2HVYD

Crystal structure of an h/aca box rnp from pyrococcus furiosus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an H/ACA box ribonucleoprotein particle
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/biosynthetic protein/rna
molecule keywords H/ACA RNA
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2hvyD00
3VI6A 5GAPK 2AIFA 3LWPC 1W2BF 3E20B 3JCMM 2FC3A 1VQ8F 3CPQA 2OTLF 4LCKA 3OBWA 1VQPF 1YJNF 1IPAA 3NVKE 3LWQC 2KTVA 3CCVF 1Q7YH 2VGMA 1QVGF 3CCMF 3IR9A 2KTUA 1Q81H 3V7EA 3CC2F 3CCEF 1SDSA 1X52A 5EO3A 4NUTA 1XBIA 2JNBA 1T0KB 1VQ6F 4BY9D 3NK6A 3RA6A 3CCJF 2OTJF 3CCSF 3RA5A 1W41A 1VQLF 3J81M 2CZWA 2LBXA 3CCRF 3NVIB 1KC8H 1E7KA 3I55F 3CMAF 1QVFF 1CN7A 3SIVA 3J80M 3OBYA 5A2QM 1M1KH 1K8AH 3PAFA 1K73H 1RLGA 3CCQF 1YITF 1YIJF 1VQNF 3G6EF 3CMEF 3CC4F 3HJWC 4X3MA 1VQ5F 1KD1H 2LBWA 5GINC 2VGNA 3WXMB 3GYQA 2QA4F 5GANK 1NJIH 1K9MH 1M90H 3LWVC 3HAXD 3J7AR 5GIPC 3CPWF 3MCAB 1X7PA 3N4ZA 5G4UC 1W42A 1ZWZA 3E1YA 2HVYD 3CG6A 3CCLF 1GO1A 3G4SF 2BO1A 1VQMF 3CXCF 5FJ4C 1YJWF 3NMUC 5IT9M 1YI2F 3OW2F 2OHWA 1Q82H 5G4VC 2OZBA 1JJ2F 2QI2A 1YJ9F 1VQ9F 3SIUA 1GZ0A 1NMUB 2WALA 3PLAC 1CK2A 1H7MA 3V7QA 3I56F 3CC7F 2KG4A 3VMFB 3N4YA 1Q86H 3CCUF 1VQ7F 1RA4A 4X3LA 1VQ4F 3AGKA 1W3EX 1N8RH 3FFMA 4TZZA 5DCVA 3JAMM 2QEXF 3O85A 3LFOA 1VQKF 1KQSF 1PXWA 5FLXM 4C4WC 2I6DA 1X7OA 3CD6F 3NK7A 3ON1A 3LWRC 1W40A 3G71F 2ALEA 1VQOF 1DT9A 1YHQF 4BW0B 5EWRA 1GO0A 1S72F 5GIOC 3LWOC
chains in the Genus database with same CATH superfamily
1IV2A 1W2BF 3JCMM 2P6YA 4G4VA 3CPQA 3IEWA 4BVQA 4U39A 2CHTA 3HTNA 5HXUA 3CCMF 3WGMA 2KTUA 2QTPA 3IKEA 1Q81H 1QAHA 2Z01A 1FFXA 4HNAB 4NUTA 5EO3A 5JVDB 1VQ6F 2ZODA 3N2GA 3RA6A 2OTJF 3RA5A 3RYIB 2GLZA 1VQLF 2MQEA 4I50B 4G88A 1KC8H 3I55F 4G4XA 2UYNA 4C82A 3JAWB 5A2QM 1U3LA 3PAFA 1RLGA 1PF5A 2CW4A 4I55B 3D01A 5JH7A 1TUBA 4X1IB 1U3PA 1IV4A 2LBWA 3R0PA 5GINC 3DDNA 1SA0A 1XHOA 1W5EA 3JALA 3MDOA 1U40A 3VYSC 4DXDA 3HAXD 5HY2A 5GIPC 4BT6A 1W42A 4C8EA 3FBAA 4I4TA 5EYPB 2IG8A 3KJJA 4NWOB 5GONA 3K0TA 4IHJA 4X20A 2BO1A 3V4DA 5AVMA 1IV1A 1Q82H 3C9SA 3IKFA 5JCOC 4X1IA 3GHZA 1FNJA 3I56F 3KIZA 3QTYA 3VMFB 3N4YA 1W55A 5HXZA 1Q86H 1XV2A 1VQ7F 1RA4A 2HS0A 3L7QA 3GTZA 1W3EX 4ZHYB 3HKCB 2RHOA 5JQGB 5LYJA 5EAZA 4WBNA 2QEXF 4ZI7B 3LFOA 1W5AA 2UYPA 5KMGA 2CVLA 4X1KA 1JD1A 3WGNA 3LWRC 5HY4A 1VH8A 5EIBD 3C8LA 1GO0A 3E22B 5FNVA 4O4LB 5EIBC 3UT5A 3VI6A 3LWPC 4FFBA 5MN5A 5HY0A 2FC3A 1VQ8F 2Z1UA 4LCKA 3FD5A 4U3JB 2RHLA 3NVKE 3LWQC 2KTVA 3QUWA 2VAPA 3V3TA 5HP7A 3HKBA 4TV9A 2Z1FA 2H8CA 4TV8B 3VIUA 2CWJA 1X52A 3MQWA 2BTQB 4RQOA 2JNBA 2Q1XA 4X1KB 4BY9D 1TVKA 3DC2A 3HKDA 2W8BC 4O4HB 2CZWA 2LBXA 3CCRF 1ODEA 4YJ3A 3CMAF 3UT5B 3WGLA 3SIVA 3VCZA 3JASB 4C81A 3J80M 1M1KH 1W5FA 2VXYA 2YYEA 4IIJA 3CCQF 2DYYA 4B62A 1YITF 5LA6A 4DRXA 3JAKA 3HJWC 5MN6A 4X1YA 1KD1H 1RLUA 2KGWA 2I6RA 2VAMA 2QA4F 5B8FA 2HS3A 1Q8RA 1M90H 4EB6A 3CPWF 3TD3A 5LOVA 5J2UA 4LNUB 1ZWZA 3S0HA 4EI7A 2K1SA 2YXZA 4B46A 5EZYA 2HVYD 3CCLF 1GO1A 2RHJA 3JASA 4ZHVA 5LP6C 1VQMF 3CXCF 4G4ZA 4R40B 2OTMA 1YJWF 4IIJB 2OHWA 5G4VC 1UFYA 3JVHA 5EB1B 4O2BB 2LBTA 1VQ9F 5CB4B 5BMVA 5J2TB 1GZ0A 3KE1A 2WALA 3B6NA 1CK2A 2KG4A 3S0YA 4BT5A 3RYCB 3WPWA 3I3FA 3N2KB 5MN4A 1SZQA 4X3LA 5HWEA 5JCOA 3RYFA 5C8YA 3FFMA 5LOVB 5IJ0B 5DCVA 2FGYA 1JY8A 2VAWA 5EZYB 1VQKF 1KQSF 2ZVYA 5FLXM 2I6DA 1X7OA 5LXTB 3CD6F 3NK7A 3VTIC 2HP0A 3G71F 2ALEA 1DT9A 2N48A 2RB9A 3Q8HA 5BMVB 1YHQF 2ZF8A 2Q1YA 3LWOC 5GAPK 2HX0A 3VOAA 2AIFA 2HS4A 3S0WA 5LP6B 3N2KA 5IYZA 3E20B 1QU9A 2OTLF 4TUYA 4YJ2B 3JAKB 2ZVZA 1VQPF 2Z1TA 2UYNB 3JATB 1Q7YH 1W5BA 3F0FA 2ZAUA 3WPXA 3IR9A 3P4EA 3F0DA 3WJPA 3CCEF 4I55A 4BVTA 1SDSA 4ERHA 3S06A 4PWTA 3WGJA 2CHSA 1RQ2A 3EORA 4C8IA 3VOBA 5JH7B 4F6RB 2R6R1 3CCSF 1VQVA 3D00A 3F0GA 1SA0B 3WJRA 4EI9A 3FD6A 3ZOPA 1Z5WA 4BT3A 3CYPB 1KNJA 5LP6A 5IJ9B 5IYZB 5J2TA 4HNAA 4I4TB 1YGYA 4TUYB 3N2GB 1VQNF 3LYBA 2LCAA 2UYJA 3CMEF 3CC4F 3D54A 4X3MA 1VQ5F 3WXMB 3GYQA 1IV3A 5C8YB 4I50A 1NJIH 3QHDA 2NMUA 4M8IA 3KJKA 5IJ0A 3P0ZA 3MCAB 5G4UC 3N4ZA 4G4WA 4XCQA 1W57A 5ITZB 3CG6A 1TUBB 1J7HA 1H48A 3G4SF 2HP0B 4ZOLB 2UZHA 3NMUC 1YI2F 3OW2F 3JALB 3F6MA 5KX5A 2OZBA 2R751 3C9RA 3SIUA 4B5CA 3P10A 4BT7A 1NMUB 3V7QA 3CC7F 5CA0B 4YJ2A 3ZO8A 3CCUF 3JATA 4IHJB 4ZHQB 4RHAA 5EYPA 3JARA 3BYQA 3K12A 4O4JB 3C9UA 4TZZA 3VYTC 3E22A 5FNVB 3JAMM 4FFBB 3I7TA 4F6RA 3RYHA 2RHHA 3M1XA 4ZOLA 4C8GA 4C4WC 1U43A 3HWUA 3ON1A 1XRGA 5KX5B 2BTUA 1W40A 1VQOF 1UI9A 1H47A 3HKCA 4TV8A 5IJ9A 2PHNA 5GIOC 4WBNB 3HKDB 5JQGA 4ZI7A 4O4HA 5LYJB 3LMEA 3M4SA 4ZHQA 5KMGB 3JARB 3OBWA 3HKEA 1YJNF 1IPAA 1W581 2CSLA 1R1MA 4O4JA 2VGMA 3CCVF 3K2XA 1OAPA 1ONIA 3IEQA 1QVGF 2EWCA 2BTOA 3V7EA 3CC2F 5HP8A 2HQSC 1XBIA 3FPIA 2UYKA 3WJQA 4O4LA 1T0KB 2AIZP 3CYQA 3K14A 3NK6A 4O4IB 3U0OA 3M84A 5CA1A 3CCJF 4G4YA 4NQ3A 3VYUC 1W41A 2GVIA 3WGKA 5ITZA 4X1YB 3J81M 3NVIB 1JFFA 3HKBB 4TV9B 1E7KA 4U3JA 1KNKA 3ESJA 1QVFF 4EB6B 1CN7A 1COMA 3OBYA 1GX1A 1YQNA 1K8AH 2ZOVA 1K73H 3KHNA 4ZK7A 3ERNA 5J2UB 4O2AB 1YIJF 3G6EF 3ELCA 3RE3A 1TVKB 2H8EA 5CA0A 4EI8A 2B33A 3VO8A 1JN1A 2VGNA 4YJ3B 4BT2A 4O2BA 4KWEA 5GANK 2H6LA 3ZP4A 1K9MH 2G9IA 2V9YA 4O4IA 1NQ3A 3LWVC 3J7AR 3OONA 2HRUA 4BT4A 1X7PA 1W59A 4E6EA 3T80A 3E1YA 1CLIA 3RYHB 4DRXB 1X25A 1DBFA 3RYIA 4BVSA 5LA6B 3S02A 2HRYA 1OFUA 3RYFB 3IMPA 5FJ4C 5IT9M 3JAWA 3S03A 2IAFA 1JJ2F 2QI2A 4O2AA 3C9TA 1YJ9F 4BVRA 1FNKA 1FSZA 3PLAC 1H7MA 3MCQA 2Z1EA 3F0EA 3HKEB 1QD9A 4B45A 4LNUA 5LXTA 3TD5A 1VQ4F 1RQ7A 1VK3A 2IQQA 3AGKA 3LDTA 1N8RH 2F9ZC 2DT4A 2HP3A 3MBMA 1Z5VA 2AMTA 2L26A 3CB2A 3O85A 5CB4A 4ZHWA 3TD4A 1FFXB 5CA1B 1PXWA 2GZLA 5JVDA 5GONB 1VHAA 5HY1A 1JFFB 4X20B 3RYCA 5EB0A 3ZP7A 4BW0B 5EWRA 1T0AA 1S72F 2PMPA
chains in the Genus database with same CATH topology
3VI6A 5GAPK 2AIFA 3LWPC 1W2BF 3E20B 3JCMM 2FC3A 4BVQA 3CPQA 5HY0A 1VQ8F 2OTLF 4LCKA 3OBWA 1VQPF 1YJNF 1IPAA 3NVKE 3LWQC 2KTVA 3CCVF 3V3TA 2VGMA 5HXUA 1Q7YH 1QVGF 3CCMF 3IR9A 2KTUA 1Q81H 3V7EA 3CC2F 3CCEF 4BVTA 1SDSA 1X52A 5EO3A 4NUTA 1XBIA 2JNBA 1T0KB 1VQ6F 4BY9D 3NK6A 3RA6A 3CCJF 2OTJF 3CCSF 4NQ3A 3RA5A 1W41A 1VQLF 2GLZA 3D00A 3J81M 2CZWA 2LBXA 3CCRF 3NVIB 4EI9A 1KC8H 1E7KA 3I55F 3CMAF 1QVFF 1CN7A 3SIVA 3J80M 3OBYA 5A2QM 1M1KH 1K8AH 3PAFA 1K73H 1RLGA 3CCQF 1YITF 1YIJF 1VQNF 3G6EF 3CMEF 4EI8A 3CC4F 3HJWC 4X3MA 1VQ5F 1KD1H 2LBWA 5GINC 2VGNA 3WXMB 3GYQA 2QA4F 5GANK 1NJIH 1K9MH 1M90H 3LWVC 5HY2A 3HAXD 5GIPC 3CPWF 3J7AR 3MCAB 1X7PA 3N4ZA 5G4UC 1W42A 1ZWZA 3E1YA 4EI7A 4XCQA 2HVYD 3CG6A 3CCLF 1GO1A 4BVSA 3G4SF 2BO1A 1VQMF 3CXCF 5FJ4C 1YJWF 3NMUC 5IT9M 1YI2F 3OW2F 2OHWA 1Q82H 5G4VC 2OZBA 1JJ2F 2QI2A 1YJ9F 1VQ9F 4BVRA 3SIUA 1GZ0A 1NMUB 2WALA 3PLAC 1CK2A 1H7MA 3V7QA 3I56F 3CC7F 2KG4A 3VMFB 3N4YA 5HXZA 1Q86H 3CCUF 1VQ7F 1RA4A 4X3LA 5HWEA 1VQ4F 3AGKA 1W3EX 1N8RH 2F9ZC 3FFMA 4TZZA 5DCVA 2FGYA 3JAMM 2QEXF 3O85A 3LFOA 1VQKF 1KQSF 1PXWA 5FLXM 4C4WC 2I6DA 1X7OA 3CD6F 3NK7A 3ON1A 5HY1A 3LWRC 1W40A 5HY4A 2ALEA 3G71F 1DT9A 1VQOF 1YHQF 4BW0B 5EWRA 1GO0A 1S72F 5GIOC 3LWOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VI6 A;  5GAP K;  2AIF A;  3LWP C;  1W2B F;  3E20 B;  3JCM M;  2FC3 A;  1VQ8 F;  3CPQ A;  2OTL F;  4LCK A;  3OBW A;  1VQP F;  1YJN F;  1IPA A;  3NVK E;  3LWQ C;  2KTV A;  3CCV F;  1Q7Y H;  2VGM A;  1QVG F;  3CCM F;  3IR9 A;  2KTU A;  1Q81 H;  3V7E A;  3CC2 F;  3CCE F;  1SDS A;  1X52 A;  5EO3 A;  4NUT A;  1XBI A;  2JNB A;  1T0K B;  1VQ6 F;  4BY9 D;  3NK6 A;  3RA6 A;  3CCJ F;  2OTJ F;  3CCS F;  3RA5 A;  1W41 A;  1VQL F;  3J81 M;  2CZW A;  2LBX A;  3CCR F;  3NVI B;  1KC8 H;  1E7K A;  3I55 F;  3CMA F;  1QVF F;  1CN7 A;  3SIV A;  3J80 M;  3OBY A;  5A2Q M;  1M1K H;  1K8A H;  3PAF A;  1K73 H;  1RLG A;  3CCQ F;  1YIT F;  1YIJ F;  1VQN F;  3G6E F;  3CME F;  3CC4 F;  3HJW C;  4X3M A;  1VQ5 F;  1KD1 H;  2LBW A;  5GIN C;  2VGN A;  3WXM B;  3GYQ A;  2QA4 F;  5GAN K;  1NJI H;  1K9M H;  1M90 H;  3LWV C;  3HAX D;  3J7A R;  5GIP C;  3CPW F;  3MCA B;  1X7P A;  3N4Z A;  5G4U C;  1W42 A;  1ZWZ A;  3E1Y A;  2HVY D;  3CG6 A;  3CCL F;  1GO1 A;  3G4S F;  2BO1 A;  1VQM F;  3CXC F;  5FJ4 C;  1YJW F;  3NMU C;  5IT9 M;  1YI2 F;  3OW2 F;  2OHW A;  1Q82 H;  5G4V C;  2OZB A;  1JJ2 F;  2QI2 A;  1YJ9 F;  1VQ9 F;  3SIU A;  1GZ0 A;  1NMU B;  2WAL A;  3PLA C;  1CK2 A;  1H7M A;  3V7Q A;  3I56 F;  3CC7 F;  2KG4 A;  3VMF B;  3N4Y A;  1Q86 H;  3CCU F;  1VQ7 F;  1RA4 A;  4X3L A;  1VQ4 F;  3AGK A;  1W3E X;  1N8R H;  3FFM A;  4TZZ A;  5DCV A;  3JAM M;  2QEX F;  3O85 A;  3LFO A;  1VQK F;  1KQS F;  1PXW A;  5FLX M;  4C4W C;  2I6D A;  1X7O A;  3CD6 F;  3NK7 A;  3ON1 A;  3LWR C;  1W40 A;  3G71 F;  2ALE A;  1VQO F;  1DT9 A;  1YHQ F;  4BW0 B;  5EWR A;  1GO0 A;  1S72 F;  5GIO C;  3LWO C; 
#chains in the Genus database with same CATH topology
 1IV2 A;  1W2B F;  3JCM M;  2P6Y A;  4G4V A;  3CPQ A;  3IEW A;  4BVQ A;  4U39 A;  2CHT A;  3HTN A;  5HXU A;  3CCM F;  3WGM A;  2KTU A;  2QTP A;  3IKE A;  1Q81 H;  1QAH A;  2Z01 A;  1FFX A;  4HNA B;  4NUT A;  5EO3 A;  5JVD B;  1VQ6 F;  2ZOD A;  3N2G A;  3RA6 A;  2OTJ F;  3RA5 A;  3RYI B;  2GLZ A;  1VQL F;  2MQE A;  4I50 B;  4G88 A;  1KC8 H;  3I55 F;  4G4X A;  2UYN A;  4C82 A;  3JAW B;  5A2Q M;  1U3L A;  3PAF A;  1RLG A;  1PF5 A;  2CW4 A;  4I55 B;  3D01 A;  5JH7 A;  1TUB A;  4X1I B;  1U3P A;  1IV4 A;  2LBW A;  3R0P A;  5GIN C;  3DDN A;  1SA0 A;  1XHO A;  1W5E A;  3JAL A;  3MDO A;  1U40 A;  3VYS C;  4DXD A;  3HAX D;  5HY2 A;  5GIP C;  4BT6 A;  1W42 A;  4C8E A;  3FBA A;  4I4T A;  5EYP B;  2IG8 A;  3KJJ A;  4NWO B;  5GON A;  3K0T A;  4IHJ A;  4X20 A;  2BO1 A;  3V4D A;  5AVM A;  1IV1 A;  1Q82 H;  3C9S A;  3IKF A;  5JCO C;  4X1I A;  3GHZ A;  1FNJ A;  3I56 F;  3KIZ A;  3QTY A;  3VMF B;  3N4Y A;  1W55 A;  5HXZ A;  1Q86 H;  1XV2 A;  1VQ7 F;  1RA4 A;  2HS0 A;  3L7Q A;  3GTZ A;  1W3E X;  4ZHY B;  3HKC B;  2RHO A;  5JQG B;  5LYJ A;  5EAZ A;  4WBN A;  2QEX F;  4ZI7 B;  3LFO A;  1W5A A;  2UYP A;  5KMG A;  2CVL A;  4X1K A;  1JD1 A;  3WGN A;  3LWR C;  5HY4 A;  1VH8 A;  5EIB D;  3C8L A;  1GO0 A;  3E22 B;  5FNV A;  4O4L B;  5EIB C;  3UT5 A;  3VI6 A;  3LWP C;  4FFB A;  5MN5 A;  5HY0 A;  2FC3 A;  1VQ8 F;  2Z1U A;  4LCK A;  3FD5 A;  4U3J B;  2RHL A;  3NVK E;  3LWQ C;  2KTV A;  3QUW A;  2VAP A;  3V3T A;  5HP7 A;  3HKB A;  4TV9 A;  2Z1F A;  2H8C A;  4TV8 B;  3VIU A;  2CWJ A;  1X52 A;  3MQW A;  2BTQ B;  4RQO A;  2JNB A;  2Q1X A;  4X1K B;  4BY9 D;  1TVK A;  3DC2 A;  3HKD A;  2W8B C;  4O4H B;  2CZW A;  2LBX A;  3CCR F;  1ODE A;  4YJ3 A;  3CMA F;  3UT5 B;  3WGL A;  3SIV A;  3VCZ A;  3JAS B;  4C81 A;  3J80 M;  1M1K H;  1W5F A;  2VXY A;  2YYE A;  4IIJ A;  3CCQ F;  2DYY A;  4B62 A;  1YIT F;  5LA6 A;  4DRX A;  3JAK A;  3HJW C;  5MN6 A;  4X1Y A;  1KD1 H;  1RLU A;  2KGW A;  2I6R A;  2VAM A;  2QA4 F;  5B8F A;  2HS3 A;  1Q8R A;  1M90 H;  4EB6 A;  3CPW F;  3TD3 A;  5LOV A;  5J2U A;  4LNU B;  1ZWZ A;  3S0H A;  4EI7 A;  2K1S A;  2YXZ A;  4B46 A;  5EZY A;  2HVY D;  3CCL F;  1GO1 A;  2RHJ A;  3JAS A;  4ZHV A;  5LP6 C;  1VQM F;  3CXC F;  4G4Z A;  4R40 B;  2OTM A;  1YJW F;  4IIJ B;  2OHW A;  5G4V C;  1UFY A;  3JVH A;  5EB1 B;  4O2B B;  2LBT A;  1VQ9 F;  5CB4 B;  5BMV A;  5J2T B;  1GZ0 A;  3KE1 A;  2WAL A;  3B6N A;  1CK2 A;  2KG4 A;  3S0Y A;  4BT5 A;  3RYC B;  3WPW A;  3I3F A;  3N2K B;  5MN4 A;  1SZQ A;  4X3L A;  5HWE A;  5JCO A;  3RYF A;  5C8Y A;  3FFM A;  5LOV B;  5IJ0 B;  5DCV A;  2FGY A;  1JY8 A;  2VAW A;  5EZY B;  1VQK F;  1KQS F;  2ZVY A;  5FLX M;  2I6D A;  1X7O A;  5LXT B;  3CD6 F;  3NK7 A;  3VTI C;  2HP0 A;  3G71 F;  2ALE A;  1DT9 A;  2N48 A;  2RB9 A;  3Q8H A;  5BMV B;  1YHQ F;  2ZF8 A;  2Q1Y A;  3LWO C;  5GAP K;  2HX0 A;  3VOA A;  2AIF A;  2HS4 A;  3S0W A;  5LP6 B;  3N2K A;  5IYZ A;  3E20 B;  1QU9 A;  2OTL F;  4TUY A;  4YJ2 B;  3JAK B;  2ZVZ A;  1VQP F;  2Z1T A;  2UYN B;  3JAT B;  1Q7Y H;  1W5B A;  3F0F A;  2ZAU A;  3WPX A;  3IR9 A;  3P4E A;  3F0D A;  3WJP A;  3CCE F;  4I55 A;  4BVT A;  1SDS A;  4ERH A;  3S06 A;  4PWT A;  3WGJ A;  2CHS A;  1RQ2 A;  3EOR A;  4C8I A;  3VOB A;  5JH7 B;  4F6R B;  2R6R 1;  3CCS F;  1VQV A;  3D00 A;  3F0G A;  1SA0 B;  3WJR A;  4EI9 A;  3FD6 A;  3ZOP A;  1Z5W A;  4BT3 A;  3CYP B;  1KNJ A;  5LP6 A;  5IJ9 B;  5IYZ B;  5J2T A;  4HNA A;  4I4T B;  1YGY A;  4TUY B;  3N2G B;  1VQN F;  3LYB A;  2LCA A;  2UYJ A;  3CME F;  3CC4 F;  3D54 A;  4X3M A;  1VQ5 F;  3WXM B;  3GYQ A;  1IV3 A;  5C8Y B;  4I50 A;  1NJI H;  3QHD A;  2NMU A;  4M8I A;  3KJK A;  5IJ0 A;  3P0Z A;  3MCA B;  5G4U C;  3N4Z A;  4G4W A;  4XCQ A;  1W57 A;  5ITZ B;  3CG6 A;  1TUB B;  1J7H A;  1H48 A;  3G4S F;  2HP0 B;  4ZOL B;  2UZH A;  3NMU C;  1YI2 F;  3OW2 F;  3JAL B;  3F6M A;  5KX5 A;  2OZB A;  2R75 1;  3C9R A;  3SIU A;  4B5C A;  3P10 A;  4BT7 A;  1NMU B;  3V7Q A;  3CC7 F;  5CA0 B;  4YJ2 A;  3ZO8 A;  3CCU F;  3JAT A;  4IHJ B;  4ZHQ B;  4RHA A;  5EYP A;  3JAR A;  3BYQ A;  3K12 A;  4O4J B;  3C9U A;  4TZZ A;  3VYT C;  3E22 A;  5FNV B;  3JAM M;  4FFB B;  3I7T A;  4F6R A;  3RYH A;  2RHH A;  3M1X A;  4ZOL A;  4C8G A;  4C4W C;  1U43 A;  3HWU A;  3ON1 A;  1XRG A;  5KX5 B;  2BTU A;  1W40 A;  1VQO F;  1UI9 A;  1H47 A;  3HKC A;  4TV8 A;  5IJ9 A;  2PHN A;  5GIO C;  4WBN B;  3HKD B;  5JQG A;  4ZI7 A;  4O4H A;  5LYJ B;  3LME A;  3M4S A;  4ZHQ A;  5KMG B;  3JAR B;  3OBW A;  3HKE A;  1YJN F;  1IPA A;  1W58 1;  2CSL A;  1R1M A;  4O4J A;  2VGM A;  3CCV F;  3K2X A;  1OAP A;  1ONI A;  3IEQ A;  1QVG F;  2EWC A;  2BTO A;  3V7E A;  3CC2 F;  5HP8 A;  2HQS C;  1XBI A;  3FPI A;  2UYK A;  3WJQ A;  4O4L A;  1T0K B;  2AIZ P;  3CYQ A;  3K14 A;  3NK6 A;  4O4I B;  3U0O A;  3M84 A;  5CA1 A;  3CCJ F;  4G4Y A;  4NQ3 A;  3VYU C;  1W41 A;  2GVI A;  3WGK A;  5ITZ A;  4X1Y B;  3J81 M;  3NVI B;  1JFF A;  3HKB B;  4TV9 B;  1E7K A;  4U3J A;  1KNK A;  3ESJ A;  1QVF F;  4EB6 B;  1CN7 A;  1COM A;  3OBY A;  1GX1 A;  1YQN A;  1K8A H;  2ZOV A;  1K73 H;  3KHN A;  4ZK7 A;  3ERN A;  5J2U B;  4O2A B;  1YIJ F;  3G6E F;  3ELC A;  3RE3 A;  1TVK B;  2H8E A;  5CA0 A;  4EI8 A;  2B33 A;  3VO8 A;  1JN1 A;  2VGN A;  4YJ3 B;  4BT2 A;  4O2B A;  4KWE A;  5GAN K;  2H6L A;  3ZP4 A;  1K9M H;  2G9I A;  2V9Y A;  4O4I A;  1NQ3 A;  3LWV C;  3J7A R;  3OON A;  2HRU A;  4BT4 A;  1X7P A;  1W59 A;  4E6E A;  3T80 A;  3E1Y A;  1CLI A;  3RYH B;  4DRX B;  1X25 A;  1DBF A;  3RYI A;  4BVS A;  5LA6 B;  3S02 A;  2HRY A;  1OFU A;  3RYF B;  3IMP A;  5FJ4 C;  5IT9 M;  3JAW A;  3S03 A;  2IAF A;  1JJ2 F;  2QI2 A;  4O2A A;  3C9T A;  1YJ9 F;  4BVR A;  1FNK A;  1FSZ A;  3PLA C;  1H7M A;  3MCQ A;  2Z1E A;  3F0E A;  3HKE B;  1QD9 A;  4B45 A;  4LNU A;  5LXT A;  3TD5 A;  1VQ4 F;  1RQ7 A;  1VK3 A;  2IQQ A;  3AGK A;  3LDT A;  1N8R H;  2F9Z C;  2DT4 A;  2HP3 A;  3MBM A;  1Z5V A;  2AMT A;  2L26 A;  3CB2 A;  3O85 A;  5CB4 A;  4ZHW A;  3TD4 A;  1FFX B;  5CA1 B;  1PXW A;  2GZL A;  5JVD A;  5GON B;  1VHA A;  5HY1 A;  1JFF B;  4X20 B;  3RYC A;  5EB0 A;  3ZP7 A;  4BW0 B;  5EWR A;  1T0A A;  1S72 F;  2PMP A; 
#chains in the Genus database with same CATH homology
 3VI6 A;  5GAP K;  2AIF A;  3LWP C;  1W2B F;  3E20 B;  3JCM M;  2FC3 A;  4BVQ A;  3CPQ A;  5HY0 A;  1VQ8 F;  2OTL F;  4LCK A;  3OBW A;  1VQP F;  1YJN F;  1IPA A;  3NVK E;  3LWQ C;  2KTV A;  3CCV F;  3V3T A;  2VGM A;  5HXU A;  1Q7Y H;  1QVG F;  3CCM F;  3IR9 A;  2KTU A;  1Q81 H;  3V7E A;  3CC2 F;  3CCE F;  4BVT A;  1SDS A;  1X52 A;  5EO3 A;  4NUT A;  1XBI A;  2JNB A;  1T0K B;  1VQ6 F;  4BY9 D;  3NK6 A;  3RA6 A;  3CCJ F;  2OTJ F;  3CCS F;  4NQ3 A;  3RA5 A;  1W41 A;  1VQL F;  2GLZ A;  3D00 A;  3J81 M;  2CZW A;  2LBX A;  3CCR F;  3NVI B;  4EI9 A;  1KC8 H;  1E7K A;  3I55 F;  3CMA F;  1QVF F;  1CN7 A;  3SIV A;  3J80 M;  3OBY A;  5A2Q M;  1M1K H;  1K8A H;  3PAF A;  1K73 H;  1RLG A;  3CCQ F;  1YIT F;  1YIJ F;  1VQN F;  3G6E F;  3CME F;  4EI8 A;  3CC4 F;  3HJW C;  4X3M A;  1VQ5 F;  1KD1 H;  2LBW A;  5GIN C;  2VGN A;  3WXM B;  3GYQ A;  2QA4 F;  5GAN K;  1NJI H;  1K9M H;  1M90 H;  3LWV C;  5HY2 A;  3HAX D;  5GIP C;  3CPW F;  3J7A R;  3MCA B;  1X7P A;  3N4Z A;  5G4U C;  1W42 A;  1ZWZ A;  3E1Y A;  4EI7 A;  4XCQ A;  2HVY D;  3CG6 A;  3CCL F;  1GO1 A;  4BVS A;  3G4S F;  2BO1 A;  1VQM F;  3CXC F;  5FJ4 C;  1YJW F;  3NMU C;  5IT9 M;  1YI2 F;  3OW2 F;  2OHW A;  1Q82 H;  5G4V C;  2OZB A;  1JJ2 F;  2QI2 A;  1YJ9 F;  1VQ9 F;  4BVR A;  3SIU A;  1GZ0 A;  1NMU B;  2WAL A;  3PLA C;  1CK2 A;  1H7M A;  3V7Q A;  3I56 F;  3CC7 F;  2KG4 A;  3VMF B;  3N4Y A;  5HXZ A;  1Q86 H;  3CCU F;  1VQ7 F;  1RA4 A;  4X3L A;  5HWE A;  1VQ4 F;  3AGK A;  1W3E X;  1N8R H;  2F9Z C;  3FFM A;  4TZZ A;  5DCV A;  2FGY A;  3JAM M;  2QEX F;  3O85 A;  3LFO A;  1VQK F;  1KQS F;  1PXW A;  5FLX M;  4C4W C;  2I6D A;  1X7O A;  3CD6 F;  3NK7 A;  3ON1 A;  5HY1 A;  3LWR C;  1W40 A;  5HY4 A;  2ALE A;  3G71 F;  1DT9 A;  1VQO F;  1YHQ F;  4BW0 B;  5EWR A;  1GO0 A;  1S72 F;  5GIO C;  3LWO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...