 A;  4NZO A;  4LLG F;  3BJY A;  2EV5 A;  2L7Z A;  3ZOB A;  2HGX A;  2RAE A;  1QO0 D;  5CPR B;  4HX8 A;  2DJN A;  4BDZ A;  2QB5 A;  4HST A;  2ECB A;  3CCU I;  3J7A K;  3GIM A;  3IRQ A;  4XKW A;  3BR2 A;  2Z04 A;  2VA3 A;  3LQQ A;  2V59 A;  2ADU A;  2AQF A;  3F9K A;  4M9Z A;  1J0R A;  5EF6 A;  4IRI A;  1IDZ A;  5D8D A;  2MC3 A;  3IG0 A;  1B59 A;  1FWZ A;  2VON A;  1MNE A;  5IY5 H;  4HYE A;  3K70 D;  3ZN1 A;  3PO3 J;  3F3X A;  1A0G A;  3KEY A;  1QQI A;  3RKQ A;  2DTZ A;  2HGW A;  4G7H F;  3HJE A;  4V19 K;  1MJ9 A;  1LE8 A;  3OSF A;  2B9S A;  4IF4 A;  2QA4 I;  2QK4 A;  2VIX A;  3LST A;  4O4J F;  1ERD A;  4Q45 A;  2FA5 A;  2DFF A;  2EFW A;  1U0J A;  3FZV A;  1BXR A;  4IHX A;  4MA5 A;  3A01 A;  4Y8V B;  4B3R H;  2EZK A;  3KTM A;  5FKO A;  4NLG A;  9ANT A;  4FFN A;  4PDK A;  1B9M A;  1TNS A;  1HW2 A;  2PJP A;  2ZDG A;  1Q1H A;  3JRF A;  3GX4 X;  4L5J A;  4DAA A;  2VA2 A;  1Y1V J;  2BR0 A;  5BPD A;  3K4L A;  2X0S A;  3NUA A;  3VB2 A;  2NU8 B;  3HOV J;  4V2G A;  3HUG A;  5LGT A;  3MMY B;  2V79 A;  4BY1 G;  1MBJ A;  3SYT A;  5GAH J;  4MFE A;  3CLQ A;  1S0O A;  3JRD A;  5B3S H;  2V58 A;  4HOB A;  2X5R A;  4A2B A;  4WBN F;  1Q1V A;  5DDG A;  5K5Q A;  3EYY A;  2OTL I;  5DGH A;  3ABT A;  5KFX A;  2CV2 A;  3JRI A;  3V6K A;  3ABK H;  2DMN A;  1L3L A;  1BJZ A;  3H35 A;  3BZ6 A;  1T33 A;  1ZN2 A;  5FLM J;  1R1U A;  4AID A;  3CCQ I;  3MQ0 A;  2GQQ A;  1BR2 A;  4HV6 A;  4I7H A;  4NXN H;  2VB6 A;  1ETY A;  1K6Y A;  5ILV A;  1BI3 A;  1RKT A;  2MSY A;  3IP4 B;  4G94 A;  3O3K A;  4F3Q A;  2VAS A;  5D5W B;  2EIY A;  3T5K A;  2BBY A;  3A03 A;  1UCR A;  3H9J A;  4J9K A;  1ZAO A;  1TZL A;  5L3B A;  5DG8 A;  2KIM A;  5IPA A;  5KG6 A;  2F5E A;  3SDG A;  5K5O A;  2PMU A;  1USS A;  4J0M A;  2MD0 A;  1HCR A;  2WAE A;  1TQM A;  4PGG A;  3DV8 A;  5LEK A;  3JSP A;  3HOZ G;  3H9G A;  5D5V B;  1ZGA A;  2VT2 A;  1N25 A;  1QZE A;  3ZR8 X;  1U8B A;  3EYI A;  4O84 A;  2V9W A;  2LVS A;  3F6O A;  2OZU A;  4HQM A;  1OCZ H;  3HPG A;  3TDU C;  4ETS A;  2O61 A;  3M1E A;  1XMX A;  3L4K A;  2DQR A;  2K9N A;  5FKK A;  3TOA A;  2X51 A;  3N05 A;  2L02 A;  3OIO A;  2FPI B;  1V51 A;  3S2W A;  2CSO A;  3I4P A;  3N41 B;  2HZD A;  4GDF A;  2VBW A;  3R60 A;  3U9S A;  1A35 A;  2V6C A;  2K3P A;  3VEP A;  1GLN A;  3RQI A;  4FE4 A;  4YQW A;  5HLG A;  3ZQC A;  1E2X A;  4IHW A;  1V9P A;  1AUV A;  3V4S A;  1S03 G;  3FBN B;  2O03 A;  1SVO A;  4YY3 H;  1ON1 A;  3ZGK A;  1TQI A;  4XBF A;  2XKO A;  1OJL A;  1RK6 A;  4YRV A;  2CW0 F;  2BZT A;  4A6D A;  5IP6 A;  4G6D A;  3SZT A;  4A3J J;  3PM1 A;  2NVQ J;  2R7F A;  2M45 A;  2RF4 A;  4YP3 A;  4ECS A;  3WTY C;  4IJA A;  3MZY A;  2IAI A;  4AD9 A;  2E5N A;  4XID A;  4CKC A;  3GW2 A;  2X6Y A;  1D0Z A;  2Y2Z A;  3KLO A;  4A3J G;  2JA5 A;  2DPI A;  1WJ5 A;  5ILS A;  5L3G A;  4P5O A;  3KLN A;  3MKZ A;  1EHI A;  4RAY A;  1N48 A;  3L4J A;  1BOB A;  5KT6 A;  1Z3X A;  1LEA A;  3E0J B;  5E18 F;  5EOY A;  5KFP A;  3IRR A;  4JI4 H;  1TP4 A;  4JI8 H;  3QQM A;  5A2Q K;  4H4K C;  1PUF B;  5F6F A;  3ECH A;  3I59 A;  3G73 A;  2DDB A;  4HF1 A;  1DIK A;  4LF6 H;  5BPH A;  3N6X A;  2VKH A;  4KFC A;  1EKV A;  4II3 A;  2E7X A;  2GPS A;  4A3G J;  3KYH C;  1D1C A;  1K1Q A;  2DYS H;  2DOF A;  2ICW G;  5FNV F;  2FQ4 A;  3FHN A;  3T1Y H;  1OQY A;  1I6H J;  4CCN A;  1LVK A;  4CZC A;  2DOA A;  4J19 A;  4FS1 A;  1VND A;  3HIF A;  5DCM B;  1MMA A;  2STW A;  1IRZ A;  1U5T B;  3HTS B;  2DMQ A;  3JW4 A;  1BJT A;  2WC2 A;  2IPQ X;  2AO9 A;  4QTR A;  1XGO A;  4H0E A;  5DYM A;  4B09 A;  3J80 Z;  1XMQ H;  3V8K A;  4FCY A;  1V3F A;  1EH6 A;  4Q4D A;  5LRS A;  2KZV A;  4FFL A;  4IHY A;  3VSL A;  4A2A A;  1R58 A;  4FTH A;  1I94 H;  4GYG A;  4J9P A;  4ED8 A;  1HOM A;  1OR7 A;  2DO7 A;  4BE1 A;  2STT A;  4OMY A;  3U0G A;  2WAF A;  2F48 A;  3T99 A;  3DU5 A;  1JTX A;  1WJD A;  1XSX A;  4QSH A;  2DFH A;  2FXA A;  4I02 A;  3CCM I;  2NNY A;  2W9C B;  4B3S H;  2ELJ A;  1T6S A;  3A01 B;  1DAA A;  2B0L A;  1TBX A;  1ZGW A;  5J1Y A;  4LF8 H;  2DA4 A;  2RRE A;  5C5J A;  2NVY J;  5F9L A;  3ASO H;  2IA6 A;  3BZK A;  3QWL A;  2A61 A;  3BTI A;  1LJ9 A;  4BY1 J;  3MWE A;  3L2C A;  5L1K A;  1T36 A;  4C3J J;  1VQL I;  4DL6 A;  1UAA A;  3ZQI A;  4X64 H;  5FLX Z;  3C1D A;  2XPW A;  4M71 A;  3FXK A;  3MVP A;  5IP7 J;  4M7E A;  2DW4 A;  5LOV F;  1W7P A;  3RTX A;  4UVA A;  3H9Q A;  4Y33 A;  3HTU A;  1A36 A;  4TV8 F;  3L1P A;  4QJF A;  3JZ6 A;  1CQT A;  3H0D A;  3GVA A;  3ERM A;  4AM3 A;  2L2O A;  2WDT A;  2PQ8 A;  2E2H A;  1OKR A;  1H88 C;  2DCE A;  3BG9 A;  2DU9 A;  1FP2 A;  2DIK A;  2ATL A;  2R7Q A;  2HOE A;  1JUS A;  4UB8 C;  5LHI A;  2FP4 B;  2V4Q A;  4ENK A;  1CS0 A;  2V9P A;  1WI9 A;  5KFR A;  1B4A A;  4UB6 C;  4A0X A;  1EJ9 A;  3K7A J;  5DQI A;  5L1J A;  1Z7U A;  4J9S A;  4KT5 C;  4L5E A;  2VQH A;  2HU9 A;  2WA0 A;  3GZ6 A;  1J75 A;  4NYE A;  3D0S A;  3T5H A;  2BQ3 A;  3KYL A;  1FSE A;  1RZ4 A;  1F43 A;  3RR5 A;  1ODD A;  3LSI A;  3MJF A;  3QRF F;  2CS3 A;  5KAF C;  3KP5 A;  5E79 C;  2ME0 A;  2EZH A;  2E2I J;  2OTJ I;  3GIK A;  4MQ9 F;  3OS2 A;  4BEH B;  2CV1 A;  1KON A;  1QA6 A;  4LB6 B;  2XC7 A;  2A69 F;  1GSH A;  5BQT A;  2HGC A;  4YAK B;  1EKF A;  4A3I J;  4RNM A;  5F1J A;  1GV5 A;  3M8F A;  3KAK A;  1OCR H;  3LA2 A;  4YBZ B;  2ZJP F;  2WAQ E;  4ZDO A;  2JMW A;  2JEJ A;  4CKE A;  1SVL A;  2HWV A;  2HPI A;  2LH9 A;  3G6Y A;  1A04 A;  1VZ0 A;  3SHF A;  2D2W A;  5KK1 A;  2HXI A;  2EFN A;  2VPS A;  4XIC A;  1LDD A;  2RDI A;  1MMN A;  2V6E A;  4RZR A;  3MR2 A;  2CUJ A;  3HOY G;  4LOC A;  1IRX A;  3EET A;  2HQN A;  1HKQ A;  2EH3 A;  2LRD A;  3PL8 A;  4WXD A;  2HQA A;  1F36 A;  5CVV A;  3UZO A;  2XV4 S;  3P5J A;  2DAO A;  1HR0 H;  3KYC B;  4ABZ A;  5GAE J;  3GIL A;  1NK3 P;  1TWF J;  4Y4R A;  2ZB9 A;  3PO3 G;  3R9R A;  2ZME A;  2ZFW A;  3WG9 A;  2R84 A;  5KG0 A;  5F1R A;  4NZM A;  4EJO A;  3A4C A;  2L3D A;  4CYC B;  2YRX A;  2C00 A;  2H6B A;  3GIP A;  1Z7L A;  3R5X A;  1L2Z A;  4HF2 A;  2EPF A;  2F5C A;  2CH0 A;  4XM3 A;  3I12 A;  4UY8 I;  5CQE A;  3WGH A;  1M0T A;  1K83 A;  1JUP A;  1G3S A;  1P4W A;  3BA8 A;  1UMQ A;  3CC4 I;  4HSR A;  4WX9 A;  2KDZ A;  1UC8 A;  3VMM A;  4DLK A;  3ZCO A;  4RGR A;  3QPL A;  1FOW A;  2IRF G;  4EM1 A;  5FR9 A;  1MBG A;  3F6V A;  1WJA A;  1HKT A;  1JDB B;  2D5V A;  3UFX B;  2DI3 A;  1HDD C;  5GAG J;  1G3W A;  2M7B A;  4LGW A;  3FK6 A;  3TQT A;  1XGM A;  3TO6 A;  3E5Q A;  4XX0 B;  2B63 A;  2K9S A;  3JRA A;  3K3V A;  5DV5 A;  2ZXH A;  2UVW A;  2JA6 G;  3RYR A;  4O3M A;  4Q0Y A;  2BXY A;  3CF5 F;  2UVV A;  2Q2E A;  5AON A;  2PBZ A;  2QF7 A;  4YR2 A;  2R7D A;  2QUF A;  3A2K A;  1F1Z A;  1Z0X A;  1RKW A;  3K3P A;  3MR6 A;  2BV6 A;  4ZYH A;  4QLC U;  3F21 A;  1SEU A;  4DL5 A;  1WGX A;  3TO7 A;  3K70 C;  4PZ8 A;  5I5S A;  4A69 C;  1W4M A;  3DFG A;  3B6C A;  4PJ0 C;  4OIN F;  1YW7 A;  5BNG A;  2YX4 A;  2XD4 A;  2K9Q A;  2YW2 A;  4EGQ A;  1EKE A;  2P5V A;  2P5L C;  1EUC B;  1EV7 A;  3TMO A;  1BN5 A;  2X9D A;  5TJJ A;  2E1C A;  2BVM A;  3COA C;  3FKI J;  4JYA H;  5D5U B;  1G2H A;  2P7C B;  3W2V A;  3WTV C;  3ERE D;  1N56 A;  4DR7 H;  1XDU A;  4HRI A;  1GVJ A;  1GT0 C;  2EFQ A;  1QPI A;  2AXT C;  2L01 A;  5EZH A;  5DD8 A;  2DOE A;  1BW6 A;  1WJC A;  1REP C;  3TP0 A;  3K5I A;  5EZY F;  3FKI G;  1ETX A;  2R5Z B;  2COJ A;  5J2U F;  3SEZ A;  4JP0 A;  4GFB A;  4LLL A;  2Q7D A;  2R7M A;  3CEB A;  2DPU A;  1VFC A;  3DF7 A;  3R0J A;  1O4X A;  2Z02 A;  1OIS A;  4MA0 A;  2J6T A;  4I4T F;  2HXO A;  5KNL A;  1DPR A;  3GYH X;  2KT0 A;  3MFK A;  1MMS A;  2TCT A;  1I1K A;  4LF9 H;  3BC8 A;  3KZZ A;  2RQP A;  5J3L A;  1TWA A;  1PP8 F;  4EGJ A;  2JUG A;  3C0F B;  3T9D A;  1SMY F;  3SZG A;  4DL2 A;  2MA3 A;  3V7R A;  1FYK A;  3CUQ C;  4QWB A;  2R6F A;  2PN1 A;  2WWY A;  3RB6 A;  4WXH A;  5C8Y F;  5IYD G;  2GZW A;  1E17 A;  1BL0 A;  3TGN A;  2K4J A;  2FRH A;  4XLC A;  4X65 H;  2YSR A;  2ZKZ A;  3CMM A;  5KFE A;  4RAF A;  1E3H A;  1YRN B;  1SYX B;  1KT8 A;  4MV8 A;  4DNC A;  1X4P A;  4CUG A;  1XMA A;  2K85 A;  4KIG A;  4QIW N;  4DV4 H;  1B6R A;  1F9N A;  4I55 F;  3RSN A;  1WQ2 A;  1ZHF A;  2QSF X;  2X6O A;  4BWS C;  5EWE A;  5HS7 A;  4JXU A;  3M4O J;  1MKM A;  1U8R A;  1LDJ A;  3DBL B;  2OQR A;  5E3M A;  2X1C A;  4M3B A;  3KIO A;  2DA1 A;  4XOP A;  1NG7 A;  4DUY H;  2W85 A;  5IT9 Z;  5M3M J;  2W8K A;  4Q44 A;  2P6T A;  5L3C A;  1V55 H;  3RPQ A;  1MGT A;  1IUY A;  1FEX A;  2R7Z J;  1A0I A;  2H6C A;  5ICF A;  4QWC A;  3L00 A;  1S7O A;  3LSK A;  4DGW B;  4E7K A;  3FMS A;  1VQ8 I;  1F4K A;  3E5N A;  1UJ8 A;  1RC9 A;  4I99 C;  4UUV A;  2A1H A;  3NGD A;  1J5E H;  3KRE A;  2M8E A;  3S32 A;  2IGN A;  3I4N G;  2EA4 A;  1T38 A;  3OYG A;  3FWE A;  2OC6 A;  3QP5 A;  1JTY A;  5ICE A;  3M3Y J;  4APM A;  3JRH A;  3C3W A;  4NDL A;  2J6S A;  2F5V A;  4OIO F;  2BY0 A;  4PJJ A;  3V6J A;  4A3D J;  1RK5 A;  3SI8 A;  3I55 I;  5HLT A;  1FMV A;  4BEH A;  2L9N A;  3OWT A;  3QAH A;  4MHG A;  1I50 J;  3DBR B;  5KT7 A;  1JT0 A;  3GII A;  2VBX A;  1YTY A;  4A3K J;  4IAJ A;  2KIU A;  2X1E A;  3OYI A;  2ZME B;  2YYA A;  1TT0 A;  2PN6 A;  3PFF A;  2FUG 2;  2K86 A;  2OUM A;  2FBI A;  2XAQ A;  4KMU X;  1OR7 C;  3T1B A;  1XPX A;  4DUZ H;  4JX4 A;  1PDN C;  4E7Z A;  4O7R A;  1LFB A;  1MDM B;  1J5Y A;  3JR9 A;  3HOT A;  2ASD A;  2M5W A;  4AWX B;  4RA2 A;  2WB1 E;  2HDK A;  4DOZ A;  2EBI A;  2ZSI B;  3FMQ A;  1VQO I;  2ACJ A;  2RNJ A;  3BP8 A;  3LFU A;  3HRM A;  2A5Y B;  5KCM A;  3MKW B;  2EK5 A;  1T8I A;  5JVL A;  5DLG A;  3KP7 A;  4GLX A;  3KP4 A;  1FOK A;  4O5V A;  3SFI A;  5KFU A;  2Y0S E;  1QVU A;  4IVN A;  2COG A;  2HDC A;  4MGR A;  2VJ5 A;  3HOS A;  4ESB A;  5HNH A;  5HVQ C;  2Q2E B;  2E1O A;  3FIS A;  3K4J A;  4A3F G;  3N4M A;  4IRG A;  2EJ2 A;  4KN7 X;  2FLL A;  4IPA A;  4KN4 X;  5LMN H;  1Y0U A;  3KXY T;  4XLA A;  4ENJ A;  4O3S A;  1Y39 A;  3DWL E;  4CYD A;  2R5Z A;  3PZP A;  1IXC A;  4CZZ A;  4XR6 A;  1Z2O X;  1FY7 A;  2E60 A;  3F8F A;  4DZP A;  3CMA I;  1FPQ A;  3CJT B;  3NBY B;  2JA6 J;  4F50 A;  2X85 A;  5L3F A;  3I71 A;  3WGI A;  5IOY A;  4TVI A;  1MZB A;  4DRF A;  2V1N A;  2L7K A;  2XRL A;  4IX7 A;  2AXL A;  1CKO A;  3DQV C;  3PUF A;  2ME6 A;  5FRM A;  3QOP A;  2IXS A;  5F64 A;  3PW7 A;  1CKN B;  1IUF A;  3S1R J;  1FIP A;  2YWV A;  1TWG A;  2W6Z A;  1KJ9 A;  2EIL H;  2O7O A;  1O75 A;  1T95 A;  3J80 K;  2CO5 A;  3PR4 A;  4F55 A;  3OS0 A;  4HR7 A;  2VOD A;  2P0W A;  2WV0 A;  3HBL A;  3D5S C;  4G7Z F;  1D5V A;  4EQ5 A;  1YX3 A;  2DBB A;  3OYN A;  1FBQ A;  5J8C A;  3IL2 A;  1K78 A;  2HVS A;  3ZMZ A;  5KFK A;  3N8D A;  4BJT A;  2R7S A;  3HEF A;  1Y1W G;  4ANJ A;  1XMO H;  1P6R A;  2R93 G;  4NC6 A;  3OR1 C;  3OUZ A;  1JKR C;  3TL4 X;  3U1D A;  1ON2 A;  2FD5 A;  3O2P E;  5LGN A;  3Q0V A;  1W0U A;  1SFX A;  2VXD A;  1AWC A;  1GHC A;  5KFG A;  1S0M A;  3GTG A;  1B8I B;  4DL3 A;  4U0Y A;  3M9M B;  4WK8 F;  4J9L A;  5KT4 A;  5BPI A;  3FKJ A;  1ZRD A;  1X3Z B;  2ALZ A;  3C2H A;  1M7J A;  1YJ9 I;  2UXX A;  4F91 B;  4JUZ A;  1YE9 A;  2LG4 A;  4CIC A;  1RET A;  5CM0 A;  2P8T A;  4J9N A;  5IYD J;  2J5P A;  2L54 A;  3TEK A;  4G9Y A;  4HG2 A;  5AIQ A;  3W6K B;  2W8L A;  5C4J J;  4QIW A;  5DG7 A;  3KX2 A;  4DL4 A;  2XGX A;  2F4I A;  5BYB A;  5KG2 A;  3MR3 A;  2JPB A;  1MND A;  2I8C A;  3GID A;  1CQI B;  2VUM A;  1WI3 A;  2YR2 A;  3DTF A;  2P6S A;  1Z21 A;  2XCA A;  3WHB A;  3JRX A;  3HKZ N;  1FX7 A;  2JVH A;  4A3C G;  4P96 A;  3GTJ J;  4ED2 A;  2Y0S N;  1DV2 A;  2KSW A;  3HT5 A;  2A05 A;  5KFF A;  5EEG A;  4OOI A;  2L9R A;  2DK5 A;  1ZYR F;  2HQR A;  3CP8 A;  5H6Q A;  5ED4 A;  4IQ4 A;  1MBF A;  1MBE A;  2GAU A;  4WXC A;  5ERI A;  3M9N B;  1BI0 A;  3L2P A;  3REO A;  2DWC A;  3WTS C;  4RGX A;  2L4A A;  3N42 B;  2ZJ2 A;  3RF2 A;  1W7P B;  4HDV A;  2FPP B;  2Q2U A;  3OSN A;  1FBS A;  4E7J A;  2LF8 A;  1MMD A;  4HX4 A;  2VQE H;  1TW2 A;  2HNH A;  2FJZ A;  2ZNZ A;  3QZ7 A;  4EV0 A;  2HOS A;  4A3E G;  1BM9 A;  3N40 P;  3KHR A;  2KQR A;  3EUH C;  3S1Q J;  1B04 A;  2NYX A;  5M5Y J;  2CMP A;  2IA1 A;  1Y6I A;  4RGU A;  5KT3 A;  1UZC A;  4LLN A;  1GGO A;  5D1O A;  1MDM A;  3RZO J;  3FXR A;  3UYY A;  1TAE A;  3HDD A;  2EJ0 A;  3TP3 A;  3T5X A;  2QKM B;  4FBT A;  1WZ2 A;  3QZ8 A;  3S3O A;  1R23 A;  4I01 A;  1X3U A;  1H89 C;  1U9N A;  2CQQ A;  2A68 F;  4PJN A;  1K6O A;  3CQZ A;  3U9G A;  4P9U A;  5CR5 A;  3I58 A;  2DLL A;  4V2F A;  4BJ6 C;  4OWR B;  3J7A O;  1XTA A;  5E3L A;  4AU7 A;  2XAJ A;  2IS4 A;  5DD4 A;  1C3O A;  2NU9 B;  3CUQ B;  4BBR J;  4R7R A;  1XNQ H;  4U0V A;  2K9M A;  5EGO B;  2ESN A;  2LY1 A;  5BWU A;  1S3J A;  5EWG A;  4YR0 A;  2DMP A;  4OAY A;  2X4H A;  2EIK H;  1RIO H;  4LIU A;  3RYP A;  1IOV A;  3ISP A;  2ABJ A;  1YX5 A;  4OIQ F;  4FHT A;  1A3G A;  2Z1D A;  2EV6 A;  3M9A A;  4ECU A;  2QEX I;  4MV9 A;  2M8G X;  4BQQ A;  1M6V A;  3AX6 A;  2XRN A;  2V26 A;  3DPL C;  1JKP C;  2UUB H;  4G8X A;  1RYR A;  1YS6 A;  4FAS D;  4UUT A;  3LAJ A;  3H0G J;  3ECO A;  5TRD A;  5J4Y A;  4BY7 G;  2I5U A;  3DLL F;  1CQJ B;  2UUA H;  5L9X A;  5C3E J;  5BOX A;  2O8K A;  3BJ6 A;  4GKK H;  2R93 A;  2O3F A;  3VA7 A;  4JV2 A;  4I76 A;  1D1B A;  1FOY A;  4ZHQ F;  3PW4 A;  1MSF C;  3OOP A;  3ZMV A;  2G0E A;  4ON0 A;  2Y30 A;  4BNC A;  4RUC A;  3IN5 A;  1Z9C A;  3OHB A;  5KFN A;  3PFY A;  1T94 A;  1Z05 A;  3ZQ7 A;  1DV1 A;  4FS2 A;  4KMF A;  3LL7 A;  3R5H A;  4AIH A;  4MQV A;  3W2A A;  1CKN A;  1ETK A;  1X2N A;  4LH7 A;  5J1R A;  1A48 A;  1ZHS A;  2VT3 A;  4B47 A;  1JXS A;  3WU1 B;  4A3B J;  2EQR A;  3PIO F;  3S2D J;  4DJA A;  2RN7 A;  3WTZ A;  1KJ8 A;  5K2M A;  1IBM H;  1V4R A;  2W57 A;  1IN8 A;  4GC7 A;  2LP0 A;  5E25 A;  1IGN A;  3W1B A;  1OYW A;  5F04 A;  3CCV I;  1D8J A;  3K69 A;  1OCT C;  3K9T A;  3PW2 A;  3JSN A;  1SD6 A;  4O3R A;  3T8R A;  4UUS A;  4I2O A;  4EFE A;  5HS9 A;  3CQZ J;  5GTI C;  2L5Q A;  3K6G A;  1LB2 A;  3CCJ I;  4A3L G;  1WH5 A;  1KYZ A;  3F8M A;  1UST A;  2W1O A;  1TT5 B;  2ZXW H;  3CJQ B;  3BTJ A;  4M6Y A;  1BOA A;  5DUK A;  3GFJ A;  4C30 A;  3TII A;  1NHA A;  3FXJ A;  6PAX A;  4XRF A;  4EFB A;  2E36 A;  2HFH A;  4RAG A;  1JUM A;  1P2F A;  1LNW A;  2YZL A;  1YJN I;  4M9X A;  4AC0 A;  3PQJ A;  3VWB A;  4R8H A;  1YI2 I;  1GXQ A;  1DGS A;  1TQP A;  4Y7N J;  4O82 A;  2D1H A;  3EUH A;  2PI0 A;  2MG4 A;  3IH2 A;  4L0Z B;  1S7A A;  2MYS A;  1V4Y A;  1KGS A;  4XZ3 B;  4RB3 C;  3DTG A;  3A02 A;  1OWT A;  2GOM A;  3H4B A;  1JJ6 C;  1A6I A;  1I7N A;  3SFZ A;  1POG A;  3V4Z A;  1I3Q J;  1ETQ A;  5JQG F;  2XVC A;  3OIP A;  4B3X A;  1KQ8 A;  2ZJT A;  3KHL A;  3SGI A;  4BJ5 C;  4Q48 A;  4J9O A;  4K6N A;  4LB5 A;  4LMY A;  5LLQ A;  1JIH A;  2JEI A;  4IHS A;  1M0W A;  2WBM A;  4NBQ A;  1G6N A;  5C4X G;  5CA1 F;  1I5Z A;  2L0K A;  4C2M J;  3MKL A;  1T0F C;  4D5C A;  2RKH A;  3W5O A;  4LSA A;  3QPH A;  3H1C A;  2IT0 A;  4IRK A;  2DXI A;  2XAG A;  5FKM A;  4UVB A;  4O3P A;  1XK5 A;  4JI2 H;  1YIT I;  4FBU A;  1TL8 A;  1QZY A;  4ENN A;  4Z2Y A;  3DPU A;  5F0F A;  3RV3 A;  2DFI A;  3EDP A;  4O7S A;  1MBH A;  2LBF B;  4EGZ A;  1B33 N;  1U3E M;  4U6P A;  4DYC A;  5C44 J;  5M3F J;  2L7F P;  5JFR A;  3DLA A;  2XAF A;  5CVI A;  2MD5 A;  2DDA A;  2EJR A;  2R4G A;  2ZXJ A;  1N77 A;  4Y13 A;  5KFQ A;  3GV8 B;  4XLN F;  3QPS A;  1XG1 A;  3OYA A;  2DT6 A;  1E4E B;  2VXZ A;  3LWF A;  2ZFU A;  1RUN A;  1F5T A;  4PZJ A;  3EPI A;  2Q2T A;  2VC0 A;  5KG4 A;  3RIR A;  5IOZ A;  1I6X A;  3V6H A;  2QGU A;  2JSP A;  3CLO A;  1JHH A;  4P1W A;  4A3I G;  3T9C A;  3G71 I;  3UKG A;  1WCM A;  2DQL A;  2FOW A;  4YFK F;  3HGY A;  3HZJ A;  2JSC A;  2WAQ N;  3G6X A;  1ZAR A;  2R82 A;  5FFX A;  4S04 A;  5JVG F;  4HAM A;  4EEF G;  3CC7 I;  4CCM A;  5BMV F;  2B63 J;  3CO7 C;  4A3K G;  3RGX A;  4MIM A;  1L0O C;  1SVM A;  2H1L A;  3RZD J;  1X2M A;  3BQY A;  3N44 B;  4O3Q A;  3F72 A;  1PYV A;  2DTR A;  1U5T C;  1TW3 A;  3H5A A;  1R00 A;  3HUG B;  1I1S A;  2JRT A;  2K02 A;  4QPO A;  4JI6 H;  3BAC A;  3QOE A;  2ZBK A;  4OIR F;  4LIV A;  3L2V A;  4UUS B;  1ZRC A;  4ED6 A;  1X1P A;  3AFH A;  3OYC A;  5K7Z A;  2IP4 A;  2RQQ A;  2NU7 B;  4PZ6 A;  1ZQ7 A;  2BQU A;  3GFL A;  2CRG A;  1G4D A;  4FFM A;  1A6Q A;  3BTC A;  2DN0 A;  1YHQ I;  1IC8 A;  4IZO A;  1X9N A;  4QIW E;  1FJG H;  4YII A;  1E0E A;  3BDD A;  1Z91 A;  1DUX C;  3JZI A;  3LA3 A;  1UG2 A;  3PJR A;  3JRC A;  1Y56 A;  2BHZ A;  4HDU A;  2YS6 A;  4DV6 H;  2JWT A;  4K2E A;  1DU0 A;  1G2W A;  4YIR X;  1Y1V A;  1MH4 A;  2KDO A;  4HEA 2;  3J81 Z;  3K5H A;  1TWF A;  2RDJ A;  2GBY A;  1T56 A;  1D8K A;  1OMI A;  3VDX A;  4J01 A;  4CE5 A;  3U21 A;  1Y1W A;  5DCF A;  2XAS A;  2IW5 A;  5CAE B;  2OH2 A;  3GTP J;  3M7G A;  5HDK A;  2BY3 A;  5KHD A;  2BY1 A;  1WSC A;  5H80 A;  2PFB A;  3HC7 A;  2PEX A;  1FIA A;  2AQE A;  1MJB A;  1XN7 A;  3LQS A;  4JI7 H;  2COM A;  4G6T B;  4RDU A;  4PSW A;  1KQ0 A;  2R7L A;  1IV8 A;  3IAM 2;  3BJA A;  3CD6 I;  5BWV A;  1QZZ A;  2FBK A;  3H92 A;  4UVC A;  1EH8 A;  1OYY A;  4G12 A;  5KFD A;  1S8N A;  1Z77 A;  4ZOL F;  1DDN A;  2DA3 A;  2XCL A;  3HSR A;  4U88 A;  4E4T A;  5LP6 F;  2IS6 A;  2DA7 A;  4ENM A;  1W96 A;  5DM6 F;  3EQL F;  3BCB A;  1A5J A;  3AG4 H;  4A6E A;  4AYB A;  1W36 D;  1B72 B;  3I3L A;  4F52 A;  2P7V B;  3C7J A;  4HV5 A;  3G6E I;  2Q8K A;  1J59 A;  2HR3 A;  3I53 A;  3F0C A;  3K1N A;  5CQG A;  4BHB A;  3OSP A;  2DYR H;  5B1B H;  1RJR A;  5DUI A;  5KFT A;  5FGM A;  3I0T A;  5KVR A;  1GYF A;  3S3M A;  4I0B A;  3Q8S B;  1FTZ A;  3QWU A;  2KIS A;  2VQG A;  4GXO A;  2AHQ A;  3OYJ A;  5DLF A;  4ITV A;  2WAQ A;  5DGI A;  2EIN H;  4FX4 A;  2OF7 A;  4IOA F;  1S68 A;  4O6J A;  2R7U A;  3OL4 A;  1I3A A;  3BA9 A;  4C5A A;  2FK1 A;  1VQP I;  2OJE D;  2QQB A;  4HPQ A;  2XB5 A;  4MNU A;  2R92 J;  1XC5 A;  4L5I A;  2A3S A;  2HGS A;  4J9M A;  1UHM A;  3DKW A;  2F6C A;  4UXN A;  3E97 A;  2VKV A;  1CE8 A;  1SEI A;  2RGV A;  4HNU A;  2BW3 A;  4A3F J;  3T9F A;  5C3E G;  5F08 A;  3GWZ A;  2LD5 A;  1I7L A;  1JE8 A;  4XYM B;  4CHI A;  2V4J C;  3ZP5 A;  5J40 A;  2JPC A;  3PW5 A;  5JHU A;  5DG9 A;  4QWQ A;  3PVX A;  4HW0 A;  3GUD A;  2GPW A;  2CKZ B;  1E3P A;  3KEQ A;  5KFA A;  4RUA A;  3B6A A;  4BBS G;  4A93 G;  1N75 A;  2VKD A;  5DGB A;  4ZTF A;  1XNR H;  5M5X J;  4IR1 A;  2EZI A;  1TLH B;  3OYM A;  1FC3 A;  3G3Z A;  2XB0 X;  4ED0 A;  4M3F A;  3JSL A;  3H20 A;  2MLK A;  3QPT A;  3VOE A;  4A0Y A;  4B1R A;  1R49 A;  2GXB A;  4O7T A;  3N43 B;  1WHU A;  2PG4 A;  4ECX A;  4RB1 A;  3AL0 C;  2COB A;  2TDX A;  3M1C A;  3GDE A;  1DP7 P;  2R7Z G;  3DP7 A;  4ZTJ A;  3L2W A;  1H9G A;  4CXF A;  2LR8 A;  3U54 A;  2QQ8 A;  1KUT A;  4O4I F;  1SD7 A;  2GLO A;  3MCZ A;  4XK4 A;  3BR1 A;  3BPX A;  2MH9 A;  3RB4 A;  2H94 A;  4LK1 F;  2AU0 A;  3N97 A;  2NVX A;  1FKA H;  4FE2 A;  1ORK A;  4UCT A;  4JOM A;  1J2X A;  4FFP A;  1QVT A;  5KFH A;  3O8H A;  2DAB A;  4BYY A;  1IV6 A;  4BXX J;  1PK8 A;  3O8G A;  4EYI B;  4ASN A;  1OLT A;  1ENH A;  5CVR A;  1Z2N X;  2W70 A;  2X48 A;  4DBQ A;  4IOC F;  4XSZ F;  2QBY A;  2P0A A;  4LG0 A;  3F22 A;  3VNN A;  4M73 A;  4RB2 C;  1KJJ A;  4D9J A;  2Y4R A;  4EBC A;  3IKT A;  4J9Q A;  4XLH A;  2FU4 A;  3RDI A;  3NC0 B;  4DL7 A;  3ZRG A;  5LHG A;  2W6O A;  3HOU J;  3T7A A;  1K78 B;  4XLF A;  2A6T A;  1B8I A;  1TWG J;  5D8L B;  3TKY A;  3JRW A;  3HSE A;  2NAZ A;  4CC6 A;  3MAJ A;  1HNZ H;  4Q8F A;  3KYD B;  3JRG A;  3T0Y A;  1RR7 A;  2VE9 A;  5GON F;  2DA2 A;  2CG4 A;  4GKJ H;  3FDY A;  2Y31 A;  2M30 A;  2NVY A;  5H6R A;  1VQ5 I;  3LP8 A;  1W36 C;  4HN2 A;  5I5Y A;  5DEQ A;  2PMH A;  3L2Q A;  5BMZ A;  1FYM A;  1YLF A;  3VPB A;  1KJQ A;  1WKM A;  1N34 H;  1YJW I;  1OCP A;  3RTR A;  3TDZ C;  2QLZ A;  4QWD A;  1FJL A;  4O3O A;  1N33 H;  1U2W A;  5BWR A;  5KFJ A;  3E6M A;  1S72 I;  2AS5 F;  2DLN A;  1RYS A;  3KE2 A;  3V8J A;  3F23 A;  2K9L A;  1H0M A;  2BQR A;  2GWR A;  2OA4 A;  2W6Q A;  5K7H A;  3ZPL A;  4ESF A;  1I27 A;  2LDU A;  4LG3 A;  1DQU A;  1LE8 B;  2E2H J;  2JA8 J;  2FPG B;  2R0Q C;  4EBE A;  2UXB H;  3K4C A;  1HA8 A;  3G1L A;  3IAS 2;  3K4N A;  4RS8 A;  1LEB A;  4CC5 A;  5HLI A;  3DBH B;  4RM3 A;  3HRT A;  2W84 A;  4RMN A;  2JT1 A;  2CUE A;  5CB4 F;  2ISZ A;  3VPD A;  2KIF A;  4C3I J;  1K7A A;  2M1B A;  5EDN A;  2Q0O A;  4O3N A;  5EZG A;  5KFZ A;  4S05 A;  3NAR A;  4AIJ A;  1GSA A;  4UUG A;  3IC7 A;  5CVU A;  3NAU A;  4E6K G;  3CC2 I;  5BWT A;  1VQ7 I;  2NS0 A;  3J80 W;  3PNT A;  4E6N A;  4IRC A;  3WOD F;  4FX0 A;  1T98 A;  1ZRE A;  2A5W A;  3H3V H;  4MV7 A;  3RFC A;  1HSJ A;  1VTN C;  4BBR G;  5E1X A;  3CUQ A;  5KFC A;  2XDV A;  4DV5 H;  1TNT A;  4BXX G;  1GV2 A;  4N0B A;  3AAF A;  1EA3 A;  2K3F A;  3OIQ A;  1VBG A;  4O2B F;  3KET A;  4YR3 A;  1ZRF A;  2NVX J;  1ZK8 A;  4JI0 H;  2OD5 A;  2PMZ N;  5FLX K;  4FFO A;  2HHF A;  3CF2 A;  2VUM G;  1KEE A;  1JXL A;  1WH7 A;  4PDB A;  4UCU A;  2KLO A;  1VAJ A;  4CCL A;  3OYH A;  2Z3Y A;  3NWT A;  1BIB A;  4G7O F;  1J9I A;  3WTU C;  2VLA A;  2E2J J;  2UVU A;  4YEJ A;  1Z3Y A;  2HKO A;  4IIJ F;  4UFZ A;  4JI3 H;  3WG7 H;  5LA6 F;  4GO1 A;  5BWW A;  3BQ0 A;  4DBR A;  5DAA A;  2ZSH B;  5KX5 F;  2JRM A;  3SJM A;  4EMS A;  1D1A A;  1Z1D A;  2XIG A;  2VN2 A;  3QYE A;  4IXA A;  3GTG J;  1LVA A;  2JTV A;  2M4K A;  1R22 A; 
#chains in the Genus database with same CATH homology
 1LKX A;  2VAS A;  4GRI A;  4YEL A;  4XKC A;  3N42 B;  3H9J A;  3RF2 A;  3W2W A;  4B48 A;  3NBZ B;  2Q2U A;  1TZL A;  1MW7 A;  4XOT A;  4E7J A;  3LML A;  4EAT A;  3UNG C;  2VQE H;  1MMD A;  1L2Z A;  1DP3 A;  4E7S A;  3FBI B;  4J0M A;  2MD0 A;  2HNH A;  2WAE A;  4KHP H;  4XQF A;  3N40 P;  2KQR A;  4E7H A;  3H9G A;  3EUH C;  1B04 A;  3ZR8 X;  2CMP A;  1Y6I A;  4RB0 A;  4CCO A;  4ETS A;  3HPG A;  5D1O A;  2E5L H;  4PSX A;  4DV2 H;  3PNV A;  2IS1 A;  4BE2 A;  1TAE A;  2X51 A;  3K4M A;  3N05 A;  4PK4 A;  4BXF A;  4J00 A;  2QKM B;  1P8L A;  1G8X A;  3N41 B;  2OV7 A;  3S3O A;  4XN0 A;  2HZD A;  1FMW A;  5HNF A;  2K3P A;  4PJN A;  1XDN A;  2KMU A;  4UCS A;  1GLN A;  3DKY A;  4BJ6 C;  5LFA A;  3I9V 2;  3K4K A;  2X6W A;  4OWR B;  1V9P A;  4AU7 A;  2IS4 A;  1S03 G;  4LFB H;  3FBN B;  2O03 A;  1D0Y A;  4R7R A;  4ZDP A;  4YY3 H;  1XNQ H;  4PZ7 A;  3ZGK A;  3G2B A;  2K9M A;  4QPQ A;  2LY1 A;  4YRV A;  2KP6 A;  2PJR A;  3S3N A;  4X62 H;  4DR3 H;  4OAY A;  4CCK A;  4LIU A;  1YX5 A;  4PJL A;  4XN3 A;  5FRO A;  2HIX A;  3OYL A;  1N78 A;  2Z1D A;  4B44 A;  2E5N A;  1X4O A;  4MV9 A;  4BQQ A;  2X1D A;  2V26 A;  3H5N A;  1D0Z A;  2X6Y A;  2VQC A;  3DPL C;  1J09 A;  2UUB H;  2WAD A;  1X1A A;  1WJ5 A;  4XKB A;  4FAS D;  2LRE A;  3OYK A;  5D1O B;  4P5O A;  3MKZ A;  3RCO A;  2XF6 A;  4HNT A;  1BR4 A;  4RAY A;  2KL4 A;  3BCA A;  3L4J A;  1BOB A;  2UUA H;  4KJZ A;  1Z3X A;  3E0J B;  5EOY A;  2M4G A;  4JI4 H;  4JI8 H;  3QYB A;  5FD5 A;  4LH6 A;  4GKK H;  2KRH A;  2M0M A;  5HOO A;  1D1B A;  3A1Y A;  4H4K C;  1LFP A;  1P16 A;  3GBG A;  4LF6 H;  4BUP A;  2UXB H;  3BG7 A;  2VKH A;  2VOB A;  3PFY A;  3N6X A;  4NNJ A;  2VUG A;  2VL8 A;  4II3 A;  3LL7 A;  3KYH C;  2O5R A;  1D1C A;  4DR6 H;  3W2A A;  1CKN A;  2VQL A;  4LH7 A;  3FHN A;  1ZHS A;  3PSI A;  3T1Y H;  4B47 A;  4CCN A;  3LSH A;  1LVK A;  4PFP A;  3HL2 A;  2XF7 A;  5FLX W;  4DJA A;  2DOA A;  4CZC A;  4DR2 H;  4AQY H;  2XAU A;  1IBM H;  2WY7 Q;  3JAM W;  1MMA A;  5BR8 H;  1DGR M;  2W57 A;  1BJT A;  1VS0 A;  1QHG A;  4BL0 B;  2DJI A;  3W1B A;  3ZXS A;  2WYO A;  1XMQ H;  2LYC A;  2VJ4 A;  3JSN A;  4XL9 A;  4JQF A;  4UCO A;  2KZV A;  4EFE A;  3VSL A;  1QHH D;  4A2A A;  4LF7 H;  2L5Q A;  3K6G A;  3FMA A;  1I94 H;  4BE1 A;  2W1O A;  4KT6 A;  2DT7 B;  5IWA H;  3L4K A;  3CJQ B;  2WAF A;  3VYU B;  4C30 A;  4DR1 H;  3DU5 A;  3VYS B;  4EFB A;  1WJD A;  4BQO A;  1X1B A;  5JHF A;  4B3S H;  1QU3 A;  2ELJ A;  4IKF A;  4B3M H;  1DGW Y;  4LF8 H;  3VWB A;  2RRE A;  3S24 A;  2QKL B;  1DGS A;  4XMY A;  2R7O A;  4IZZ A;  3J7A Y;  4C9Y A;  2Z16 A;  2MYS A;  4XOR A;  2E1M B;  2IGO A;  2PMZ A;  3V42 A;  3OY9 A;  4RB3 C;  2GOM A;  2WE6 A;  1UAA A;  2R7W A;  1X1D A;  1WJF A;  4X64 H;  2LC2 A;  4M7E A;  2ZJT A;  4YHH H;  3OIP A;  3HXL A;  4B3X A;  3RTX A;  2IGK A;  4BJ5 C;  1I6U A;  1E4F T;  3H9Q A;  4Y33 A;  2V9K A;  4LMY A;  3CES A;  4ZDL A;  2WDT A;  3H0D A;  3OL3 A;  3QOD A;  2WBM A;  2L2O A;  4PUS A;  1M0W A;  3LMM A;  3BAA A;  4JV5 H;  4EEQ A;  2DCE A;  3GB8 B;  2NOJ B;  3M8J A;  4CCJ A;  3BAB A;  1T0F C;  2R7Q A;  3CJR B;  3W5O A;  4LSA A;  2DXI A;  3RJ0 A;  4JI2 H;  1XK5 A;  2VQH A;  2HU9 A;  2WA0 A;  3NWS A;  2W00 A;  3KYL A;  3DPU A;  3RR5 A;  2L9S A;  3LSI A;  3OOU A;  2LBF B;  2CS3 A;  3DTI A;  5FD6 A;  2Z2S B;  3OS2 A;  3DLA A;  4BEH B;  2CV1 A;  1KON A;  2UWM A;  2R4G A;  2XC7 A;  4DR4 H;  1N77 A;  4LSX A;  1UG0 A;  3OYA A;  2DT6 A;  3DU6 A;  4XNF A;  3KAK A;  2VXZ A;  4MTE A;  2ZFU A;  5LD2 C;  4ZDO A;  2KHM A;  4E4H A;  4DV1 H;  2F4V H;  2I8D A;  4DV3 H;  2Q2T A;  2HPI A;  2LH9 A;  2JSP A;  1VZ0 A;  4P1W A;  3OR2 C;  1WFX A;  2VPS A;  4Y3O A;  2IGM A;  4LFC H;  1MMN A;  2V6E A;  1SFK A;  2CUJ A;  1IRX A;  4BGD A;  2LRD A;  3PL8 A;  3TY8 A;  2HQA A;  3M4I A;  4XON A;  4FM9 A;  2LBF A;  1HR0 H;  1X1C A;  2CFO A;  3S93 A;  4CCM A;  3ZQQ A;  1N32 H;  3LSM A;  4Y4R A;  3C2G A;  3RGX A;  4BS9 A;  3UR3 C;  5FRN A;  2HIV A;  3N44 B;  2MCT A;  2RNG A;  3RPU D;  1PYV A;  3W3C A;  4XLE A;  3H5A A;  2R7V A;  3HUG B;  3A4C A;  4QPO A;  4JI6 H;  3QOE A;  4X0G A;  1Z7L A;  4LIV A;  3L2V A;  4LF5 H;  4XM3 A;  2LOO A;  2CH0 A;  1LDK B;  4BU2 A;  3AFH A;  3OYC A;  4PZ6 A;  2E5Z A;  2RQQ A;  3OMY A;  5CQE A;  1BGW A;  1M0T A;  3PSF A;  3BA8 A;  3MWM A;  5CKT A;  4HSR A;  4CA0 A;  4LFA H;  3ZCO A;  2M7A A;  1FJG H;  1X9N A;  4FET A;  4NQW B;  1E0E A;  3PJR A;  1G59 A;  1WJA A;  4NC8 A;  1J5E H;  1Y56 A;  3RIZ A;  4DV6 H;  2M7B A;  2UV1 A;  2VJI A;  4MLO A;  3E1S A;  3K4B A;  3DEE A;  2KDO A;  4HEA 2;  2MC4 A;  4J01 A;  3K3V A;  2UUZ A;  3VDX A;  2ZXH A;  3U21 A;  3OYE A;  4U7B A;  1PJR A;  4Q0Y A;  4KIS A;  5KHD A;  3EUK L;  3F8N A;  2E1M C;  2OWO A;  1MMG A;  4X66 H;  3HC7 A;  4PJM A;  3OYF A;  1D0X A;  4JI5 H;  3HG9 A;  2AQE A;  3A2K A;  4OAZ A;  4F93 B;  3OYB A;  2HVR A;  4G6T B;  3BLY A;  4JI7 H;  2GOX B;  4PSW A;  3T1H H;  4R79 A;  5FPR A;  1V5G A;  3IAM 2;  3K70 C;  4BQN A;  4PZ8 A;  1WJE A;  2R7X A;  3TMO A;  2XSJ C;  2BVM A;  4LIT A;  3S8P A;  2IS6 A;  4JYA H;  3TBI A;  3W2V A;  3BCB A;  2CUZ A;  4DR7 H;  4AYB A;  1W36 D;  4HRI A;  3I3L A;  3MKY B;  1HNX H;  1P9Q C;  4F52 A;  1WJC A;  4RAZ A;  4DV0 H;  5CQG A;  2ZM6 H;  2YCH A;  3SEZ A;  2R7R A;  2UXC H;  5TGT A;  1GYF A;  3S3M A;  3DF7 A;  2X6X A;  3QWU A;  2VQG A;  3OYJ A;  4ITV A;  2WAQ A;  5KNL A;  3IUO A;  1S68 A;  2R7U A;  4LF9 H;  3BC8 A;  3OL4 A;  3DPT A;  4RLQ A;  3BA9 A;  4HPQ A;  2JVG A;  2JUG A;  3C0F B;  3RGZ A;  3SZG A;  3VSK A;  2HGS A;  3KAJ A;  2F6C A;  3OYD A;  2V7F A;  3D5L A;  1SEI A;  3MD2 A;  4AVZ A;  4RZQ A;  3PUB A;  4HNU A;  2RGV A;  2BW3 A;  2R7T A;  2KRC A;  3J81 W;  3ONQ A;  4XLC A;  4X65 H;  5LMU H;  2CFM A;  3SDB A;  2V4J C;  3CMM A;  3GJX B;  1AN7 A;  4NXM H;  1HNW H;  4U87 A;  1SYX B;  1E4G T;  3DTE A;  3AKZ A;  4PFO A;  2WB1 A;  4IQJ A;  4UCR A;  1X4P A;  4RLF A;  4RM2 A;  4CUG A;  3L2U A;  1WH2 A;  1ZHQ A;  4DV4 H;  1N75 A;  4K0K H;  2VKD A;  3RSN A;  5LL6 b;  4ZTF A;  4DV7 H;  1XNR H;  3QYF A;  4BWS C;  4ZJZ A;  3OYM A;  2X1C A;  4XOP A;  4DUY H;  1NG7 A;  4DIQ A;  3JSL A;  3H20 A;  3EPZ A;  1S9H A;  3N43 B;  3HPH A;  1A0I A;  4D1Q A;  4OX9 H;  4II2 A;  3LSK A;  4RB1 A;  2CW8 A;  4DGW B;  4E7K A;  4LF4 H;  2CV0 A;  3AL0 C;  4N4O B;  2JA2 A;  1BR1 A;  1N36 H;  3M1C A;  4BDY A;  3GDE A;  2WY8 Q;  2W4S A;  2IGN A;  3S32 A;  3VYR B;  4ZTJ A;  3OYG A;  2VPL A;  2OC6 A;  3BG6 A;  3L2W A;  1TA8 A;  1V5F A;  4APM A;  4MTD A;  2HHH H;  2KPM A;  2IS2 A;  2F5V A;  4CH7 A;  2UUC H;  4PJJ A;  4XKV A;  5HLT A;  1FMV A;  4BEH A;  3RQ4 A;  3H5R A;  2L9N A;  3OWT A;  4KIT B;  2PJR B;  1SAU A;  4ZC3 A;  2CW7 A;  2Q1Z B;  1FKA H;  4UCT A;  4IAJ A;  4JOM A;  2X1E A;  3OYI A;  4DR5 H;  1IBL H;  1TT0 A;  2FUG 2;  2OUM A;  3L2R A;  1OR7 C;  4CSW A;  1OLT A;  1Z2N X;  4DUZ H;  4E7Z A;  4DBQ A;  3HOT A;  2BW3 B;  4C2U A;  5DIS C;  1X19 A;  3VNN A;  4JI1 H;  3CP2 A;  2W82 A;  3VYT B;  4DOZ A;  4RB2 C;  4D9J A;  2ZSI B;  3TY5 A;  3TY9 A;  1IBK H;  2VJJ A;  4XLH A;  3LFU A;  5KCM A;  3MKW B;  3NC0 B;  3ZRG A;  4N4N B;  1Z2P X;  4GLX A;  2UXD H;  2BOL A;  4XLF A;  2A6T A;  2MFZ A;  3W1G A;  2UU9 H;  1HNZ H;  4CC6 A;  2FE3 A;  3EUA A;  1CKM A;  2VJ5 A;  3HOS A;  5HNH A;  5HVQ C;  2Q2E B;  3K4J A;  5A2Q W;  4BAC A;  4GKJ H;  3FDY A;  4ZYA A;  5LMN H;  1AA7 A;  3KXY T;  4XLA A;  1W36 C;  2HPM A;  4E7I A;  3DWL E;  3L2Q A;  3KAL A;  2XF5 A;  1N34 H;  4XR6 A;  1Z2O X;  1N33 H;  2E60 A;  3RTR A;  2K5C A;  5FPO A;  1FVI A;  3OTO H;  3NBY B;  4NC7 A;  4BE0 A;  2X85 A;  4B43 A;  2ZXI A;  2K9L A;  1WJB A;  1MZB A;  4DRF A;  2V1N A;  2L7K A;  4IX7 A;  1CKO A;  3DQV C;  4LG3 A;  1DQU A;  2VQF H;  5FRM A;  5CPR B;  2IXS A;  4BDZ A;  3K4C A;  1HA8 A;  1CKN B;  3PN1 A;  2MAB A;  3IAS 2;  4HST A;  3K4N A;  4C2T A;  2LY2 A;  3J7A K;  3K10 A;  4CC5 A;  4XKW A;  2W7N A;  4RM3 A;  4RMN A;  1O75 A;  1T95 A;  2RGR A;  4F55 A;  3OS0 A;  1ZEL A;  2P0W A;  2AQF A;  3D5S C;  3F9K A;  4EQ5 A;  1YX3 A;  3OYN A;  2HVS A;  3SEQ A;  3IG0 A;  4BJT A;  2R7S A;  4E6K G;  1MNE A;  3J80 W;  3K70 D;  3PNT A;  4ANJ A;  4E6N A;  1XMO H;  3KEY A;  3OR1 C;  2A5W A;  4MV7 A;  3TL4 X;  2VIX A;  3CVZ A;  4B3T H;  4F92 B;  4NUB A;  2VXD A;  3AL0 B;  1ERD A;  2XDV A;  3UQ8 A;  4DV5 H;  1U0J A;  1V5E A;  3FKJ A;  1EA3 A;  3OIQ A;  3C2H A;  4B3R H;  4F91 B;  1YE9 A;  2BVL A;  2LG4 A;  4JI0 H;  3DTK A;  3D5R C;  3CF2 A;  3K4L A;  4PDB A;  4HG2 A;  4UCU A;  3LSG A;  2KLO A;  3MMY B;  3CZ6 A;  3KX2 A;  3SYT A;  4CCL A;  3OYH A;  5D1P A;  3NWT A;  3PNY A;  2F4I A;  4A2B A;  2VLA A;  3EYY A;  1MND A;  4YEJ A;  1R6R A;  1Z3Y A;  2HVQ A;  2CV2 A;  4UFZ A;  4JI3 H;  1Z21 A;  2HDW A;  2Y0S A;  2JVH A;  2M3A A;  1NG6 A;  3H35 A;  4DBR A;  3HKZ A;  2ZSH B;  2KSW A;  1JI8 A;  4E7L A;  1BR2 A;  4UCV A;  4I7H A;  3DKX A;  1D1A A;  3CP8 A;  4NXN H;  2VB6 A;  4IQ4 A;  2XIG A;  1K6Y A;  1UEL B;  3QYE A;  5IT9 W;  2M4K A;  3IP4 B;  3OS1 A;  3L2P A;  4F3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...