2HVYD

Crystal structure of an h/aca box rnp from pyrococcus furiosus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an H/ACA box ribonucleoprotein particle
pubmed doi rcsb
molecule keywords H/ACA RNA
molecule tags Isomerase/biosynthetic protein/rna
source organism Pyrococcus furiosus
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2hvyD00
3CMAF 1X52A 5GIPC 1VQ7F 2KTVA 1X7OA 2VGMA 1YITF 5A2QM 3CCQF 1RLGA 2VGNA 1VQ4F 3G6EF 2OTJF 1VQNF 4BY9D 5GANK 2QA4F 1YI2F 1SDSA 3V7QA 1QVFF 2KTUA 3SIVA 1N8RH 1GO1A 3NMUC 3NVKE 1K9MH 2AIFA 3IR9A 2OHWA 3CCVF 1CN7A 2JNBA 2ALEA 1VQOF 3AGKA 3V7EA 1Q7YH 3RA5A 3GYQA 1RA4A 1KD1H 3PAFA 3N4ZA 1VQ8F 5G4UC 3ON1A 3E1YA 1K8AH 1JJ2F 3CCLF 3I55F 3OBWA 2LBWA 1Q82H 3CC4F 3HAXD 3CCMF 3NVIB 5DCVA 3LWQC 3CMEF 3LWPC 1X7PA 3I56F 1W40A 5FJ4C 1NMUB 3G4SF 1S72F 2OZBA 1H7MA 1GZ0A 1KQSF 1W2BF 4NUTA 2QI2A 1VQMF 1ZWZA 1YJNF 3CD6F 1W42A 3VMFB 1Q86H 3J80M 3CXCF 1VQLF 3OW2F 1VQ6F 3OBYA 1IPAA 2I6DA 1M90H 3HJWC 1QVGF 1VQPF 1W41A 3O85A 5FLXM 3LFOA 4X3MA 4BW0B 1Q81H 2KG4A 1K73H 5G4VC 2BO1A 3CCUF 3MCAB 3LWRC 3FFMA 4X3LA 2OTLF 3LWOC 3CCEF 1YJ9F 3CC2F 3G71F 1XBIA 2QEXF 1YIJF 1M1KH 3LWVC 4TZZA 3NK7A 3CCSF 1T0KB 2LBXA 3CCJF 5EWRA 1KC8H 3CG6A 3N4YA 3J7AR 1YHQF 1YJWF 1VQ9F 3CC7F 4C4WC 1PXWA 1NJIH 3NK6A 5GINC 3CPQA 3CCRF 1VQKF 2HVYD 5GAPK 5EO3A 3JAMM 3CPWF 3RA6A 1E7KA 1VQ5F 4LCKA 5IT9M 2CZWA 1GO0A 3PLAC 3JCMM 1CK2A 3VI6A 3J81M 3WXMB 2FC3A 3E20B 1DT9A 2WALA 3SIUA 5GIOC 1W3EX
chains in the Genus database with same CATH superfamily
4HNAA 2G9IA 4B45A 4ZHQA 4X20A 4IIJB 2KTVA 3MQWA 1X7OA 3T80A 2HQSC 3WGJA 3RYIB 4ZOLA 3S02A 4IHJB 4O2BA 5GIOC 1T0AA 1VQ4F 5CB4A 5LP6B 2QA4F 3HTNA 4O4HA 1YI2F 4HNAB 4X1YB 3E22B 3N2GA 4X20B 2KTUA 3RYFA 1YQNA 4ZI7A 4ZOLB 1IV2A 2HS0A 3LYBA 3FPIA 3IR9A 3JAKB 1CN7A 4PWTA 1H48A 1KNKA 1SA0B 4TV9A 1YGYA 2CWJA 3GYQA 3KJKA 2Q1XA 1RA4A 4G4VA 4C8EA 3N4ZA 3JAWB 3RYCB 3Q8HA 3I55F 3F6MA 3HAXD 5LYJB 4EI8A 4O4JA 5J2UA 3LWQC 3CMEF 3WJPA 3RYHB 1W40A 2ZOVA 3JALB 4I50B 3I7TA 1KQSF 1GX1A 4YJ3A 2CSLA 3RE3A 4BT4A 3VMFB 4FFBA 5IJ9A 2ZVYA 2DYYA 3OW2F 2HX0A 5ITZB 5JH7A 4TV8A 3HKEA 3F0EA 5HXZA 3LFOA 1TUBB 5G4VC 5LOVB 2BO1A 5EAZA 2UYNB 2Z1TA 4X3LA 3JASB 3CCEF 5FNVA 4F6RA 3HKEB 3M1XA 2PMPA 2RB9A 4B46A 2GZLA 5CA0B 3LWVC 4EI9A 3LMEA 2IAFA 5AVMA 1W581 1DBFA 3CG6A 1Z5VA 2Z01A 3N2KA 5MN5A 3K0TA 3JATB 3CYQA 5GAPK 1E7KA 2H8CA 5CA1B 2Q1YA 2RHLA 3HKBB 4LNUB 1CK2A 5MN6A 3QHDA 3UT5B 3FBAA 3N2KB 2R751 4TUYA 3S06A 5BMVB 2ZAUA 1DT9A 2YYEA 4G88A 4WBNA 3SIUA 5IJ0A 5KMGA 3CYPB 1JN1A 2ZODA 1VQ7F 1TVKB 3VO8A 2VGMA 3V4DA 1KNJA 3P4EA 4RQOA 4U3JB 2Z1UA 5EZYA 3VOAA 3VIUA 4EI7A 1XV2A 1FFXA 5KMGB 3IEQA 4IIJA 1VH8A 3EORA 3RYIA 1GO1A 3NMUC 4IHJA 5JCOA 2UYPA 4B5CA 4I4TB 3C9SA 2GVIA 5EZYB 2HS4A 2B33A 4O4IB 3GTZA 1H47A 2P6YA 4X1YA 3E22A 3K14A 3WPXA 4BT6A 5J2TB 1RQ7A 5EIBD 2HP0A 2AMTA 5B8FA 4ZHVA 3ON1A 1JJ2F 3C9TA 3CCLF 3JAKA 3OBWA 2LBWA 3CC4F 4G4YA 1SA0A 3CCMF 3NVIB 2GLZA 4BVSA 1X7PA 5HWEA 4BVQA 5FJ4C 4G4XA 1NMUB 2HP0B 1H7MA 3JAWA 3RYCA 1J7HA 4NUTA 1YJNF 1ZWZA 5IYZB 3CD6F 3KHNA 5LYJA 5C8YB 5JVDA 3KJJA 5LA6B 3VYUC 3VYSC 3ZP4A 3RYHA 1IPAA 1M90H 4M8IA 1Z5WA 2HRUA 1QVGF 2RHHA 3JALA 3HWUA 4I50A 3FD5A 1W41A 4ZK7A 2BTOA 2HRYA 5FLXM 3V3TA 1QU9A 5JVDB 2KG4A 2BTUA 3I3FA 3K12A 2UYKA 5ITZA 1W55A 3TD3A 4ZHYB 1YIJF 1M1KH 2Z1EA 4TZZA 3ELCA 1TUBA 1QD9A 3N4YA 5LOVA 3KIZA 2UYNA 1VQ9F 3CC7F 1PXWA 5HY0A 3D00A 3HKCB 3JASA 1XHOA 5CA0A 3CCRF 1W57A 5EO3A 4DRXA 4B62A 4LCKA 5IT9M 2CZWA 3WJQA 3PLAC 2Z1FA 3J81M 3F0DA 4NQ3A 5EB1B 4ERHA 2DT4A 2VAMA 1X52A 3JATA 4ZHWA 3M84A 4DRXB 1YITF 1W59A 5CA1A 5A2QM 3CCQF 1NQ3A 3HKBA 3DC2A 4LNUA 3KE1A 3BYQA 3UT5A 2VGNA 2VAWA 2PHNA 5LP6C 5KX5B 3G6EF 2OTJF 1VQNF 5LXTB 5BMVA 3VCZA 1JFFA 4NWOB 2KGWA 1TVKA 3L7QA 3SIVA 1Q8RA 4I55B 3NVKE 4U3JA 1K9MH 1VHAA 3CCVF 1UI9A 5HP7A 3C8LA 2JNBA 2ALEA 1JFFB 4E6EA 1VQOF 3WGLA 3V7EA 1Q7YH 4EB6B 3RA5A 2ZVZA 3HKDA 1VQ8F 3S03A 5EIBC 4I4TA 1Q82H 2I6RA 4O4IA 5EB0A 5DCVA 2OTMA 3LWPC 2V9YA 5J2TA 3I56F 3JARB 3HKDB 3G4SF 2MQEA 1X25A 1FSZA 3IKFA 4RHAA 2QI2A 3VYTC 1VQMF 2LCAA 3D01A 5HY2A 5EYPB 1VQ6F 2FGYA 2H6LA 3TD5A 5HY4A 3QTYA 3S0HA 3CB2A 2VXYA 1W5BA 5IYZA 4BW0B 1Q81H 5C8YA 3LDTA 4BT5A 4BT2A 5LA6A 3MCAB 3LWRC 5JQGB 2OTLF 3F0GA 3CC2F 3G71F 1XBIA 4X1KB 3TD4A 2QEXF 3NK7A 5GONB 1ODEA 3CCSF 2LBXA 1JY8A 5HY1A 4O4LB 3WJRA 1KC8H 2AIZP 3VOBA 4R40B 3J7AR 5HXUA 1U3LA 3WGNA 1YHQF 3ERNA 3ZOPA 1JD1A 4C4WC 1OAPA 3P10A 4BT7A 3NK6A 5GINC 1VK3A 2IG8A 3CPQA 3B6NA 4G4ZA 2LBTA 4ZHQB 2HVYD 3JAMM 3CPWF 4U39A 4O2BB 2RHOA 3IMPA 3HKCA 5CB4B 3U0OA 3WXMB 3MDOA 3E20B 2FC3A 2WALA 1VQ5F 2EWCA 1W3EX 4O4HB 2W8BC 3CMAF 3N2GB 3FD6A 5GIPC 2YXZA 3RYFB 3MCQA 3C9RA 4ZI7B 1RLGA 4X1IA 1RLUA 4DXDA 3QUWA 1UFYA 4BVRA 4BY9D 1ONIA 1SZQA 1RQ2A 2HS3A 2K1SA 5GANK 1SDSA 4TV9B 3V7QA 1QVFF 1QAHA 1FNJA 1N8RH 3K2XA 4X1IB 2AIFA 2OHWA 3M4SA 5KX5A 3WGKA 3ESJA 4XCQA 1IV3A 5LXTA 4YJ2A 1U3PA 3VTIC 4C8GA 5J2UB 3AGKA 4O4JB 2HP3A 2L26A 2QTPA 5JCOC 1W5AA 1KD1H 3PAFA 4I55A 4C82A 5G4UC 3E1YA 1K8AH 1FNKA 4YJ3B 4FFBB 4YJ2B 3ZP7A 5IJ9B 3IKEA 2CW4A 2VAPA 4EB6A 3WPWA 3OONA 2N48A 5JH7B 4G4WA 3GHZA 4TV8B 5MN4A 1S72F 2OZBA 4BT3A 1GZ0A 4KWEA 1W2BF 2UYJA 1W42A 1Q86H 3J80M 3CXCF 1VQLF 3ZO8A 3OBYA 2I6DA 2CHSA 2UZHA 1CLIA 3JARA 1R1MA 5FNVB 3HJWC 3MBMA 1IV4A 4F6RB 1VQPF 3S0WA 3O85A 4C81A 4X3MA 1U43A 4C8IA 1OFUA 1K73H 5EYPA 2NMUA 1XRGA 3CCUF 1PF5A 3FFMA 3F0FA 2CVLA 1W5FA 3LWOC 1YJ9F 1VQVA 1T0KB 2ZF8A 2BTQB 3CCJF 5EWRA 2IQQA 3D54A 1YJWF 4O2AA 3JVHA 5JQGA 1NJIH 4TUYB 3IEWA 4X1KA 3S0YA 4WBNB 1W5EA 5IJ0B 3WGMA 4BVTA 5GONA 1VQKF 3C9UA 1U40A 4O4LA 3RA6A 3DDNA 1GO0A 3JCMM 3VI6A 4O2AB 2CHTA 3P0ZA 2H8EA 3R0PA 5HP8A 2R6R1 2RHJA 1IV1A 5LP6A 1COMA 2F9ZC 1FFXB
chains in the Genus database with same CATH topology
3CMAF 1X52A 5GIPC 1VQ7F 2KTVA 1X7OA 2VGMA 1YITF 5A2QM 3CCQF 1RLGA 2VGNA 1VQ4F 3G6EF 2OTJF 4BVRA 1VQNF 4BY9D 5GANK 2QA4F 4EI7A 1YI2F 1SDSA 3V7QA 1QVFF 2KTUA 3SIVA 1W3EX 1N8RH 1GO1A 3NMUC 3NVKE 1K9MH 2AIFA 3IR9A 2OHWA 3CCVF 4XCQA 1CN7A 2JNBA 2ALEA 1VQOF 3AGKA 3V7EA 1Q7YH 3RA5A 3GYQA 1RA4A 1KD1H 3PAFA 3N4ZA 1VQ8F 5G4UC 3ON1A 3E1YA 1K8AH 1JJ2F 3CCLF 3I55F 3OBWA 2LBWA 1Q82H 3CC4F 3HAXD 4EI8A 3CCMF 3NVIB 5DCVA 2GLZA 3LWQC 4BVSA 3CMEF 3LWPC 1X7PA 3I56F 5HWEA 4BVQA 1W40A 5FJ4C 1NMUB 3G4SF 1S72F 2OZBA 1H7MA 1GZ0A 1KQSF 1W2BF 4NUTA 2QI2A 1VQMF 1ZWZA 1YJNF 3CD6F 1W42A 3VMFB 1Q86H 3J80M 5HY2A 3CXCF 1VQLF 3OW2F 1VQ6F 3OBYA 2FGYA 1IPAA 2I6DA 1M90H 5HY4A 3HJWC 1QVGF 1VQPF 1W41A 3O85A 5FLXM 5HXZA 3LFOA 4X3MA 3V3TA 4BW0B 1Q81H 2KG4A 1K73H 5G4VC 2BO1A 3CCUF 3MCAB 3LWRC 3FFMA 4X3LA 2OTLF 3LWOC 3CCEF 1YJ9F 3CC2F 3G71F 1XBIA 2QEXF 1YIJF 1M1KH 3LWVC 4TZZA 4EI9A 3NK7A 3CCSF 1T0KB 2LBXA 5HY1A 3CCJF 5EWRA 1KC8H 3CG6A 3N4YA 3J7AR 5HXUA 1YHQF 1YJWF 1VQ9F 3CC7F 4C4WC 1PXWA 5HY0A 3D00A 1NJIH 3NK6A 5GINC 3CPQA 3CCRF 4BVTA 1VQKF 2HVYD 5GAPK 5EO3A 3JAMM 3CPWF 3RA6A 1E7KA 1VQ5F 4LCKA 5IT9M 2CZWA 1GO0A 3PLAC 3JCMM 1CK2A 3VI6A 3J81M 4NQ3A 3WXMB 2FC3A 3E20B 1DT9A 2WALA 3SIUA 5GIOC 2F9ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA F;  1X52 A;  5GIP C;  1VQ7 F;  2KTV A;  1X7O A;  2VGM A;  1YIT F;  5A2Q M;  3CCQ F;  1RLG A;  2VGN A;  1VQ4 F;  3G6E F;  2OTJ F;  1VQN F;  4BY9 D;  5GAN K;  2QA4 F;  1YI2 F;  1SDS A;  3V7Q A;  1QVF F;  2KTU A;  3SIV A;  1N8R H;  1GO1 A;  3NMU C;  3NVK E;  1K9M H;  2AIF A;  3IR9 A;  2OHW A;  3CCV F;  1CN7 A;  2JNB A;  2ALE A;  1VQO F;  3AGK A;  3V7E A;  1Q7Y H;  3RA5 A;  3GYQ A;  1RA4 A;  1KD1 H;  3PAF A;  3N4Z A;  1VQ8 F;  5G4U C;  3ON1 A;  3E1Y A;  1K8A H;  1JJ2 F;  3CCL F;  3I55 F;  3OBW A;  2LBW A;  1Q82 H;  3CC4 F;  3HAX D;  3CCM F;  3NVI B;  5DCV A;  3LWQ C;  3CME F;  3LWP C;  1X7P A;  3I56 F;  1W40 A;  5FJ4 C;  1NMU B;  3G4S F;  1S72 F;  2OZB A;  1H7M A;  1GZ0 A;  1KQS F;  1W2B F;  4NUT A;  2QI2 A;  1VQM F;  1ZWZ A;  1YJN F;  3CD6 F;  1W42 A;  3VMF B;  1Q86 H;  3J80 M;  3CXC F;  1VQL F;  3OW2 F;  1VQ6 F;  3OBY A;  1IPA A;  2I6D A;  1M90 H;  3HJW C;  1QVG F;  1VQP F;  1W41 A;  3O85 A;  5FLX M;  3LFO A;  4X3M A;  4BW0 B;  1Q81 H;  2KG4 A;  1K73 H;  5G4V C;  2BO1 A;  3CCU F;  3MCA B;  3LWR C;  3FFM A;  4X3L A;  2OTL F;  3LWO C;  3CCE F;  1YJ9 F;  3CC2 F;  3G71 F;  1XBI A;  2QEX F;  1YIJ F;  1M1K H;  3LWV C;  4TZZ A;  3NK7 A;  3CCS F;  1T0K B;  2LBX A;  3CCJ F;  5EWR A;  1KC8 H;  3CG6 A;  3N4Y A;  3J7A R;  1YHQ F;  1YJW F;  1VQ9 F;  3CC7 F;  4C4W C;  1PXW A;  1NJI H;  3NK6 A;  5GIN C;  3CPQ A;  3CCR F;  1VQK F;  2HVY D;  5GAP K;  5EO3 A;  3JAM M;  3CPW F;  3RA6 A;  1E7K A;  1VQ5 F;  4LCK A;  5IT9 M;  2CZW A;  1GO0 A;  3PLA C;  3JCM M;  1CK2 A;  3VI6 A;  3J81 M;  3WXM B;  2FC3 A;  3E20 B;  1DT9 A;  2WAL A;  3SIU A;  5GIO C;  1W3E X; 
#chains in the Genus database with same CATH topology
 4HNA A;  2G9I A;  4B45 A;  4ZHQ A;  4X20 A;  4IIJ B;  2KTV A;  3MQW A;  1X7O A;  3T80 A;  2HQS C;  3WGJ A;  3RYI B;  4ZOL A;  3S02 A;  4IHJ B;  4O2B A;  5GIO C;  1T0A A;  1VQ4 F;  5CB4 A;  5LP6 B;  2QA4 F;  3HTN A;  4O4H A;  1YI2 F;  4HNA B;  4X1Y B;  3E22 B;  3N2G A;  4X20 B;  2KTU A;  3RYF A;  1YQN A;  4ZI7 A;  4ZOL B;  1IV2 A;  2HS0 A;  3LYB A;  3FPI A;  3IR9 A;  3JAK B;  1CN7 A;  4PWT A;  1H48 A;  1KNK A;  1SA0 B;  4TV9 A;  1YGY A;  2CWJ A;  3GYQ A;  3KJK A;  2Q1X A;  1RA4 A;  4G4V A;  4C8E A;  3N4Z A;  3JAW B;  3RYC B;  3Q8H A;  3I55 F;  3F6M A;  3HAX D;  5LYJ B;  4EI8 A;  4O4J A;  5J2U A;  3LWQ C;  3CME F;  3WJP A;  3RYH B;  1W40 A;  2ZOV A;  3JAL B;  4I50 B;  3I7T A;  1KQS F;  1GX1 A;  4YJ3 A;  2CSL A;  3RE3 A;  4BT4 A;  3VMF B;  4FFB A;  5IJ9 A;  2ZVY A;  2DYY A;  3OW2 F;  2HX0 A;  5ITZ B;  5JH7 A;  4TV8 A;  3HKE A;  3F0E A;  5HXZ A;  3LFO A;  1TUB B;  5G4V C;  5LOV B;  2BO1 A;  5EAZ A;  2UYN B;  2Z1T A;  4X3L A;  3JAS B;  3CCE F;  5FNV A;  4F6R A;  3HKE B;  3M1X A;  2PMP A;  2RB9 A;  4B46 A;  2GZL A;  5CA0 B;  3LWV C;  4EI9 A;  3LME A;  2IAF A;  5AVM A;  1W58 1;  1DBF A;  3CG6 A;  1Z5V A;  2Z01 A;  3N2K A;  5MN5 A;  3K0T A;  3JAT B;  3CYQ A;  5GAP K;  1E7K A;  2H8C A;  5CA1 B;  2Q1Y A;  2RHL A;  3HKB B;  4LNU B;  1CK2 A;  5MN6 A;  3QHD A;  3UT5 B;  3FBA A;  3N2K B;  2R75 1;  4TUY A;  3S06 A;  5BMV B;  2ZAU A;  1DT9 A;  2YYE A;  4G88 A;  4WBN A;  3SIU A;  5IJ0 A;  5KMG A;  3CYP B;  1JN1 A;  2ZOD A;  1VQ7 F;  1TVK B;  3VO8 A;  2VGM A;  3V4D A;  1KNJ A;  3P4E A;  4RQO A;  4U3J B;  2Z1U A;  5EZY A;  3VOA A;  3VIU A;  4EI7 A;  1XV2 A;  1FFX A;  5KMG B;  3IEQ A;  4IIJ A;  1VH8 A;  3EOR A;  3RYI A;  1GO1 A;  3NMU C;  4IHJ A;  5JCO A;  2UYP A;  4B5C A;  4I4T B;  3C9S A;  2GVI A;  5EZY B;  2HS4 A;  2B33 A;  4O4I B;  3GTZ A;  1H47 A;  2P6Y A;  4X1Y A;  3E22 A;  3K14 A;  3WPX A;  4BT6 A;  5J2T B;  1RQ7 A;  5EIB D;  2HP0 A;  2AMT A;  5B8F A;  4ZHV A;  3ON1 A;  1JJ2 F;  3C9T A;  3CCL F;  3JAK A;  3OBW A;  2LBW A;  3CC4 F;  4G4Y A;  1SA0 A;  3CCM F;  3NVI B;  2GLZ A;  4BVS A;  1X7P A;  5HWE A;  4BVQ A;  5FJ4 C;  4G4X A;  1NMU B;  2HP0 B;  1H7M A;  3JAW A;  3RYC A;  1J7H A;  4NUT A;  1YJN F;  1ZWZ A;  5IYZ B;  3CD6 F;  3KHN A;  5LYJ A;  5C8Y B;  5JVD A;  3KJJ A;  5LA6 B;  3VYU C;  3VYS C;  3ZP4 A;  3RYH A;  1IPA A;  1M90 H;  4M8I A;  1Z5W A;  2HRU A;  1QVG F;  2RHH A;  3JAL A;  3HWU A;  4I50 A;  3FD5 A;  1W41 A;  4ZK7 A;  2BTO A;  2HRY A;  5FLX M;  3V3T A;  1QU9 A;  5JVD B;  2KG4 A;  2BTU A;  3I3F A;  3K12 A;  2UYK A;  5ITZ A;  1W55 A;  3TD3 A;  4ZHY B;  1YIJ F;  1M1K H;  2Z1E A;  4TZZ A;  3ELC A;  1TUB A;  1QD9 A;  3N4Y A;  5LOV A;  3KIZ A;  2UYN A;  1VQ9 F;  3CC7 F;  1PXW A;  5HY0 A;  3D00 A;  3HKC B;  3JAS A;  1XHO A;  5CA0 A;  3CCR F;  1W57 A;  5EO3 A;  4DRX A;  4B62 A;  4LCK A;  5IT9 M;  2CZW A;  3WJQ A;  3PLA C;  2Z1F A;  3J81 M;  3F0D A;  4NQ3 A;  5EB1 B;  4ERH A;  2DT4 A;  2VAM A;  1X52 A;  3JAT A;  4ZHW A;  3M84 A;  4DRX B;  1YIT F;  1W59 A;  5CA1 A;  5A2Q M;  3CCQ F;  1NQ3 A;  3HKB A;  3DC2 A;  4LNU A;  3KE1 A;  3BYQ A;  3UT5 A;  2VGN A;  2VAW A;  2PHN A;  5LP6 C;  5KX5 B;  3G6E F;  2OTJ F;  1VQN F;  5LXT B;  5BMV A;  3VCZ A;  1JFF A;  4NWO B;  2KGW A;  1TVK A;  3L7Q A;  3SIV A;  1Q8R A;  4I55 B;  3NVK E;  4U3J A;  1K9M H;  1VHA A;  3CCV F;  1UI9 A;  5HP7 A;  3C8L A;  2JNB A;  2ALE A;  1JFF B;  4E6E A;  1VQO F;  3WGL A;  3V7E A;  1Q7Y H;  4EB6 B;  3RA5 A;  2ZVZ A;  3HKD A;  1VQ8 F;  3S03 A;  5EIB C;  4I4T A;  1Q82 H;  2I6R A;  4O4I A;  5EB0 A;  5DCV A;  2OTM A;  3LWP C;  2V9Y A;  5J2T A;  3I56 F;  3JAR B;  3HKD B;  3G4S F;  2MQE A;  1X25 A;  1FSZ A;  3IKF A;  4RHA A;  2QI2 A;  3VYT C;  1VQM F;  2LCA A;  3D01 A;  5HY2 A;  5EYP B;  1VQ6 F;  2FGY A;  2H6L A;  3TD5 A;  5HY4 A;  3QTY A;  3S0H A;  3CB2 A;  2VXY A;  1W5B A;  5IYZ A;  4BW0 B;  1Q81 H;  5C8Y A;  3LDT A;  4BT5 A;  4BT2 A;  5LA6 A;  3MCA B;  3LWR C;  5JQG B;  2OTL F;  3F0G A;  3CC2 F;  3G71 F;  1XBI A;  4X1K B;  3TD4 A;  2QEX F;  3NK7 A;  5GON B;  1ODE A;  3CCS F;  2LBX A;  1JY8 A;  5HY1 A;  4O4L B;  3WJR A;  1KC8 H;  2AIZ P;  3VOB A;  4R40 B;  3J7A R;  5HXU A;  1U3L A;  3WGN A;  1YHQ F;  3ERN A;  3ZOP A;  1JD1 A;  4C4W C;  1OAP A;  3P10 A;  4BT7 A;  3NK6 A;  5GIN C;  1VK3 A;  2IG8 A;  3CPQ A;  3B6N A;  4G4Z A;  2LBT A;  4ZHQ B;  2HVY D;  3JAM M;  3CPW F;  4U39 A;  4O2B B;  2RHO A;  3IMP A;  3HKC A;  5CB4 B;  3U0O A;  3WXM B;  3MDO A;  3E20 B;  2FC3 A;  2WAL A;  1VQ5 F;  2EWC A;  1W3E X;  4O4H B;  2W8B C;  3CMA F;  3N2G B;  3FD6 A;  5GIP C;  2YXZ A;  3RYF B;  3MCQ A;  3C9R A;  4ZI7 B;  1RLG A;  4X1I A;  1RLU A;  4DXD A;  3QUW A;  1UFY A;  4BVR A;  4BY9 D;  1ONI A;  1SZQ A;  1RQ2 A;  2HS3 A;  2K1S A;  5GAN K;  1SDS A;  4TV9 B;  3V7Q A;  1QVF F;  1QAH A;  1FNJ A;  1N8R H;  3K2X A;  4X1I B;  2AIF A;  2OHW A;  3M4S A;  5KX5 A;  3WGK A;  3ESJ A;  4XCQ A;  1IV3 A;  5LXT A;  4YJ2 A;  1U3P A;  3VTI C;  4C8G A;  5J2U B;  3AGK A;  4O4J B;  2HP3 A;  2L26 A;  2QTP A;  5JCO C;  1W5A A;  1KD1 H;  3PAF A;  4I55 A;  4C82 A;  5G4U C;  3E1Y A;  1K8A H;  1FNK A;  4YJ3 B;  4FFB B;  4YJ2 B;  3ZP7 A;  5IJ9 B;  3IKE A;  2CW4 A;  2VAP A;  4EB6 A;  3WPW A;  3OON A;  2N48 A;  5JH7 B;  4G4W A;  3GHZ A;  4TV8 B;  5MN4 A;  1S72 F;  2OZB A;  4BT3 A;  1GZ0 A;  4KWE A;  1W2B F;  2UYJ A;  1W42 A;  1Q86 H;  3J80 M;  3CXC F;  1VQL F;  3ZO8 A;  3OBY A;  2I6D A;  2CHS A;  2UZH A;  1CLI A;  3JAR A;  1R1M A;  5FNV B;  3HJW C;  3MBM A;  1IV4 A;  4F6R B;  1VQP F;  3S0W A;  3O85 A;  4C81 A;  4X3M A;  1U43 A;  4C8I A;  1OFU A;  1K73 H;  5EYP A;  2NMU A;  1XRG A;  3CCU F;  1PF5 A;  3FFM A;  3F0F A;  2CVL A;  1W5F A;  3LWO C;  1YJ9 F;  1VQV A;  1T0K B;  2ZF8 A;  2BTQ B;  3CCJ F;  5EWR A;  2IQQ A;  3D54 A;  1YJW F;  4O2A A;  3JVH A;  5JQG A;  1NJI H;  4TUY B;  3IEW A;  4X1K A;  3S0Y A;  4WBN B;  1W5E A;  5IJ0 B;  3WGM A;  4BVT A;  5GON A;  1VQK F;  3C9U A;  1U40 A;  4O4L A;  3RA6 A;  3DDN A;  1GO0 A;  3JCM M;  3VI6 A;  4O2A B;  2CHT A;  3P0Z A;  2H8E A;  3R0P A;  5HP8 A;  2R6R 1;  2RHJ A;  1IV1 A;  5LP6 A;  1COM A;  2F9Z C;  1FFX B; 
#chains in the Genus database with same CATH homology
 3CMA F;  1X52 A;  5GIP C;  1VQ7 F;  2KTV A;  1X7O A;  2VGM A;  1YIT F;  5A2Q M;  3CCQ F;  1RLG A;  2VGN A;  1VQ4 F;  3G6E F;  2OTJ F;  4BVR A;  1VQN F;  4BY9 D;  5GAN K;  2QA4 F;  4EI7 A;  1YI2 F;  1SDS A;  3V7Q A;  1QVF F;  2KTU A;  3SIV A;  1W3E X;  1N8R H;  1GO1 A;  3NMU C;  3NVK E;  1K9M H;  2AIF A;  3IR9 A;  2OHW A;  3CCV F;  4XCQ A;  1CN7 A;  2JNB A;  2ALE A;  1VQO F;  3AGK A;  3V7E A;  1Q7Y H;  3RA5 A;  3GYQ A;  1RA4 A;  1KD1 H;  3PAF A;  3N4Z A;  1VQ8 F;  5G4U C;  3ON1 A;  3E1Y A;  1K8A H;  1JJ2 F;  3CCL F;  3I55 F;  3OBW A;  2LBW A;  1Q82 H;  3CC4 F;  3HAX D;  4EI8 A;  3CCM F;  3NVI B;  5DCV A;  2GLZ A;  3LWQ C;  4BVS A;  3CME F;  3LWP C;  1X7P A;  3I56 F;  5HWE A;  4BVQ A;  1W40 A;  5FJ4 C;  1NMU B;  3G4S F;  1S72 F;  2OZB A;  1H7M A;  1GZ0 A;  1KQS F;  1W2B F;  4NUT A;  2QI2 A;  1VQM F;  1ZWZ A;  1YJN F;  3CD6 F;  1W42 A;  3VMF B;  1Q86 H;  3J80 M;  5HY2 A;  3CXC F;  1VQL F;  3OW2 F;  1VQ6 F;  3OBY A;  2FGY A;  1IPA A;  2I6D A;  1M90 H;  5HY4 A;  3HJW C;  1QVG F;  1VQP F;  1W41 A;  3O85 A;  5FLX M;  5HXZ A;  3LFO A;  4X3M A;  3V3T A;  4BW0 B;  1Q81 H;  2KG4 A;  1K73 H;  5G4V C;  2BO1 A;  3CCU F;  3MCA B;  3LWR C;  3FFM A;  4X3L A;  2OTL F;  3LWO C;  3CCE F;  1YJ9 F;  3CC2 F;  3G71 F;  1XBI A;  2QEX F;  1YIJ F;  1M1K H;  3LWV C;  4TZZ A;  4EI9 A;  3NK7 A;  3CCS F;  1T0K B;  2LBX A;  5HY1 A;  3CCJ F;  5EWR A;  1KC8 H;  3CG6 A;  3N4Y A;  3J7A R;  5HXU A;  1YHQ F;  1YJW F;  1VQ9 F;  3CC7 F;  4C4W C;  1PXW A;  5HY0 A;  3D00 A;  1NJI H;  3NK6 A;  5GIN C;  3CPQ A;  3CCR F;  4BVT A;  1VQK F;  2HVY D;  5GAP K;  5EO3 A;  3JAM M;  3CPW F;  3RA6 A;  1E7K A;  1VQ5 F;  4LCK A;  5IT9 M;  2CZW A;  1GO0 A;  3PLA C;  3JCM M;  1CK2 A;  3VI6 A;  3J81 M;  4NQ3 A;  3WXM B;  2FC3 A;  3E20 B;  1DT9 A;  2WAL A;  3SIU A;  5GIO C;  2F9Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...