2HVZA

Solution structure of the rrm domain of sr rich factor 9g8
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
101
structure length
101
Chain Sequence
MKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRKLLEVLFNGPLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Splicing factor, arginine/serine-rich 7
total genus 10
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hvzA01
5DETA 4CIOA 1DBDA 3NS6A 3I55S 5D77A 1FT8A 2MSSA 1X0FA 3US5A 2L08A 1N88A 4C4WA 3CF5Q 2MMYA 3K0JA 5IM0A 5DDRC 3V4MA 3S01A 3MUTP 3EGNA 2RU3A 1WHXA 2M4MA 1VQ6S 1WEYA 2VOPA 2MY7A 1S72S 1M90T 3CCES 2DNNA 2K3KA 4UY8T 2CQ3A 2DH7A 1YI2S 3NNAA 1OO0B 4Y00A 2LA6A 2RT3A 4PKDB 2N82B 1NU4A 5GVQA 4LIRA 3CCUS 3EGZA 3BO4A 2YTCA 2KXNB 3PIPQ 3TYTA 5FJ4A 2ZJQQ 4WFAQ 3VAIA 2RNEA 2MGZA 2AD9A 1WHWA 2CPHA 4IO9Q 1VC0A 2DNMA 4EGLA 2CPXA 3J7YU 4CQ1A 4WCEQ 2D9PA 2SXLA 1U1LA 5IQQA 1U1MA 3NNCA 2UP1A 1U6FA 1FJEB 2DNLA 2JX2A 4W92B 2G0CA 2MJNA 2LXUA 3CCLS 5LJ3Y 1SXLA 4LJMA 3CMES 2DGQA 1XN9A 2F9JA 2LCWA 1VQ9S 1X5OA 2LEBA 3SMZA 4OZ0A 2DIVA 1WG5A 2KYXA 2DNRA 4WFNQ 2FHOB 5GAEU 3G96A 3UCZP 1DZ5A 1KD1T 2L41A 3VAMA 2AYMA 2PEHA 3BS9A 3P3DA 3PIOQ 1NO8A 1ZH5A 1WG4A 3NMRA 2JVOA 3B4DA 2MZSA 2G1DA 4WF9Q 1WF1A 1U1PA 5DM6Q 1Q7YT 2MKHA 1X5PA 1X5TA 5IM0B 2I38A 2DNPA 3BEGB 2CQ2A 3NS5A 2KG1A 1VQKS 2CQ4A 2DK2A 1H2TZ 2RQCA 2XB2D 3UWTA 2MQMA 3VAJA 4QU6A 3ZZZA 2J0QD 1SJ4P 3CCSS 2YH0A 2QFJA 1B7FA 2FPHX 3CCRS 3SDEA 4V19X 2KVIA 4PRFA 2MYFA 2VOOA 2MQQA 2MGZB 1H2VZ 2CPDA 2JRSA 2X1BA 2YKAA 3G71S 2GO9A 5IFMA 2DNYA 2BOPA 1VC6A 1WF2A 2KU7A 3TO8A 3CMAS 5JVGQ 3CC2S 2LKZA 2DNQA 4FXVA 1OIAA 4F26A 2MKKA 2LECA 1HL6A 1VBXA 2MKSA 2MJUA 2MZQA 5GMKa 4QPTA 1M5VC 4A8XA 1X4AA 1X4EA 3HHNB 2XSFA 3MURP 4LMZA 2EVZA 2LEAA 1CVJA 3MI7X 2MKIA 3UD3P 2CQPA 1KQSR 1N52B 5H1SV 2DH9A 2DNOA 2OSQA 3J7ZT 2N7CA 1K9MT 2DNKA 3MD3A 3N9UC 1BY9A 3CPWR 1YJNS 2MY8A 2M9KA 2RRBA 3S8SA 2HGMA 2BZ2A 2CQBA 5JVHQ 1M5KC 1WELA 3G8TA 2G4BA 2CQ1A 1YTYA 2CPIA 1X4HA 1YITS 1VC5A 1UFWA 5DDQC 2MZ1A 2ERRA 2O3DA 2FY1A 1D9AA 2DHGA 3THPA 3UCUP 4OZ1A 2HVZA 2DGWA 3CCMS 5DM7Q 2RVJA 2ZJPQ 2E44A 3ZZYA 2XS2A 3DXBA 1D8ZA 1M5OC 1VQPS 2M8DB 2M7SA 3SXLA 1YJ9S 2DGXA 3CUNA 2FC9A 2J8AA 1AUDA 3SDEB 2DNHA 1ZZFA 1N54B 2KT5A 2WBRA 4Z2XA 4WKRA 2MPUA 2N3LA 3CC4S 1FNXH 1YIJS 1JJ4A 1UP1A 2CQ0A 1JMTA 2NLWA 3MXHP 1UW4A 1WTBA 3Q2TC 2MQOA 3THTA 2MHNA 2YWKA 2VONA 2I2YA 4ED5A 1RK8A 2LXIA 3G8SA 4ZKAA 1OWXA 1U1NA 3CXCR 3NNHA 2M2BA 2D3OR 2DH8A 2OSRA 1SJRA 3P49B 3TP2A 2E5HA 5LSLA 1U2FA 1QM9A 2PE8A 3MUMP 1R8HA 1H2UX 4QU7A 1X4CA 2HGLA 3H2UB 1FXLA 1WHYA 5CA5A 4PR6A 5DDPC 2CPJA 1WI6A 5LXRA 1U1KA 3P6YC 1HD1A 3S7RA 3CCVS 4WIIA 5GAHU 1X5SA 2DHSA 1F9FA 1SJQA 3RW6A 2DGVA 5BJRA 3U1LA 2KN4A 2KHCA 1YJWS 2LQ5A 2OJ3A 2CQIA 1HD0A 1U6BA 2CPYA 1U1OA 2CPEA 1FJ7A 1IQTA 4YB1P 2MB0B 3B4MA 2LA4A 2RS2A 2CQCA 2HGNA 5HO4A 1OPIA 1W2BR 2MZJA 2KXFA 1VQ5S 1FO1A 1HA1A 2M70A 2M52A 2AYEA 1KOHA 3G4SS 2KH9A 3I56S 3IRWP 2OTJS 1K73T 4ERDA 3CCQS 3S6EA 2X1AA 4W90B 4C7QA 1L3KA 5GADU 1VQLS 1O0PA 2ZJRQ 2LYVA 5ITHA 5LJ5Y 4J5OA 3VAKA 1ZZNA 3LQVA 1PO6A 3EX7B 3BO2A 2U2FA 3MDFA 1VQ7S 5CXTA 5LSOA 2DISA 1WI8A 2MQPA 4F25A 4IOAQ 2M0GB 4TU8A 5CYJA 2RQ4A 3UCGA 4IUFA 4YUDA 4M5DB 1VQ4S 2MQNA 3JB9k 4C0OC 3IWNC 1WEZA 1WEXA 2KI2A 2E5JA 1JJHA 2VODA 2NZ4A 2MXYA 1M5PC 1WF0A 2MZTA 3VAHA 1A7GE 2DO4A 2KM8C 2CQHA 1WG1A 5GAGU 4IOCQ 1FJCA 2B0GA 1X4FA 1WHVA 2GHPA 2AYBA 2RRAA 2XNRA 5D78A 1X4GA 2DIUA 1PGZA 1A9NB 2Q79A 2DHXA 4CH0S 2KRRA 2OTLS 3CD6S 1DRZA 2MQLA 2KRBA 2F3JA 2EK1A 4YOEA 2ADBA 3U1MA 3CTRA 2CQDA 2KG0A 2MKCA 2XS5A 1SJ3P 2DO0A 1P1TA 3P5TL 1U1RA 2DNZA 2DGSA 2JWNA 1S79A 1Q86T 2DGTA 3FEXB 4BS2A 4TU7A 4UQTA 3VAGA 2CJKA 1QVGR 2KM8B 3H2VE 2HZCA 1VQ8S 3FEYB 2X1FA 4U67Q 4TU9A 2XNQA 3MD1A 2M8HA 4CH1A 3L3CA 2QEXS 2MZRA 5MLCV 1P27B 1Q81T 1H6KX 1NJIT 2KFYA 3LPYA 1RKJA 3G6ES 4RU2A 1U1QA 2X1GA 2KXHA 2DB1A 2DNGA 2DHAA 4WFBQ 1VQOS 2QA4S 1X4BA 2U1AA 3OW2R 1JJ2R 3VF0B 2V94A 1UAWA 3CC7S 3BO3A 1KC8T 4P6QA 1G2EA 2DITA 3R1LA 2FC8A 3D2WA 1FHTA 1VBYA 4FXWA 2LMIA 2E5GA 2CQGA 3UE2A 1N8RT 1Q82T 2ADCA 3DLLQ 3R27A 3HI9A 1YWXA 2OIHA 3VALA 2YH1A 1URNA 2CPFA 4Y0FA 1SJFA 2MKJA 3UD4P 2DGOA 2M88A 5DDOC 4F02A 1X4DA 1R8PA 2RUGA 1M1KT 4QQBA 1WWHA 2DGUA 1KOOA 1VBZA 2E5IA 5LXYA 2AYGA 1YHQS 1VQMS 3G9CA 2EK6A 3VAFA 1K8AT 3RW7A 2J0SD 2D9OA 3MOJB 2F9DA 5HL7Q 2CPZA 3MUVP 3Q2SC 3CULA 3CCJS 2J76E 3ULHA 2HYIB 4TLQA 3R1HA 1QVFR 1VQNS 2XS7A 2A3JA 2L9WA 2MSTA 2RS8A 2JVRA 2K8GA 1DHMA 2N3OA 5EN1A
chains in the Genus database with same CATH superfamily
1RAAB 5DETA 2C22A 5A8RA 4ZPVR 4YR0A 4DN0A 1KEKA 1X0FA 2RDJA 3US5A 1NUEA 3PRVA 3IRXA 2N7YA 4B02A 5EWFA 2Z8QA 5KFHA 4E8UA 1ZTWA 2CNLB 2FHMA 1UVMA 1SH0A 2Y0BB 1LW2A 3MUTP 1N5VA 2VPXB 5KT4A 2RU3A 2HK2A 2HG4A 1WEYA 1WDTA 2XGQA 2L48A 1RP5A 4X4TA 1U8SA 2VOPA 2B5JB 2MY7A 2D1CA 3NWRA 4R8UA 4IFVA 5IC4B 2BQUA 1JLBB 3OXFA 4IFVB 4FKYA 3DYAA 4A8YA 3NNAA 1CG2A 1OO0B 3OBIA 2RT3A 2BQRA 2CJ9A 1HNIB 1RAJA 3EGVA 4F3OA 1HNIA 4XPCA 1F5BA 5GVQA 2FB0A 3OL6A 6FDRA 3EGZA 1PC5A 4RX6A 4ZP7A 2P5VA 4NA3A 3TYTA 1MNEA 4J9QA 1SV5A 5FJ4A 4LF5J 2RNEA 3CJ0A 3OTDA 4P72A 5I3QA 4Z7CA 5F8MA 2MGZA 3UQSA 4JI1J 3RAQA 2CAJA 2H1YA 2ZVIA 4LSNA 1CC8A 1RBLA 1N33J 1RAGB 4RUHA 5KFGA 1SL1A 1RSCA 1BMQB 3H8YA 3FCWA 1X60A 1D3WA 3T41A 4CQ1A 4MKAA 2D9PA 1U1LA 1IKWA 5ETLA 2NUUG 3O6QA 5IQQA 4EFAC 2ILYA 2PMWA 2XBPA 4I0WA 5KFAA 4EZ9A 2W7OA 1G7CB 4AL5A 1DFDA 4C2MA 3C16A 3OUYA 4DLEA 1P8GA 2LXFA 1VI7A 3LO3A 3PHEA 4FYYB 1HNZJ 1D09B 4IG0B 2RU9A 3V5RA 2J9CA 3LH2S 4Q2LA 5M2UA 4V19J 3JXOA 3QIPA 3UW1A 2MJNA 3W64A 1ZPWX 1TL5A 1WTFA 1AYEA 2ZITA 3BBCA 3R7SB 1EP4B 3TWZA 3ZTRA 3ZZOA 2YWHA 5LJ3Y 1NKEA 4GKKF 1SB6A 4U7UD 4NX9A 3L7PA 4LBHA 1DTQB 4ES3A 1SC1B 2XSJB 3NGTA 2B9XA 2VFSA 2XSJA 2E66A 3BSNA 1N5YB 2KYXA 1WG5A 3DDIA 4ZN3A 4DV5F 1P9QC 4AQYF 5CABA 3UCZP 4IRCA 3HFVA 4TVAB 1QTNB 1Y5IB 2W24A 5AJ3F 1KD1T 1NDLA 3GSIA 1JK9B 3UD5A 2J6SA 1I1GA 2ZDPA 1SPBP 1WKLA 5HVGA 3PIOQ 1XMOF 1LNQA 2ZBQA 1ZH5A 2JVOA 2H5IB 2ERRA 3I5CA 1WC5A 4IQXA 3B4DA 4XPEA 3QO9B 5A8RB 3DCAA 1U1PA 4ELUA 4DU8A 3W66A 5T14A 1Q7YT 1TKZB 1X5PA 5F9NA 1UTAA 1X5TA 2V67A 4UOCA 5AXKA 4QPXA 3H40A 5EX0A 2E9TA 2I38A 2OHDA 3D1HA 3A4TA 2DNPA 5DZ7A 3B78A 2QA1A 2JNJA 3M6UA 4G1IA 4AL7A 4UF4A 3OTCA 1F2HA 3KJQB 3WX8A 2ZH1A 2OMLA 4USVA 1UEKA 2B4OA 3B82A 4NL5A 1UPPA 2YWEA 4ATNA 2HHVA 5ETSA 3VAJA 2QRRA 2JLGA 1SH2A 4DV5J 4KV8B 2B3TB 1RT2A 1RT1A 2YH0A 3FMBA 5DGAA 3T5KA 1B7FA 4LRAA 4OI4A 3OVSA 4V19X 3AHPA 2GC8A 4ZCIA 3R2DJ 2KVIA 2N4CA 3IGNA 2AU0A 4HVZA 4JI6J 2VOOA 4QIEA 2MQQA 2DR6A 3PJXA 4JV5F 2HIYA 2JRSA 1UFLA 1H73A 3W1YC 2AW0A 4P7TA 1T03A 5KFLA 2GO9A 5FIIA 5IFMA 3H4BA 3Q0AA 1T9UA 2HS0A 1WF2A 3EWGA 4HL9A 5CHCB 4DUYF 4ANEA 1ZBTA 1EETA 1Q0NA 1OMSA 2HBRB 4F8RA 1KTQA 1VRTA 3M6XA 2XY5A 4G3IA 1JNZB 2DNQA 1OIAA 4FXVA 4P73A 2MKKA 1Q5VA 5JXSA 4IDKB 4ZLJA 1VBXA 5HROB 2GS8A 3DGPA 2DTJA 2FJAB 4WXWA 3KHLA 3LP1B 4C8YA 2MKSA 3AD9C 2GX8A 3EYZA 4RUAA 4KB7A 3SCKE 3D9BA 2VU5A 1Y0HA 2RHSB 4O4GB 1X4AA 1GMWA 3NGRA 3C6TB 3OT9A 3HHNB 1MLAA 3SI8A 4ZPBA 2R7WA 4MT1A 1CJTA 1FJGF 2B4VA 3MI7X 2AMCB 1C0TA 3FRYA 2MKIA 3UD3P 1D8YA 3D3BJ 1GXUA 2WB1D 5K14A 1SC3B 3TJAA 1FKPB 4N8OA 4LBIA 1HNWF 3G6VA 1HQUB 1NHUA 1Z2ZA 2IDEA 2OSQA 5HQ8A 4N77A 5C42A 4KTQA 3D6TB 2FYXA 4CLUA 4ILMA 3DLEB 3MR2A 3CD0A 3CIMA 3MD3A 1HHTP 3N9UC 1BY9A 1T9VA 2EFVA 3TX8A 4GC6A 1N5SA 4G1QA 2EC0A 1LEOA 4W98A 4A46A 4L75A 3KYLA 1QD1A 1IUJA 2X3DA 4H4KC 3SV3A 2HRTA 2L9NA 1T3NA 2EG2A 2UVRA 1W25A 1YZ7A 2BZ2A 1FTRA 3QFWA 2ALZA 2DEIA 1EB0A 1S99A 4YB5A 5EHHA 1M5KC 4NYPA 1N34F 3KLEB 3EVMA 4KIAA 2G4BA 3RBEA 4NLSA 4OI0A 4DG1B 1YTYA 3RG6A 3AA9A 4ZVUB 3C19A 4Y34A 5ETMA 1Q78A 1K0TA 5DDQC 4A47A 7AT1B 2YPZA 2O3DA 4NLOA 1D9AA 1NDKA 1YJTA 5CD4H 4QWEA 5E7OB 1HNXJ 3NNHA 1QAXA 5KFBA 5KFTA 1Q79A 3DRSA 3DU6A 3JQKA 4ZVPB 1UZDA 3C8YA 3UCUP 4B3MJ 2HNDB 4MKVA 5L8RC 3HPOA 3HZEA 1MMDA 1L3SA 3HHEA 4J91A 5DM7Q 2NXNA 3BGOP 3MZIA 1CPZA 3JTNA 1GXLA 4KO0A 1Y3KA 3KKFA 2LVWA 3QLHB 2XS2A 3EDQB 1D8ZA 2GHWA 5LSRA 3I5BA 5KOXA 2LU2A 1VMBA 1FRHA 3EZUA 1YJ9S 3CUNA 1BD6A 1RU2A 4Q2MA 2CUYA 1FESA 4JB8B 4USWA 3KK2A 2YKMB 4EYIB 2KT5A 2WBRA 4ZP8A 1U2RA 3MCNA 1DLOA 4I7FB 4S0MA 4DR1J 2XLKA 4J9PA 5THWA 4GVLA 2LQ9A 2Q6BA 1YIJS 1JJ4A 2ZOFA 1SL2A 3LTOA 1ZOTA 2NZCA 2RF2A 2WVEA 4UZCA 3RU0A 3MM7B 4J90A 2I6WA 3I5AA 3THTA 2CJQA 3OVAA 2XMJA 5B0CA 2YWKA 4WFYA 5IT9Y 2C2NA 2O01C 2UUTA 1LXNA 3GJSB 4QW9A 3NXZA 4QZVB 4JI3F 3C15A 5K20B 2VFRA 2F5GA 3NGSA 4X66F 4K5RA 2H5JB 3G8SA 2FLLA 3J7YI 4KHMA 2QT7A 4ZKAA 4AL6A 4F3QA 1RTHB 5GAGI 1Y5NB 2LQJA 2DH8A 2NSBA 5AXLA 1IVZA 2E5HA 1U2FA 4ZVHA 4Y2CA 2PIIA 2LEPA 1IKXA 1PG5B 1RT5A 2PGCA 2ATCB 3Q8VA 3V6DB 1E6VA 2HPUA 2QGFB 4YDDB 3CJ5A 1N6QB 4B3TF 3C14B 4WFZA 3TJ8A 2YKPA 2HGLA 4TQSA 1GAOA 1FXLA 4J9SA 4J9RA 1WHYA 5CA5A 1IM6A 4NLWA 2B9WA 2ZE2B 3EICA 3L7UA 3R9LA 2YKNB 3VGSA 3S7RA 2QTWA 4WIIA 1S9GB 3H5SA 2DHSA 1F9FA 2CVIA 2KT2A 2QLWA 3M6VA 4JP8A 4M5KA 2WBMA 4RW9B 4Y65A 4LFAF 1NK8A 4K4SA 1U24A 4OZNA 4EYHB 1WACA 1KHWA 3KLFB 3H5YA 2KJVA 2BRLA 1W26A 3ZO7A 2V2VA 2BANB 2FTRA 4X66J 2CRLA 5E41A 1YJWS 2YNHA 2GGPA 3DOKA 4C0HA 5AE2A 1ZAVA 2IM2A 2BYCA 2V8PA 2UV8G 5L9XA 4WTYA 1RBAA 1LWFA 1KDNA 4OZLA 1Q8IA 4PXCA 4WIQA 3W9HA 4N76A 1IQTA 1S7IA 2IM3A 3V81A 3VR1A 2QJ3A 2FVRA 3B4MA 2HVDA 2MB0B 3J7AN 3WDOA 1UMJA 5JJBA 3GCWP 2R2TA 4KBIA 2WB4A 2MZJA 3K7RA 1VQ5S 1HA1A 5EX3A 4LFBJ 2W2QP 2C3PA 2LFVA 2M52A 3HHLB 1FEEA 1KOHA 2W4CA 4AUKA 4RNNA 4ERDA 2MDAA 1HMVB 3CCQS 1GX6A 2OKQA 1WOSA 4FYWB 4K7QA 3S6EA 4DPOA 4TQRA 2M5YA 1JLQA 1L3KA 2OPRA 3I0RA 2Z2MA 4OX6A 4C7QA 4DV2J 4LQ3A 2IPOB 1IBMF 2HVIA 3VAKA 1RA7A 2XM3A 5KFNA 2JC1A 3PX6A 1XNRF 1VISA 4K4UA 3L95X 3HP6A 1RXOB 2E1PA 3LQVA 3HVRA 1T05A 4F0HA 3PRBA 1TMJA 2RAQA 2EXUA 3D28A 3KUEA 2I0XA 3KK1B 2QIFA 2F7VA 3DOLA 5CXTA 1S1TA 3GMGA 4M5MA 4A8MP 3DGVA 4FYDA 3KDNA 5A8KA 2MQPA 4F25A 2FZCB 3PKYA 3NAIA 2B4PA 2M0GB 1F3VA 3UI3A 1SC6A 3IBCB 3NOGA 5CYJA 1WKKA 1IM4A 1TVRA 3D0IE 5F8IA 2ZH9A 1FI4A 3DNCA 2XZDB 2OFGX 4DZ6A 1I3OB 1F60B 2XC9A 3JB9k 1H0HB 4C0OC 3OLBA 5E0OA 4JUZA 5F8HA 1S10A 2GIRA 4QWDA 4CO3A 1FFSB 1Y9OA 2E5JA 3E51A 2MXYA 1TELA 3GP9A 3BH7B 4IG3B 3K5NA 2W1BA 3M8QA 3ETOA 4R5PB 3GFYA 4DR3F 1MW7A 4FVMA 1FX4A 4LF6J 3CT9A 3N6NA 4B9VA 4WU2A 4K4XA 3QRRA 3GYGA 3BSOA 1U1KA 1WG1A 1NHKL 2AJ0A 4FF2A 1YDLA 4PQUA 1RAEB 4UY85 1U0HA 2AF6A 8RUCA 4DCJB 3U7JA 1TQLA 2ZNZA 2AYBA 1IKWB 3KHHA 1FKOB 2KB2A 1WORA 2RRAA 1HYSA 1W2IA 3CJKB 3MM6A 4GO5X 3TI0A 3MM6B 1RQ0A 4PYAA 4O0IA 4TY8B 4OJ1A 4XK8C 4BWMA 1Q5YA 4DX7A 4HEA9 2PC6A 4RNOA 4CH0S 3LGMA 3NCRA 3W65A 2HBQB 3NY0A 4JI6F 3KK3B 4LR7A 2BJ8A 2DXFA 5LMUJ 2XTJP 4DV0F 1IXKA 4FS2A 2UVUA 4KAIA 4AD6A 2BQ3A 3D6MB 4YEAA 2RDIA 3A1YG 3HULA 5F41A 4DR5F 3J81U 2BJDA 4ZJLA 3MR3A 2BA9A 1KRPA 1LWFB 1RWXB 4AT1B 3TVYA 1NKCA 4KPCA 2KG0A 2XMVA 3J80Y 1OQ3A 1YJRA 2DCLA 5C25B 2Y1IA 2XS5A 2YY3A 3BGUA 1P1TA 3P5TL 1FX2A 2FHJD 4BC9A 2JEJA 1MWZA 1S6QB 2K2PA 2OO4A 4NI2A 4KH1B 3FC9A 4NMLA 4A4JA 2Z57B 2MQ8A 1IKYA 3MR5A 2IAJB 5IS2A 1TKXB 3P96A 4UQTA 3VAGA 4PG5A 2MLZA 2WHOA 4RWWA 3T9ZA 2CJKA 2IJNA 5IQ6A 3GV5B 3JSMA 3CW2C 3E2EA 4JI8F 4I64A 1HNWJ 2FZKB 3N5BA 2X1FA 4DR4F 2W7PA 2CJAA 2ZEJA 2JH3A 2POKA 2VBXA 4K4WA 2IA6A 1MSWD 2XNQA 3MEGB 5A2QU 1RHUB 2QEXS 2MZRA 1XERA 3A3PB 3CDBA 2H4WB 2K1RA 3KG4A 4USKA 4I6YA 4DF4A 2KFYA 2IYGA 2VFTA 4K5SA 5G4DA 3G6ES 3M2RB 4GKJJ 5E3CA 2EEYA 4C48A 2X1GA 2KDOA 5M2PA 4RU2A 3I31A 2J5AA 1U25A 3A3NB 2HNYB 2DNGA 1VQOS 1RA6A 1HQEA 1SI9A 5A0YB 3GWCA 2U1AA 2WW8A 4PZVA 3CJ2A 1UAWA 5KG1A 3JYTA 4F4KA 1B0VA 4OFZA 2ROGA 4H54A 3G6YA 4ECXA 3QFHA 2FJVA 2J6TA 3MECB 3FCHA 3CO0P 1G2EA 4FP9A 4LT6A 5KFIA 3NCQA 1NK0A 1HBNA 2FC8A 3QGIA 4M5NA 2ZVSA 1PJ7A 5C5JA 4QYRA 3T1HJ 4PQUB 5ADZA 3PVXA 1WUUA 1KR4A 4WZMA 1P6TA 1HPZB 1VDHA 1FRMA 1V5IB 2B4UA 1ZM3A 3MWBA 1NSAA 2ZDOA 1DLOB 2D7SA 4I56A 4WE1A 4WJBA 2EKYA 3T9NA 5KFOA 3EZOA 1YWXA 2ZBRA 3IP0A 3CJKA 1TL1B 2ZH6A 2YH1A 2OIHA 1URNA 4Y0FA 1SJFA 3K8VA 3LW5C 2PI5A 3I9ZA 4OYAA 3Q8SB 3NOCA 4HKQA 3J7A1 1Z2LA 3UD4P 5HVHA 2M88A 1N32F 1L5UA 2VASA 4CM2A 4F02A 1QY7A 4DOZA 3E01B 4GO7X 1CULB 1R8PA 3DLGB 5CH7B 4C98A 4OMFG 1BE4A 1SBRA 3QO9A 5CZVA 4DUTA 4QQBA 3AQPA 4NXNF 2DGUA 1FKPA 4JV5J 1YHQS 4A8OA 3H7HB 3K8WA 3DOMB 3L7OA 3CJRA 1F9EB 1K8AT 3RW7A 4IR1A 3NL0A 5HL7Q 1XMOJ 2A2CA 1TV6A 2CPZA 3C6UB 1RT5B 4RPFA 1HBMB 3OLAA 3GV8B 1RUSA 2NPIA 3K89A 2J76E 3RJMB 2D3O1 4PUOB 4GMKA 1QVFR 2K7KA 4PXDA 4C8ZA 2CNKB 3OJUA 3HHKA 5C42B 3RB4A 2WZ1A 1XC9A 2EFPA 2L9WA 4KGKA 1WKJA 3O5TB 3U02A 4LRFA 5GAEI 2NCKL 3D54A 2HZVA 3A3OB 1U02A 2VKRA 1PILA 4LF6F 3ILLA 3RAMA 2BW2A 2HHUA 2N3OA 2DXDA 4ZCLA 5B0FA 5KG3A 1HNVB 4CIOA 4ER8A 3I55S 1FT8A 1EJ7L 3MMBA 2MEWA 3OTOF 4C4WA 4ECQA 3PRDA 4CYUA 5FLXY 1OJ4A 4RNFA 4LF5F 3K0JA 1UPMB 2XHWA 2Y1JA 5H9FJ 2XWXA 3S01A 4ES1A 3TZZA 1HW8A 1RT7A 3LP2A 2JSXA 4O3QA 1S77D 4CCHA 3EGNA 1UW9A 4YR3A 4RLEA 4AXIA 5K8NA 1S1WB 4ZS6A 3SCLE 4DPXA 1M90T 2F8EX 5T7LB 2DNNA 3WQPA 2XYPB 1RT3B 4DV6J 2CQ3A 2DH7A 4EWTA 4JI5J 1DQ9A 2LA6A 3TW0A 4IH7A 1JLQB 2WSCC 4ELVA 3CCUS 4LIRA 1JLGA 3OFHA 4ZPDA 2GQCA 2ZUGA 3E3XA 5DG9A 3W3SA 5J1NA 4OHZA 3QSYB 1IR2A 3JSYA 5MAOA 1QVGR 1LWCA 1QSYA 2UXBJ 4LR8A 1LWCB 1SKWA 2YX4A 4PXEA 1QTMA 5E3AA 1J5OB 1WHWA 1PAEX 3D68A 1C0UA 1S6OA 1S9EB 5I42B 1JXLA 4RBTA 3T6JA 3OTBA 3P5BP 3Q22A 4J9NA 5D0HA 4ED0A 1VJQA 2FY8A 1J2VA 1FF2A 3WC0A 4A8SA 3RB3A 4LFCF 3QSIA 3BM7A 2F4FA 4F2RA 4OYZA 4F4XA 4R8UB 1HI1A 1NZ8A 2YNGB 1R31A 3KLVA 3NNCA 2VD3A 5BXIA 1VLYA 2QMUB 3C15B 1JLCA 1FK9A 3OPKA 4YY3F 3ENWA 1C0TB 3G6XA 4JV0A 3M8PA 1T11A 4YP3A 1U09A 3R2CJ 2JX2A 3M8QB 1N5QA 3UFCX 4NLVA 3CCLS 4WFXA 3RR8A 2RQKA 2EWHA 1FD8A 2QSWA 2ZE2A 3GFZA 4J9KA 1CJVB 4JI0J 1GFWB 3IWXA 3ONQA 2MHEA 3FFIA 4IOBA 4K2XA 4ZLPA 1E6YB 1SXLA 2AX0A 1PYSB 1S57A 3NLCA 4LJMA 2V9KA 5KOWA 2RRNA 3ZZRA 3G96A 1T95A 1FKOA 2DNRA 2R42A 4WFNQ 1U45A 3HX9A 3O44A 3VAMA 2HLUA 3M8ZA 3PYEA 1IWAA 1NO8A 2QYGA 3HVTB 3NMRA 3K5LA 3TA0A 3KK2B 1XIQA 1PYTA 2G1DA 2KT3A 3HSJA 3MEDB 1FCAA 3MPYA 3VV2B 5F8LA 5DM6Q 1HR0F 1HWIA 2MKHA 2CADA 3PW5A 2WW4A 4N41A 4C11B 5DG8A 5J2PB 4RL1A 4K2JA 5KG2A 4B9LA 1EKSA 3LA0A 3A8KA 2NUHA 2ZHBA 4RKUC 2YKOA 4ZK7M 2XY7A 3BEGB 1X9SA 4KO0B 2DRAA 1EAYC 1TL3B 2RE1A 3PNIA 1GMWD 3LWMA 2ZH3A 4XTTA 3TA2A 1H2TZ 1T3OA 2G9OA 2XYHB 2RQCA 2NYIA 3VCDA 2HSEB 3DGPB 1VK3A 4ZIWA 4DR7F 4QU6A 1TKDA 2HZAA 1CEZA 1WSRA 2RD5C 3CCSS 2FPHX 3TRGA 1Q53A 1S12A 3QQCD 4I7FA 4RW8B 3SDEA 1WDDA 1IJFB 2B43A 1JLGB 2AEMA 2W9CB 2W9CA 3TQ1A 1XK8A 2ZH7A 3M30A 2RF2B 3CJ3A 1IKVA 1E6VB 2NXJA 3Q86A 2UUCJ 3IRXB 4CT8A 1QUPA 3MM5B 4CDIA 3TQEA 1H2VZ 2CPDA 1R8AA 2X1BA 4WU3A 4B08A 4C8MA 5IV4A 4X4QA 3G71S 2B6AA 3FCVA 3GR1A 1SV5B 4EO6A 5DQIA 1TUWA 1YRTA 2BOPA 3TVKA 3FMWA 2KU7A 1S49A 1T94A 2LKZA 4F26A 4ZDNA 2XY6A 4OIXA 3GV7B 5KT5A 5CD4A 2LECA 5IOLA 3GFXA 3N0VA 1NZAA 2O1PA 4LF7F 3EMTA 3EM1A 3KLFA 1JLBA 3W9JA 4IH6A 2CA9A 3D3CJ 4TN2A 4H4KA 3R5BA 1XJWB 3GLJA 1NBEB 2F65A 4C3KA 1FDAA 3TZXA 5GMKa 3KNGA 3KJVA 5L1IA 1NJWA 1UA0A 1M5VC 2IMWP 4DR6F 1TL7A 4QCLA 4ZPWR 4K4TA 4DG1A 2Z30B 3RBXA 1NJZA 2VC0A 1R0AB 1YRUA 2NS1B 4BDPA 4QIFA 2CQPA 2UZAA 1KQSR 2W2NP 2XI3A 1RI7A 3VVUA 3ENAA 5J2NA 4P2XA 2N7CA 1K9MT 2QFIA 3C2PA 4FYXB 2PMZD 1RACB 2RKIA 3HT3A 2EFQA 3KHGA 1R6YA 2Y3YA 4P9SA 1C1CA 1PCAA 4PCQA 3T6BA 5I3UB 3X1LB 3DU5A 2HVHA 4IFYA 2XMAA 1YJNS 4QIGA 1JQGA 1KLMB 2CWKA 2FVSA 3PO4A 3S8SA 3PXGa 4K59A 2R8IA 1KS2A 2PT0A 4K8RA 4LF7J 2CQBA 2V34A 3D6FB 1AROP 4OLOA 3OR1B 2DPIA 4FF4A 2RQMA 2I5JB 2YWGA 3G8TA 2DT9A 3PO5A 4WP9A 2CPIA 3I4PA 1SKSA 1FDNA 3DLGA 5A8WA 1AT1B 1UFWA 4OYIA 2MZ1A 3DLHA 4C8NA 2FY1A 2P9GA 1FXDA 3CDUA 1S1XA 3W60A 2WVBA 2AHOB 3BN7A 4ZMMA 1VR6A 4LRDA 1C4AA 4DEZA 2R8HA 4DFJA 5FDLA 4MTPA 4OZ1A 2HVZA 4ZPCA 4B3RF 2HQDA 3I4HX 2YQ1A 3IAS9 1B0PA 2P6TA 3VVTA 2ZJPQ 2ZC4A 4F50A 3GE9A 4J37A 3FBFA 3DXBA 5B0GA 2FD2A 4JI3J 2W2PP 3FVYA 3R6GB 3L9ZA 4G1QB 1M5OC 2M8DB 3N6MA 4O44A 1RABB 3SXLA 2ZH4A 2J8SA 2HNZB 4OL8A 4B3OB 4NEZA 4RW8A 2J9EA 2QV6A 1WC1A 3SDEB 2YVSA 1KVKA 5KFDA 4IRKA 1CS4A 1N54B 4O4RA 3HKZD 4ZHRB 2V2KA 1HWUA 2YNIA 4DV1J 4JI4F 1NSQA 4Z2XA 4WKRA 2XGPA 4JI0F 2AJ2A 3CC4S 2C2KB 5E5NA 3IR5B 1N36J 3EGWB 4B3MF 1JLEA 3D5MA 2C42A 3OFGA 3MXHP 1BGXT 3V6KA 1UW4A 5A0YA 2EI5A 1UVIA 4NZ7A 5ETVA 3S1TA 3FQKA 1RTDB 4RW7B 1C1BA 2KTQA 2MQOA 1TK0A 3ZTOA 1B70B 2L3MA 3Q8RB 4C8LA 2MHNA 3ZC4A 4AE5A 5C7PA 1GMUA 3LP2B 2I2YA 2CJXB 2BVZA 3C16B 4P75A 2ASJA 4IR9A 4UUWA 2VL1A 4KC5A 5KFFA 3PKMA 4P7VA 4ID8A 3TA1A 3OFFA 3BB5A 4ES2A 1Y11A 3RRGA 3CCZA 1OS5A 2XG8A 1HWLA 2BJ7A 3AJ2A 4ENOA 4ED3A 4CTAB 1NH8A 4Z7YA 2M2BA 1WOOA 2RJZA 3VGVA 2OSRA 4F67A 2D3OR 2YKMA 3TP2A 5LSLA 2IJFA 1HPZA 5I3PA 2CDQA 1S1VB 4KJIA 2VKZG 1S7HA 1SC4B 4WWSA 3M8RA 4DV1F 3H59A 5EGYA 3MUMP 1QSSA 1IJEB 4C97A 2UVWA 2R8JA 1R8HA 1H2UX 1LK7A 1X4CA 3GU0A 4HI2A 2EBGA 3H2UB 2CPJA 5HQMA 1HD1A 1S9EA 5I42A 1SJQA 3FBBA 5ETNA 4ZOSA 3RW6A 2OPRB 4DQSA 1LWEA 2ZD1A 4ICLB 1QAYA 1LWEB 2ZD1B 4R0EA 2QC3A 4ETXA 8ATCB 3U1LA 4DV2F 2ZWPA 4ED4A 2KN4A 2FVQA 2KHCA 2OJ3A 2LQ5A 4BLGA 4NCBA 4DPWA 3NRBA 2CQIA 2I5JA 2DD8S 1FJ7A 2H4YB 3W8GA 3KMQA 1VS3A 1LW2B 4YB1P 4DV3F 4DS4A 3DLKB 4M8LA 1S1XB 1RT4A 3MR6A 1TZ0A 2H65B 4IYQA 1WC0A 2Z0GA 1T9XA 1T9WA 1WJ9A 2R7QA 4KYZA 1VHIA 3BQ1A 1W2BR 1FNOA 2WVCA 4U7UK 5J2QA 2JEFA 2AZ1A 1IBKJ 2H54B 3G4SS 3I56S 3IRWP 4EBEA 1CLFA 4Q0BB 3AODA 3IG1A 3CD7A 2A6OA 3NG8A 4W90B 2HFUA 5GADU 1HNXF 3BPSP 2XULA 2WRMA 1MU2B 1RTZA 4C8KA 1HHQA 5KT6A 4G1PA 3TANA 3G2XA 3HVAA 1F2GA 4LFAJ 3LWLA 1SUQA 2XO6A 3CD5A 4I4BA 4N5SA 2XQCA 3EX7B 3WC2A 3HJVA 1SQEA 1LFWA 2CG4A 3QIDA 2OELA 2ASLA 5LSOA 2AGPA 4P10A 3PX4A 3BQ0A 4HLBA 2DJWA 2DY1A 2KZZA 3Q8QB 2AZ3A 4B9MA 4K0KJ 5J2PA 2W4PA 3A13A 4TU8A 4FF3A 1UVLA 3M9MB 2UUAJ 3UCGA 4DPTA 4YUDA 5J2MA 3GB0A 2HMIB 4RBUA 3MFIA 4NLTA 1B4SA 2J9DA 4PEOA 5LM7E 1RU1A 2GZOA 2MQNA 2WCXA 4HHUA 3F73A 1WNEA 5K5MA 4ECWA 3TJ9A 1XMBA 1WEXA 4KGXB 4QR2A 5KFEA 5KT7A 3PR5B 4IG0A 5K9FA 2IY5B 2NPFA 1S1WA 3PZPA 1TUGB 3M9NB 1M5PC 3T1AA 1GQEA 2J7WA 4ZCKA 3AT1B 1X9MA 1MG7A 2N4DA 1Q7LB 2MZTA 4HDHA 1A7GE 2DO4A 3L09A 1G4CA 3GJQB 5BR8J 2PO4A 2KM8C 4EZ6A 4LF8J 2JLEA 2KYZA 3H4DA 3KLIB 2QO3A 1BWEA 5CCMA 2VG6A 3QBCA 4M5LA 2Q43A 2CNNB 3M30B 2PN6A 3SBMA 4DJBA 3W62A 1YVFA 2Y8WA 3BZQA 5DG7A 3HJFA 1C4CA 3FK4A 2VC1A 4DI6A 4J9LA 2W25A 3H20A 4ZVSB 4DR2F 4PWDB 1NAQA 2EW9A 2FGCA 4ZVFA 1QSLA 5F8JA 1N0VC 2W2MP 4B9SA 1JKHA 5E33A 2C3OA 1JKHB 4XIUA 4DL7A 4ZP9A 4JV1A 2KRRA 3IM8A 4N47A 5ETRA 5HLFA 1RTJB 1SH3A 3BKUA 2MQLA 2KRBA 3LF0A 4P2SA 1TKZA 2F3JA 1GMVA 3BSCA 4GVBA 1YJVA 5D6GA 3NWGA 4RW4B 4YMEA 1RWMB 2YWFA 1HNVA 2DRDA 3B8HA 3QT6A 3U1MA 1UA1A 4DV6F 3CTRA 1OQ6A 3DRSB 2CQDA 2AV5A 2YQ3A 3C6UA 3CIZA 3NGKA 3OR2B 5IWAF 3MMCA 4C0BA 2MKCA 1N56A 1R6VA 1B7YB 1YBTA 2BOAA 2O66A 4JBCA 1H74A 1SJ3P 1D9FA 2DNZA 2DGSA 2ROEA 3W63A 4DFKA 2FQQB 2D3UA 3BV8A 2BR0A 4LSLB 2R2SA 1EZZB 3ZNJ1 1F1BB 2XO7A 3RRHA 2DRBA 2HHTA 1UETA 3PEHA 1FTCA 3I32A 1O51A 1E6YA 2CJYB 4TU7A 1RT2B 2AQ4A 2V69A 1NSKL 4WYLA 1MU2A 5KFYA 4H4MA 3HK2A 3F44A 3DRPB 4I6WA 2KM8B 4YB6A 4HI1A 5B09A 3N6LA 3FEYB 2V8DA 1F5CA 2ACYA 3MGJA 4U67Q 4KHRA 5L1LA 2Y0SD 5EN1A 1YBAA 3TEGA 3D0GE 3SSQA 4HYKA 4KE5A 4WP8A 4DR2J 3PACA 4JI2F 3UR3C 4U95A 1W7WA 4HDGA 1RT7B 3VQSA 2YPYA 4EEYA 5AT1B 4HT7A 4F4AA 2MKYA 2RHQB 4F3MA 5IWAJ 2VJUA 1RKJA 3KJFB 3IC1A 3M6WA 3OD2A 4C11A 2C2MB 1R0BG 2O67A 5DRKA 4X4RA 1U1QA 4B3SJ 1S5ZA 3IBWA 3LALA 6FD1A 2KXHA 2BACA 3FRZA 3I87A 4H4OA 5J2MB 2DHAA 3W7BA 3EPGA 5D0EA 3IFEA 4OI6A 4BBYA 3OW2R 3I0SA 4UW2A 2V94A 4DSKA 2V8HA 2WONB 1BC6A 1S9FA 4ZP6A 4CLZA 4USTA 4L74A 3PTWA 1KC8T 4Q8EA 3V6DA 2NQPA 4KY3A 2DITA 3R1LA 3PW4A 2HNZA 4Q7AA 2KL8A 1VBYA 1RTHA 2UUWA 3PW0A 2HFNA 1ZM4A 2E5GA 4FXWA 4MYUA 3WIVA 1KVIA 1KVJA 3F41A 1CJVA 2ZOGA 3BKFA 3UE2A 4Q44A 4JI2J 3ZNUA 4DV4J 1M5HA 4FXDA 3DRRB 4NCGA 5HJXA 4Q45A 3V6JA 2ADCA 1RWPB 2YX7A 4LRBA 4QW8A 3VALA 5KTQA 4KGVB 5HVFA 3PW7A 2HNYA 4RW6B 3UDLA 2XMKA 4YHHJ 1J27A 1TKTB 4JI1F 3BJYA 2VJVA 1WC3A 1BWVA 3GONA 1S48A 3DI6A 3JTPA 5DDOC 2M3DA 3DI6B 1UZHA 2XCAA 1CJKB 4NLUA 2W9BB 3JSRA 1N0UA 2QLFB 5D4OA 4RW9A 1LV5A 3M8YA 3MF5A 1FD2A 3NGUA 3VZHA 1NPRA 1D1UA 5D4NA 1J5EJ 2MTLA 1BLUA 2BANA 3TUIC 3HVWA 1UCNA 3G9CA 4DQQA 3LAKA 1SVDA 2XEXA 2A10A 2BJ9A 2J0SD 1S76D 5IT9U 1UEVA 2AJ4A 4F4ZA 2DVIA 1SKUB 4M5IA 3MUVP 4IFYB 3QLHA 1BHNA 1HYSB 1OYDA 1TL1A 2KJWA 3R8YA 4URQU 3LAMA 4B3TJ 1RJJA 1GTHA 2PI4A 1VQNS 2HBYB 2A3JA 2BE7D 2FJXA 3W2WA 2NSCA 3BGRA 3QZ7A 3Q24A 2Y8YA 1C2PA 4DCOB 4QIVA 1N36F 2R7XA 1OY9A 1TL4A 2V8VA 2UV8A 4MMOA 1NKBA 4PYDA 3ILIA 4OX9F 1DBDA 1HI0P 3NS6A 4I68A 1RHRB 3LGNA 2QA4G 2BDPA 3KWMA 4D3HA 2DXEA 1ELOA 1HARA 2L08A 4OI3A 1I6JA 1KTVA 1REVA 2LLZA 2UVVA 1REVB 3GJTB 3HMJG 3CF5Q 2MMYA 1TAUA 5IM0A 4DV3J 5DDRC 1CJUB 3V4MA 5KFKA 5D8HB 4ZIVA 1HWJA 2BBEA 5A8WB 1FDDA 3NMAA 4M95A 4ED8A 1KKHA 1S1TB 2DYAA 2F8HA 4H4OB 4ZVRB 8AT1B 4ILLA 3A8IA 2HVEA 2M4MA 2XWYA 1IKYB 5JUMA 2HRYA 1AW0A 3SIPB 1NDCA 4FNIA 4IG3A 1V3ZA 3T19A 4IQMA 3CCES 5H9EK 2WAQD 2K3KA 2FHKA 4I2PA 2KZMA 3BBFA 5CYQA 1RAIB 5CYQB 3IG1B 3RR7A 3ILOA 2JFDA 3CO9A 5IC6B 2ZKUA 2FJDB 4PWUA 4PKDB 3SEOA 2N82B 1O8BA 2BJ1A 1UVJA 1NU4A 1VRQC 2QZ8A 3OV7A 1UVNA 4XDCA 4HHJA 4ECZA 1U0HB 3AY0A 3ENVA 1QUVA 2I8EA 2YTCA 3MECA 3ZTPA 3H25A 3BO4A 5F3TA 1IBMJ 2ZC3A 4TKTA 3OQ2A 2ZUAA 3MPUB 4ZPTR 4YN3B 2IVFB 4CYUB 5B0DA 4MIAA 1RWKB 5KFJA 4IO9Q 4DL4A 3FDSA 2DNMA 2CDRB 5CQGA 3WHIA 4EGLA 4TY9A 3J7YU 4I2QA 5DJBA 3R5JB 3M1VB 2IMOA 4UUXA 4WCEQ 2OI2A 2DR5A 3FNNA 1FE4A 3DRXA 4HACA 4RW7A 3VWSA 3WBZA 4QWCA 5KG4A 3RB6A 4KKOA 1NK9A 4KKOB 4KSEB 1S1UB 3LUYA 2YQ0A 3MAAA 3A8EA 2HWTA 4M63A 1S1VA 2XMUA 4MH8A 4YS2A 4DSIA 2MLYA 1FJEB 2X7IA 2DNLA 3ZZUA 5B0BA 3C3LA 3OXLA 1RB0A 5F0UA 2G0CA 4W92B 2OGUA 4JYAF 4KHPJ 3BR9A 4FPRA 1RCXB 2AIRB 3MCOA 1AB8A 2K06A 3JTOA 1U8WA 5D0RA 3TX0A 2R3VA 1S4EA 1TKXA 4OV6A 1DTQA 4DFMA 3TAMB 3CMES 1XN9A 1YQHA 2F9JA 3D67A 2LCWA 2F40A 3I82A 2B51A 3KG0A 1S6UA 1MN7A 2DIVA 3MEKA 2GQQA 2G1HA 3H42A 4O3NA 4ALZA 1DZ5A 1VRUA 2J7UA 2R7VA 2GMJA 2VA2A 3OVBA 1EQ0A 2RSQA 4CLKA 2PEHA 3JAMU 5IXUA 1RAFB 4DMZA 3OL8A 2IRUA 2R2RA 5CYMB 2OPSA 3NEKA 4G6VB 1WG4A 4YY3J 3M9OB 4L3KA 3W61A 3TAQA 1YG0A 4DL2A 2R7SA 1CS4B 1QE1B 5DGBA 3M8PB 1WF1A 4ZVEA 4LF4J 2PD1A 2ZOMA 4OYWA 4DQRA 1FWKA 1VK8A 4RW4A 3HFKA 3MM5A 5B7WA 5IM0B 3PYGA 5J1PA 1RZMA 5DO2A 5JMNA 1R8CA 1N4LA 1RTIA 3ITHA 4DUYJ 3I6PA 3RYLA 1RTDA 1VQKS 2UU9F 3AA8A 3CGIA 3MCMA 4WKYA 2CQ4A 2DK2A 3TZYA 4YHHF 4DSEA 1HHSA 2VICA 5AXMA 3Q8UA 4DV7J 5T41A 3PCOB 1MMNA 3AOCA 3QNWB 4LIWA 3AB4B 3K17A 2P9CA 4LR9A 3UWTA 2R7RA 4A8WA 4A8KA 4RUCA 4DFPA 1X9WA 2QMWA 3F0NA 3RZAA 3ZZZA 5KFQA 1LXJA 3JSBA 2KKHA 1YGYA 2IHR1 3CCRS 4OLPA 1HW9A 2D3ZA 1RHJB 3SQGA 3OTEA 3H90A 4DX8H 1QLNA 2MLXA 4JI8J 4PG6A 3DKDA 4ED6A 5HBMB 1YX2A 4JI7F 4O0NA 3GG1A 2Y1RI 2BKNA 5KFVA 5CCLA 3M32A 2GJIA 2MGZB 2YKAA 3AD7C 5AE1A 4NRUA 3GIKA 2B7CB 4MK8A 3KMSA 4FBUA 4MK9A 4LFBF 2DNYA 2JHEA 1VC6A 2JOQA 1OSCA 3VZIA 2W8LA 1XBWA 3CMAS 1FA0A 3FJ2A 1KQFB 3SZ2A 5JVGQ 1VRTB 2WK4A 2AEFA 2J6UA 3JS9A 1LK5A 2Z2LA 3N5FA 2VG5A 2F4VF 4TYBA 2V2ZA 3VHQA 3ISND 3KLHA 2MJUA 2YX1A 4OQJA 4Y2IA 1N34J 1SIZA 3BR8A 4L3NA 1ULRA 2ASYA 3C6TA 2LDIA 1GNKA 1LW0B 4O3PA 4LMZA 5KFRA 2V68A 2ZH8A 1CC7A 3IR7B 2WOMB 5KFCA 4CLPA 3ELHA 1N52B 2C2DA 2J7KA 2LP4A 4NZ0A 3OHAA 1SL0A 1EHWA 1N6QA 2DH9A 3ENQA 1UWBB 1I5OB 4PAAA 2UUAF 3MEEB 2KO1A 2YKNA 2YWWA 3MPDA 2DNKA 3MM9B 1A6LA 3EZ5A 2CJBA 4L76A 1RBOB 1QDUB 1RTJA 3Q89A 1Q16B 2MY8A 3DDNA 3ISNC 4FN5A 3VGTA 4DR1F 2FLOA 2M9KA 2VF3A 2HIQA 1K1SA 3N4WA 4ZPAA 4WPAA 3IBFB 2W8KA 2NXUA 4DV4F 1RWVB 5IT4A 2IC3A 4CO2A 3N28A 4RU9A 2UXBF 1F6TA 2HHQA 5HP1B 1WELA 9ATCB 4U8VA 5HN0A 1ZETA 2CQ1A 2XCPA 1T7PA 1YITS 1N32J 1X4HA 1VC5A 1NM2A 4UZBA 2HS4A 3TARA 3W9IA 1FVQA 3QWPA 1FJGJ 4LSLA 2FUG9 3CWJA 3T3FA 1JLEB 1M1GA 3OXGA 3X3UA 3ZXWA 1S0NA 2F63A 2B7BB 3IS9A 4ZVTB 3KUGA 3GFHA 3CCMS 4OJGA 1NH7A 1VIXA 2DEJA 4NXMJ 1JLFB 1AZSB 2RVJA 4FDFA 4B9NA 3CJSA 4J7CA 4OZJA 1S0VA 1TL3A 2XI2A 2OP5A 2BX6A 2H51B 5C2GA 5KG0A 1HWKA 4X64F 4OJ3A 2D41A 4M5JA 1VQPS 2HBZB 2M7SA 3M7VA 2C3YA 3R5AA 1Q8KA 2DR9A 4CLTA 2HKEA 2GIFA 4MFBB 2DCUB 2FC9A 2J8AA 2JLFA 4PQAA 5HMYA 4ED1A 1AUDA 4CO5A 5C24B 1CSJA 1RWOB 3U1NA 1U26A 1ZZFA 2V4JB 1NDPA 2W4DA 1H38A 4X65F 4QYZK 3RAXA 3ICLA 3IM9A 3SQOP 4AYBD 2HWIA 1FFWB 1R3NA 4CZCA 1FNXH 1TTHB 1UP1A 4ANDA 2XLJA 1FKAF 1TR0A 3DN9A 4CRJA 3HD2A 2ZH2A 1WTBA 1Q95G 2OAUA 1FDBA 1FWPA 1EETB 3K57A 2DY9A 2DKOB 2HS3A 1H72C 2VONA 2BJEA 1DJ0A 1ZA1B 3PJWA 3W5YA 3TUJC 1CULA 2GMHA 5C2CA 4ED5A 4CLWA 4DHVA 2VQEJ 4ICLA 1L3TA 2ZBPA 3PFEA 1AFJA 1UJ4A 4KFBB 2GAGC 3FSYA 2HQFA 2RH3A 4CH7A 4ZLLA 4RNMA 2C28A 1KFSA 3CXCR 1VBKA 2ZZNA 3BYPA 3T5HA 1WOPA 3DFEA 2QE5A 4Y6IA 5SZTA 3P49B 1Y5LB 1BUXA 1QM9A 2QN6B 4LVNP 5G0RA 1HI8A 4NOHA 2PE8A 1NRKA 1B0TA 1YZ6A 7FDRA 4K4VA 5L46A 1EARA 3VAHA 2Q6CA 1Z1ZA 5L1JA 5K14B 4MKYA 1VIOA 3CJ4A 3O3LA 2RB7A 3HFZB 4QJVA 4PWDA 2QYCA 3T5JA 4U7CA 2DR7A 4ANCA 4PR6A 4DN9A 1S4FA 1WI6A 2AT1B 2XMTA 4QIWD 4RNHA 3DLEA 3SCJE 3UNGC 5LXRA 1C1BB 3MM9A 3P6YC 5GAHU 3FFIB 2HFOA 1X5SA 1JXEA 3IGVA 4NLPA 5J2NB 4ZCMA 1KQKA 3HM9A 3ZTQA 3DHWC 4YB7A 1NK5A 1DTTA 4BCAA 1WSVA 3FUYA 4QYZJ 2FLPA 3WX4A 1B3TA 1YK9A 1TKTA 2BXJA 3DM2B 2FVCA 3C46A 3R3TA 3L4BC 1DY3A 2YNHB 4DU7A 1U6BA 1XQIA 3Q8YA 1U1OA 3KNAA 4FYVB 1YJ7A 1UWAA 1FRXA 4B9UA 3MTKA 3BQ2A 2B8QA 1AA1B 5J1EB 2LA4A 2CQCA 1HFEL 2HGNA 2L9DA 2NXCA 2PEBA 4Z37A 5HO4A 3O1LA 2E9RX 1FO1A 4Q43A 1IBCB 3SFGA 3G82B 1JLFA 2OTJS 4GC7A 1LKZA 2GQ2A 1Z4UA 4DL0C 1C1CB 3GJRB 1TUVA 2C2ZB 2HFSA 2F4VJ 1TFWA 3QGGA 1VQLS 3G87A 2HAIA 4NEYA 2LYVA 5ITHA 5HSPA 4TLRA 1UL3A 4DR3J 2CZ4A 1WC4A 4DX6A 1D0EA 1RHQB 1PO6A 2OH2A 4OV1A 3BO2A 4LF2A 3QZ8A 1NK6A 1VQ7S 3MDFA 4USHA 2B6AB 5E2QA 5EWEA 1BQNB 4MIBA 4AQYJ 1BQNA 3UVJB 5M2RA 2W9AA 2WSEC 2AKWB 3H5UA 1IBLF 4DR5J 5F9LA 4E98A 3QJLA 2E5LF 2RQ4A 2CWXA 4IUFA 1TVRB 2ZHAA 4Y2MA 4M5DB 3U27A 4DSFA 2JDJA 1FXRA 1XR7A 2ACMA 2F1FA 3O2IA 3IXQA 1AXQA 4CO4A 3J80U 2OLWA 3KJVB 1WEZA 3IWNC 4DV7F 3LANA 2KI2A 1ZM9A 4O44B 3PY8A 2AGOA 2NZ4A 2HHXA 3IWLA 1R0AA 3OSNA 3CSKA 2X51A 2X3GA 9RUBA 1XNRJ 2IJRA 2QL9B 2BKPA 1WF0A 5D4LA 4HHHA 4YR2A 3SFUA 3VAIA 2HQIA 3BKTA 3EPIA 3R5DA 4K4YA 1RT6B 3HZGA 4CTAA 1FRKA 4FNHA 4IOCQ 5GAGU 5H9FK 1KQGB 1LFPA 1NPPA 1WHVA 2HHWA 5KFMA 2V9WA 3NS7B 2GHPA 4CM0A 1NPKA 3FQLA 5CZXA 2A0FB 3VQTA 2XNRA 3NGDA 1KLMA 4TXSA 1PGZA 1FWLA 2C2OB 2Q79A 2R7OA 1T0TV 4FPIA 3Q23A 1A9NB 3UDCA 3N01A 2DHXA 4PG7A 3QWUA 1PC4A 3OR1A 4Y2KA 2D74B 3MPWA 4ZJOA 4DR4J 3HT0A 2Z56B 2XMMA 4QWAA 1HIYA 3AJDA 2R2UA 1DRZA 2OTLS 3A8JA 2GGPB 3DOKB 5HROA 2UUBF 1X8DA 2ADBA 2E5LJ 4ELTA 2E1AA 3AOBA 4NA2A 1AFIA 3HD1A 2HRUA 4OYOA 3ZZTA 1MMLA 4OHXA 4O23A 3MTJA 3MPVA 5DLFA 3KLIA 4JI4J 3NKYA 5C25A 5IZHA 2J9DE 2DO0A 3JQJA 3M2UA 3SCIE 1MROB 1CJTB 1BQMA 3D7SB 1PYOB 2EBEA 2OFHX 2AJQA 4A48A 4DL6A 1Q86T 4A8FA 1JLAB 3FEXB 5KFZA 4PUOA 2IAJA 3CB4A 4F2SA 2A2DA 4BS2A 3GIMA 5GADI 4DXLA 4KH0B 1IN0A 2A1BA 2PFDA 3ISZA 4B3OA 5EDWA 4MJKA 1G3OA 2K3IA 2OEMA 3DYAB 4I67A 4CP5A 1Q8BA 1MWYA 3H0PA 3MHYA 4OJHA 2HQCA 4TNOA 2DHHA 2YNIB 3H2VE 1XNQF 1VQ8S 3JAMY 1PBUA 1NB2A 1NMEB 2BW7A 3QPIA 1LOUA 2IM0A 5F0WA 1HLWA 2IC3B 3MD1A 2OPSB 2M8HA 2IA0A 2RIJA 3FKBA 5E3RA 4CH1A 4WBFA 3T1YJ 2DPJA 5RUBA 4ECVA 1H6KX 4NPOA 4CLFA 4DS5A 1Q81T 3UVJA 1DURA 4LF1A 3DRRA 3TOQA 1S0MA 5BYSA 4C8OA 5EWGA 3AXKA 2ILZA 3CNQP 2LDYA 1M0SA 2DB1A 2B9YA 3OTOJ 4WFBQ 1T9TA 2BUNA 2OEJA 5DZ6A 4ZLNA 2ASDA 2BM0A 4KQZA 4Q0BA 4NXMF 1NCLA 1RYSA 2FDNA 5BYRA 2VPYB 1JJ2R 3VF0B 2A18A 4C3MA 1UJ5A 4PPZA 5LT5A 5F8GA 4DSLA 1VQYA 3BN4A 1BXNA 3GYXB 3BO3A 3CC7S 1FNMA 2CNOB 4QR0A 1KLNA 4CI0B 2GMLA 3M8SA 4DSJA 4P6QA 2H5EA 2JC0A 2OUGA 5FLXU 1N5TA 4UOGA 4RBVA 3D2WA 5F8NA 1APSA 2FJEB 2G2OA 4LSNB 3TVZA 4X4SA 2HHPA 2LMIA 2AP6A 3CDWA 3GILA 4NRTA 4USMA 4JI5F 1N8RT 3ZZPA 4X62F 2JEIA 2FIUA 3PDNA 4NCAA 4NMXA 3DLLQ 3FEZA 3R27A 4PG8A 3PR4A 3DLBA 3HI9A 1KNZA 4DLGA 1PBAA 1ZS6A 2V4QA 3HSZA 2CPFA 4U96A 4U6PA 1I51B 1F5AA 3IMQJ 2I9SA 2W2OP 5A2QY 3OUYB 2QLJB 2AEJA 1ZA2B 4YDXA 2DGOA 3KK3A 3HHDA 3PYFA 3LOUA 4WTOB 1QAIA 2VHGA 3AD8C 1NJXA 4G65A 4NLQA 4Y2AA 1T8EA 1JB0C 1RGVA 2GVZB 2VG5B 2XB2D 4U8YA 4OZ5A 2KHDA 1ZTTA 2VQFJ 2DBBA 3UR0A 5DQHA 3LP0B 3GTYX 5LXYA 4DL5A 4U9RA 1VQMS 4OZ2A 2E1CA 4OZ3A 5FDLB 2EK6A 2GJ2A 2HURA 5KT3A 1S97A 3H5XA 2JZ5A 3QT8A 2O5DA 4X84A 3M8WA 2F9DA 3FZBA 2PMHA 1HBUA 1KBRA 2QL5B 2RDDA 3MMCB 4CLYA 3BYRA 2QG9B 4NI2B 1VFJA 2EFOA 2E7VA 4I6AA 3ULHA 3J81j 4KR0B 4LF4F 2BMBA 5U47A 4F0MA 3R1HA 1XMQF 4V1Ak 3M2VA 3OL9A 3F56A 3KDOA 1ZYQA 2E29A 3NP5A 1A0OB 3NBPB 3PV8A 3PM9A 4QOTA 3W2VA 3TR5A 1VGYA 4OX8A 4ED7A 3EXCX 2JVRA 4EUVA 2VA3A 4OI2A 2UU9J 2EFNA 1XR6A 3VAFA 3CD6S 5HMWA 4DL3A 3GR0A 3UN5A 4LF9J 2QLBB 3MEDA 3GYNA 2J0WA 4ID5B 2MSSA 2XHCA 5D77A 3W8PA 1SKRA 1N88A 4CNYA 1NK4A 5AJ3J 2VBZA 2WVDA 4PABA 1H7WA 3FBEA 3WIUA 4E2FB 1RISA 2XZTB 2ZBIA 3ADAC 3ET6B 3IN5A 5J1EA 1GTEA 4X2BA 5KFXA 4I2QB 1WHXA 2P8IA 2ZNYA 3MCSA 4M1KA 2V8GA 1X0PA 1VQ6S 4L73A 1U49A 3MMAB 2GAHC 4CO1A 1S72S 3K59A 1RT3A 3CE8A 4Q8FA 1YI2S 4UY8T 1O5JA 1HMVA 3BSAA 3DHXA 4Y00A 1URRA 4ETZA 5L38A 4ECUA 3T1HF 2UUBJ 2OPPB 4X62J 3HHLD 3DRYA 3V4IA 3V4IB 3LGHA 4DR7J 3GIJA 5LOQA 1XMQJ 4OYPA 4WP3A 2KXNB 3PIPQ 2P9EA 4X4NA 2WOMA 2ZJQQ 2BE9B 4WFAQ 1JWWA 4B9TA 3ZZ0A 4HH1A 4DX5A 2AD9A 1RYRA 2CPHA 1EKRA 2OD6A 3VTIA 3AOAA 2I1RA 1VC0A 2VUGA 2HWHA 2YNFA 3TUPA 1P1LA 5AXNA 2KFZA 2CPXA 4B3RJ 1SQGA 1KWMA 4FF1A 3QRQA 2SXLA 3KLHB 2CXEA 1U1MA 3FZ2A 2ZM6F 1REGX 3BPDA 1Y00A 2Z4PA 1JIHA 1M5SA 4QBUA 2YNGA 2HK3A 2WONA 3KJNB 4NASA 3CVKA 5H9EJ 3POTA 2UP1A 1CBKA 1U6FA 2QSFA 3IA0A 2C2EA 3OL7A 4WZQA 3KLEA 3TUZC 2GJFA 1NEEA 2CZVC 1TL7B 4OHWA 3QYYA 4D3GA 3GPAA 3T1YF 1JX4A 5D4PA 2E7WA 4EI2A 4GVBB 4R5PA 1VYAA 2LXUA 4TYAA 4F7VA 5J2QB 2QLXA 1F0XA 3KXDA 1NK7A 4XO0A 4NLGA 1GT8A 3OR2A 4R25A 4X4OA 2AJFE 2CG8A 3OHBA 5BR8F 1TMMA 2DGQA 2CYYA 2ZHOA 1NJYA 1VQ9S 4B3SF 3QT5A 5L1KA 4OX9J 1X5OA 2LEBA 2X1AA 3H2LA 3SMZA 1EQMA 2KVQE 4OZ0A 4FBTA 5A76A 5GAEU 2FHOB 3DM2A 3QJPA 4OHYA 3NBPA 4HACB 5ETPA 3R5GA 2L41A 3DMJB 2AYMA 1K47A 5SUHA 3BS9A 3DMJA 3P3DA 2H3EB 4MFBA 3EVOA 5LL6d 2PDAA 3VGUA 5LMNF 4OHVA 1IQZA 2HQGA 5IV3A 2JJ4D 1HNZF 1H7XA 2G13A 2GCFA 2MZSA 1SIWB 3BDEA 3EDRB 3IO1A 3SQGB 3ZFVA 1U7LA 2R8GA 4PPDA 5GMEA 2QL7B 2UXCJ 2FVPA 2GIQA 2B56A 2QA2A 1ROFA 2COLA 2EG1A 3GSDA 4NYZA 3SSSA 1T9YA 1O6XA 4FKXA 4FVCA 1V3RA 1M1HA 2B9EA 3K2YA 5K8MA 2V4RA 4K0KF 4GKKJ 4KT0C 2CQ2A 4ZVQB 2C2RA 2EKNA 3NS5A 2KG1A 4P2FA 2VPZB 3I96A 3TEHB 4M94A 4KHPF 2R7UA 4XDDA 1VJWA 4KPYA 3R6LB 1HBOA 4A8QA 2CKWA 1K44A 3G82A 3PJ9A 1U0SA 4ECRA 3QJJA 5T7LA 2W01A 1VRUB 2MQMA 3UN2A 4ECSA 3LP1A 3D1QA 4KFBA 4OI1A 4F4WA 3GCXP 2J0QD 5ETKA 1SJ4P 2GV1A 1R89A 2QFJA 3GIRA 3I0SB 4WK3A 4OYMA 2IFXA 2OD4A 1YRXA 1QE1A 4ZHRA 1PJ5A 1L3UA 2D69A 4NCGB 3RBZA 3IAM9 6AT1B 3THVA 1VQSA 5HAOA 1YSJA 4RUBA 2MYFA 1HR0J 3MM7A 4PRFA 4X64J 4USIA 1J5OA 4ITSA 3LPEA 5LMNJ 2RMLA 4RW6A 1R0CB 2IIHA 2G2YA 1XEZA 2EPIA 2Z58B 4PWWA 3RGIA 2BABA 2E7XA 3TO8A 5HK4A 2HEKA 4NYOA 2B8PA 1KHVA 3CC2S 2G0JA 1TP7A 5DLGA 3MMJA 4IO1A 4F36A 2ZZTA 1HL6A 4IH5A 4DWIA 4K4ZA 2BE2A 3NAHA 4I2PB 3R5CA 5L9NA 2OEKA 1K0VA 2MZQA 1R27B 2V2QA 1U47A 4QPTA 1N33F 1OSDA 4A8XA 5E3PA 4ZVOB 1X4EA 3MFHA 2ZWOA 2IVYA 1TK5A 2V63A 2XSFA 3MURP 4LBPA 2EVZA 2LEAA 1CVJA 1G6BA 2VBYA 4UOHA 3P8BB 4EK2A 4J9UE 4O3RA 3RRKA 3M32B 1PKUA 5H1SV 2ROPA 4I69A 4WYWA 3MM8A 4MYTA 2PA3A 3MM8B 3QIPB 2DNOA 3TZWA 4YQWA 3J7ZT 3PEJA 2Y9HA 2HW3A 2ZBCA 5K8PA 3CJTA 2BV3A 1ICEB 5ETTA 1FRLA 2G0IA 4Y28C 5CAAA 5I3UA 4WF9Q 1LWXA 1K1QA 1Y3JA 4USJC 3M1VA 4WE1B 3CPWR 3V6HA 2R8KA 3BDPA 4NLXA 1LQ9A 2A6MA 3R7BB 4JOUA 4ZN1A 1UJ6A 2RRBA 5I4MA 2EC2A 3KG1A 2CIMA 4X4PA 3QMQA 2AWZA 4DZDA 1QAJA 2HGMA 4ECYA 2BKOA 5JVHQ 4KRWA 5C24A 1R43A 1KFDA 4O4GA 3KHRA 1T05B 4C9DA 2V4JA 1VHFA 1CJUA 5HMZA 3HO1A 1V5VA 2R9LA 2IVMA 1RLDA 3BF4A 2IRYA 1EP4A 4EMDA 2BRKA 3C66A 3MOZA 1VCTA 2P6SA 2DHGA 1L3VA 3THPA 4DDFA 4PXBA 2HFVA 2HFZA 3JQMA 5KFUA 2DGWA 4M5GA 4CT9A 2ATLA 3MAQA 4MAKA 1SJ1A 1MROA 4NLRA 4NXNJ 1RWWB 1MN9A 3ITHB 3NCPA 1ZAWA 2E44A 4HT5A 1Y10A 3ZZYA 2IM1A 2VV5A 4EO8A 1ZAXA 4NZ6A 5KFWA 2K7JA 2V5HG 4DQPA 1DQAA 4Q5VA 2DGXA 2IDLA 1IWGA 1SQFA 4NLDA 3MAHA 5HP1A 3HF5A 3CMQA 2CVEA 2DNHA 2YKQA 4XAKA 4DBQA 3O8WA 1B64A 2Z2YB 1KN6A 3AH6A 5LMUF 1YJUA 4DV0J 2MPUA 1V9OA 2CFXA 2IBOA 2N3LA 2IRXA 3CCWA 1PIEA 4J9VA 1RCOB 3B6BA 4RWXA 5E3QA 3UO0A 3MEGA 2CQ0A 1JMTA 2NLWA 3MMBB 4M5HA 4DCPB 3Q83A 2GNKA 5L39A 3E8OA 3UNYA 3Q2TC 1J5EF 3QAUA 4TY8A 1AZSA 1T03B 5F3ZA 3MAAB 1RK8A 5IT0A 3PW2A 2LXIA 1X7VA 1AUSL 4DUZF 4FZVA 4LRCA 2JEGA 1OWXA 1U1NA 1OYEA 5D3GB 2UXCF 1G1XA 1N48A 4HR2A 3CCTA 1JNRB 1SJRA 1CQMA 4LQ9A 4ZA1A 1Q4RA 2RILA 2C3MA 3N79A 4AXJA 1P9YA 5B0AA 3FGVA 3RUBL 2Y1LB 4CLLA 4QWBA 2BJ3A 1VQ4S 4QU7A 3OSPA 4EBCA 1MWQA 4KGMA 5DDPC 3CDAA 1F9HA 1VOMA 1S0OA 3QRPA 1EX8A 1SCJB 1RHMB 5A6WA 4QR1A 5KFSA 1CQNA 2BEFA 4LSZB 3CCVS 3KOAA 2IBKA 1C0UB 1F3FA 1HQUA 1KP6A 3E01A 3MEEA 4IKAA 2QX0A 3DXSX 5CYMA 3PYDA 3TAMA 5A6PA 2VZ9A 3KUHA 2VG7A 4K50A 2DGVA 3HKWA 5BJRA 3M4XA 2PA8D 1RLCL 4P74A 2V50A 4UT4A 2E9ZA 5KG5A 2ZZMA 3KFWX 3V2UC 2LQBA 2Q1LA 4I1TA 1UEUA 3GG0A 4EBDA 4CO0A 4ECTA 1HD0A 1YKWA 2VQEF 2CPYA 2R7TA 4W4MA 2CPEA 3KK1A 3POTB 3J7Z5 3ZTSA 4GRSA 1ZPVA 2GVZA 1TV6B 1UKUA 2WVFA 3DDKA 4LVOP 1RT4B 1Q8LA 2HLTA 3AQOA 3DLKA 3P45B 5A8KB 1RAHB 4URGA 2RS2A 3TAPA 4MIWA 1KSPA 2FZGB 1OPIA 3C14A 2APOA 3LP0A 4WK1A 2KXFA 4C6AA 1U48A 4CLSA 5BYQA 1H98A 2M70A 1TFYA 3RBDA 1NSPA 4JV2A 1UFKA 2AYEA 2Q66A 5B0EA 2KH9A 3BGFA 4M5DA 1FVSA 3UN3A 4PG4A 1K73T 1HQEB 2VDHA 2HHHJ 4X65J 3ETMA 2HNDA 2VPWB 2ABYA 1RT1B 4ZITA 4UOFA 3JYTB 4JI7J 1O0PA 2NR0A 2VB6A 4MKBA 2ZJRQ 2VBWA 1FRJA 5LJ5Y 1RKIA 3HSDA 3M2VB 4J5OA 1ZZNA 2FJWA 4O3SA 4GKJF 4LUBA 4R0JA 5HBMA 2XLIA 1SUQB 2K1RB 2LU1A 5D3GA 5HI7A 1YLXA 2FJBB 4L72B 1FEHA 2U2FA 3GZ7A 3M2RA 2CZ9A 4CWBA 2HAFA 5KAKA 3MR7A 3B54A 2DISA 1WI8A 3HSGA 4Y3CA 1UVKA 1QJHA 2ALYB 5KG6A 4IOAQ 2VQFF 1H3DA 2ZM6J 1FRIA 2VFVA 3DLJA 1HQ2A 4AFFA 4IDKA 3HHLA 5D15A 1OPZA 4NE9C 2HMIA 1S1UA 1IBKF 3D1OA 2P2CB 2Z2ZA 4P2MA 4JYAJ 4N56A 2WSFC 1BQXA 2C1EB 1U6ZA 2VODA 1JJHA 4LREA 2R4FA 3AXMA 3AB2B 3D0HE 3EJMA 3BH6B 3H98A 3MMAA 4IRDA 2GW8A 4OYBA 3FSIA 3PX0A 4F0KA 1U2CA 3W5ZA 2UXDJ 1Y7PA 2HQ3A 4HH0A 1R8BA 1IR1A 1DQ8A 2JL9A 2OPPA 1UWBA 1RADB 2CQHA 2VH7A 3BREA 1RWNB 3D66A 2ZFHA 3BGLA 3DOMA 4WXOA 5ETOA 2B0GA 5D0GA 1X4FA 3M2UB 1TAQA 1FJCA 2FGOA 4LF9F 1IKXB 1XWLA 1IKVB 4RJVA 4RO0A 3SSRA 1N5YA 5AE3A 3GQCA 4NWBA 5D78A 5HJYA 1JLAA 1X4GA 1PAUB 2DIUA 3AAWB 4F4YA 5HATA 4ZJQA 3K5OA 2YNFB 3HLUA 2V6AA 4OX7A 3JSMB 3W2VB 2JFKA 2QMXA 4USUA 5K8OA 1RWUA 1XR5A 2AX1A 1CJKA 4P71A 2W9BA 1XNQJ 1RE1B 2EFGA 2BE2B 2VIHA 2EK1A 4YOEA 3EVWA 1WD6A 1GH8A 2DR8A 3Q8PB 1OY8A 1NB7A 1GK8A 1RTIB 1JLCB 1FK9B 1HBUB 2G2ZA 2YBVA 2UXDF 4BHQA 1HBMA 1I94F 1R7IA 2GO8A 2PFFB 3K5PA 3FSXA 5GMDA 4EU0A 1JXVA 2OMOA 1S6PB 1U1RA 4FS1A 4ZVGA 3QGHA 3SV4A 3G8QA 2YXLA 2JWNA 2XZWA 3D4JA 3HXMA 1U4BA 1S79A 3KTQA 2OPQB 3AFGA 1PJ6A 5EUHA 4J9OA 2ZKTA 2DGTA 4HTJA 1Q1KA 3RB0A 1S9GA 3GIIA 4KV8A 4KGZB 3HVTA 4LF8F 4UTGA 2HHSA 4H4MB 1ZM2A 3EE3A 2FHJA 3DRPA 1NLKL 4RR5A 2HZCA 4URSA 3K58A 1NHVA 3K5MA 1D9DA 2FLNA 5HQLA 1GEHA 3T5LA 5KT2A 4NA1A 1B99A 4TU9A 1HBNB 1V3SA 2E1RA 2IYIA 3IR6B 2NREA 2AGQA 3L3CA 3ET6A 3M05A 3WZ0A 5MLCV 1P27B 4E0DA 1JJCB 1I94J 3LPYA 3J81Y 2XYGB 3DOLB 2NXEA 2XMWA 1DAXA 3UDEA 1NJIT 3OFEA 1GXTA 1S6QA 2C3UA 3QGPA 4HTIA 2KFNA 3PFOA 4N8NA 3QAEA 5DS7A 4OYXA 5HANA 5B08A 2QA4S 1X4BA 4DR6J 5KFPA 1NXIA 4DPUA 2B5JA 1FE0A 3FBCA 4N7TA 3I0RB 2RUSA 5GAHI 3R97A 1LW0A 3HDSA 1ITPA 5DQGA 1HKAA 3CDEA 2F8MA 2VDIA 4CNZA 3KLGB 1GX5A 3KLGA 1IR0A 4C3LA 4DF8A 4X4VA 3UDVA 1YBUA 4ILRA 2W7AA 4NLYA 1FHTA 1DARA 2Q3PA 4UQGA 1NNDA 3OJSA 4ED2A 1FERA 2CQGA 2VFUA 2VG6B 1Q82T 3RTVA 5G0RB 1PSDA 4B17A 1T02A 1RT6A 3G86A 3QT7A 2HHHF 1V6HA 3HCXA 2H9ZA 5FD1A 3EXYA 4L6V3 2GFFA 5KG7A 3SYZA 2H48B 1TK8A 2AJ1A 2E1MC 3CJ8A 4YFUA 4MK7A 3BBBA 1VLOA 2BM1A 2MKJA 4BC7A 2WTFA 4P52A 3CJQA 3TNVA 3R7NB 2GA7A 5HLFB 1X4DA 4F04B 2RUGA 1DTTB 1RHKB 2NYHA 1M1KT 3W5XA 3AJ1A 2GHVC 3HHLC 3CEDA 1WWHA 4ID5A 1KOOA 3UPFA 2E5IA 2J0XA 1VBZA 3I9V9 1IBLJ 2AYGA 2UUCF 3IS9B 4LFCJ 4X4UA 1X31C 3D6HB 4O3OA 1OY6A 1KONA 1TU0B 2LQ8A 1S6PA 3QATA 7FD1A 4DUZJ 2D9OA 3MOJB 1S59A 1ACMB 3DC2A 4J9MA 3V81B 4DQIA 3Q2SC 3CULA 2OPQA 3CCJS 1HBOB 1RDRA 3A12A 2GVDB 3PHTA 1BQMB 4TLQA 2GVDA 2ZH5A 2HYIB 1XTZA 1FFGB 1Y4ZB 1RAOA 2RKIB 3EUNA 5ETQA 4BWJA 2XS7A 4RZRA 3BGRB 2MSTA 3ILJA 2RS8A 2V0NA 3P4UB 3W2WB 4DPYA 5HMXA 2K8GA 1DHMA 1WC6A 2PSZA 2VG7B 3PG9A 1EIYB
chains in the Genus database with same CATH topology
2C22A 5DETA 5A8RA 4ZPVR 4YR0A 4DN0A 1KEKA 1X0FA 2RDJA 3US5A 5EWFA 3IRXA 2N7YA 4B02A 2Z8QA 5KFHA 4E8UA 1ZTWA 1UVMA 2FHMA 1SH0A 1LW2A 3MUTP 1N5VA 2VPXB 5KT4A 2RU3A 2HG4A 1WEYA 2VOPA 2XGQA 2L48A 1RP5A 4X4TA 1U8SA 2B5JB 2MY7A 2D1CA 4R8UA 2BQUA 4IFVA 2HW3A 1JLBB 3OXFA 4IFVB 4A8YA 3DYAA 3NNAA 1CG2A 1OO0B 3OBIA 2RT3A 2BQRA 2CJ9A 1HNIB 1RAJA 1HNIA 4XPCA 1F5BA 5GVQA 2FB0A 3OL6A 6FDRA 3EGZA 1PC5A 4RX6A 4ZP7A 2P5VA 4NA3A 3TYTA 1MNEA 4J9QA 1SV5A 5FJ4A 2RNEA 3CJ0A 3OTDA 5I3QA 2MGZA 5F8MA 3UQSA 3RAQA 4LSNA 1CC8A 4RUHA 5KFGA 1SL1A 3H8YA 4CQ1A 1D3WA 4MKAA 2D9PA 1U1LA 1IKWA 2NUUG 3O6QA 5IQQA 4EFAC 2ILYA 2XBPA 4I0WA 5KFAA 4EZ9A 2W7OA 1G7CB 4AL5A 1DFDA 4C2MA 3OUYA 4DLEA 1P8GA 2LXFA 1VI7A 3LO3A 3PHEA 4IG0B 2RU9A 3V5RA 2J9CA 3LH2S 4Q2LA 5M2UA 4V19J 3QIPA 3UW1A 2MJNA 1ZPWX 1TL5A 1WTFA 2ZITA 5B09A 4F3OA 1EP4B 3ZZOA 2YWHA 5LJ3Y 1NKEA 4GKKF 1SB6A 4NX9A 3L7PA 1DTQB 4ES3A 2XSJB 2B9XA 2VFSA 2XSJA 2E66A 3BSNA 1N5YB 2KYXA 1WG5A 4DV5F 1P9QC 4AQYF 3UCZP 4IRCA 5AJ3F 1KD1T 1Y5IB 2W24A 1JK9B 2J6SA 1I1GA 2ZDPA 3PIOQ 1XMOF 1ZH5A 2JVOA 4IQXA 3I5CA 3B4DA 4XPEA 3QO9B 5A8RB 3DCAA 1U1PA 4ELUA 1Q7YT 5T14A 1TKZB 1X5PA 5F9NA 1X5TA 4UOCA 5AXKA 4QPXA 3H40A 5EX0A 2E9TA 2I38A 3D1HA 2DNPA 3B78A 2QA1A 3M6UA 4G1IA 4AL7A 3OTCA 2ZH1A 2OMLA 2B4OA 3B82A 4NL5A 2HHVA 2YWEA 4ATNA 3VAJA 2QRRA 2JLGA 1SH2A 4KV8B 2B3TB 1RT2A 1RT1A 2YH0A 3FMBA 5DGAA 3T5KA 1B7FA 4OI4A 3OVSA 4V19X 3AHPA 2GC8A 4ZCIA 2KVIA 2N4CA 3IGNA 2AU0A 4HVZA 2VOOA 4QIEA 2MQQA 4JV5F 3PJXA 2JRSA 1UFLA 2AW0A 4P7TA 1T03A 5KFLA 2GO9A 5FIIA 5IFMA 3H4BA 3Q0AA 2HS0A 1WF2A 4HL9A 5CHCB 4DUYF 1ZBTA 1EETA 4F8RA 1KTQA 1VRTA 3M6XA 2XY5A 4G3IA 1JNZB 2DNQA 1OIAA 4FXVA 2MKKA 5JXSA 4IDKB 1VBXA 5HROB 3KHLA 3DGPA 2DTJA 2FJAB 4WXWA 4C8YA 3LP1B 2MKSA 2GX8A 3EYZA 4RUAA 4KB7A 3SCKE 1Y0HA 4O4GB 1X4AA 3C6TB 3HHNB 3SI8A 4ZPBA 2R7WA 1FJGF 2B4VA 3MI7X 2MKIA 1C0TA 3FRYA 3UD3P 1D8YA 1GXUA 2WB1D 5K14A 1FKPB 4N8OA 1HNWF 3G6VA 1HQUB 1NHUA 1Z2ZA 2OSQA 5HQ8A 4N77A 5C42A 4KTQA 4ILMA 3DLEB 3MR2A 3CD0A 3CIMA 3MD3A 1HHTP 3N9UC 1BY9A 2EFVA 3TX8A 4GC6A 1N5SA 4G1QA 2EC0A 4A46A 3KYLA 1IUJA 4H4KC 3SV3A 2UVRA 2L9NA 1T3NA 2EG2A 1W25A 2ALZA 2BZ2A 1FTRA 1S99A 5EHHA 4YB5A 1M5KC 4NYPA 1N34F 3KLEB 4KIAA 2G4BA 3RBEA 4NLSA 4OI0A 4DG1B 1YTYA 3AA9A 1K0TA 4Y34A 1Q78A 5DDQC 4A47A 2ERRA 2O3DA 4NLOA 1D9AA 1YJTA 5CD4H 4QWEA 5E7OB 1QAXA 5KFBA 5KFTA 1Q79A 3DRSA 3DU6A 3C8YA 3UCUP 2HNDB 5L8RC 3HPOA 3HZEA 1MMDA 1L3SA 3HHEA 5DM7Q 1CPZA 3MZIA 3JTNA 1GXLA 4KO0A 1Y3KA 3KKFA 2LVWA 3QLHB 2XS2A 1D8ZA 2GHWA 5LSRA 3I5BA 5KOXA 2LU2A 1VMBA 1FRHA 3EZUA 1YJ9S 3CUNA 1BD6A 4Q2MA 1FESA 3KK2A 2YKMB 4EYIB 2KT5A 2WBRA 4ZP8A 1U2RA 1DLOA 4I7FB 2XLKA 4J9PA 5THWA 2LQ9A 2Q6BA 1YIJS 1JJ4A 2ZOFA 1SL2A 1ZOTA 3RU0A 2RF2A 3MM7B 3I5AA 3THTA 2CJQA 3OVAA 2XMJA 5B0CA 2YWKA 4WFYA 5IT9Y 2O01C 2UUTA 1LXNA 4QW9A 4QZVB 4JI3F 2VFRA 4X66F 4K5RA 3G8SA 2FLLA 3J7YI 4KHMA 2QT7A 4ZKAA 4AL6A 4F3QA 1RTHB 5GAGI 1Y5NB 2LQJA 2DH8A 2NSBA 5AXLA 2E5HA 1U2FA 4ZVHA 4Y2CA 2PIIA 2LEPA 1IKXA 2PGCA 1RT5A 3V6DB 1E6VA 2HPUA 4YDDB 3CJ5A 1N6QB 4B3TF 4WFZA 4TQSA 2YKPA 2HGLA 1GAOA 1FXLA 4J9SA 4J9RA 1WHYA 5CA5A 4NLWA 2B9WA 2ZE2B 2YKNB 3S7RA 4WIIA 1S9GB 3H5SA 2DHSA 1F9FA 2CVIA 2KT2A 2QLWA 3M6VA 4Y65A 4LFAF 2WBMA 4RW9B 4K4SA 1NK8A 1U24A 4OZNA 4EYHB 1WACA 1KHWA 3KLFB 3H5YA 2KJVA 2BRLA 2BANB 2FTRA 5E41A 2CRLA 1YJWS 2YNHA 2GGPA 3DOKA 4C0HA 5AE2A 1ZAVA 2IM2A 2BYCA 2UV8G 5L9XA 1KSPA 4WTYA 4PXCA 1LWFA 4E0DA 4OZLA 1Q8IA 4N76A 1IQTA 2IM3A 3V81A 2FVRA 3VR1A 2MB0B 3B4MA 3WDOA 1UMJA 5JJBA 2R2TA 4KBIA 2WB4A 2MZJA 3K7RA 1VQ5S 1HA1A 5EX3A 2C3PA 2M52A 3HHLB 1FEEA 1KOHA 2W4CA 4AUKA 4RNNA 4ERDA 2MDAA 1HMVB 3CCQS 1GX6A 2OKQA 4TQRA 3S6EA 4DPOA 2X1AA 4B9NA 2M5YA 1JLQA 1L3KA 2OPRA 3I0RA 2Z2MA 4OX6A 4C7QA 4LQ3A 1IBMF 2HVIA 3VAKA 1RA7A 5KFNA 2JC1A 3PX6A 1XNRF 4K4UA 3L95X 3HP6A 3LQVA 3HVRA 1T05A 3PRBA 3D28A 3KK1B 2I0XA 2QIFA 2F7VA 3DOLA 5CXTA 1S1TA 3GMGA 4A8MP 4FYDA 5A8KA 2MQPA 4F25A 3PKYA 3NAIA 2B4PA 2M0GB 3UI3A 1SC6A 5CYJA 1IM4A 1TVRA 3D0IE 5F8IA 2ZH9A 3DNCA 2OFGX 1F60B 2XC9A 3JB9k 1H0HB 4C0OC 3OLBA 5E0OA 4JUZA 5F8HA 1S10A 2GIRA 4CO3A 2E5JA 1Y9OA 3E51A 2MXYA 4IG3B 3K5NA 3M8QA 3ETOA 4R5PB 3GFYA 4DR3F 1MW7A 4FVMA 3CT9A 3N6NA 4B9VA 4WU2A 4K4XA 3BSOA 1U1KA 1WG1A 2AJ0A 4FF2A 4PQUA 4UY85 2AF6A 3U7JA 1TQLA 2ZNZA 2AYBA 1IKWB 3KHHA 1FKOB 2KB2A 2RRAA 1HYSA 1W2IA 3CJKB 3MM6A 4GO5X 3TI0A 3MM6B 1RQ0A 4O0IA 4TY8B 4OJ1A 4XK8C 4BWMA 4HEA9 2PC6A 4RNOA 4CH0S 3LGMA 3NCRA 4JI6F 3KK3B 4FS2A 4DV0F 2UVUA 1IXKA 4KAIA 2BQ3A 4YEAA 2RDIA 3A1YG 4DR5F 5F41A 2BJDA 1KRPA 3MR3A 2BA9A 1LWFB 3TVYA 1NKCA 2KG0A 2XMVA 3J80Y 1OQ3A 1YJRA 2DCLA 5C25B 2Y1IA 2XS5A 2YY3A 3BGUA 1P1TA 3P5TL 2FHJD 4BC9A 2JEJA 1MWZA 1S6QB 2K2PA 2OO4A 4NMLA 4A4JA 3MR5A 1IKYA 2IAJB 5IS2A<