2HVYC

Crystal structure of an h/aca box rnp from pyrococcus furiosus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
53
structure length
53
Chain Sequence
b'FRIRKCPKCGRYTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWKREVLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H/ACA RNA
publication title Crystal structure of an H/ACA box ribonucleoprotein particle
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/biosynthetic protein/rna
total genus 7
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04135 Nop10p Nucleolar RNA-binding protein, Nop10p family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.40 Mainly Beta Single Sheet Rubrerythrin, domain 2 H/ACA ribonucleoprotein complex, subunit Nop10 2hvyC00
3LWRB 3HJYB 3HJWB 2RFKB 2AUSB 3LWVB 3LWQB 2HVYC 2APOB 3LWOB 3MQKB 3LWPB 2AQCA 2EY4E 3HAXC
chains in the Genus database with same CATH superfamily
1FHMA 3PZAA 2C6AA 3P8BA 3KYYA 2Z3RB 4B8CD 5M3FL 5DM71 3HOVL 3VPBE 5GAGc 1P7PA 2KKDA 3HAXC 4QIWP 1VCXA 3H9BA 4C3HL 4AI2A 1VZIA 3S2HL 2M4YA 5MF6A 1IU6A 2ZIXA 3HKZP 3KYUA 2HR5A 1R0HA 4A3EL 4AR3A 2E2HL 3QQCE 1ODHA 1VZGA 4JAFA 2XJPA 4A3ML 3PO3L 1CAAA 3H3VM 4AHXA 4JAGA 2PVXA 2YU9L 4K9FA 3HOWL 3GTGL 4A3JL 3PIP1 5GAEc 3MSUA 4ZN1B 3LWRB 1RDGA 2VUML 1F4LA 1RB9A 2E2JL 2JA5L 5C3EL 3LNLA 3WWNB 3KYVA 5EIOC 4A3GL 5AI3A 5C4JL 4A3KL 3GTKL 1WJVA 2VL6A 2A6ED 1QYBA 1E8JA 1YUZA 2PPTA 3RZTA 1C09A 4TPUA 1DVBA 4E6YA 1T9OA 1CADA 5IYDL 3GTML 2RFKB 3PIO1 1YK5A 1QCVA 2R92L 4U671 3RZ6A 4AI3A 3HOXL 3J7Y1 1S2ZA 3WWLA 2PVEA 3HOYL 2PSMC 4LHLA 3LWPB 1TWCL 3RZDL 1I3QL 1S24A 1T9PA 1NXEA 2J9UB 1OWCA 2V3BB 4AI0A 5MGNA 5MLC3 2L0ZA 4WFN1 4LHNA 4A3CL 4BBRL 3HOUL 5GAHc 2XJQA 2B5ID 3PKIA 4UY81 3S2DL 4A3BL 1LTLA 4YWLA 1B13A 1RDVA 1PZXA 1LKPA 2ERSA 3MQKB 2KN9A 3KYXA 2R7ZL 2XJVA 1IU5A 1FHHA 6RXNA 2O5JD 7RXNA 3LWQB 5JVH1 3NFPI 4BY7L 2XJUA 1NXGA 2NVTL 1YV1A 1BFYA 5RXNA 3FKIL 1SMUA 2RDVA 1SFOL 3RZOL 1H7VA 8RXNA 4POGA 3S1ML 2WB1P 1B71A 5M5WL 2JI1A 1TWFL 1TWHL 1B2OA 1NNQA 3M4OL 2C6BA 2AUSB 1S30A 2E2IL 2APOB 3LWOB 5IP7L 2AQCA 2M6OA 5K2ME 3CQZL 3S17L 5IY0A 4A3LL 3I4NL 3PKJA 3LWVB 1PFYA 1Y1WL 1IRNA 1TWGL 4AHWA 3GTPL 4AHYA 3H0GL 3IU3I 1YUXA 5C44L 3P2AA 3ZG6A 5M5YL 2NVQL 4AR4A 5DM61 1DX8A 1PFVA 2Y0SP 4TVMA 1PFWA 4C3IL 3A44A 5AN9H 1QQTA 1SMWA 4RXNA 4POFA 1Y1VL 4BXXL 3B0AB 5IYCL 4JADA 2LCQA 4Y7NL 3S14L 4BBSL 4C2M1 2XJRA 2AYJA 3H99A 2NYDA 1R9TL 3S1RL 1R0JA 3J7Z1 1I50L 2XJTA 4YWMA 1OWBA 5IP9L 5IYBL 1TWAL 2QL0A 1T9QA 1Z92B 3I4ML 3KYWA 1RYTA 3B08B 4ME3A 1B2JA 3K7AL 4A3DL 2NVXL 2NVYL 3JR7A 5MFPA 1VZHA 3S1QL 2CKAA 4AHZA 4ZN3B 2R93L 2PYAA 1SMMA 4A3IL 2WAQP 4JAEA 3GTQL 3H9CA 1IROA 1R0FA 4AR5A 2JA6L 4AYBP 3RYGA 1R0GA 2PMZP 3M3YL 1R0IA 4XXBB 1JYBA 1YK4A 3HOZL 3S16L 2A68D 1BE7A 2ERJA 2HVYC 4BY1L 2JA8L 2CKCA 4V196 2A6HD 1BQ9A 2V0EA 2DSXA 1RWDA 4G6BA 5GADc 1PFUA 2B63L 2M6PA 1BRFA 3LPEB 5JVG1 1RYQA 1ZRPA 4XGHA 3GTJL 1IW7D 3GTLL 2BE5D 2M4VA 2A69D 4Y52L 3S15L 1K83L 5FJ8L 5C4XL 2Z3QB 5FLML 3PL5A 3PWFA 3FDJA 4X6AL 5M3ML 3S1NL 2K2DA 1BQ8A 5AI2A 2JI3A 2JA7L 3K35A 5M5XL 3MPSA 1I6HL 2XJSA 4AR6A 2EY4E 2CR8A 3HJYB 5MFZA 4AI1A 1LKMA 3SS2A 5H1Sc 4A3FL 3GTOL 2MS3A 3PO2L 2JI2A 3HJWB 2GMGA 2H12A 1LKOA 3QVDA 4GS7D 4A93L 1WCML 5EINC 2V0FA 4C3JL 3H97A
chains in the Genus database with same CATH topology
3LWRB 3HJYB 3HJWB 2RFKB 2AUSB 3LWVB 3LWQB 2HVYC 2APOB 3LWOB 3MQKB 3LWPB 2AQCA 2EY4E 3HAXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWR B;  3HJY B;  3HJW B;  2RFK B;  2AUS B;  3LWV B;  3LWQ B;  2HVY C;  2APO B;  3LWO B;  3MQK B;  3LWP B;  2AQC A;  2EY4 E;  3HAX C; 
#chains in the Genus database with same CATH topology
 1FHM A;  3PZA A;  2C6A A;  3P8B A;  3KYY A;  2Z3R B;  4B8C D;  5M3F L;  5DM7 1;  3HOV L;  3VPB E;  5GAG c;  1P7P A;  2KKD A;  3HAX C;  4QIW P;  1VCX A;  3H9B A;  4C3H L;  4AI2 A;  1VZI A;  3S2H L;  2M4Y A;  5MF6 A;  1IU6 A;  2ZIX A;  3HKZ P;  3KYU A;  2HR5 A;  1R0H A;  4A3E L;  4AR3 A;  2E2H L;  3QQC E;  1ODH A;  1VZG A;  4JAF A;  2XJP A;  4A3M L;  3PO3 L;  1CAA A;  3H3V M;  4AHX A;  4JAG A;  2PVX A;  2YU9 L;  4K9F A;  3HOW L;  3GTG L;  4A3J L;  3PIP 1;  5GAE c;  3MSU A;  4ZN1 B;  3LWR B;  1RDG A;  2VUM L;  1F4L A;  1RB9 A;  2E2J L;  2JA5 L;  5C3E L;  3LNL A;  3WWN B;  3KYV A;  5EIO C;  4A3G L;  5AI3 A;  5C4J L;  4A3K L;  3GTK L;  1WJV A;  2VL6 A;  2A6E D;  1QYB A;  1E8J A;  1YUZ A;  2PPT A;  3RZT A;  1C09 A;  4TPU A;  1DVB A;  4E6Y A;  1T9O A;  1CAD A;  5IYD L;  3GTM L;  2RFK B;  3PIO 1;  1YK5 A;  1QCV A;  2R92 L;  4U67 1;  3RZ6 A;  4AI3 A;  3HOX L;  3J7Y 1;  1S2Z A;  3WWL A;  2PVE A;  3HOY L;  2PSM C;  4LHL A;  3LWP B;  1TWC L;  3RZD L;  1I3Q L;  1S24 A;  1T9P A;  1NXE A;  2J9U B;  1OWC A;  2V3B B;  4AI0 A;  5MGN A;  5MLC 3;  2L0Z A;  4WFN 1;  4LHN A;  4A3C L;  4BBR L;  3HOU L;  5GAH c;  2XJQ A;  2B5I D;  3PKI A;  4UY8 1;  3S2D L;  4A3B L;  1LTL A;  4YWL A;  1B13 A;  1RDV A;  1PZX A;  1LKP A;  2ERS A;  3MQK B;  2KN9 A;  3KYX A;  2R7Z L;  2XJV A;  1IU5 A;  1FHH A;  6RXN A;  2O5J D;  7RXN A;  3LWQ B;  5JVH 1;  3NFP I;  4BY7 L;  2XJU A;  1NXG A;  2NVT L;  1YV1 A;  1BFY A;  5RXN A;  3FKI L;  1SMU A;  2RDV A;  1SFO L;  3RZO L;  1H7V A;  8RXN A;  4POG A;  3S1M L;  2WB1 P;  1B71 A;  5M5W L;  2JI1 A;  1TWF L;  1TWH L;  1B2O A;  1NNQ A;  3M4O L;  2C6B A;  2AUS B;  1S30 A;  2E2I L;  2APO B;  3LWO B;  5IP7 L;  2AQC A;  2M6O A;  5K2M E;  3CQZ L;  3S17 L;  5IY0 A;  4A3L L;  3I4N L;  3PKJ A;  3LWV B;  1PFY A;  1Y1W L;  1IRN A;  1TWG L;  4AHW A;  3GTP L;  4AHY A;  3H0G L;  3IU3 I;  1YUX A;  5C44 L;  3P2A A;  3ZG6 A;  5M5Y L;  2NVQ L;  4AR4 A;  5DM6 1;  1DX8 A;  1PFV A;  2Y0S P;  4TVM A;  1PFW A;  4C3I L;  3A44 A;  5AN9 H;  1QQT A;  1SMW A;  4RXN A;  4POF A;  1Y1V L;  4BXX L;  3B0A B;  5IYC L;  4JAD A;  2LCQ A;  4Y7N L;  3S14 L;  4BBS L;  4C2M 1;  2XJR A;  2AYJ A;  3H99 A;  2NYD A;  1R9T L;  3S1R L;  1R0J A;  3J7Z 1;  1I50 L;  2XJT A;  4YWM A;  1OWB A;  5IP9 L;  5IYB L;  1TWA L;  2QL0 A;  1T9Q A;  1Z92 B;  3I4M L;  3KYW A;  1RYT A;  3B08 B;  4ME3 A;  1B2J A;  3K7A L;  4A3D L;  2NVX L;  2NVY L;  3JR7 A;  5MFP A;  1VZH A;  3S1Q L;  2CKA A;  4AHZ A;  4ZN3 B;  2R93 L;  2PYA A;  1SMM A;  4A3I L;  2WAQ P;  4JAE A;  3GTQ L;  3H9C A;  1IRO A;  1R0F A;  4AR5 A;  2JA6 L;  4AYB P;  3RYG A;  1R0G A;  2PMZ P;  3M3Y L;  1R0I A;  4XXB B;  1JYB A;  1YK4 A;  3HOZ L;  3S16 L;  2A68 D;  1BE7 A;  2ERJ A;  2HVY C;  4BY1 L;  2JA8 L;  2CKC A;  4V19 6;  2A6H D;  1BQ9 A;  2V0E A;  2DSX A;  1RWD A;  4G6B A;  5GAD c;  1PFU A;  2B63 L;  2M6P A;  1BRF A;  3LPE B;  5JVG 1;  1RYQ A;  1ZRP A;  4XGH A;  3GTJ L;  1IW7 D;  3GTL L;  2BE5 D;  2M4V A;  2A69 D;  4Y52 L;  3S15 L;  1K83 L;  5FJ8 L;  5C4X L;  2Z3Q B;  5FLM L;  3PL5 A;  3PWF A;  3FDJ A;  4X6A L;  5M3M L;  3S1N L;  2K2D A;  1BQ8 A;  5AI2 A;  2JI3 A;  2JA7 L;  3K35 A;  5M5X L;  3MPS A;  1I6H L;  2XJS A;  4AR6 A;  2EY4 E;  2CR8 A;  3HJY B;  5MFZ A;  4AI1 A;  1LKM A;  3SS2 A;  5H1S c;  4A3F L;  3GTO L;  2MS3 A;  3PO2 L;  2JI2 A;  3HJW B;  2GMG A;  2H12 A;  1LKO A;  3QVD A;  4GS7 D;  4A93 L;  1WCM L;  5EIN C;  2V0F A;  4C3J L;  3H97 A; 
#chains in the Genus database with same CATH homology
 3LWR B;  3HJY B;  3HJW B;  2RFK B;  2AUS B;  3LWV B;  3LWQ B;  2HVY C;  2APO B;  3LWO B;  3MQK B;  3LWP B;  2AQC A;  2EY4 E;  3HAX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...