2HVYC

Crystal structure of an h/aca box rnp from pyrococcus furiosus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
53
structure length
53
Chain Sequence
FRIRKCPKCGRYTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWKREVLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H/ACA RNA
publication title Crystal structure of an H/ACA box ribonucleoprotein particle
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/biosynthetic protein/rna
total genus 7
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04135 Nop10p Nucleolar RNA-binding protein, Nop10p family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.40 Mainly Beta Single Sheet Rubrerythrin, domain 2 H/ACA ribonucleoprotein complex, subunit Nop10 2hvyC00
3LWOB 3LWVB 2AQCA 3HJWB 3HJYB 3LWQB 2HVYC 3LWPB 3HAXC 3MQKB 2AUSB 2APOB 2RFKB 3LWRB 2EY4E
chains in the Genus database with same CATH superfamily
1E8JA 2RDVA 1YUZA 4LHNA 3CQZL 1ZRPA 1RYQA 4B8CD 2WAQP 5GADc 1NNQA 4K9FA 1SFOL 3H0GL 4UY81 5MGNA 2RFKB 3S1RL 3HOXL 1RDGA 3I4NL 5JVH1 4V196 2L0ZA 3K35A 3HOUL 2VL6A 4LHLA 2JA7L 4A3EL 1R0GA 6RXNA 2PYAA 4A3CL 4A3GL 3J7Z1 2NYDA 5MFZA 3LPEB 2VUML 1B2OA 2HVYC 2NVQL 5FJ8L 2A69D 3QQCE 3JR7A 1IU6A 4TPUA 4A3ML 2XJVA 2V0FA 3PIO1 3LNLA 1YV1A 3HAXC 2GMGA 4C3HL 4AHXA 5H1Sc 5EINC 2Z3RB 2MS3A 4C3IL 2NVTL 3H9CA 2ERSA 4BY7L 3HOYL 1C09A 1SMWA 1IW7D 1R0HA 2JI3A 5RXNA 2ZIXA 3PO2L 2M6OA 3HOZL 4YWLA 1DX8A 4AR3A 1PFUA 3RZOL 3K7AL 1R0JA 3LWVB 2R92L 4C2M1 2JI1A 4A3IL 3ZG6A 4ZN1B 3RZDL 2PMZP 5IYBL 4C3JL 4Y52L 2J9UB 5IYDL 4POFA 2Y0SP 5AI2A 3PWFA 4A3FL 2K2DA 1LTLA 2DSXA 1RYTA 1YUXA 1Z92B 3GTPL 3MPSA 1BFYA 2AQCA 1BQ8A 3KYVA 2B63L 3VPBE 8RXNA 3PO3L 3LWRB 1I3QL 4TVMA 3I4ML 1LKPA 1DVBA 1SMUA 3FKIL 3NFPI 4BBSL 2H12A 4AR4A 2PSMC 4U671 3S1NL 2JA5L 1VZIA 1NXEA 1BRFA 4Y7NL 3GTLL 1YK4A 4JADA 4RXNA 3RZTA 4JAGA 3S2DL 2KKDA 3PL5A 1B13A 3KYWA 1RB9A 4WFN1 2HR5A 1OWCA 3S2HL 4A93L 4A3KL 1TWGL 1TWCL 4AHZA 2Z3QB 3B0AB 1QQTA 3MSUA 1QYBA 3GTGL 1R0IA 4JAEA 1LKMA 1IRNA 3WWNB 4A3LL 2CKAA 2KN9A 3S16L 2R7ZL 3SS2A 5IYCL 1TWAL 4BBRL 2CKCA 4AI1A 5DM71 1VZHA 2A6HD 3J7Y1 2B5ID 3PKIA 2E2JL 2E2HL 5FLML 4BY1L 1Y1WL 2JA8L 4AR6A 1R9TL 1S30A 3PZAA 2APOB 2YU9L 4AI0A 1S24A 5C44L 3HJWB 7RXNA 3P8BA 4QIWP 2EY4E 2M4VA 5DM61 2C6BA 1PFVA 5AI3A 1RWDA 5M5XL 4A3BL 5M5WL 1BQ9A 1K83L 4JAFA 3PKJA 4A3DL 1H7VA 3S1ML 5K2ME 3LWPB 1I6HL 3S15L 1T9QA 2E2IL 3WWLA 3LWQB 5MF6A 5GAHc 1R0FA 4A3JL 2PPTA 4ZN3B 3S1QL 1IU5A 2XJPA 4ME3A 1Y1VL 3GTOL 3KYUA 4AHWA 4AI2A 1F4LA 4YWMA 1JYBA 5EIOC 1PFWA 2A6ED 3IU3I 1T9OA 1PZXA 1T9PA 4G6BA 2V3BB 2NVYL 5C3EL 3H3VM 3HJYB 5M3ML 3KYXA 1PFYA 4X6AL 2XJTA 3MQKB 2JA6L 1FHHA 1SMMA 5JVG1 3RYGA 2AUSB 2NVXL 4BXXL 2R93L 4XXBB 4AR5A 5M3FL 3A44A 2XJSA 4AHYA 4E6YA 1OWBA 2BE5D 2LCQA 1I50L 3B08B 5IY0A 3H9BA 2JI2A 1WJVA 2C6AA 2XJRA 4POGA 3S17L 3PIP1 5MLC3 5MFPA 3HKZP 3LWOB 4GS7D 2XJQA 5C4JL 3GTKL 3GTML 2M4YA 2WB1P 3GTJL 1WCML 2PVXA 5IP9L 1CADA 3S14L 5M5YL 5AN9H 1B2JA 3H99A 3QVDA 5C4XL 1TWFL 1TWHL 2PVEA 2QL0A 1FHMA 2XJUA 3RZ6A 2ERJA 4XGHA 2A68D 1NXGA 1RDVA 2V0EA 1BE7A 2CR8A 5GAGc 3P2AA 3FDJA 3HOVL 1IROA 1B71A 2O5JD 1QCVA 1VZGA 3M3YL 3M4OL 1S2ZA 3H97A 4AYBP 2AYJA 5GAEc 3KYYA 1VCXA 1ODHA 5IP7L 1YK5A 3HOWL 2M6PA 1LKOA 4AI3A 1P7PA 3GTQL 1CAAA
chains in the Genus database with same CATH topology
3LWOB 3LWVB 2AQCA 3HJWB 3HJYB 3LWQB 2HVYC 3LWPB 3HAXC 3MQKB 2AUSB 2APOB 2RFKB 3LWRB 2EY4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWO B;  3LWV B;  2AQC A;  3HJW B;  3HJY B;  3LWQ B;  2HVY C;  3LWP B;  3HAX C;  3MQK B;  2AUS B;  2APO B;  2RFK B;  3LWR B;  2EY4 E; 
#chains in the Genus database with same CATH topology
 1E8J A;  2RDV A;  1YUZ A;  4LHN A;  3CQZ L;  1ZRP A;  1RYQ A;  4B8C D;  2WAQ P;  5GAD c;  1NNQ A;  4K9F A;  1SFO L;  3H0G L;  4UY8 1;  5MGN A;  2RFK B;  3S1R L;  3HOX L;  1RDG A;  3I4N L;  5JVH 1;  4V19 6;  2L0Z A;  3K35 A;  3HOU L;  2VL6 A;  4LHL A;  2JA7 L;  4A3E L;  1R0G A;  6RXN A;  2PYA A;  4A3C L;  4A3G L;  3J7Z 1;  2NYD A;  5MFZ A;  3LPE B;  2VUM L;  1B2O A;  2HVY C;  2NVQ L;  5FJ8 L;  2A69 D;  3QQC E;  3JR7 A;  1IU6 A;  4TPU A;  4A3M L;  2XJV A;  2V0F A;  3PIO 1;  3LNL A;  1YV1 A;  3HAX C;  2GMG A;  4C3H L;  4AHX A;  5H1S c;  5EIN C;  2Z3R B;  2MS3 A;  4C3I L;  2NVT L;  3H9C A;  2ERS A;  4BY7 L;  3HOY L;  1C09 A;  1SMW A;  1IW7 D;  1R0H A;  2JI3 A;  5RXN A;  2ZIX A;  3PO2 L;  2M6O A;  3HOZ L;  4YWL A;  1DX8 A;  4AR3 A;  1PFU A;  3RZO L;  3K7A L;  1R0J A;  3LWV B;  2R92 L;  4C2M 1;  2JI1 A;  4A3I L;  3ZG6 A;  4ZN1 B;  3RZD L;  2PMZ P;  5IYB L;  4C3J L;  4Y52 L;  2J9U B;  5IYD L;  4POF A;  2Y0S P;  5AI2 A;  3PWF A;  4A3F L;  2K2D A;  1LTL A;  2DSX A;  1RYT A;  1YUX A;  1Z92 B;  3GTP L;  3MPS A;  1BFY A;  2AQC A;  1BQ8 A;  3KYV A;  2B63 L;  3VPB E;  8RXN A;  3PO3 L;  3LWR B;  1I3Q L;  4TVM A;  3I4M L;  1LKP A;  1DVB A;  1SMU A;  3FKI L;  3NFP I;  4BBS L;  2H12 A;  4AR4 A;  2PSM C;  4U67 1;  3S1N L;  2JA5 L;  1VZI A;  1NXE A;  1BRF A;  4Y7N L;  3GTL L;  1YK4 A;  4JAD A;  4RXN A;  3RZT A;  4JAG A;  3S2D L;  2KKD A;  3PL5 A;  1B13 A;  3KYW A;  1RB9 A;  4WFN 1;  2HR5 A;  1OWC A;  3S2H L;  4A93 L;  4A3K L;  1TWG L;  1TWC L;  4AHZ A;  2Z3Q B;  3B0A B;  1QQT A;  3MSU A;  1QYB A;  3GTG L;  1R0I A;  4JAE A;  1LKM A;  1IRN A;  3WWN B;  4A3L L;  2CKA A;  2KN9 A;  3S16 L;  2R7Z L;  3SS2 A;  5IYC L;  1TWA L;  4BBR L;  2CKC A;  4AI1 A;  5DM7 1;  1VZH A;  2A6H D;  3J7Y 1;  2B5I D;  3PKI A;  2E2J L;  2E2H L;  5FLM L;  4BY1 L;  1Y1W L;  2JA8 L;  4AR6 A;  1R9T L;  1S30 A;  3PZA A;  2APO B;  2YU9 L;  4AI0 A;  1S24 A;  5C44 L;  3HJW B;  7RXN A;  3P8B A;  4QIW P;  2EY4 E;  2M4V A;  5DM6 1;  2C6B A;  1PFV A;  5AI3 A;  1RWD A;  5M5X L;  4A3B L;  5M5W L;  1BQ9 A;  1K83 L;  4JAF A;  3PKJ A;  4A3D L;  1H7V A;  3S1M L;  5K2M E;  3LWP B;  1I6H L;  3S15 L;  1T9Q A;  2E2I L;  3WWL A;  3LWQ B;  5MF6 A;  5GAH c;  1R0F A;  4A3J L;  2PPT A;  4ZN3 B;  3S1Q L;  1IU5 A;  2XJP A;  4ME3 A;  1Y1V L;  3GTO L;  3KYU A;  4AHW A;  4AI2 A;  1F4L A;  4YWM A;  1JYB A;  5EIO C;  1PFW A;  2A6E D;  3IU3 I;  1T9O A;  1PZX A;  1T9P A;  4G6B A;  2V3B B;  2NVY L;  5C3E L;  3H3V M;  3HJY B;  5M3M L;  3KYX A;  1PFY A;  4X6A L;  2XJT A;  3MQK B;  2JA6 L;  1FHH A;  1SMM A;  5JVG 1;  3RYG A;  2AUS B;  2NVX L;  4BXX L;  2R93 L;  4XXB B;  4AR5 A;  5M3F L;  3A44 A;  2XJS A;  4AHY A;  4E6Y A;  1OWB A;  2BE5 D;  2LCQ A;  1I50 L;  3B08 B;  5IY0 A;  3H9B A;  2JI2 A;  1WJV A;  2C6A A;  2XJR A;  4POG A;  3S17 L;  3PIP 1;  5MLC 3;  5MFP A;  3HKZ P;  3LWO B;  4GS7 D;  2XJQ A;  5C4J L;  3GTK L;  3GTM L;  2M4Y A;  2WB1 P;  3GTJ L;  1WCM L;  2PVX A;  5IP9 L;  1CAD A;  3S14 L;  5M5Y L;  5AN9 H;  1B2J A;  3H99 A;  3QVD A;  5C4X L;  1TWF L;  1TWH L;  2PVE A;  2QL0 A;  1FHM A;  2XJU A;  3RZ6 A;  2ERJ A;  4XGH A;  2A68 D;  1NXG A;  1RDV A;  2V0E A;  1BE7 A;  2CR8 A;  5GAG c;  3P2A A;  3FDJ A;  3HOV L;  1IRO A;  1B71 A;  2O5J D;  1QCV A;  1VZG A;  3M3Y L;  3M4O L;  1S2Z A;  3H97 A;  4AYB P;  2AYJ A;  5GAE c;  3KYY A;  1VCX A;  1ODH A;  5IP7 L;  1YK5 A;  3HOW L;  2M6P A;  1LKO A;  4AI3 A;  1P7P A;  3GTQ L;  1CAA A; 
#chains in the Genus database with same CATH homology
 3LWO B;  3LWV B;  2AQC A;  3HJW B;  3HJY B;  3LWQ B;  2HVY C;  3LWP B;  3HAX C;  3MQK B;  2AUS B;  2APO B;  2RFK B;  3LWR B;  2EY4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...