2HVZA

Solution structure of the rrm domain of sr rich factor 9g8
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
101
structure length
101
Chain Sequence
b'MKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRKLLEVLFNGPLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor, arginine/serine-rich 7
publication title Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 10
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hvzA01
4UQTA 3G6ES 2CQ2A 1A7GE 2M88A 4J5OA 2MQLA 3VF0B 1Q86T 2LEBA 2CQDA 1WI8A 3TO8A 4U67Q 2LECA 1VQ9S 1YI2S 2LEAA 3IWNC 1WF1A 2F3JA 4ERDA 5MLCV 1VC5A 2MZ1A 2YTCA 1VQNS 2CPDA 2ADCA 2HYIB 2M52A 4M5DB 2DGTA 2CQGA 5GVQA 3US5A 2AD9A 4OZ1A 3V4MA 1X5TA 1AUDA 2CQ0A 2EVZA 3CPWR 1U6BA 2OJ3A 2MKJA 2DK2A 2DNRA 2LCWA 5GMKa 1KC8T 4C4WA 1P1TA 2XNRA 1FO1A 3P49B 3FEYB 3MXHP 1W2BR 4WF9Q 3MUMP 2MQQA 1H2TZ 2G1DA 2MYFA 2CJKA 2G4BA 1DBDA 1X4HA 1S72S 2J76E 2FPHX 3MD1A 3CCUS 3NS6A 1U2FA 2XS2A 1ZH5A 2YH0A 1UP1A 2U1AA 5D78A 3I56S 2CQ1A 4IUFA 2L9WA 1OPIA 4CQ1A 3CCRS 1WELA 3IRWP 2DNKA 4WKRA 1X5OA 4Z2XA 2KXNB 2MKIA 3R1LA 3CC7S 2XS7A 3HI9A 1N54B 2G0CA 1VC6A 1N8RT 1X4BA 2CPZA 1R8HA 2MZJA 2BOPA 2BZ2A 1FNXH 3MURP 1YJNS 5LJ5Y 3UD3P 1N88A 4TU9A 5DM7Q 1WF2A 4TU8A 2N3OA 3CUNA 1SJFA 2DHXA 2MZTA 3H2UB 3SDEB 1A9NB 4WIIA 2RU3A 4IOCQ 2E44A 1HL6A 1VQMS 2JRSA 4YOEA 2X1FA 2LQ5A 2MHNA 4Y00A 1DZ5A 1Q81T 3NNHA 2J8AA 3S6EA 4F25A 2MQNA 1VQ7S 3MI7X 2RT3A 4WFBQ 3G9CA 3G8SA 2LMIA 1NO8A 3B4MA 5DM6Q 2CPJA 3NMRA 3EGZA 3S01A 3LQVA 2DITA 2KVIA 2AYGA 1VQKS 2DH9A 3CCES 1RKJA 2WBRA 2KH9A 1F9FA 4QU7A 1VBXA 3MDFA 2CPXA 4W90B 2JWNA 2MGZA 1X4FA 3CCSS 5IM0A 2YH1A 2DNHA 2MKKA 1FJ7A 2KRBA 2CPFA 4FXVA 1DHMA 3LPYA 2UP1A 2QA4S 2M8DB 2OSRA 1FJEB 2JVOA 1X5PA 2MKSA 1X4AA 1QVGR 1FXLA 2KYXA 2XSFA 1UAWA 3PIPQ 1K9MT 1KD1T 1N52B 1UW4A 2E5IA 4WFNQ 2DO4A 2VONA 2FY1A 1YTYA 1DRZA 1D9AA 2XNQA 2LA6A 2M0GB 2N82B 2A3JA 2LXIA 4ZKAA 2LKZA 5JVHQ 2CPEA 1HA1A 5GAHU 1NJIT 3CC2S 2DNPA 1WEZA 1FT8A 1VQLS 1OWXA 3THPA 3ULHA 2MQPA 5GAEU 2VOPA 1O0PA 1H6KX 2DO0A 4IOAQ 4WCEQ 3D2WA 2DNGA 1Q82T 2KXHA 3CCJS 1VBZA 1JJ4A 2OIHA 3G4SS 5HL7Q 2KI2A 1M5PC 2FC8A 3CMAS 4PKDB 3I55S 2DNLA 2MZQA 4YUDA 2OTJS 1H2VZ 5EN1A 2MKHA 1M5VC 2KHCA 2MJUA 2E5JA 3MUVP 3MOJB 5DETA 1VQ5S 1OO0B 3FEXB 3S7RA 1K8AT 2SXLA 2RVJA 4QPTA 1JJ2R 1WEXA 2E5HA 5BJRA 2DGXA 3J7ZT 1FJCA 3P3DA 2ZJQQ 3CCVS 4F02A 2B0GA 2U2FA 3MD3A 2ZJPQ 2J0QD 1U1QA 3VAJA 1WTBA 1FHTA 3Q2TC 3RW6A 2E5GA 2DGSA 2D9PA 3Q2SC 3CCQS 1VQ8S 1M5KC 3CCLS 2MY7A 2DISA 1OIAA 2M9KA 1U1RA 4V19X 1WWHA 1SJ4P 1VC0A 3CULA 2O3DA 1YJWS 1WF0A 2DIVA 3PIOQ 4F26A 2DNNA 2PE8A 2M8HA 2CQ3A 3P6YC 2CQIA 5LXRA 2EK1A 1K73T 1KOOA 2DIUA 2MSSA 3BEGB 5DDQC 1L3KA 1X0FA 3SMZA 1H2UX 1U6FA 2L08A 2LXUA 3VAIA 4Y0FA 2X1AA 3UCGA 3S8SA 3VALA 2JX2A 1R8PA 4TLQA 2GHPA 3CTRA 2MPUA 2KRRA 5CYJA 1URNA 2KM8C 3CD6S 3U1MA 2MQMA 2DNQA 2N3LA 2KFYA 1BY9A 3CC4S 2F9JA 2JVRA 3UCUP 2FC9A 3VAHA 2KXFA 1SJQA 2DNYA 1KOHA 2LA4A 1VBYA 1WG4A 2MB0B 2DHAA 2LYVA 2K8GA 2L41A 2RQCA 1PGZA 2DB1A 3CF5Q 2HGLA 2RRBA 3CXCR 3K0JA 2DH7A 1XN9A 4BS2A 1U1MA 1KQSR 1VQPS 2CPYA 5GAGU 2MMYA 2PEHA 5DDRC 2M7SA 2YKAA 2F9DA 3BS9A 2DHSA 5CA5A 3R1HA 4TU7A 2CPIA 5LXYA 1X5SA 1WHVA 1WHXA 1QVFR 1G2EA 2CQBA 2M70A 3MUTP 4RU2A 2QEXS 2XS5A 1UFWA 2OSQA 4PRFA 3BO4A 2RUGA 2KG1A 3UE2A 1M90T 2M4MA 2MXYA 1ZZNA 1VQ4S 2MGZB 2CPHA 5IM0B 3BO2A 2CQPA 2MZRA 4CH1A 2CQ4A 1U1KA 2HGMA 2DNZA 2XB2D 1S79A 1SXLA 2DGOA 3OW2R 1SJ3P 2RS2A 2AYMA 2YWKA 2D3OR 3H2VE 2KN4A 4PR6A 4P6QA 1U1NA 2FHOB 3U1LA 4YB1P 2EK6A 1JJHA 3CCMS 3VAKA 2HGNA 2X1BA 3VAFA 3BO3A 2DGUA 3R27A 4CIOA 3TP2A 1X4EA 3P5TL 1IQTA 2J0SD 3SDEA 2MZSA 3DXBA 2DGWA 2HZCA 2X1GA 4IO9Q 3EGNA 2DHGA 5IQQA 5IFMA 2MJNA 2RRAA 4LMZA 1WI6A 2V94A 2K3KA 1X4GA 2KT5A 5JVGQ 1U1OA 4LIRA 4ED5A 3UCZP 2OTLS 5D77A 4QQBA 1WG1A 2RNEA 5LJ3Y 2ZJRQ 3VAMA 2I2YA 4UY8T 1M5OC 5LSOA 1WEYA 2NZ4A 2ADBA 2AYEA 1U1PA 4C0OC 1YIJS 3G71S 5LSLA 3NNCA 3TYTA 5GADU 4WFAQ 1HD1A 2RQ4A 3THTA 1SJRA 2RS8A 2VODA 3SXLA 2M2BA 2HVZA 3N9UC 1WHWA 3VAGA 2DGVA 3UWTA 3ZZZA 2MQOA 3CMES 3NNAA 2DGQA 2Q79A 1JMTA 2D9OA 4QU6A 1P27B 3J7YU 1CVJA 3EX7B 1VQ6S 1YWXA 1NU4A 1RK8A 3G96A 2KM8B 2DNOA 2GO9A 3DLLQ 1HD0A 3UD4P 2NLWA 5FJ4A 2MY8A 3B4DA 1YHQS 1YITS 2DNMA 1WHYA 3RW7A 3HHNB 5CXTA 1WG5A 2CQHA 4CH0S 4W92B 1B7FA 4C7QA 2MKCA 4OZ0A 2I38A 5ITHA 5DDPC 1YJ9S 4A8XA 1ZZFA 5HO4A 2VOOA 3JB9k 1U1LA 1VQOS 5H1SV 1QM9A 2KG0A 3NS5A 1X4CA 2N7CA 1M1KT 3ZZYA 3G8TA 2QFJA 2MSTA 4EGLA 4LJMA 1X4DA 5DDOC 1Q7YT 2ERRA 1PO6A 4FXWA 2CQCA 2KU7A 1D8ZA 2DH8A 2AYBA 3L3CA
chains in the Genus database with same CATH superfamily
1FTRA 3ILIA 3FDSA 3I32A 4WK3A 4HDHA 2B5JB 2CQDA 4FBUA 2LECA 1C0TB 3T1YJ 3N6MA 4OIXA 5A6WA 5K8OA 1VC5A 2D74B 4OYIA 4DJBA 3Q8QB 1VRUB 2PFDA 3D54A 3US5A 2WW4A 2GIFA 1OSCA 1KP6A 2FVRA 4V1Ak 2F65A 4B3RF 4ECSA 3ISZA 1Z2ZA 1VIXA 2HFVA 2ZOFA 1OSDA 4KFBA 4J90A 3IM9A 3G82A 3T1HJ 3W65A 1Q8IA 5HP1A 2BANA 3Q8RB 3MTJA 4NCGA 1VC6A 4L3NA 1PG5B 3NMAA 2ZD1B 2AIRB 3N6LA 3LP0B 3GYGA 2ZBPA 1S7IA 2QN6B 1UWAA 3GYNA 4IFVB 4FP9A 2G2OA 1DZ5A 2BABA 2W7OA 4NLPA 4X64J 3BH7B 3WZ0A 2RT3A 5HROB 3BF4A 3B4MA 4CTAA 5HMWA 3S01A 1BWVA 1K0TA 2AKWB 1JKHB 3MOZA 2WBRA 4OZ3A 2JWNA 4WXOA 2X7IA 5IM0A 1MMDA 2RE1A 4LF7J 4I7FA 4TN2A 4FXVA 1DHMA 3U02A 5D3GB 1IKYA 2YNHA 5KFNA 2R8JA 2GVDB 2XSFA 3GJTB 3EYZA 5KG4A 4HLBA 3AXMA 4IG0A 3NOCA 3OTOF 2LKZA 2RILA 1RT2B 3CC2S 3DU5A 2E1CA 2AV5A 3THVA 5GAEU 3VGTA 3CJ0A 1S59A 5HJYA 3D2WA 3RG6A 4P73A 2ZNYA 3Q22A 2PO4A 4NLXA 5T41A 1QSLA 5KT7A 4Q8EA 3MEDA 3ENAA 2GJFA 4OYWA 1SC1B 2V0NA 3MCNA 2W25A 4CO5A 1G3OA 3CDWA 3OR1B 4PQAA 3LF0A 2ZJQQ 2NUHA 4CLZA 2U2FA 3ZZOA 1FHTA 1EAYC 5E5NA 1N48A 3RW6A 3FBBA 3DRSB 4IQMA 3W5YA 5KAKA 1JLCB 4E2FB 2W8LA 3CCLS 1WDDA 1U1RA 3AT1B 1UWBB 4PWDB 1SL0A 3TZXA 1IBCB 4X4QA 4EO8A 1QAIA 1NJYA 4F04B 1HLWA 2EK1A 4ED0A 3MECA 3PEHA 2RDDA 3NL0A 4MMOA 4LSNA 4I69A 1XIQA 2OFHX 2W2NP 3QQCD 3OSNA 1AYEA 5ETQA 4YQWA 4YB6A 2LA4A 4P2XA 4HR2A 3CW2C 2R7QA 2RQCA 3PW4A 2ZH6A 5KT5A 1FKOA 3CXCR 1CG2A 1GMWA 2CJAA 4JV2A 1Q0NA 2DRAA 2VPXB 4LVNP 4BS2A 1VHIA 3OLAA 1KQSR 2MMYA 5IC6B 2AZ3A 5E7OB 2W24A 2V67A 3GSDA 1UEUA 2Z2LA 1G2EA 2XS5A 4PRFA 3BO4A 2IRYA 5ETVA 5DGBA 1IR2A 2UUAF 5IZHA 1UVIA 2QL7B 4CM2A 3OW2R 4CLSA 3AY0A 3I0RB 4ID5B 4ZPAA 2HWIA 4PQUB 4A8KA 2VFRA 2R8HA 1UVKA 1IKVA 1NPKA 3KLHA 3PNIA 2FVQA 3TP2A 1RTIA 5B0DA 4B3RJ 1SL1A 3GJRB 3PYDA 3DMJA 4ZJLA 2OD6A 2J7KA 3DRYA 5JVGQ 3VVUA 5DZ7A 4X4UA 2BYCA 4HACA 2GMLA 5J1NA 3NGRA 5LSOA 3M32B 2AEMA 1S9GB 3R5JB 1NK6A 3NNCA 2ROPA 1SJRA 2EXUA 3JTNA 2ZKUA 4QU6A 3BBBA 2J0XA 4LFCF 3KLGA 4NL5A 4X84A 1WC1A 1HPZA 4NA3A 2B6AB 2AX1A 1S49A 1NKEA 1UVLA 2L3MA 5G4DA 2N7CA 3V2UC 4N76A 1JXVA 4EGLA 5DDOC 3PX4A 1RAOA 3RB4A 3MM8A 3KJFB 1QE1B 2AYBA 2DH8A 1CS4B 4BWJA 5DQHA 1BHNA 3QO9B 2MQLA 4J9OA 1BE4A 1S77D 2YQ3A 4M5DB 1S1UB 1X5TA 2ZUGA 1Y4ZB 2PN6A 3C8YA 4PG5A 2OJ3A 2XMWA 4QIGA 4A8OA 2P2CB 4RZRA 1S4EA 1LFPA 2G1DA 2DXEA 4ZLJA 1U7LA 2E5LF 2J76E 3EXYA 5J2NB 1TMMA 2BE7D 4NX9A 1RXOB 2Y1RI 5DZ6A 4LRFA 2BRKA 2G0CA 1G7CB 1R8HA 2MZJA 3TAMB 2DEIA 1LW2A 1NNDA 1GXUA 2YWWA 2Q6CA 5DM7Q 1SJFA 2MZTA 1D3WA 3CB4A 2XI2A 1HL6A 3SV3A 4YOEA 4OI6A 4DL4A 4F4ZA 3IAM9 5KFDA 4KR0B 4ZLNA 3G8SA 3C15A 1YJVA 2JEGA 5I3UA 4ZVTB 3LQVA 2QLFB 4O4RA 3DLKB 2CVIA 5FLXY 1UVNA 2JLEA 3MDFA 5T7LB 1IBLJ 1CJTA 2DNHA 1CC8A 2LLZA 3W2VB 2HHWA 2V2ZA 4U8YA 1J5EF 3HO1A 1LWEA 1QAXA 4PG7A 2XNQA 5GAHU 5C42B 1OY8A 1VQLS 1AT1B 1LV5A 4IOAQ 3TQEA 2OIHA 5CQGA 3O3LA 3EDQB 4H4KC 4DFJA 1M5VC 1CBKA 1TU0B 5GAGI 5CD4H 4DF8A 3W8PA 1VISA 3UPFA 4R5PA 4Y2AA 3TA2A 5B09A 2ZWPA 1YX2A 3IXQA 5B0AA 1FJCA 3CJKB 1LFWA 5HVHA 3J80Y 1YBUA 3MD3A 1S6OA 3MR5A 3AQOA 3HULA 3FCHA 2NXJA 3QAEA 4F67A 2RKIA 2KJVA 2DISA 3MEGA 1ZETA 1WF0A 2ILZA 1HI0P 4AD6A 1NSPA 2FTRA 3BREA 5LXRA 1K73T 5L8RC 1JLEB 4KHPF 3IR6B 3Q8UA 4LFCJ 3KK1B 3R2CJ 4NLSA 3C16B 2MQMA 5ETSA 4FKXA 2KXFA 4K50A 5ETPA 3MMAB 3MAAB 3A3PB 1K1SA 3BR8A 3R7BB 1A6LA 1IBKF 3ETOA 4NLYA 1TL3A 2XYHB 2DHSA 2NS1B 3OSPA 3SEOA 4DV5J 4N77A 1Y9OA 3D6MB 1VYAA 4ECWA 4A8WA 1ZZNA 1VQ4S 1RT3A 2QMXA 4JI5F 2QSWA 3M6WA 1WOSA 1APSA 3HCXA 4NLOA 2JFDA 4ED1A 1VRQC 2YKOA 1TKTB 3BYRA 4K4XA 3U1LA 4I1TA 1JLCA 1JJHA 3GR1A 4BCAA 3HSJA 3MAQA 1WD6A 2FJBB 2HZCA 2L9NA 3LWLA 3I5CA 3GIJA 1TL5A 4QQBA 5DLGA 3JQKA 2G9OA 5A8RB 2VIHA 4QIVA 2V4JA 4KO0A 3KDOA 4ECRA 2RS8A 2CADA 2MQOA 3FSIA 1GXLA 3E01B 1RHJB 2CJBA 3PM9A 1M0SA 1HD0A 1YITS 4J9KA 2CQHA 2OPRA 3B78A 2HZVA 1TKXB 4A8XA 1BC6A 1QLNA 1RUSA 4DCOB 2YQ1A 3SSSA 3G8TA 2QFJA 2COLA 4N5SA 4H4KA 2EKNA 5DJBA 3GFZA 1TVRA 3MEEA 1NDPA 2NXEA 1RWXB 3DRPB 3ZXWA 1U4BA 1F3FA 2UVRA 4LF4F 5B0EA 1GMWD 4IRCA 2ASDA 1UL3A 4DUTA 4WPAA 3CE8A 4WP3A 4CCHA 1R0AB 2HYIB 3QIPB 1JLGA 3KNGA 4YB7A 4F2SA 2F8EX 2CQ0A 4AUKA 4I2QA 4ER8A 1OMSA 1NMEB 3OFFA 1SJ1A 3QSIA 3BDEA 4C4WA 1P1TA 4DBQA 2E1MC 3M32A 1FO1A 3TX8A 1S9GA 3TAQA 2VHGA 2G4BA 2E1PA 1YJTA 4IKAA 2KZZA 2CNKB 1KVJA 3NGSA 3IRWP 4WKRA 2KXNB 1NSQA 3C14A 3I4HX 4I68A 3MM7B 3DRRB 4NZ7A 3KK2B 3MM9A 2ZE2B 5AT1B 3UD3P 1S1WA 1LWFA 3P45B 4UOHA 3SYZA 3KJNB 5L1KA 2WSFC 2DHXA 3SDEB 1D1UA 2HQCA 5BYRA 3J7A1 3NCQA 3POTB 4G6VB 1NK0A 3B82A 1SIZA 2LMIA 4KHPJ 1QE1A 2IAJA 4M5KA 2DITA 1MG7A 5CYMA 1NB7A 2P8IA 1SV5A 3LALA 4OHWA 3DDNA 2MGZA 3TZWA 3QJPA 3CCTA 3N0VA 1IBMF 2MKKA 4CLPA 1KNZA 2M8DB 2AGOA 5LT5A 2JVOA 1QVGR 1KLNA 3MM6B 2ZHAA 1L3SA 3RR8A 2VZ9A 4RBVA 3PO4A 4J9NA 2FJDB 4AYBD 2NPFA 2LXIA 3LW5C 1RBLA 3GCWP 3UFCX 1RB0A 2W2QP 1S1TA 4JI8F 3AJ1A 1PCAA 4ANDA 3Q8YA 1H6KX 2DO0A 1ZTTA 2HPUA 2DNGA 1AZSB 3OR2A 4JI5J 1BLUA 4CYUB 3A8JA 1N33J 1N5TA 3CMAS 5KTQA 2V5HG 3SCJE 4ZVHA 2KHCA 1B0VA 4O0IA 5HANA 4E8UA 2ZH9A 3HT3A 5HMYA 1S1XA 3LP2A 2Y3YA 1X9SA 3HP6A 1I3OB 1ROFA 1RWNB 3M2UB 1QSSA 3M8SA 2W2PP 2CJXB 2GS8A 3RRHA 4OI1A 2MY7A 2XQCA 1F2HA 1IM4A 3DLKA 3PIOQ 1UJ5A 4K8RA 3LTOA 1RBOB 2ZITA 4FKYA 2XSJB 1L3KA 1X0FA 3KXDA 1NEEA 3PZPA 4B3MF 1OJ4A 2ZH4A 4LF8J 4EZ6A 3L7UA 2FLPA 1XWLA 3OTCA 4EUVA 5F8LA 4GC6A 4KPCA 2ALYB 4C9DA 1Y11A 1D9FA 4LBPA 4DG1B 2GGPA 2ILYA 4ZIWA 4OV6A 3D67A 1TUGB 2F4FA 3BPDA 5D0HA 2DBBA 4RBUA 3DLGB 4QBUA 4D3GA 4X65J 4LF4J 1UFWA 3KG0A 3UE2A 1S0MA 2V9KA 4BLGA 4OYMA 5F3TA 3P8BB 2MXYA 2CPHA 1WOOA 2CQPA 2PSZA 5D0GA 2R2RA 2GAGC 3OPKA 4YB1P 1RT1A 1EB0A 4L6V3 1HIYA 1NH8A 2IM2A 1OYDA 2D69A 1K1QA 2DEJA 2HNYA 3Q8SB 4UTGA 3H90A 3CCZA 3PFOA 2V8VA 5EDWA 2MDAA 3QZ7A 1RAAB 4ED3A 1HR0F 3D6HB 3C16A 3KG1A 2HNDA 1NJXA 1RLCL 2HAIA 1WHWA 1RWUA 3MMBA 3DKDA 1NK4A 4YR3A 3J7YU 4GKKF 1U02A 1BMQB 1R8CA 1W26A 3ZZRA 1S5ZA 3PVXA 1WG5A 2NZCA 4DPTA 2ZC4A 4W92B 1D09B 4ZPWR 4DR7F 4LFAF 3G8QA 1ZZFA 2IYIA 1VQOS 4X4VA 1X4CA 4RNOA 2C3PA 1IBMJ 2J6UA 1U48A 2HVEA 3MGJA 4FXWA 3IRXA 2W8KA 2M88A 4TY8A 4WZQA 1RBAA 2R2SA 3TO8A 4Q0BA 3D28A 1I5OB 2B8QA 1V9OA 2L48A 4URSA 1QSYA 1EIYB 1FWKA 1Z1ZA 5HK4A 8ATCB 2CQGA 1RWWB 3N5BA 3D68A 4WP8A 1NKBA 2VFVA 3SQGB 4K0KF 5K9FA 2DK2A 5IT0A 4WF9Q 4NZ0A 3KLIB 1S72S 4HT5A 2FPHX 3DOLB 1AXQA 2JHEA 1ZH5A 5A8KA 5D78A 1LNQA 1NXIA 5LSRA 3DYAA 1GFWB 3DGPA 3LGNA 3R1LA 4USUA 3TRGA 1N54B 5KT6A 3HPOA 2HBZB 2C2KB 1BQMB 4ZJQA 2XHWA 1KQFB 1HQUA 4MKVA 2ASLA 4BC9A 4RUCA 3X1LB 4IOCQ 3FK4A 2RAQA 2CNNB 2PGCA 2XY7A 2J8AA 1YLXA 3HJVA 2DYAA 1GNKA 3MI7X 3BGOP 1NO8A 4B3MJ 2AYGA 1KEKA 3ZTOA 3A12A 3IAS9 3G6YA 2E66A 3SSRA 3HSDA 1QD1A 2CPFA 3LPYA 1VQSA 3I9ZA 3EMTA 1S9EA 3IFEA 4DSKA 2HMIB 3RYLA 2B7BB 5I3PA 1UW4A 4P72A 1RHRB 2KDOA 1F5BA 4MTPA 2LA6A 3AJDA 2WB4A 3GPAA 3BQ1A 3KLVA 5J2PB 1URRA 2DNPA 3QYYA 4X4RA 4U7UK 2FB0A 3ULHA 1O0PA 3QGPA 3DOKB 2Y1JA 1Q82T 2HIYA 1T9WA 2BXJA 3I6PA 2O1PA 3PFEA 3U1NA 1MROA 1XBWA 4JI4F 2JLGA 4PYAA 3BR9A 1WKJA 4I56A 3TX0A 2QL9B 4P71A 4EI2A 4F02A 4DX6A 1DQ8A 1X31C 2J0QD 3KFWX 2J9EA 3JYTA 1T3OA 1OIAA 3HHLB 3GV7B 1NSKL 3BGUA 2O3DA 5DQIA 1HR0J 3K5MA 3GONA 4P75A 2VQEF 4QPXA 3BEGB 2Z30B 3C66A 2IYGA 4GKKJ 3H7HB 1URNA 5E2QA 3NS7B 2ATLA 3LANA 3VAHA 2QSFA 3AD9C 1KOHA 3GG0A 5GADI 2V2VA 2D1CA 4C6AA 4R8UA 4LFAJ 2Z58B 3I4PA 4OJHA 1E6VB 1YGYA 1WJ9A 2AEFA 2RQMA 3HZEA 2XMAA 1X5SA 4DCPB 1WHXA 3H4DA 3N79A 4CLFA 2JC1A 2ZNZA 4B9SA 2JEIA 3RUBL 2ACMA 3IG1A 4DQIA 3NXZA 2DNZA 3DLEA 2KKHA 3OVSA 1SC4B 3C2PA 4M5JA 2HQGA 3M2UA 5SZTA 1XC9A 1ZBTA 1U1NA 3TI0A 3KLEA 4K0KJ 2EK6A 4ZVSB 3G87A 4CH7A 1YZ7A 1O5JA 1HWJA 1FI4A 4IO9Q 2DHGA 1MMNA 2R7SA 2E1AA 6AT1B 1RU2A 1S97A 1X4GA 3D6FB 1CULB 3PO5A 3QIDA 1SPBP 2VG5B 4UOGA 3K8WA 1U1PA 4ZVUB 2AJ2A 5EX3A 3HMJG 2V8PA 5LSLA 3TEGA 2OHDA 4R0EA 1ZA2B 4USMA 3KMQA 3GWCA 3QRQA 1TV6A 2I5JA 4M5GA 1K44A 2JSXA 3LUYA 2W9BA 2UVWA 2RF2B 3H25A 2RQKA 3IA0A 4OX8A 2NYHA 4BWMA 2NXNA 3JSMB 2V4QA 1YBTA 1IKWB 4RNNA 3W1YC 1S7HA 1NK7A 3EPGA 1FWPA 4LJMA 4NA2A 3W60A 1Y3KA 2XMVA 5FDLB 4C0BA 2ZEJA 4PAAA 2UUBF 5A76A 5H9FJ 4ZMMA 1XNQF 2FDNA 3IGNA 4USWA 2PA8D 4ELUA 1TL7A 2F3JA 1N6QB 2R7OA 3R5CA 4ZOSA 4K5SA 5HJXA 2DR9A 3ZTSA 1YJ7A 4EFAC 3D1OA 3V4MA 1AUDA 2Z4PA 2EWHA 4DZDA 1KKHA 4JI4J 2XNRA 2CXEA 4K2JA 4Q8FA 4DV3F 2LQ9A 2C3YA 4D3HA 3PDNA 2IHR1 3AFGA 5KFSA 2C3OA 1JLBA 2V8DA 2XS2A 2YH0A 3UN2A 4X4SA 1OPIA 4J9PA 3L9ZA 1J5OB 5G0RA 6FD1A 1T9XA 5ADZA 2JH3A 5E33A 4ENOA 2XZDB 5D0RA 1YK9A 3MURP 2YNGA 2XZTB 1FK9B 5CH7B 3CUNA 3HHLC 1IWAA 2HURA 2HHUA 1A9NB 3OV7A 2KB2A 1EP4A 2UV8G 2W9AA 5CD4A 4ILLA 3S6EA 3A1YG 3RR7A 3KWMA 2IA0A 1DTQA 4NA1A 2IMWP 5KFUA 1VBXA 2CPXA 3OHAA 4AXJA 1YSJA 1DY3A 2Q1LA 1XR5A 3BGRA 1JLAA 5D0EA 1TTHB 3GIIA 1FJEB 3GFXA 3O2IA 4FPRA 3MMCB 1PC4A 3HVWA 4WFNQ 2PEBA 1LK7A 3BJYA 2WK4A 2EG2A 2YKMB 3C6TB 3ENVA 3AH6A 3NCPA 2J8SA 3FRYA 1FFWB 4USTA 2VOPA 1YDLA 1D0EA 4ZCKA 3FMWA 3NWRA 2FC8A 1DQ9A 4YUDA 2C2EA 1FA0A 1U8SA 5EN1A 4CDIA 4P7TA 4GVBB 1S6PA 4ANCA 3MUVP 3Q8PB 2IC3A 3MOJB 3HKZD 2VBWA 4L74A 2MKYA 2F1FA 1RGVA 2VPZB 3JAMY 2UVUA 3A3NB 4BHQA 2WOMB 3DM2A 2HFSA 2QO3A 4X4PA 1O8BA 3PV8A 4X66J 2ZH7A 4B17A 2B7CB 3M2VB 1TL1B 4O3SA 3LAMA 5D4OA 3TUIC 2MLZA 4B3SF 4GKJF 1RAEB 3W61A 3HVTB 2GMHA 4OI3A 2W9CA 5D4PA 2WCXA 1T9YA 5F3ZA 1RAHB 2DIUA 4DN0A 2HNZB 4YS2A 3NGDA 1U6FA 3PG9A 2HMIA 1RWOB 1UZDA 1B70B 2B56A 5U47A 2O66A 1BY9A 4M5HA 2F9JA 4C97A 1WTFA 4EWTA 2W7AA 2VBYA 2UXDF 3HX9A 3O5TB 1CJKA 1R31A 1KSPA 3HLUA 1UJ4A 3A8IA 4LF5J 1WHVA 4IYQA 1SKRA 2UUBJ 3DXSX 1X0PA 1XNQJ 2QMUB 5KFQA 3KKFA 4XPEA 3UR0A 2MZRA 2HGMA 2PT0A 3IBFB 1S79A 2E7VA 4OX9J 4Y2CA 2AQ4A 3H2VE 4OYZA 4IR9A 4PR6A 1VGYA 2FHOB 3EZOA 3M8QA 1I51B 3VAFA 3BN7A 1NPRA 1RAIB 2J0SD 3DXBA 3OQ2A 4DV3J 3NGUA 1T94A 5IFMA 4C8MA 4DSFA 3HD1A 2YQ0A 3D1QA 1U1OA 3QJJA 1N5SA 7FD1A 6FDRA 2RNEA 4ZPBA 4IO1A 1NJZA 1LXNA 1HNIA 3RTVA 2NZ4A 1WKLA 1EETB 3J81U 4WFAQ 2RQ4A 4FPIA 2PDAA 2G1HA 3QT8A 4N47A 4G1QB 4WFXA 3ZZZA 1Y5LB 3WIUA 1TKZB 2HLUA 2QRRA 2DGQA 3W5XA 2ZDOA 3QATA 2RHQB 1RK8A 4NXMJ 2F8HA 2Y8YA 1HBUA 2XO7A 3BV8A 2Z2YB 1CQNA 2YNIA 4PCQA 4OYOA 1ULRA 1WKKA 5ITHA 2YX7A 2XLKA 2VICA 5I42B 2KG0A 2EFPA 5B7WA 2CDRB 2BE2B 4LVOP 3OVAA 5J2QA 2C2DA 2AJ1A 4QW8A 5KG5A 1OPZA 1X4DA 2XHCA 2YKNA 1Q8LA 3ZFVA 1BWEA 2IY5B 2X51A 2QYGA 1Q86T 2F7VA 2DR7A 3A8KA 3E3XA 1F1BB 4LRDA 2C42A 1TZ0A 5F8IA 4RW9A 1UA0A 2LFVA 3ITHA 4ECXA 4DR6J 5IC4B 4OYPA 1RHMB 4NLGA 4FBTA 1MW7A 4P52A 3J7AN 1C1CA 4IFYB 3MXHP 2MQQA 4O4GA 4KRWA 2PMHA 2DY9A 3H5XA 5GAEI 4QIFA 1R6YA 1TR0A 5A0YA 1Z2LA 3A3OB 3AQPA 1X5OA 2HHTA 2ROGA 1N8RT 2EFQA 3ILJA 1PJ5A 1FNXH 1YJNS 2EKYA 3DI6A 1SC3B 1RT5B 2Q66A 4GKJJ 4C11A 4HTJA 1HNVB 3NGTA 2E44A 4RNFA 3A8EA 1H98A 2O01C 4MK7A 2IM3A 3PRDA 3LPEA 4TNOA 2AEJA 2DHHA 2BW7A 2B9YA 2QTWA 1OY9A 1CJVA 5ETNA 3RB6A 4MFBA 4GRSA 1V6HA 1N6QA 2LDYA 1FD2A 1UTAA 3EVWA 3QT5A 2LQ8A 2VUGA 5HQMA 3ZO7A 2BM1A 2NSBA 2N82B 5GMEA 4LREA 3I87A 3AOBA 4ECYA 5HVGA 3ZZTA 4DU7A 2PC6A 1B0TA 5C25B 3PYGA 1TK0A 2VBXA 3M2RB 5HL7Q 2AGQA 1PC5A 3I55S 4CLYA 2DNLA 2OTJS 4ZVQB 4AXIA 2BVZA 2CUYA 1QTMA 4CZCA 5A2QU 5BYSA 2WB1D 5CZVA 5HQLA 1K8AT 2DD8S 3UNGC 1TMJA 2R4FA 3GP9A 4H4MA 4TYAA 2XG8A 2AJFE 4WYWA 2HFUA 2ZJPQ 3M8WA 1SH0A 2DGSA 3BQ2A 2IVFB 1UA1A 2QX0A 3H40A 3VGSA 2DR8A 3H59A 4KT0C 4KFBB 1UCNA 2BJEA 3ZTPA 1H2UX 3PX0A 1OY6A 2JDJA 2J9DA 2JZ5A 3UCGA 3SCIE 1LWXA 5HP1B 2BANB 2KFYA 4NCGB 4ZIVA 3FBCA 4C3MA 1ELOA 2YWFA 2ZZNA 2OFGX 2JFKA 3DDKA 4Y2KA 1E6YA 1T03A 4J9VA 5ETMA 4CTAB 3TVZA 3T9ZA 1QVFR 3VGUA 2IIHA 2R7UA 4EBCA 2OPPA 4NRUA 3IO1A 5IM0B 1U25A 4I7FB 2QA4G 2WOMA 1RKIA 2DCUB 3P5BP 1IKYB 2C22A 2AYMA 2H5EA 1RYSA 4P6QA 4QWBA 2YKQA 4CRJA 4IG0B 2Y1LB 3QZ8A 3ILLA 2BJ7A 1TL1A 1NUEA 3TANA 1FRHA 4B02A 1JLFA 2J6TA 2P9EA 3UN3A 1FVQA 3KUEA 3DFEA 1EARA 5ETOA 1LKZA 1N4LA 4MAKA 4JYAJ 1O51A 3K5LA 4UY8T 3MEDB 4URGA 2FY8A 1RADB 4DX5A 5C2CA 2GMJA 4F0KA 3IGVA 3R6LB 1RT4A 3I31A 4KSEB 2BKOA 2C28A 2GC8A 2C1EB 1N34F 2XBPA 2DNOA 3MCMA 2CWXA 4HTIA 3RW7A 5KFXA 3CVKA 4DF4A 1Q79A 3TWZA 3SCLE 2FLOA 3D0IE 2NREA 1IJEB 2QZ8A 2YVSA 2I38A 4DL2A 3ELHA 4OHVA 4QR0A 1RABB 2VJUA 3MECB 1RISA 1WACA 3K5PA 1IR0A 2HHXA 2CKWA 4LRCA 2ZOMA 4LSNB 1HNZF 4V19J 4IDKA 1HW8A 1X8DA 1YRUA 3M6VA 3TW0A 4RUHA 2J5AA 1FDAA 3BBFA 2XEXA 2XMJA 4B9MA 2JOQA 2VL1A 5RUBA 3CJ4A 3FEYB 3MUMP 1S4FA 5F8GA 1X4HA 1NK5A 2JC0A 5GAHI 3FGVA 3CCUS 1D9DA 2RH3A 2B9WA 3QRRA 3IWXA 1NHUA 1TKZA 3FKBA 1XMOF 1P6TA 2IDLA 4LSLB 4DS5A 2Z56B 1NSAA 5D8HB 3QT6A 2VKZG 3OTBA 1IKVB 3I5BA 3K8VA 3KLHB 2CG4A 1RTIB 4EYIB 3ET6A 2XGPA 4RW8A 4WIIA 2ZH1A 5KFHA 4E98A 5I42A 2MHNA 3IN5A 2AW0A 4PXEA 1Q81T 3DMJB 3WHIA 3D1HA 2FHJA 1SQEA 3CJQA 1YVFA 1R3NA 4NLWA 3BSOA 4Q5VA 4HACB 4ZP9A 4U8VA 1WC5A 4KGZB 1F9EB 3QMQA 1TAQA 5F9LA 2GVZA 1W7WA 3JQJA 5AXLA 4DPOA 4NXNF 1HW9A 4WIQA 1LEOA 4LRBA 3HVRA 1U0HA 2OSRA 1KVKA 1GX5A 1X5PA 1LWCA 1V3SA 2E5IA 4QWDA 4NRTA 2FY1A 2HKEA 1YTYA 3KLGB 5H9EK 5LM7E 5JVHQ 2R3VA 1B7YB 3H42A 2MEWA 4WKYA 4DL0C 4JP8A 4ZLPA 2BQUA 4B9VA 1HPZB 4LF9F 4K59A 5K8NA 3I0SA 3C6UA 1M5PC 4PKDB 3IS9A 4F3QA 3MM8B 2AJ0A 1T3NA 3K2YA 5DLFA 1RT7B 1C0UA 3DOMA 4ES3A 1VQ5S 4CT9A 4FVCA 4C8NA 1T95A 3S7RA 4QPTA 3D3BJ 1FE4A 2FJXA 3I5AA 3TEHB 1VR6A 4EBDA 1YRXA 4RW7A 4ZHRA 5EUHA 4ZPCA 1VQ8S 2IBOA 1RTJA 3CGIA 3KUGA 4DR3J 2WBMA 1FJGJ 2C3UA 1R0CB 3OD2A 4HDGA 3LWMA 2AMCB 5JUMA 1F3VA 3GIMA 2XCPA 2IBKA 2PI5A 4NYPA 2BX6A 1F0XA 1PAUB 1PILA 2ZBCA 1S1VA 4MIBA 2MQ8A 2JVRA 1LW2B 2IJFA 3FQKA 2DNYA 1YG0A 2L41A 3O6QA 3PJXA 4TXSA 2CVEA 3HT0A 3BKUA 4RX6A 4XPCA 2KT2A 1H38A 3C15B 4G3IA 3RBXA 3FMBA 4YEAA 1N36F 5I3UB 2OMOA 3MZIA 5IOLA 1HNZJ 4BBYA 3NAIA 3RAQA 5J1EA 3F41A 4YR2A 1JWWA 5E0OA 1CJTB 2LEPA 1U49A 2J6SA 4CH1A 1KFSA 3ETMA 5F0UA 3HZGA 3EJMA 1H72C 1LWEB 3VR1A 1P8GA 2YKPA 2X1BA 2KHDA 2DGUA 4ZCIA 4EU0A 3T41A 5ETRA 3HM9A 3M8PA 3D3CJ 4RWXA 1HHQA 3FZ2A 2OI2A 2KVQE 2ZBRA 1XMOJ 3GJSB 5LJ3Y 4IQXA 4F4WA 2HBRB 1M5OC 2UVVA 1ACMB 2V69A 4QOTA 3QWUA 3BSCA 4J9QA 1B64A 4DQSA 1U0SA 4U6PA 2FGCA 4R5PB 2DGVA 1IVZA 3GJQB 2HWHA 4M95A 4CLUA 1YWXA 2H4WB 4QW9A 4DZ6A 4DI6A 2VG6B 2HS0A 4L72B 1XTZA 3HHNB 2RKIB 3MMJA 4PXDA 1VRTA 2RJZA 3MEGB 1XMQF 4ETXA 5I3QA 2GJIA 5H1SV 1QM9A 2RMLA 4PG4A 5AJ3J 1KN6A 3ZZ0A 3MHYA 2B4OA 1D8ZA 3H5UA 3T19A 2HFOA 4O3NA 3N6NA 4RBTA 2XWYA 4KY3A 1FFSB 4C3LA 2I0XA 3QPIA 4B9LA 5D6GA 4LF9J 5HMZA 1WDTA 4OZ1A 2B51A 4ITSA 1TL3B 4DEZA 2QFIA 2C2OB 2CJKA 2MYFA 4F4AA 4ALZA 1RT3B 4CO2A 3L09A 3CMQA 4Y6IA 2O5DA 4J37A 4MJKA 3MFIA 5KFPA 5J2MB 5B0CA 1N5QA 1TUWA 2W1BA 3IBWA 4OMFG 2LDIA 1N88A 1Q8KA 2N3OA 3OL6A 2WVDA 5KFWA 3K58A 3NNHA 2XCAA 5BXIA 2H3EB 2JNJA 4U96A 1LK5A 2Y0SD 2KVIA 2OPSA 2DH9A 4EBEA 4HKQA 1RTDA 2DR5A 4DV6F 2V4JB 4KO0B 4AL6A 5A8WA 2WZ1A 4F7VA 5FLXU 4DFPA 2HQFA 2ROEA 3PIPQ 1KHVA 1DRZA 1D9AA 2BUNA 2N4CA 3RU0A 3CO9A 2MHEA 4KGMA 1WEZA 1T9TA 1N36J 2E9ZA 2OPRB 4K4WA 4DV0F 4DWIA 3OUYA 1G4CA 3G4SS 2KI2A 3KK3A 5D4NA 4FYXB 1TVRB 3UVJA 3MEEB 3AOCA 5K8PA 4LSLA 2H9ZA 2OPQA 1ZAWA 1U09A 3GB0A 4R25A 1UFLA 1SB6A 1R7IA 3O8WA 2RVJA 3TUJC 5K14A 1ZM3A 2DGXA 2GJ2A 4OLOA 1QDUB 4CNYA 3I96A 1JLGB 2E5GA 5C24A 2YWGA 3J80U 2D9PA 3CCQS 4I2QB 5HSPA 2V2QA 1WWHA 2C3MA 2P9GA 3AB4B 4RJVA 1KWMA 3K89A 3H8YA 3G2XA 3CO0P 1I1GA 1OQ3A 3FC9A 3RJMB 2FGOA 2LU2A 2NSCA 1AB8A 3MPVA 1DJ0A 5B0BA 2LXUA 4ZLLA 1BGXT 4Y0FA 4HH1A 2Z2MA 3M7VA 3C14B 2H51B 1HHSA 2N7YA 1JXLA 3MR7A 2WRMA 2DTJA 3MM9B 2FHJD 1SJQA 4RKUC 3VCDA 1S1WB 1LWFB 2VG7A 3FBFA 2LYVA 3FSXA 3KNAA 2FZCB 3K0JA 4J9LA 2DH7A 4QZVB 1NHVA 2CPYA 2PEHA 4WE1A 4XK8C 1SBRA 4RW6B 3J7YI 1GT8A 3R1HA 5LXYA 1QUPA 2HVHA 1S6UA 2IAJB 2VASA 5CYMB 1S6QA 1RT7A 4YHHF 1RHKB 1M90T 2ABYA 1SV5B 3OTOJ 3IR5B 2MGZB 5CZXA 3RAXA 1L3UA 3OXFA 1H7XA 2VDHA 3EVOA 2UU9F 4X4OA 1VS3A 4WK1A 5CHCB 1GXTA 2GQQA 4OLPA 4QWAA 2FJEB 2CZVC 1S1TB 4GC7A 2HHQA 1SKSA 4A8QA 5KFEA 1HYSA 3OR2B 4L75A 3VAMA 4P7VA 3UQSA 3T1AA 2D3O1 1WEYA 2FJVA 2E9RX 3G71S 1HKAA 1Z4UA 3BGLA 4ZPTR 3PACA 1N32F 4YMEA 1S1XB 1FRIA 3LP2B 2A6MA 1CVJA 1VQ6S 4KKOA 2V4RA 2KM8B 5IXUA 3BH6B 4IG3A 3B4DA 4DSJA 5IWAF 2VH7A 3QWPA 4HYKA 3VQSA 1PIEA 3CD7A 3R5BA 4DV6J 4WU3A 4LBHA 1BQNA 2MLXA 2R7XA 2ERRA 1J2VA 4K4VA 3ZNJ1 3NKYA 4WU2A 5EHHA 1ZAXA 1WF1A 2YTCA 2XULA 5M2RA 2G2ZA 2GGPB 2XMTA 4X4NA 2HEKA 4JBCA 5KG2A 2UUAJ 4CWBA 3GFHA 3TJ8A 3C3LA 2RSQA 4TKTA 4DMZA 4ICLA 1RAJA 3KLFA 1NH7A 1UEKA 3BDPA 3HHEA 4YY3F 2VB6A 5IT4A 2ZUAA 2J7UA 1FRKA 5IV4A 2Q43A 4KGXB 3GR0A 5AE1A 3TZYA 1FKPA 2VG6A 2HVDA 4DSIA 1RT1B 4WFYA 2WHOA 4DDFA 3V5RA 4JB8B 4M1KA 1DFDA 4NLUA 3AD7C 3AA9A 1VQMS 1H3DA 4EEYA 2HNYB 4MKBA 2MQNA 3RB3A 1PYOB 5DM6Q 1DTTA 2OAUA 2IMOA 5KFVA 1F2GA 2XO6A 7FDRA 1HBMA 3VQTA 2K2PA 5AE2A 5AXKA 3JS9A 1RT6A 2HNDB 1UVMA 2YH1A 3JSYA 3GYXB 4HI1A 3ZC4A 3MMBB 3NLCA 4C48A 2ZBQA 4JUZA 2IPOB 1TK8A 4M94A 1NK9A 3MPDA 1HA1A 4FYYB 5KG6A 1Y0HA 2CG8A 2C2RA 4YHHJ 4TQRA 3EWGA 1KLMB 2KL8A 3V4IA 3UD5A 1C1BA 3GZ7A 3BSAA 3QFHA 2CJQA 2UU9J 4PUOA 1FDNA 3IRXB 5J2MA 1FXRA 4TY8B 4A8SA 5HBMA 4Q0BB 2BM0A 1ZYQA 5JMNA 4ZP7A 5CYQA 1ZAVA 4N7TA 2E5LJ 4GVLA 2RIJA 3Q2TC 3H5SA 3Q2SC 4KGVB 2M9KA 4OI4A 4MK9A 3CJ3A 5DRKA 2R7RA 4DR5F 5SUHA 1U2CA 2OKQA 2ZH3A 2EFVA 1IKXA 1N32J 3SFGA 3SMZA 3KHHA 3KYLA 5A8KB 1RI7A 3W2WA 5CCLA 2X1AA 3DYAB 3M1VA 3DGPB 5M2UA 1R8PA 5CYJA 5EGYA 2MPUA 2KM8C 2AF6A 5IWAJ 3CC4S 4FN5A 2AJQA 1HQUB 2O67A 3CF5Q 2OEKA 2VC0A 1KR4A 1M1GA 1U1MA 4P2MA 4ELTA 1PSDA 5DDRC 4ZVEA 3U7JA 2V8HA 5DGAA 3T1YF 3R9LA 3HSGA 1J5EJ 4DV1F 1RTHA 2M4MA 5F8HA 2Y0BB 1RDRA 3NGKA 1N56A 3VWSA 1SKWA 3KHLA 5HLFA 3DRXA 3D7SB 2PMWA 4USJC 1S9EB 4KBIA 2AHOB 1PBAA 4CM0A 4PYDA 5B0FA 2C2ZB 2ZBIA 3EGNA 4QYRA 4C0HA 2RRAA 4YY3J 1WI6A 2XI3A 4LIRA 2WW8A 2IVYA 1MROB 2GQ2A 2ADBA 2AYEA 4LQ9A 3G6XA 1HD1A 4OYAA 1FEHA 4ZK7M 3SXLA 4I0WA 2HIQA 2FVPA 4A47A 1WOPA 1Q5VA 4USVA 2YWEA 1JMTA 2VBZA 5BYQA 3BKTA 2FLNA 3EX7B 1VIOA 4AQYF 2GA7A 1N5YA 2EW9A 3UD4P 3AA8A 3JYTB 4RW6A 5THWA 1ICEB 4J9UE 2MKCA 5DDPC 1L3TA 1HBOA 3PW0A 4NEZA 1OYEA 2OD4A 5KFFA 3NBPA 4K4UA 4CO1A 3L3CA 4FS2A 1IBKJ 1RAGB 4RNHA 1VQ9S 1VJWA 5MLCV 2A6OA 2XMMA 1VCTA 2DGTA 4ZPVR 4LT6A 2E7WA 1KVIA 4R8UB 2R9LA 5GVQA 3NP5A 2VFSA 2CJ9A 3DHXA 4OJ1A 2BQRA 1FNOA 2CA9A 2LCWA 3HHDA 2F40A 1Y3JA 4MKAA 4OX6A 1LQ9A 4CLLA 5IT9Y 3K59A 2FZGB 2FIUA 4CLWA 2UZAA 2WONA 1Q1KA 4YP3A 4M5NA 4IUFA 4DPUA 3IG1B 5MAOA 2BOAA 3DLEB 3V6JA 2XS7A 3RRKA 4DV7F 1WC3A 2BOPA 2OELA 3KLEB 4X4TA 5K5MA 3UDEA 4FVMA 4DSEA 1KTQA 3CJ5A 4DR5J 1AFJA 3IC1A 3L7OA 9RUBA 1R0BG 4FF3A 2HBYB 1NM2A 1MNEA 2LQ5A 4KV8A 5F8NA 3V6DB 4ZCMA 3DLJA 1HMVA 4U95A 1MMLA 2K06A 3TVKA 4NPOA 3NMRA 5KFOA 1SCJB 3SI8A 2E1RA 1V3ZA 5AXMA 3QBCA 3M30A 1X4FA 4J9RA 1S57A 4C2MA 1CC7A 4OHXA 1F6TA 3SIPB 3TQ1A 1TV6B 2I5JB 3IP0A 3WC2A 1X7VA 1T11A 2XZWA 3D0GE 1Q78A 2BV3A 2YX4A 3KMSA 1Q4RA 1V3RA 4C3KA 2W9BB 4IRKA 3DLBA 3EVMA 1HWKA 4RW4A 4NEYA 3THPA 4JI3F 4DV1J 4KHMA 3RBZA 3NG8A 4ZN1A 2KXHA 3QAUA 5CABA 1JJ4A 5IS2A 3FNNA 2Z0GA 1HWIA 3O44A 2VA3A 2A0FB 1GH8A 3K5OA 3D4JA 1S12A 1QUVA 3BQ0A 2VC1A 5DETA 1HARA 2NYIA 4GMKA 1T05A 7AT1B 1PKUA 1TL7B 1WC4A 3J7ZT 4ZVOB 4JI1F 2YXLA 3PEJA 1U1QA 1HBNA 2XY6A 3L7PA 2POKA 2CNLB 4MT1A 1R8AA 4JI6F 3MCOA 3V6KA 3UN5A 4ZN3A 4FNIA 4A8MP 2DNNA 2PE8A 1SH2A 4GO5X 3Q23A 1CSJA 2F63A 2K1RA 4B9TA 4HHUA 1JLBB 5DDQC 4TVAB 3MM5A 4AQYJ 5G0RB 1SKUB 1NDKA 4EZ9A 2NR0A 1CJUA 1XERA 1YBAA 1RHQB 4OYBA 2XGQA 2QG9B 3UCUP 1UVJA 2HHVA 2YNGB 2MB0B 4LSZB 4CO4A 5KT2A 1KLMA 1Q95G 2BACA 2UXBF 1EP4B 2GW8A 5IQ6A 3VV2B 1HQEA 4UY85 4FYVB 2KT3A 2HFZA 5HVFA 3VHQA 1DTQB 4YDXA 4RL1A 2C2NA 2ZC3A 3HDSA 3KJVA 3E8OA 4NLVA 3FEZA 3BGRB 1JLAB 4JI8J 2M3DA 4LR7A 3HSZA 4M5LA 3I9V9 1T9VA 2ZM6F 2HBQB 2HGNA 3OFHA 4OQJA 3DHWC 4NLRA 3CDUA 1HWLA 4OI0A 5L1LA 1VQYA 5IQQA 3SSQA 5KFLA 2ZHOA 5D77A 3PJ9A 4C8YA 2IJRA 4FYWB 4M63A 1S6PB 1HI8A 3UW1A 3AD8C 4DV7J 2IC3B 1UKUA 1REVA 4LUBA 3UO0A 2KTQA 1UZHA 4DOZA 1OQ6A 5KFJA 4DL3A 3DM2B 1B3TA 2GQCA 5EX0A 2QLBB 1F60B 1IBLF 4HHHA 1NZAA 2QA1A 4CH0S 2DCLA 2YX1A 4C7QA 1YJ9S 2H4YB 2XYPB 3AOAA 4Q2LA 4MK8A 1MU2A 3VZIA 2W9CB 4YR0A 1VK3A 3PKMA 4FF1A 5LMNF 3MWBA 4Y28C 3HJFA 1NPPA 1RLDA 2OLWA 2BJ9A 3CD0A 4MIAA 1WI8A 2EFGA 1TP7A 4ERDA 4RLEA 2ADCA 4E0DA 4JI3J 3E51A 3KJQB 5KT3A 3UNYA 2M52A 4F3OA 3EZ5A 4JV1A 3L4BC 2KO1A 2WVBA 1CJKB 3HFZB 2AT1B 1C4CA 4K4SA 4RUBA 1H7WA 3PR4A 1VDHA 1D8YA 3NOGA 4B3OA 4USKA 4Z7YA 3T5LA 4F4YA 1MWZA 3FCVA 2CQ1A 2R7TA 4CQ1A 2WVFA 3CCRS 4JI1J 2RDJA 3TUPA 2VA2A 2DXDA 5CAAA 3CC7S 4ZPDA 4ED6A 3Q0AA 2P6TA 1RWVB 3M8QB 4JI6J 1QAYA 4TU8A 3IM8A 4KH1B 2R2UA 3Q8VA 2JRSA 2X1FA 4Y00A 2UUTA 1PJ6A 1V5VA 4WYLA 4OJ3A 3G9CA 3GE9A 3PHTA 2DR6A 2WAQD 1HNIB 4KH0B 3CCES 1RKJA 4DUZF 3T5JA 1GK8A 4AL5A 4NI2B 2HW3A 4PWUA 2W01A 3QLHA 5M2PA 1IUJA 4F3MA 4A4JA 1UPPA 4DV5F 4L76A 5ETKA 4DR7J 2UXBJ 3ENQA 3PRVA 1HFEL 3B8HA 1HBUB 2R2TA 2A3JA 4I2PA 2CPEA 2YNIB 4NOHA 4J9SA 2JLFA 2LXFA 1DLOA 2YNFA 2QYCA 1OWXA 4NASA 1AUSL 1FESA 3PXGa 4WCEQ 2HK2A 3CCJS 2RU9A 4ZVGA 3OVBA 1LW0A 4XO0A 2K3IA 5J2QB 2MZQA 4XIUA 1XQIA 4W4MA 4ES2A 2MKHA 5H9EJ 2G2YA 3QGHA 2YKNB 4AFFA 2ZM6J 4B3TF 2H1YA 4H4OA 2W4PA 3K17A 2BJDA 4P2FA 4UUWA 3P3DA 1SUQA 3JAMU 4RW9B 1WTBA 3ITHB 1EJ7L 3V6DA 4K4ZA 1U45A 5KFCA 4RPFA 3U27A 1JLQB 2P6SA 1NAQA 1C1CB 4NZ6A 3AJ2A 1KQGB 4O4GB 4KE5A 1MSWD 1ZM9A 3EICA 1TELA 2YY3A 5A0YB 2VF3A 4I4BA 2B5JA 1C0TA 3DI6B 2J7WA 1VRUA 4C11B 3EGWB 4I67A 3O1LA 4OHYA 4IH5A 2ZVSA 2M7SA 3BS9A 1RU1A 2EFOA 5CA5A 2BW2A 5LMNJ 3W9HA 2XMUA 3LAKA 1CJVB 5KFAA 4MFBB 3CJ2A 4TY9A 3C19A 1JJCB 2GNKA 3LGMA 1DURA 4DXLA 4OL8A 2ZD1A 4O3QA 3LP0A 3GG1A 1H74A 4NCAA 3FQLA 2DGWA 4ZJOA 4IFVA 1GX6A 3M6UA 4XDCA 3KHRA 2V94A 5HROA 1WG1A 8AT1B 2NCKL 1JKHA 2LVWA 4Q43A 2QL5B 3PRBA 4A48A 1AROP 4G65A 5D3GA 4H4MB 4OYXA 2GVDA 2B43A 3V81B 2R8IA 5KG7A 3M9NB 2D7SA 4K5RA 4UOCA 3CCWA 1FEEA 2VQEJ 4MYUA 1U2RA 1WHYA 1RT2A 4FNHA 5F8MA 2V68A 3OBIA 4O0NA 1S76D 3D9BA 4DUZJ 1NK8A 4ECZA 1G6BA 3NS5A 1KQKA 2CFXA 1M1KT 4X62F 8RUCA 2GZOA 1IWGA 3PW5A 1Y10A 4ILMA 5HI7A 3BGFA 2XLJA 2CQ2A 3MFHA 3GMGA 4IH6A 1SVDA 1JNZB 3IWNC 1Y7PA 3OR1A 1N33F 2MZ1A 4FS1A 3EM1A 4WTYA 3CWJA 3KUHA 3MEKA 4DPXA 1FVSA 3UDCA 2BJ8A 3DRSA 1E6YB 2NXUA 2MKJA 1T03B 3RBDA 1UWBA 4PWDA 4EMDA 1ZOTA 2EI5A 2HQ3A 4A8FA 4B3TJ 2JJ4D 4F0MA 2OPPB 3I56S 3RZAA 2FHMA 5E3QA 3HI9A 1RSCA 3FUYA 2FD2A 2IA6A 4LFBF 5LJ5Y 4WP9A 1RCXB 3BKFA 2FJWA 1WF2A 2J0WA 4OZLA 1JLFB 4N8OA 2Q6BA 2ASYA 2AJ4A 4OZJA 5KG3A 1TAUA 2K7JA 4XAKA 4LF8F 2W2MP 1VQ7S 1SI9A 5BR8F 1KDNA 3T6JA 2MLYA 3EGZA 5E3CA 5ETTA 2KH9A 1F9FA 5B08A 2ZH8A 1DAXA 1ZM2A 4W90B 4KYZA 1F9HA 2B9EA 2KYZA 1FJ7A 3I82A 2QA4S 3QGGA 3GILA 1RT4B 3I0RA 4ID5A 2C2MB 2KYXA 4TQSA 4X65F 1KD1T 4PQUA 2ZOGA 3BM7A 2VONA 1QAJA 4O44B 2EC0A 1FF2A 4ZKAA 1OS5A 1BXNA 2YPYA 3OLBA 1Q7LB 2YPZA 4LIWA 3L95X 4L73A 4NLTA 1RZMA 3H4BA 1XR6A 2ZFHA 2G13A 4CLTA 3EDRB 1Y5IB 2UXCF 4DR4F 5K20B 2G0IA 4QYZK 5GMDA 3HFVA 4LBIA 1W25A 2GAHC 3FEXB 2HAFA 1JQGA 1P1LA 2SXLA 4IDKB 1JJ2R 2RD5C 1GTHA 4NE9C 4J7CA 2VJVA 4M8LA 4A46A 3R8YA 1EZZB 3BBCA 4UF4A 2RDIA 2IDEA 1T02A 4F2RA 2E9TA 2PFFB 4ZDNA 3CULA 2B4VA 2XY5A 2B6AA 2HK3A 4PXBA 3TZZA 4NI2A 2HLTA 2CQ3A 1VK8A 1ZTWA 3CNQP 3FFIB 3QNWB 3NRBA 3VAIA 1CS4A 4OX7A 4K7QA 4TYBA 1ZA1B 3S8SA 1HWUA 3QO9A 2JX2A 4QCLA 5LOQA 3R3TA 1REGX 4UZBA 3VTIA 2LP4A 2GIQA 2BJ1A 4QWCA 2W4DA 2MTLA 3ET6B 4M5DA 2RRBA 4RW8B 1S1UA 1FDDA 1H73A 2GV1A 1VQPS 4K2XA 4X62J 1RAFB 1G1XA 1NRKA 3GIRA 5AE3A 3R7SB 3ICLA 2QEXS 2M5YA 4RU2A 2RUGA 1HNWF 2GVZB 5J2NA 2CZ4A 3V6HA 3W8GA 1UMJA 1K47A 3M9MB 2XMKA 2QC3A 1U0HB 1L3VA 1SXLA 2DGOA 3DC2A 5E3AA 4CLKA 2W2OP 4RUAA 1LWCB 1EX8A 5EWEA 1GMVA 3TAMA 3A13A 1RHUB 3SQOP 3W9IA 4USIA 3OL7A 3VAKA 2R8GA 2XTJP 4DQQA 3P5TL 1IQTA 2B9XA 1JLQA 4FZVA 3TOQA 5HN0A 1HQ2A 3I0SB 2OH2A 2Z57B 2OTLS 4HVZA 3C6UB 4J91A 5J1PA 3D66A 2ZWOA 3IS9B 2W7PA 2IVMA 3GSIA 4F36A 4Y2MA 1TUVA 5T7LA 1C0UB 3DOMB 4LFBJ 2HVZA 3N9UC 3C46A 4RO0A 3UWTA 5JXSA 4B3SJ 1FERA 1FTCA 3W2VA 2EBEA 3PY8A 2D9OA 1P27B 2AZ1A 3IWLA 2G0JA 3MPYA 2DXFA 2V8GA 3TARA 1FWLA 4RW7B 5E3RA 4ZHRB 5BR8J 5C5JA 5C42A 1XNRF 2NXCA 1RTJB 3MAHA 4P9SA 2RRNA 2HZAA 3JB9k 1U1LA 4NLDA 3W64A 1P9QC 2KFNA 1MN9A 2AGPA 1PO6A 2I8EA 3TA1A 2UXDJ 1QTNB 4UQTA 3G6ES 1A7GE 1R8BA 1JB0C 2CAJA 5CCMA 1S1VB 4Q2MA 3OL8A 1FRLA 3LP1B 2DVIA 1C2PA 1TQLA 4K4YA 1TFWA 3CJKA 2CPDA 4P10A 1ZS6A 3JQMA 4EO6A 3AODA 2A2DA 4EYHB 5LL6d 3OTEA 3QGIA 1FX2A 5KFMA 5F0WA 2RHSB 2UXCJ 4DR4J 4P2SA 1KC8T 4JV0A 3OJUA 5J1EB 4KJIA 3MD1A 5DO2A 3NS6A 3F44A 1JLEA 2U1AA 3CJSA 4ED2A 4DU8A 2L9WA 2QLXA 1T8EA 4IH7A 3V81A 3KK1A 3OL9A 1H0HB 1Q16B 1GEHA 1X4BA 1B0PA 2HVIA 1SH3A 2B8PA 5L9NA 4XTTA 1FXDA 3MMAA 3GTYX 1WC0A 4M5MA 3MAAA 3MF5A 1AW0A 3FBEA 3W5ZA 1PBUA 3M8PB 3DDIA 1Q5YA 2EBGA 4UT4A 4WFBQ 1JXEA 3W9JA 2VD3A 2CPJA 2PD1A 4S0MA 3WIVA 3SBMA 3GV5B 3ZZPA 4OZ2A 2BBEA 3OFGA 2KRBA 2ZZTA 2HS4A 4NYOA 3R7NB 4ZVFA 3K57A 4LF2A 3ISNC 3RAMA 1TKTA 3LH2S 1NDLA 2VPYB 5L46A 2OO4A 3BSNA 3MR3A 3P96A 1VRTB 2QJ3A 2GIRA 3TAPA 1HNWJ 2A2CA 3HD2A 2HHPA 2P9CA 3W3SA 5A8RA 5KOWA 2YWHA 2QA2A 1Y5NB 2DKOB 4CP5A 1MN7A 2N4DA 1YKWA 5EWFA 4WWSA 2VPWB 3MR6A 1VHFA 1RA6A 1KRPA 4KGKA 3Q89A 3HHKA 3E01A 2EFNA 3VAJA 1Q8BA 3GIKA 1F5AA 2Y1IA 2GHWA 2EC2A 3HKWA 4O3OA 4O3PA 4V19X 3T3FA 4CT8A 3QJLA 4KIAA 1TKXA 1V5IB 3N28A 3GQCA 2XWXA 4MIWA 4F26A 2R7WA 4N56A 1VLOA 3P6YC 3WDOA 1NZ8A 1S10A 2ZH2A 1FE0A 3LOUA 3DRPA 2L08A 3KTQA 4QWEA 2R8KA 4I64A 4O44A 4TLQA 1WNEA 4TLRA 3U1MA 1XNRJ 4HT7A 4U9RA 1R0AA 1ZPWX 1RWKB 3QIPA 2K8GA 4P74A 4R0JA 2HGLA 1AA1B 1L5UA 5GAGU 4LR9A 2FHKA 2F9DA 3CJTA 4ECTA 4YFUA 4M5IA 3N01A 4C8LA 4X2BA 2OPSB 1RTDB 4USHA 3M8YA 1WSVA 5A8WB 3D0HE 3EGVA 3BO2A 4NWBA 2XB2D 4DFKA 2AU0A 2RS2A 1S9FA 3AXKA 3MM7A 3DRRA 4Y65A 3KK2A 2V6AA 2ZE2A 3BO3A 1S99A 1R27B 1X4EA 2ZH5A 3SDEA 2MZSA 4UQGA 3PHEA 4ETZA 4FDFA 3OUYB 2VV5A 3FFIA 3POTA 3T5HA 4ED5A 2DJWA 4EK2A 4F8RA 3F0NA 2QIFA 2I2YA 3KK3B 2QLWA 2ASJA 1M5HA 3UVJB 2HRTA 2P5VA 4PPDA 2OPQB 1YIJS 1U24A 3WQPA 3TYTA 4YDDB 3OXGA 2M2BA 2LU1A 4ZP6A 1EQ0A 2A10A 5K14B 3H20A 2Q79A 3MM6A 4W98A 1GMUA 4WZMA 3DLLQ 3CDAA 2NLWA 4DCJB 5C24B 2DNMA 4ZCLA 2L9DA 1MLAA 4QJVA 4ES1A 2IFXA 3WX8A 5HO4A 1AZSA 1DQAA 1FRMA 4OJGA 1KHWA 3CJRA 4CYUA 3KG4A 3ZZYA 3GFYA 5DG7A 4CO3A 4IRDA 3TR5A 3CT9A 1X9WA 3VF0B 3F56A 5C7PA 3BN4A 2LEAA 4FXDA 2VG7B 3W7BA 4HHJA 3GCXP 2AD9A 2HRYA 2BKPA 2BE9B 1YRTA 1U6BA 4WE1B 2K7KA 5GMKa 5K8MA 1X9MA 2CJYB 1IJFB 3P49B 3OHBA 3HFKA 1S6QB 4BDPA 4X66F 2CZ9A 3E2EA 3FRZA 2XSJA 1U2FA 1VOMA 1UP1A 4IR1A 2UUWA 3DNCA 3PYEA 2WSCC 3PKYA 3TUZC 4LF1A 1N0VC 4UZCA 5L1JA 1ZM4A 2BZ2A 1R43A 2FLLA 2XYGB 1JX4A 2RU3A 4DG1A 2H5IB 3UDLA 4JI2F 3R2DJ 1S0VA 3R97A 1HYSB 3RB0A 3TVYA 4I6WA 1CEZA 3DLGA 4OHZA 5KFGA 1N34J 2BR0A 3CIZA 2GFFA 2GO8A 1HI1A 3J7Z5 3LP1A 3ONQA 1IQZA 3T9NA 2XM3A 5B0GA 1RA7A 4LF5F 1X4AA 5HAOA 1U47A 3GV8B 5E3PA 1N52B 1M5SA 4A8YA 4KKOB 2PA3A 4QR1A 3VGVA 4IG3B 2NQPA 2BA9A 2DT9A 4FYDA 3CDEA 1FT8A 4IOBA 2MQPA 2QT7A 4PG8A 2BMBA 3RRGA 4OX9F 3MTKA 5KFIA 2VFUA 4HI2A 2A18A 1FDBA 1BQNB 5HATA 2UV8A 3TA0A 4DPWA 2J9CA 1ZPVA 3DGVA 3GU0A 1NDCA 2MJUA 3W62A 4F0HA 1RP5A 1OO0B 2PMZD 1T9UA 5DS7A 1HNXF 2UUCF 1WEXA 2E5HA 4KPYA 5BJRA 4O23A 3ZNUA 3MCSA 2J9DE 4WFZA 4ANEA 4PABA 4WBFA 3PCOB 4ILRA 3UI3A 3LA0A 2DIVA 2HHHF 5KOXA 5HQ8A 3TJAA 2BDPA 1C4AA 4ICLB 1SQGA 4NXMF 3B6BA 3KLFB 2CQIA 4Q44A 1KOOA 4DN9A 4DR1F 3KDNA 3K5NA 4ED7A 2B4PA 1JNRB 4HH0A 4OI2A 1VFJA 4RWWA 2HRUA 4PEOA 3VALA 2NUUG 2GHPA 1FKPB 2DNQA 2N3LA 1GAOA 5IV3A 4CO0A 1NBEB 1KFDA 2EEYA 4LR8A 1WG4A 3H0PA 4OFZA 5FIIA 1PGZA 2DB1A 4ATNA 5KFZA 3SQGA 4NXNJ 4DUYF 4UW2A 2YKAA 2FYXA 4DL5A 4TU7A 2CPIA 3P4UB 3GLJA 2HHSA 1DTTB 4C8OA 2M70A 3KLIA 1HBMB 3DOLA 1VLYA 4DR6F 1X60A 2I1RA 3OJSA 1YJUA 1RT6B 2HWTA 1B4SA 3EE3A 4WJBA 1PYTA 2ZHBA 1PAEX 4Q45A 3BYPA 1UFKA 1W2IA 2QGFB 3VVTA 3Q24A 5DQGA 1BQMA 4B08A 4FF2A 4CIOA 4I6YA 4PZVA 3CJ8A 3R6GB 2MJNA 3V4IB 4GO7X 1C1BB 2HG4A 3SV4A 2QMWA 4JV5F 4ELVA 5F9NA 4DR2F 2HSEB 4PUOB 1KTVA 2XC9A 4DV4F 9ATCB 2F8MA 5HBMB 3NNAA 4PG6A 4LQ3A 3ZZUA 1K0VA 2DPJA 5L38A 5CYQB 4ZITA 4AE5A 4JI2J 1IM6A 4OZ5A 3G96A 3J81j 3H5YA 2MY8A 2GHVC 4ZP8A 4N41A 3HF5A 5J2PA 5CXTA 1S48A 1TKDA 2AP6A 2IM1A 1B7FA 1NCLA 3DOKA 4DQRA 4NLQA 2ZZMA 1RWMB 4KAIA 1FX4A 1IKXB 3R5GA 2QLJB 3G86A 1M1HA 2EG1A 2OUGA 1CLFA 1N0UA 3W2WB 3M1VB 4J5OA 2VQFF 2LEBA 4U67Q 3QSYB 2OGUA 3H98A 1LOUA 4CI0B 4QIEA 4N8NA 4F4KA 3UDVA 3JSBA 1R89A 3HXMA 2EVZA 1MWYA 3CPWR 3HHLA 2DNRA 2H65B 1H2TZ 2FJAB 1RTHB 2V34A 1HNXJ 2UUCJ 4ZA1A 3M8RA 3N4WA 3FVYA 2DNKA 4Z2XA 5HLFB 2V9WA 2MKIA 3IR7B 4L3KA 2CPZA 3ENWA 3UR3C 1NB2A 4B9NA 3R5DA 3DN9A 4TU9A 4C8ZA 1VMBA 2H48B 2HHHJ 1CPZA 4WXWA 1XJWB 4MYTA 1E6VA 2E7XA 4F25A 4DR1J 3DLHA 4JI7F 4RR5A 4URQU 2ATCB 1IXKA 2XLIA 3G6VA 2V63A 3ISND 2IRXA 1VQKS 4DLEA 3OTDA 5EWGA 1B99A 3D5MA 4ED8A 3CCSS 2Z8QA 1UETA 2OP5A 2AWZA 2UP1A 2WTFA 1XMQJ 3X3UA 3PYFA 4NMLA 2MKSA 1UAWA 3HK2A 5D15A 1N5YB 5KFBA 4DUYJ 2KZMA 4RU9A 4U7CA 4DL7A 1NJIT 2X3DA 1A0OB 2H54B 3M05A 1QJHA 1HBOB 4JOUA 1VBZA 1BD6A 1RE1B 1CULA 2B4UA 2VG5A 2DRBA 3JTPA 3NAHA 4LF6F 3NBPB 1H2VZ 1F5CA 1TL4A 4DV2F 2E5JA 2JEFA 4O3RA 1WSRA 5KFRA 2W4CA 5D4LA 2AX0A 3CSKA 3S1TA 1RYRA 3CIMA 1I94F 3CCVS 4JYAF 3W63A 4CNZA 2RF2A 4JV5J 1M5KC 1U6ZA 4DR2J 3PJWA 1SJ4P 1EHWA 1IN0A 2F5GA 5JJBA 3JSMA 1MWQA 3FZBA 4DV4J 1IKWA 1R6VA 2ZKTA 5HMXA 2M8HA 1JIHA 2LQJA 1T0TV 4AL7A 2MSSA 4K4TA 2BQ3A 2WONB 5FDLA 3EUNA 5FD1A 1TK5A 5L9XA 2FZKB 2APOA 3ZTQA 5KFKA 1WORA 3CTRA 4FF4A 2OEJA 2FC9A 3JXOA 3H2LA 4Y3CA 2V2KA 4H54A 2DHAA 5ETLA 1FNMA 2ACYA 3M6XA 1I6JA 1SIWB 4KV8B 3FSYA 1HMVB 1NHKL 3LO3A 4XDDA 1BQXA 2ALZA 1Q53A 2VQFJ 5T14A 1HHTP 3M30B 2YBVA 4Q7AA 1YZ6A 1CQMA 2Y8WA 1J5OA 1U1KA 4DV0J 1SJ3P 3PTWA 5DG9A 2YWKA 2D3OR 4ED4A 1VBKA 3NWGA 2R42A 3CCMS 1SL2A 4ZVRB 3R27A 1FK9A 2IJNA 3FCWA 5I4MA 1XEZA 3F73A 2X1GA 4RW4B 2D41A 2K3KA 2KT5A 3J81Y 1EKSA 3D6TB 4ID8A 5C2GA 1GQEA 1SQFA 1SC6A 2V50A 3KOAA 5GADU 3SFUA 3EZUA 2ZVIA 2WVEA 2A1BA 3G82B 4F50A 1T05B 1VJQA 3CDBA 2LQBA 3MMCA 2HQDA 4MH8A 1HBNB 4JI7J 2YKMA 1NKCA 5FJ4A 4C8KA 2FUG9 1YHQS 3C6TA 4F4XA 4Z7CA 2VDIA 4KC5A 4DQPA 3EPIA 3T5KA 1NLKL 4OZ0A 3KHGA 3BZQA 1FD8A 2VOOA 4ECVA 4ECQA 2K1RB 5KG1A 2MSTA 2BJ3A 1Q7YT 4GVBA 2CQCA 3MM5B 3EXCX 4DFMA 4PWWA 4BC7A 1ITPA 1BUXA 1CJUB 1FCAA 1U8WA 3IBCB 2IRUA 3PX6A 1YI2S 3W66A 1VQNS 2PIIA 2BEFA 1O6XA 3R5AA 2YNHB 3RBEA 2JL9A 2GCFA 2F4VF 1YJRA 3M2VA 3M8ZA 4YN3B 4QIWD 2D3UA 1HQEB 4LF6J 3N5FA 2EPIA 2KJWA 4DV2J 2DPIA 4DL6A 1W2BR 3HVTA 1DBDA 1P9YA 5IT9U 5AXNA 1UEVA 3KJVB 2HNZA 4KQZA 1I94J 4PPZA 2CDQA 4DR3F 1FJGF 1WELA 3FJ2A 2IM0A 3M4XA 3VZHA 1PJ7A 2CWKA 4NCBA 5KFTA 1UJ6A 3ADAC 4UOFA 2JEJA 5LMUF 2FVSA 3SZ2A 3PW7A 3H2UB 3M9OB 4G1PA 4JI0F 4WTOB 2I9SA 1XR7A 3MPUB 4DX7A 3T6BA 1RTZA 5E41A 1XMBA 3PR5B 2QE5A 3WC0A 4RNMA 4QU7A 1LXJA 2E29A 4PXCA 3NCRA 2KFZA 1REVB 3NEKA 1U26A 4ZVPB 3ILOA 5A6PA 1FKAF 1FXLA 1K9MT 4U7UD 4KTQA 2DO4A 2NPIA 4YB5A 2M0GB 2D3ZA 3OFEA 1VI7A 4C98A 1WC6A 5KFYA 3Q83A 3B54A 1FKOB 1MU2B 1J27A 4DSLA 5A2QY 3Q86A 1EETA 3JTOA 4G1IA 4B9UA 3NY0A 4MKYA 1FRXA 4G1QA 3K7RA 4OZNA 1KONA 3HHLD 3T1HF 2B0GA 1KBRA 1YQHA 2GX8A 1FRJA 4NMXA 4ECUA 2H5JB 4QYZJ 1EKRA 3OXLA 3BB5A 2Y9HA 3WX4A 3JSRA 1VC0A 1YJWS 1NJWA 3AAWB 1FFGB 3CEDA 5F8JA 4B3OB 2HQIA 2BE2A 2RUSA 4KB7A 4X64F 3WBZA 4ZS6A 2CIMA 3AB2B 4Y34A 1AFIA 4DHVA 3CD5A 1KS2A 2DRDA 3CD6S 1XK8A 2VU5A 2KRRA 4Y2IA 2I6WA 1N5VA 5AJ3F 1S0OA 3OT9A 4LF7F 4NYZA 1VBYA 1TFYA 2R7VA 3PW2A 5KT4A 3A4TA 2OEMA 1XN9A 1RQ0A 2CRLA 3AHPA 1EQMA 3TJ9A 4IFYA 2CQBA 3MUTP 2OSQA 4UUXA 1GTEA 3SCKE 2RB7A 2KG1A 4J9MA 3DCAA 3QT7A 2CYYA 5L1IA 3QLHB 2OMLA 3DU6A 4DX8H 2CQ4A 3LGHA 2ZDPA 1RACB 2F4VJ 2FVCA 2KN4A 3MR2A 1RJJA 4DPYA 1Y00A 3HVAA 4I2PB 1RT5A 4DS4A 2HS3A 1HNVA 1DLOB 2YNFB 2VKRA 1QY7A 2X3GA 2QV6A 4LMZA 1WUUA 1PYSB 1UW9A 2CNOB 3RGIA 3UCZP 4I6AA 3QRPA 1JK9B 1LW0B 2ZJRQ 3IMQJ 4AT1B 2PI4A 2Q3PA 4C0OC 2B3TB 3THTA 2VODA 1UPMB 3VAGA 2FQQB 2BRLA 4QR2A 5LMUJ 4H4OB 5F41A 3CMES 1RWPB 2Z2ZA 3QFWA 1SUQB 4JI0J 1IR1A 5KG0A 2WSEC 1NU4A 2DY1A 2GO9A 1RCOB 4Z37A 4HEA9 5H9FK 4KHRA 5DG8A 2HFNA 2BKNA 1S0NA 5C25A 3M2RA 4HL9A 4OV1A 1T7PA 3MPWA 1DARA 2VFTA 2WVCA 3ZTRA 5L39A 3TNVA 4LRAA 2KU7A 3BPSP 4DLGA
chains in the Genus database with same CATH topology
1FTRA 4UQTA 3G6ES 5H9FJ 1A7GE 1R8BA 1JB0C 5CCMA 1S1VB 3FDSA 4ZMMA 3I32A 4Q2MA 4WK3A 1XNQF 4HDHA 2B5JB 2CQDA 5EHHA 3OL8A 1FRLA 3LP1B 2DVIA 2FDNA 1C2PA 3IGNA 1TQLA 1ZAXA 2LECA 4FBUA 1C0TB 4ELUA 2PA8D 3N6MA 1WF1A 2F3JA 4OIXA 2R7OA 5A6WA 3R5CA 5K8OA 4K4YA 2YTCA 1VC5A 2D74B 1N6QB 3CJKA 1TFWA 2CPDA 4DJBA 2XULA 5M2RA 3Q8QB 4ZOSA 4K5SA 4EO6A 1VRUB 2DR9A 3D54A 2A2DA 3US5A 4EYHB 4EFAC 3D1OA 3V4MA 5LL6d 3OTEA 1AUDA 2GGPB 2XMTA 3QGIA 4X4NA 5KFMA 5F0WA 4JBCA 5KG2A 2Z4PA 1OSCA 2EWHA 3GFHA 4P2SA 1KC8T 2FVRA 4JV0A 4B3RF 3C3LA 3OJUA 2RSQA 4ECSA 2XNRA 4TKTA 3ISZA 4Q8FA 1Z2ZA 1VIXA 4DV3F 4DMZA 4ICLA 2LQ9A 2ZOFA 1OSDA 1RAJA 3KLFA 2C3YA 4D3HA 3PDNA 5J1EB 1NH7A 2IHR1 4KJIA 4KFBA 3MD1A 3BDPA 3HHEA 5KFSA 2C3OA 1JLBA 4YY3F 5DO2A 2VB6A 2V8DA 3NS6A 5IT4A 2XS2A 2YH0A 3F44A 1JLEA 2U1AA 2J7UA 1FRKA 4ED2A 4X4SA 2L9WA 2QLXA 1OPIA 4J9PA 1T8EA 1J5OB 4IH7A 3V81A 5G0RA 3KK1A 3OL9A 6FD1A 2Q43A 1Q8IA 3GR0A 5ADZA 2JH3A 1H0HB 1Q16B 5E33A 5AE1A 5HP1A 2BANA 1FKPA 3Q8RB 2VG6A 3MTJA 4NCGA 1VC6A 1X4BA 1B0PA 4L3NA 3NMAA 2ZD1B 4DSIA 3MURP 2HVIA 1SH3A 1RT1B 3N6LA 4WFYA 5L9NA 2WHOA 2YNGA 4DDFA 1FXDA 5CH7B 1FK9B 3LP0B 3MMAA 3CUNA 3HHLC 3V5RA 2HHUA 4M1KA 3MF5A 1A9NB 1DFDA 3GYNA 3OV7A 1AW0A 4NLUA 2KB2A 3AA9A 4IFVB 1VQMS 1H3DA 4FP9A 1EP4A 2UV8G 2W9AA 4EEYA 1DZ5A 2BABA 2HNYB 2W7OA 4MKBA 4ILLA 3M8PB 4NLPA 3S6EA 2MQNA 3A1YG 3WZ0A 3RR7A 2EBGA 2RT3A 3RB3A 3KWMA 5HROB 4WFBQ 2IA0A 3BF4A 1JXEA 3B4MA 1DTQA 2VD3A 4CTAA 2CPJA 5DM6Q 2PD1A 1DTTA 5HMWA 3S01A 4NA1A 2OAUA 1K0TA 2IMOA 5KFVA 1F2GA 1JKHB 7FDRA 3MOZA 2IMWP 5KFUA 2WBRA 1HBMA 3VQTA 3GV5B 3ZZPA 1VBXA 2K2PA 5AE2A 2CPXA 3OHAA 4AXJA 2JWNA 2BBEA 1YSJA 5AXKA 1RT6A 2HNDB 4WXOA 1UVMA 5IM0A 2YH1A 1MMDA 2Q1LA 2RE1A 3JSYA 3GYXB 4HI1A 1XR5A 3BGRA 3OFGA 4I7FA 1JLAA 2KRBA 4TN2A 4FXVA 2HS4A 1DHMA 3ZC4A 3U02A 4NYOA 5D3GB 3GIIA 4ZVFA 1IKYA 3MMBB 3K57A 3NLCA 2YNHA 1FJEB 3GFXA 5KFNA 3ISNC 3O2IA 4FPRA 2R8JA 2XSFA 3RAMA 3OVBA 1TKTA 3EYZA 3MMCB 1PC4A 3HVWA 5KG4A 4WFNQ 4HLBA 1LK7A 3BJYA 4IG0A 3LH2S 2WK4A 4JUZA 2EG2A 1TK8A 4M94A 3OTOF 2YKMB 2VPYB 1NK9A 2LKZA 3C6TB 2RILA 1HA1A 3ENVA 3AH6A 5KG6A 1Y0HA 2OO4A 1RT2B 3BSNA 3NCPA 3CC2S 3DU5A 3FRYA 3MR3A 2AV5A 2E1CA 3P96A 2C2RA 1VRTB 3THVA 4TQRA 2GIRA 5GAEU 2VOPA 3TAPA 3CJ0A 2A2CA 1KLMB 3D2WA 1D0EA 4ZCKA 3V4IA 3FMWA 2HHPA 1C1BA 2ZNYA 3Q22A 2P9CA 3GZ7A 2PO4A 3BSAA 4NLXA 3W3SA 2FC8A 5T41A 1QSLA 1DQ9A 5KT7A 4Q8EA 5A8RA 4YUDA 5KOWA 2YWHA 2C2EA 2CJQA 1FA0A 1U8SA 2QA2A 5EN1A 3MEDA 1Y5NB 4P7TA 4PUOA 1FDNA 3IRXB 1S6PA 5J2MA 3MUVP 3Q8PB 2IC3A 3MOJB 2V0NA 3HKZD 1FXRA 2VBWA 4TY8B 4A8SA 2N4DA 2F1FA 2W25A 5EWFA 4CO5A 1RGVA 2VPZB 5HBMA 3JAMY 1G3OA 2UVUA 2VPWB 3CDWA 4Q0BB 3MR6A 2BM0A 1VHFA 3OR1B 1RA6A 4BHQA 1KRPA 4PQAA 3LF0A 2ZJQQ 2WOMB 3DM2A 1ZYQA 2QO3A 4KGKA 4X4PA 2NUHA 1O8BA 3HHKA 4ZP7A 3E01A 2U2FA 5CYQA 1ZAVA 3PV8A 3ZZOA 2EFNA 3VAJA 2ZH7A 1Q8BA 3GIKA 1FHTA 1F5AA 5E5NA 4B17A 2B7CB 2RIJA 3Q2TC 1N48A 3RW6A 3DRSB 3H5SA 3M2VB 3Q2SC 4IQMA 2Y1IA 5KAKA 1JLCB 2GHWA 3HKWA 2W8LA 3CCLS 1TL1B 4O3PA 4O3OA 4O3SA 3LAMA 2M9KA 4OI4A 4MK9A 3CJ3A 5D4OA 5DRKA 3TUIC 3T3FA 1U1RA 1UWBB 4CT8A 4V19X 4PWDB 4B3SF 1SL0A 3QJLA 4KIAA 2R7RA 4GKJF 1TKXA 4DR5F 5SUHA 3N28A 3GQCA 2XWXA 4MIWA 4F26A 4X4QA 4EO8A 2R7WA 1QAIA 4N56A 1NJYA 3HVTB 2OKQA 2ZH3A 2GMHA 4OI3A 2W9CA 2EFVA 3P6YC 5D4PA 2WCXA 2EK1A 3WDOA 5F3ZA 4ED0A 1IKXA 2DIUA 3MECA 3PEHA 3SFGA 3SMZA 4DN0A 3KHHA 2HNZB 3KYLA 2ZH2A 1FE0A 1S10A 3NL0A 3LOUA 3DRPA 4MMOA 5A8KB 3NGDA 1U6FA 2L08A 4LSNA 1RI7A 4I69A 3W2WA 2HMIA 3KTQA 2OFHX 5CCLA 2B56A 3DYAB 4QWEA 2X1AA 3M1VA 2R8KA 5M2UA 4I64A 5U47A 1R8PA 4O44A 4TLQA 5CYJA 2MPUA 5EGYA 1WNEA 2KM8C 3OSNA 2O66A 4TLRA 3U1MA 2AF6A 1BY9A 3CC4S 4HT7A 2F9JA 4C97A 4U9RA 4YQWA 4YB6A 4FN5A 1R0AA 1ZPWX 1WTFA 2LA4A 4EWTA 3QIPA 2AJQA 2W7AA 2K8GA 1HQUB 2R7QA 2O67A 2RQCA 3PW4A 2ZH6A 4R0JA 5KT5A 1FKOA 3CF5Q 2HGLA 3CXCR 1CG2A 4JV2A 2CJAA 2VBYA 2VC0A 1KR4A 2UXDF 2DRAA 3HX9A 2VPXB 3O5TB 4LVNP 4BS2A 1U1MA 3OLAA 1L5UA 1KQSR 1R31A 4ELTA 5GAGU 2MMYA 1PSDA 1KSPA 5DDRC 4ZVEA 2FHKA 3HLUA 3U7JA 2F9DA 5E7OB 2V8HA 1UJ4A 2W24A 5DGAA 3T1YF 1WHVA 3GSDA 4IYQA 1SKRA 4DSKA 1UEUA 2Z2LA 3DXSX 4ECTA 1G2EA 4YFUA 2XS5A 3N01A 4PRFA 4C8LA 4X2BA 2OPSB 4DV1F 3BO4A 2IRYA 1X0PA 1RTHA 1RTDB 5DGBA 2M4MA 5F8HA 4USHA 5KFQA 1RDRA 3NGKA 5A8WB 1N56A 3D0HE 3VWSA 1SKWA 3KHLA 3KKFA 4XPEA 3BO2A 3UR0A 4NWBA 2UUAF 5IZHA 1UVIA 2MZRA 2HGMA 2PT0A 5HLFA 2XB2D 1S79A 3DRXA 3OW2R 4DFKA 2AU0A 4USJC 3AY0A 1S9EB 3I0RB 4ID5B 4KBIA 4ZPAA 2HWIA 2RS2A 4Y2CA 1S9FA 2AQ4A 4PQUB 3H2VE 3MM7A 4IR9A 3DRRA 4PR6A 4Y65A 1VGYA 3KK2A 2FHOB 3M8QA 2ZE2A 4A8KA 2VFRA 2R8HA 1UVKA 1IKVA 3VAFA 3BN7A 3KLHA 3PNIA 3BO3A 2FVQA 1S99A 3TP2A 1R27B 1RTIA 1X4EA 5B0DA 1SL1A 2ZH5A 2J0SD 3SDEA 2MZSA 3DXBA 3OQ2A 5B0FA