2HVZA

Solution structure of the rrm domain of sr rich factor 9g8
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
101
structure length
101
Chain Sequence
MKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRKLLEVLFNGPLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Splicing factor, arginine/serine-rich 7
total genus 10
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hvzA01
2CQPA 2M8DB 5LJ3Y 5IM0A 2LKZA 4F26A 2QFJA 3HI9A 2X1AA 3RW6A 2XS5A 2CQDA 2DISA 2E5GA 3TP2A 2AYBA 4Z2XA 2KG1A 2LECA 2DIVA 3JB9k 2YKAA 3Q2TC 2CPZA 3UE2A 1X4BA 3U1MA 2DHSA 2MKSA 2RT3A 2DH7A 1M5KC 2MY8A 3G9CA 3US5A 3NS5A 5D78A 4TU9A 1JMTA 5DETA 5CA5A 2F9DA 2KRBA 2DGVA 1YJNS 3TYTA 4WFBQ 3G96A 1YWXA 2DH8A 3MURP 1NJIT 2MKJA 2U1AA 1WI8A 1XN9A 1VQ6S 1NO8A 1HL6A 2LMIA 2KH9A 2DNPA 2PEHA 1KQSR 1WHXA 2X1FA 1PO6A 3OW2R 2GO9A 2CPFA 2RQCA 3VAMA 1U1KA 3MOJB 5HL7Q 4QU7A 2J0QD 1SJ4P 2DNMA 2LQ5A 2KM8B 1VQMS 2AYEA 2E5HA 1WF1A 2CQGA 2M9KA 2KN4A 2KYXA 5FJ4A 2OSQA 4TU8A 3CCJS 3S8SA 1R8PA 2JRSA 2CPIA 2KXFA 2FC9A 1K8AT 2MKIA 4F02A 1M1KT 3VALA 3S6EA 1IQTA 3CXCR 1FHTA 1FO1A 1U2FA 1NU4A 2U2FA 3G8TA 1BY9A 2MQOA 1VBYA 4LMZA 3SDEB 1VQ8S 3H2VE 2HZCA 1SJQA 2N7CA 2PE8A 2LCWA 2AD9A 3VAFA 1M5VC 2DHGA 5DM6Q 4EGLA 2XSFA 2VONA 2DNNA 1VQ4S 3DXBA 2CPJA 3EX7B 3CPWR 3SMZA 4LIRA 1QVGR 2FHOB 1X4FA 3UCUP 2F9JA 2LYVA 1UFWA 2MKCA 2MZTA 1A9NB 1WI6A 3H2UB 3VAIA 2I2YA 1JJHA 2DNGA 1U6FA 2MYFA 2J0SD 3NNHA 3VAHA 4IOCQ 4PKDB 4Y00A 4PRFA 1FJ7A 4RU2A 1YHQS 1U1QA 2ERRA 3CCLS 4TU7A 2SXLA 3FEYB 4U67Q 2VOPA 4WFAQ 2EK1A 4J5OA 1U1LA 1SJ3P 4A8XA 3VAJA 2MKKA 2J76E 2HGMA 1VQPS 3VAGA 2XNRA 3NNAA 2M2BA 2DGTA 3I56S 1KC8T 4WIIA 1G2EA 3UCZP 2RS2A 2M8HA 2O3DA 1KOHA 3J7YU 4V19X 3BS9A 3U1LA 4BS2A 2E44A 3R1HA 2YTCA 1YJ9S 3NS6A 1VQ5S 2DNZA 3CCMS 1VQNS 2L08A 1AUDA 1OO0B 4OZ1A 3SDEA 2I38A 2E5JA 5DDPC 1U6BA 1P27B 3R27A 3IRWP 2MZQA 3Q2SC 1FT8A 2FPHX 3J7ZT 3K0JA 3ZZYA 1DRZA 2MGZA 4P6QA 1Q81T 2HYIB 1H6KX 4IUFA 2FY1A 1OWXA 2XS2A 4ZKAA 5GAGU 2D9OA 5BJRA 1RK8A 3TO8A 2ADBA 3G6ES 2CPDA 3P5TL 4F25A 2LXUA 2MHNA 2MMYA 2XS7A 4ERDA 2DHAA 2D9PA 2CQBA 2N82B 2BZ2A 2DGSA 2M88A 1DHMA 1X4AA 2G0CA 2CQ2A 1N88A 2N3OA 3ZZZA 1N52B 1L3KA 2RS8A 5LJ5Y 2RQ4A 2RRBA 1K9MT 4UY8T 2KXNB 3PIOQ 1H2TZ 3S01A 3CC2S 2MJUA 2CPXA 2K3KA 5IFMA 5EN1A 4CIOA 2JVOA 4TLQA 2AYGA 1FJEB 4FXVA 3S7RA 4Y0FA 4QU6A 2BOPA 2L9WA 3CCVS 1X5OA 4M5DB 2ZJRQ 2F3JA 1X5SA 2KU7A 2CQ3A 5H1SV 3CCQS 2CPHA 1M90T 1VC5A 2CPEA 3MUTP 1VQLS 1OPIA 2MQNA 1X4DA 1WHYA 3THTA 4C7QA 1VC0A 5GAHU 3LQVA 1VQ7S 1H2VZ 3RW7A 1VQOS 3BO4A 2RNEA 2KVIA 4IOAQ 4CH0S 1WEYA 4WFNQ 2VOOA 5DDOC 2MZJA 1RKJA 1WG5A 3L3CA 4CH1A 3MXHP 2M7SA 2DITA 2DNQA 3VAKA 1U1MA 1FXLA 2CQ0A 2E5IA 1U1RA 2CQ1A 3CF5Q 2LEAA 2MKHA 1WHVA 1QVFR 1X5TA 2CPYA 2DNOA 1YI2S 3CC4S 1D9AA 3P49B 5DDRC 2LXIA 2KM8C 1U1NA 1PGZA 4FXWA 1X4GA 1K73T 2DNLA 4W92B 2B0GA 3LPYA 2NZ4A 1FJCA 3HHNB 2MQLA 3D2WA 1N54B 1ZH5A 1YIJS 2XNQA 1WEZA 1JJ4A 1X4HA 2M4MA 3P3DA 4UQTA 1UAWA 5HO4A 1X5PA 1B7FA 2KRRA 5JVHQ 3DLLQ 1DBDA 2JVRA 5D77A 3CCUS 1Q86T 2DGXA 1WWHA 1SXLA 1X4CA 2MZSA 3I55S 5IQQA 2M52A 2M0GB 5JVGQ 1WHWA 1WG4A 2KFYA 3NNCA 2DH9A 2MY7A 4IO9Q 3CCSS 2DGUA 1YJWS 5LSOA 4C0OC 1F9FA 1U1PA 2MPUA 4PR6A 4W90B 2RRAA 5LXRA 1DZ5A 4YUDA 4WKRA 1P1TA 2DGQA 4ED5A 2CQIA 4OZ0A 2KG0A 1WEXA 2DNKA 3UD3P 2DNRA 2CQHA 3G8SA 3CMES 2YWKA 3BO3A 5GADU 2MGZB 2MZ1A 3BO2A 1UW4A 2HVZA 2MQPA 2MSSA 2OTLS 3SXLA 2RUGA 2HGLA 2UP1A 2EK6A 2KT5A 3MI7X 5DM7Q 1VBZA 2ADCA 2N3LA 1CVJA 1WF2A 2DNHA 3EGNA 2J8AA 1A7GE 1YTYA 2KHCA 2NLWA 3UWTA 5CXTA 1SJRA 1VQ9S 1SJFA 2X1GA 4YOEA 2DIUA 2KXHA 1VC6A 1HA1A 1QM9A 1ZZNA 3CMAS 2DO4A 2JWNA 2DNYA 2X1BA 5GVQA 3P6YC 5MLCV 3G4SS 3CC7S 1HD0A 2Q79A 5GMKa 2K8GA 1KOOA 2GHPA 2XB2D 4WF9Q 3IWNC 2OTJS 4QPTA 2L41A 3V4MA 1WTBA 3VF0B 2MZRA 3R1LA 2LA6A 1UP1A 2RU3A 2G1DA 2MB0B 2WBRA 2MQMA 1U1OA 1KD1T 1M5OC 3B4MA 2OSRA 2OJ3A 2DB1A 2EVZA 1N8RT 1YITS 2CJKA 2DGOA 2YH0A 3CUNA 3UD4P 1D8ZA 1R8HA 2DHXA 3THPA 2VODA 2DGWA 2MXYA 2AYMA 1X4EA 5DDQC 2ZJQQ 3MDFA 2CQCA 2QA4S 1JJ2R 1OIAA 1O0PA 1FNXH 5LXYA 2DK2A 2HGNA 2G4BA 1WF0A 1Q82T 2OIHA 2D3OR 1H2UX 1S79A 3CTRA 2MJNA 2LA4A 2MSTA 2ZJPQ 3EGZA 3MUMP 5CYJA 1S72S 3N9UC 2CQ4A 3CCRS 1X0FA 3G71S 3NMRA 2RVJA 3MUVP 1URNA 2YH1A 4CQ1A 5LSLA 1M5PC 1W2BR 1ZZFA 2QEXS 2A3JA 3MD3A 3BEGB 2V94A 5ITHA 4QQBA 4WCEQ 1WG1A 2LEBA 4LJMA 3MD1A 2DO0A 3FEXB 2FC8A 2JX2A 3ULHA 3CULA 3CD6S 1HD1A 1VQKS 1Q7YT 4C4WA 2KI2A 1VBXA 3PIPQ 3B4DA 5GAEU 4YB1P 1WELA 3CCES 5IM0B 2M70A 3UCGA 2MQQA
chains in the Genus database with same CATH superfamily
1VRTA 1RLDA 1U4BA 4JUZA 1U0HB 2M8DB 1VHFA 5IM0A 1I1GA 4F26A 2WTFA 1XNQF 4FF1A 1UW9A 1FESA 3KMQA 1S9GA 5IQ6A 1NK9A 1NSAA 2MQ8A 3KK2A 3OTDA 4PG4A 1YKWA 4P74A 2E1MC 1OYDA 2FIUA 3B78A 4TXSA 2B56A 1ULRA 4Z2XA 4JI6J 2GQCA 5D4NA 3CMQA 1SUQA 1YZ6A 2YKAA 1RT2A 3Q2TC 2Z4PA 3L7OA 4EZ9A 1AW0A 3W9HA 2CPZA 3UE2A 4CLPA 3M8QB 3DOKB 4O0IA 2DHSA 1ZA1B 2RHQB 4IDKB 2RT3A 2DH7A 2XMWA 3CDAA 1LK7A 4DMZA 7FDRA 2BQUA 1J5EJ 3G9CA 1JLQA 3BPDA 3IR6B 4AFFA 1IXKA 2Y8YA 3A8EA 4M5KA 1T3NA 2EKNA 1RUSA 1R6VA 1S4FA 2N4CA 2IBOA 3PW7A 2Q1LA 4PQUB 2BJ7A 1YLXA 3ENWA 3GONA 1R3NA 2ZC4A 4MIBA 3GU0A 4KJIA 2QT7A 4RW4A 3MURP 2AU0A 2QE5A 1NJIT 1S48A 5GAEI 4KFBA 4QPXA 2QRRA 2HIQA 2GMLA 5KG3A 4K50A 1TKZA 2JNJA 4OHWA 4AD6A 3K5NA 1NO8A 2X7IA 1T05B 3GWCA 3FGVA 1YBUA 1IM6A 1HHSA 3NEKA 2O67A 5HP1A 2OI2A 2DNPA 4USWA 4JV0A 3JTPA 1KQSR 4DSIA 1RU1A 1TMMA 4EFAC 2X1FA 1ZAWA 1IR0A 3OW2R 1WSVA 4CLSA 2BRLA 3HFKA 2BJ8A 3RJMB 1D9FA 4NXMJ 3BKUA 1T9YA 3D9BA 5HL7Q 4HYKA 2J0QD 2LLZA 2V50A 5D0EA 1U26A 2DNMA 1JX4A 3AQPA 1U48A 1KVIA 2V4JA 2GGPA 1WKJA 1RTHA 2G1HA 3SBMA 4F3MA 2OSQA 4YN3B 2XMKA 2I5JB 4CRJA 4DR6F 1UFLA 4KO0A 4FKYA 2E5LJ 1T11A 1R8PA 1YJVA 2JRSA 3DRSA 3PACA 4KHRA 4LRAA 2V6AA 3EMTA 3AODA 3MMBB 4A8MP 3H90A 4B08A 4I1TA 2VF3A 1REGX 1WOSA 2FC9A 2IVMA 2VPZB 3GYGA 1K8AT 2F7VA 2RF2B 3QZ7A 2ZE2B 1CJUB 1RHMB 3A8IA 1AROP 2ROPA 2D74B 3IS9B 3CXCR 6FD1A 3DLJA 2F4VJ 5KFYA 5KFQA 3G8TA 2AZ1A 3M9NB 4DR2J 1NPKA 1L3SA 4KV8A 4IG0B 3H2VE 4ZHRB 1IUJA 1SKSA 1NB2A 2LCWA 3DM2B 4AL6A 1FCAA 2O66A 1S1XB 4OHVA 4EMDA 1GTHA 1BHNA 1FF2A 2VDIA 1W2IA 2WBMA 3EZUA 1SPBP 2DHGA 1XERA 4K4UA 2E29A 4DV5F 4WU2A 1JLGB 5KFIA 3AHPA 2GIFA 4CLYA 3C6UA 4KKOA 2EFOA 4ZP9A 1JLBB 4X62F 2VONA 1F3VA 3MPDA 4XK8C 3EX7B 3OXFA 2QGFB 5CYMB 5HVHA 2NXUA 3Q8VA 1S49A 2QSWA 2LU1A 3LA0A 4DS4A 2XMMA 4MIAA 4P72A 5FIIA 2QJ3A 1HQEB 4LVNP 2H3EB 3MR7A 4NX9A 4CTAB 3NGKA 1HI0P 2V4RA 4UW2A 4AXIA 3BV8A 2MKCA 1XR5A 2A18A 1EARA 2W9AA 4FBTA 4GKKF 4J9QA 4DUYJ 2XYGB 2WAQD 2I2YA 4BDPA 2G0JA 1U25A 1RT3B 5G0RA 2DNGA 2HVHA 3T1AA 3T5KA 4M5DA 3EZOA 2MLXA 3NNHA 2HPUA 2EKYA 2NYIA 3VAHA 3ZZPA 5KFPA 4DV3J 3G2XA 4PKDB 1ZBTA 1OMSA 3H25A 2IRUA 4FVMA 2YKNB 2P8IA 5ETVA 1UA1A 4RBTA 3IG1B 2NR0A 2UV8A 3I31A 2YNHB 4Z7CA 3GV5B 2ERRA 1UL3A 1X9SA 4F3OA 3W62A 3FEYB 4DV0J 2GGPB 5L9XA 2BABA 2V8PA 4FNIA 1SC3B 2CZ4A 4J5OA 5K8OA 1U1LA 4DHVA 3L7UA 3R9LA 3VAJA 5E41A 1WC5A 4LFBJ 2MKKA 2W2NP 4H54A 4ZCLA 3TOQA 4JI2J 3IRXA 4WIIA 1KHWA 4DR5F 1NB7A 3UCZP 1VR6A 2VL1A 3HX9A 4N8OA 4ZPBA 2GMHA 4JV2A 2AJ4A 2O3DA 4XO0A 1HHQA 3QO9A 1SVDA 4IQXA 1KOHA 4QR2A 4EYHB 3MECA 4KGXB 1Q4RA 1RTJA 5KG6A 3BS9A 1XWLA 1S1VA 1ZPWX 3D0IE 5E3CA 4KYZA 3JSMB 2VG7B 4NYOA 4C3KA 1N6QA 4BS2A 2YTCA 4PUOA 3CDUA 2Y3YA 1YRTA 3LAMA 4DCPB 3CCMS 2L08A 4OX6A 1NK5A 2OUGA 3DHXA 1N33J 3QZ8A 3H4DA 4B3SF 5E7OB 4DR3J 2EWHA 5LMUF 4KV8B 2C2ZB 2XMJA 2DPJA 1QAYA 3JQJA 3H4BA 1SQGA 2KVQE 1QSYA 2BE7D 1JLQB 3BBFA 6AT1B 3T9NA 3R27A 3IRWP 2YX4A 4X4SA 4DFMA 2DR5A 2QL5B 2HAIA 2J8SA 3BSCA 2HSEB 4TNOA 4QW9A 2R7OA 4GC6A 4DF8A 2QA2A 1FT8A 4Q44A 1S9FA 1JXLA 3J7ZT 4GMKA 3UDVA 4NLSA 4EUVA 1R0AA 3BGLA 3ITHB 3NXZA 2W4DA 2J0XA 1W26A 3DRSB 5F3ZA 5DLFA 4WK1A 1RTIB 2C2NA 2FZKB 3TVZA 2F40A 4IQMA 2ADBA 2YKPA 3P5TL 1HQ2A 2LXUA 3MAAA 4NLTA 5ETKA 2XS7A 4LF5F 3T6JA 2D9PA 3AD8C 1RT2B 1Q8LA 1TTHB 1IJFB 1LK5A 2CJ9A 4DCOB 1ROFA 1KQGB 2I0XA 1KNZA 2AJQA 3VHQA 2BZ2A 4FYYB 4IG0A 3AFGA 1FERA 4DR2F 3JYTA 1SL2A 1NRKA 2WVCA 3TAMB 5LJ5Y 2RS8A 2GHVC 5LOQA 4WP9A 1K9MT 4DXLA 3MF5A 4CLLA 3NMAA 5T7LA 3QGHA 1JJCB 5KFLA 1X31C 2KXNB 5E3PA 3GSDA 2ASLA 2J6UA 3M8ZA 1DTTA 5DLGA 3CC2S 4KRWA 2PMZD 2CFXA 2CNNB 1YX2A 2ZVIA 1XTZA 2HK2A 1O51A 2J7KA 4QR1A 3MR6A 3L09A 2X3DA 4NXNF 5DO2A 1SV5A 2ZE2A 2OKQA 3IGVA 4FF4A 3D0GE 5F3TA 2QA1A 4UQGA 4USVA 1U7LA 2XSJA 2BJDA 3H98A 2QG9B 5F8JA 1T9WA 4NLDA 3S7RA 4CO3A 4ZCKA 3TQEA 5AXMA 3JSMA 4PUOB 3DOKA 3OD2A 4OI4A 2FVQA 2QYGA 4MKBA 4X64F 2FJWA 2E9TA 3C19A 4UUXA 4M5DB 2ATCB 3M8RA 2ZJRQ 1KP6A 2BM0A 4ICLB 5K14B 2V4JB 3PKYA 5HMXA 3CCQS 3ZTQA 3IWXA 3DMJB 1X0PA 2DKOB 3BGRB 1CEZA 2BJEA 1HNZF 2IAJB 2RDIA 3TUJC 2EFQA 3NCPA 3MM5A 4G1IA 3KG4A 4JB8B 4X65F 2ZC3A 3GE9A 2XO7A 1S9EB 2EFGA 4P2MA 1H2VZ 2WB1D 1MU2B 3LAKA 3RW7A 5IS2A 5KFJA 3OL8A 2DR8A 3FKBA 3OFGA 2DXDA 3TW0A 2Z58B 1CJVB 2BA9A 3GFZA 2XQCA 1CULA 4B3TF 4IOAQ 2KVIA 4Y2IA 4LFBF 1K44A 3MOZA 1I94F 4TQSA 1RJJA 4ETXA 2FQQB 4N47A 5DDOC 5E3RA 3K8WA 4PG5A 3DFEA 1G3OA 1XBWA 2BKPA 2W01A 4H4MB 4U7UK 4CLWA 2B9XA 3D4JA 4IKAA 4ES1A 4EU0A 3MXHP 2DITA 2DNQA 1NPRA 3PO5A 3HJFA 2PA8D 1FD8A 2B6AB 2GJ2A 1RWKB 4URQU 2HFUA 2LEAA 1XQIA 1T7PA 4DL2A 4RJVA 3TX8A 4LF6F 3D3CJ 2CPYA 2VFSA 1ZS6A 2AGOA 1HNXF 4JYAJ 3CC4S 3IM9A 3P49B 4DI6A 5KFMA 2VD3A 3M1VA 1LWEB 3CJSA 4Q2LA 4YHHJ 1IWGA 3C2PA 3ETMA 3W2VB 1DQ9A 1FD2A 3CE8A 1UWBA 1V5VA 4KB7A 3RYLA 4DL4A 4X4NA 1HPZB 4B17A 3JTNA 5HVGA 5K8PA 4ZP8A 5I4MA 2N4DA 1TAQA 4MYTA 5DQIA 3PW2A 2BE2A 2E66A 1HBUB 5HJYA 2DNLA 4QWDA 4C8KA 3K7RA 4C11B 3R5BA 1WC1A 3PVXA 2P2CB 4M5IA 2XYHB 4K4TA 4ED6A 5D8HB 2PEBA 2WK4A 4HL9A 4I64A 2WSEC 4WXWA 2IHR1 2KHDA 2RIJA 1JJ4A 1X4HA 2NXCA 2M4MA 1N5QA 2WVDA 4NZ0A 1RYRA 1DTQB 3BH6B 3W63A 2EBEA 2HIYA 4HDHA 1T9TA 1U8WA 2VIHA 1U0SA 3BDEA 4UUWA 1FRKA 2GJFA 4BWJA 3RB0A 2FDNA 3D6HB 4MK8A 5D77A 4I69A 3CUNA 5HLFB 1WJ9A 1U6ZA 4DSJA 3R5JB 1SKUB 2W2OP 1S0NA 1Z2LA 4USMA 4HHJA 4JI7J 3LF0A 2M0GB 4J9UE 1D1UA 2XO6A 2LDIA 4CTAA 1S7HA 2XGQA 1LFWA 2HFOA 1WG4A 2MEWA 4EEYA 2HAFA 1FXRA 2HQ3A 3GYXB 4ZLNA 1NCLA 3FCVA 3NWGA 3NNCA 4OJGA 2YQ3A 4L6V3 2MY7A 3OXGA 5KG2A 2DGUA 4XDDA 5LSOA 1L5UA 3ZZ0A 1KHVA 3N4WA 4CO2A 1T03A 4G65A 4M1KA 1U1PA 1XIQA 3BGFA 5DZ7A 2E1RA 1FDNA 4X4RA 1S76D 1RA6A 1EQ0A 3PW4A 4ILLA 2ZNZA 1H74A 4PR6A 2NUHA 3GMGA 3NCRA 1YRUA 4P2FA 5KT2A 1SH0A 4DQIA 4Q7AA 1YZ7A 3UO0A 2XCAA 1WORA 3HXMA 3T5JA 4C8ZA 3UVJB 1VYAA 1LWCA 3KMSA 2OEKA 4DUYF 2DR9A 5A8WA 2B4UA 1UFKA 3V6HA 3M2UA 1HNWJ 1FRXA 4UZCA 2CJXB 1AZSB 1SQFA 1TUVA 5GADU 2QC3A 4H4KA 3GB0A 4QR0A 2MZ1A 4ECVA 1UW4A 2HVIA 2X3GA 2MSSA 1CQMA 3OUYA 4CNZA 1Q0NA 3R5GA 4KT0C 4LF8J 1QD1A 1LW0B 2HFZA 3F44A 1HW8A 3F41A 2R2TA 1B99A 1UPMB 2ZH7A 1VBZA 2RMLA 3AJDA 3OTBA 2Y1LB 5BR8F 1CVJA 1WF2A 2DNHA 2WB4A 1UA0A 4B02A 3CDBA 4ZLPA 2ATLA 2QMXA 2CDRB 1S6UA 1R8CA 1S6QB 4FDFA 4LRDA 1A7GE 5GMDA 1SC4B 5CXTA 2KHCA 2NLWA 4B3MF 2OD4A 1SJFA 4R5PA 1TKXA 2X1GA 1TR0A 4YOEA 1SH3A 2AJ2A 4IH6A 1B0TA 2KXHA 3AT1B 1HA1A 1QUPA 2Q3PA 2AJ1A 3QGIA 4N77A 4C3LA 4QYZJ 2E5LF 2UXDF 3JS9A 2ZZMA 2W7OA 3DMJA 2IIHA 2NCKL 2B5JB 2HKEA 2BKNA 2CADA 2NSBA 2V8VA 3K2YA 4BCAA 1N36F 2GV1A 5ETOA 3SSQA 1FKOB 3HVRA 3KTQA 3T41A 2HFSA 2K8GA 2G0IA 4HACB 4UTGA 3BPSP 1KOOA 3HHDA 4YB7A 3D67A 3D0HE 4F2RA 2ZH6A 2C2MB 4DV4F 1S97A 4WF9Q 1DQAA 4RW8A 1BQNB 1QAIA 4O0NA 1R0CB 2BKOA 1MWYA 3W60A 2LA6A 1M5SA 1TL1B 2BJ3A 2B4OA 2EPIA 2ZBRA 4OJ1A 3UN2A 5CABA 4DF4A 4RW9A 1HBNA 1AUSL 1Q79A 2VQEJ 2QL9B 4M5MA 2OSRA 4OYWA 2OJ3A 1IBCB 4PWDB 2EVZA 1N8RT 2RDDA 5ETMA 4IRKA 1F1BB 2VC1A 3LP2A 1GMUA 3O5TB 4F0KA 4B3RJ 4B9SA 4NLPA 2CJKA 2YH0A 4BLGA 4WTOB 2B7BB 4ECXA 3CEDA 4I2QB 1L3VA 5DQHA 3J81U 4JI4F 2DHXA 1RT3A 1YRXA 2DGWA 1UMJA 1Q16B 3PXGa 4NCGA 2FJAB 5FDLB 1PAUB 2MXYA 3LH2S 4OX8A 4Q0BB 2OMOA 1AT1B 2QA4S 3LP0A 4ZP6A 3CJ3A 5LXYA 2IBKA 5ETPA 2BR0A 1FRJA 1NZ8A 2BQRA 3ADAC 1JLFA 2W2MP 4RWWA 3TA1A 5CCLA 5RUBA 3KHGA 3HULA 2NREA 2OIHA 4GKKJ 4DQPA 1YSJA 1S79A 2A2DA 2ILYA 3CTRA 4EI2A 2F1FA 3FFIB 3HVWA 4HT7A 1NDLA 2KKHA 2FZCB 4G1QB 4RW6B 4DU7A 3T1YF 1GMVA 3N9UC 4OHXA 3CCRS 2VUGA 4DV1J 3VGSA 3K89A 2CDQA 3OSPA 1NMEB 3SZ2A 3CO9A 4ZIVA 2Q66A 2KJWA 3MUVP 1R0AB 2H5EA 4RO0A 4OLPA 4CQ1A 2HQFA 5KFAA 4EZ6A 4B3OA 2C3OA 4Y3CA 2VH7A 3KUGA 2UUBF 2OHDA 1ZZFA 4DV0F 3RUBL 1HMVB 2CNLB 2HRUA 2VBWA 1WDTA 1RBOB 4I0WA 3PKMA 3ZXWA 4DR4J 1RAAB 2V94A 1ITPA 1L3UA 2HHXA 4YP3A 4DL6A 3RB6A 4LJMA 4FYXB 1Y5IB 4XTTA 4ZPDA 3FEXB 3CULA 3ICLA 2O5DA 2BW7A 1RCOB 5CYQB 2DRBA 1JKHA 2BANA 5MAOA 1MWZA 3AY0A 3M2UB 1VLOA 3WIUA 4RNOA 4XDCA 1HNWF 1VRUA 3GTYX 1RSCA 2W9BB 3NBPA 4TY8B 3TZZA 4YB1P 1NJYA 1TL1A 5B0EA 5IM0B 1IBMJ 3M2VB 2NS1B 2CQPA 1G4CA 3JXOA 4DSEA 1Y00A 3NS7B 2X1AA 3F0NA 1GXLA 4LF6J 4JI0F 1C1BB 1C0UB 2AKWB 2DISA 2E5GA 3UQSA 3BF4A 5GAGI 4ZVTB 4X64J 4I7FB 1OJ4A 2VZ9A 4TVAB 2XZDB 1JNZB 1H7WA 1ZAXA 3C15B 3M8PB 4NCGB 1R27B 1RADB 5A0YA 4ED8A 2OH2A 5SUHA 3W5XA 2PD1A 2D3UA 2MKSA 4PABA 2XWXA 3OHAA 1RWMB 1TK5A 4DV1F 1M5KC 5L39A 1KSPA 4HR2A 3US5A 1N34F 5I3UA 2UVUA 3NS5A 1KS2A 5H9EK 3M6UA 4L72B 1MN9A 4DX7A 3GILA 4ED1A 1N36J 2ROEA 3HT0A 2UZAA 5CA5A 1B64A 1YQHA 1PG5B 1RBLA 3VV2B 2F9DA 3SSSA 3OTOJ 5E2QA 3D1QA 3TYTA 1YWXA 2JZ5A 2YKMA 3LWMA 1JLEA 3LPEA 1RWWB 2EW9A 3NKYA 2MKJA 4MK7A 2U1AA 2WVFA 1XN9A 3BBCA 4OYIA 4K4SA 3EPGA 4RBUA 4M95A 4DR1F 1RT4B 3V6DA 4LF4J 3GFHA 3FRYA 1HL6A 1X60A 2LMIA 3PG9A 2ZBPA 4FKXA 3A8JA 4KH0B 2AX0A 3ZO7A 2KH9A 2VQEF 2PEHA 4OX9F 3GCWP 4CLTA 2HG4A 1VISA 3MPWA 3NRBA 5KFDA 1EETA 1P8GA 3NGTA 4LRFA 4Y2KA 3TVKA 1A6LA 2R7SA 2CPFA 1ZM4A 2V8GA 3VAMA 5FLXY 1HWJA 2K3IA 1LW2B 4HT5A 2UV8G 1S0MA 5BYQA 3OSNA 2LQ5A 4NA3A 3C16B 1U49A 4O3SA 4NOHA 2AYEA 3B6BA 2E5HA 3ENVA 4H4OA 4W4MA 3MPYA 4A46A 1WF1A 3KDNA 2F8MA 1KLMB 3AD9C 1T94A 2HS3A 2IYIA 5A6PA 4NXMF 3R2CJ 2J7UA 1H3DA 2PSZA 2AZ3A 3OXLA 2ZFHA 4MH8A 3S8SA 3CCJS 1CJTA 1HKAA 2BRKA 2WHOA 4XPEA 4NI2A 4F4WA 1S0OA 1JQGA 3BBBA 2YQ0A 3ETOA 2CPIA 3IS9A 3KHLA 2KXFA 1CJUA 4U96A 3TAPA 1U47A 1QTMA 2MKIA 2V67A 5ETQA 2ZITA 1M1KT 4F02A 5KOXA 3RRKA 2E1AA 5HAOA 1RT1A 3GIKA 1CC8A 3I4PA 3IAS9 2B9EA 2ZDOA 1UEUA 4J37A 5M2UA 1MROA 2U2FA 4LSZB 1BY9A 2GA7A 3CDWA 4JP8A 4MJKA 2MQOA 1RTJB 4LMZA 2HZCA 2FGCA 3FSXA 4KGKA 3M8PA 2N7CA 2AGPA 5ETNA 5A0YB 2A10A 2PE8A 1RAEB 2OGUA 1FNOA 4QJVA 3QPIA 4KQZA 1T95A 1HHTP 3CB4A 4I7FA 2CYYA 4NCBA 1SC6A 2QYCA 3DRRB 4LFCF 2VKRA 1F6TA 2WVBA 4HACA 4ATNA 3NOGA 3A3OB 5HANA 2HVEA 1IQZA 1ELOA 4ELUA 3DXBA 2CPJA 3DRRA 3G87A 4KPCA 2CJYB 4DFJA 5A8RB 4AQYF 4RKUC 4LIRA 2GVDB 4X66F 4J9LA 4X4OA 3DYAA 1X4FA 2UXBF 3SQOP 2HWHA 2HQGA 3QSIA 4OYZA 1VRUB 1XMBA 2JFDA 3ISZA 3UDLA 4DPWA 3VZHA 4B9NA 4LSNB 1IKWA 4WFXA 4R5PB 3KLVA 2HHHJ 1Z2ZA 1RU2A 3MCNA 5IXUA 4LFAF 3U7JA 1VRTB 2FHKA 2YPYA 4JI1J 3DRPA 1FI4A 1U6FA 2MYFA 3MM9B 4URGA 3DDNA 4IFYB 3B54A 3GJTB 3PYEA 3MTKA 4OLOA 4ANCA 4IOCQ 4Q8FA 2BUNA 2KDOA 2RUSA 2YNHA 1FJ7A 1ZM2A 5C24B 4RU2A 2IJRA 4N5SA 5IT9Y 1JLCB 1QAJA 2RKIB 2E7XA 4ZA1A 3OQ2A 2VFRA 5F8IA 1UVLA 1HNIA 2SXLA 1H7XA 4H4OB 4ZVGA 1HYSB 4HHUA 5HBMB 4WFAQ 2XZWA 1GX5A 1KTQA 1KQKA 1HBOB 2EG1A 2DCLA 5I3UB 5KT7A 3HT3A 2Y9HA 4A8KA 1FDBA 4J9SA 1XEZA 2UUAJ 1S10A 2R8KA 3I56S 1LNQA 2QIFA 2HBRB 3DU5A 4KHPJ 1G2EA 5KFEA 4ZOSA 1EKRA 3T5LA 1JIHA 3SFUA 1GNKA 1VS3A 2IPOB 2K1RA 2MKYA 2RS2A 3MM7B 5L38A 2Y1IA 3P4UB 2V9WA 5H9EJ 3H7HB 3DLHA 3PY8A 1CJKA 5AXNA 2XC9A 5F0WA 4F50A 1BE4A 1O6XA 5HATA 4A48A 4PYDA 2GQ2A 4J90A 2EFNA 2E44A 3CJ8A 4YMEA 1YJ9S 3L95X 3NLCA 2DNZA 4DR5J 3I6PA 2B51A 3IFEA 1QUVA 3FC9A 1OO0B 4DBQA 2ZVSA 3CSKA 4WYLA 2RAQA 3LWLA 1PJ7A 2VG5B 4ZHRA 1FTCA 4B3RF 3M8WA 3L7PA 2L3MA 3I0RA 4IRDA 3QT6A 1QJHA 1LKZA 3V2UC 3IP0A 4OZ2A 5HQLA 1DLOB 1NZAA 2YNFA 1ZTWA 3GR1A 1HWLA 1K0VA 2FPHX 4DR4F 3DLKB 1KN6A 4OZJA 3HSJA 4H4KC 1WKLA 1SBRA 1DRZA 2CIMA 2OPPB 2ZDPA 2XI3A 1Q81T 1H6KX 2B4VA 1SKWA 3BN4A 3HD1A 1Q7LB 4OV1A 1RABB 4Y6IA 5AXKA 1UVJA 4CCHA 2HHUA 3SCLE 1B0VA 1WOPA 4TYBA 5HI7A 4ZKAA 5KOWA 1RK8A 4PXEA 3TO8A 1FX4A 3TZXA 3UN5A 1TAUA 2MHNA 3MM8A 3AD7C 5C2CA 4ERDA 2DHAA 2VQFJ 2HEKA 5KFSA 3C15A 4A8OA 3A1YG 2VHGA 5E3AA 4QBUA 4OYAA 3MFHA 4DFPA 1TKXB 4DG1B 5IZHA 3HK2A 1JKHB 2BANB 1N88A 2CQ2A 4U6PA 3ZZZA 1L3KA 4OYXA 2UUBJ 1QE1B 2RQ4A 2O01C 2AEMA 4PZVA 5HBMA 4O3OA 5J2MB 3FZBA 3KLGA 1OQ6A 2IVYA 4NE9C 2KZZA 5IT9U 3Q8RB 4UY8T 3R97A 4FYVB 1H2TZ 3MWBA 1LWEA 1RDRA 1OYEA 1N5YA 4I4BA 2MJUA 3ZC4A 2AEFA 2QTWA 2JEIA 3F56A 1PYSB 5A6WA 4NLQA 3BDPA 2CPXA 3D68A 2DCUB 2GIRA 1PIEA 1FWKA 3OT9A 1UVNA 1H0HB 3MMAB 2JVOA 4LR7A 1N32F 1RWPB 2KO1A 3M6XA 2ACYA 1N34J 2AYGA 3DXSX 3GG0A 4IFVB 4HTJA 4DV7J 2HWTA 3NAHA 4FXVA 2FGOA 1EX8A 3D1HA 4Y0FA 4K59A 2NZCA 2OPQB 5HSPA 4QU6A 3MM6B 2L9WA 2V2KA 4P75A 3CCVS 3JSBA 3UVJA 3NAIA 3MM9A 3UCGA 1RT7A 4DPUA 1X5SA 3Q22A 2A6OA 2CQ3A 2WRMA 3GLJA 3T6BA 3WDOA 2X51A 1JLFB 4ED0A 1GMWD 3C16A 5K8MA 4KY3A 1VC5A 1M90T 4K0KF 3IC1A 3AOAA 3K5OA 2AF6A 2J9CA 3M1VB 3ZTOA 4CH7A 4AYBD 4YS2A 2NUUG 4XIUA 3MUTP 1S9EA 1X4DA 2EBGA 2H54B 2ZBCA 3K59A 3RTVA 5J2QB 1Y3JA 3THTA 4C7QA 1RYSA 3TJ9A 1CLFA 2I9SA 1JLEB 1XR7A 3WX8A 4CO4A 2VBZA 3DYAB 3OTCA 3BKFA 4CT8A 1HBOA 3BZQA 1LXNA 5LM7E 2Z0GA 3D66A 1VQOS 3BO4A 1D3WA 2G2ZA 2CVEA 3EUNA 1VLYA 3QWUA 3I32A 3POTB 5KFKA 1LXJA 5CD4H 3GV7B 1WG5A 4F36A 5F8GA 4CH1A 6FDRA 1PKUA 1F0XA 2CZVC 2C3MA 2Y0BB 2ZOMA 3LW5C 4NA1A 3OTOF 3AXKA 3VAKA 1U1MA 5SZTA 1X9WA 3QSYB 2RHSB 3O6QA 5CQGA 4NWBA 2J6TA 1U1RA 1BXNA 1RXOB 2PT0A 2FJEB 3JQMA 4LF7J 4LRBA 2ZOGA 1MLAA 1VIOA 3DLEA 4CM0A 3JQKA 5CD4A 4DL3A 2EC0A 3N79A 4IDKA 5DG7A 1X5TA 1IKXA 3LGHA 3R3TA 1KLMA 4D3GA 2DNOA 3OR1B 4CZCA 3IR5B 5LT5A 2NSCA 4RLEA 2CJBA 4U9RA 1DFDA 2HRYA 2I1RA 5AE1A 1SCJB 3B8HA 1R8AA 2UXDJ 2IC3B 2VG5A 1LWXA 4MK9A 5DDRC 1NLKL 4V19J 4TQRA 1OY9A 5BXIA 2GVDA 1S99A 3M2VA 3A4TA 1U1NA 4Q45A 3PRVA 4C11A 4Q5VA 3K57A 5A76A 4KKOB 1BQNA 1V3ZA 3V5RA 1BMQB 9ATCB 1RT6B 1X4GA 5F8NA 4KC5A 2VU5A 3SSRA 2ZWOA 3DGPA 5F41A 1PSDA 2HFVA 3RAQA 2DEJA 2NZ4A 4IG3B 3HHNB 5BYSA 1UJ4A 4X4VA 3D2WA 1N54B 2RE1A 4ZPWR 1NJXA 3TUIC 1N0VC 5HP1B 1I51B 1NDKA 2I8EA 4K4VA 1PJ6A 5HROA 1FVQA 4F4ZA 2HFNA 1TUWA 1EHWA 5J2PA 2YKNA 5JUMA 2K2PA 1M5HA 3KG0A 5HO4A 1XR6A 1FRLA 1TL7B 1X5PA 2VPWB 3QT5A 4WFZA 4ALZA 4DDFA 5JVHQ 4J9NA 1NK0A 3HZGA 1BGXT 2A1BA 1DBDA 3C66A 2KT2A 1MMDA 3H20A 1Y9OA 3KKFA 3M2RB 1WWHA 1SXLA 2MZSA 1U2CA 3VTIA 5AE2A 5J1EB 2FJBB 1HYSA 2R7XA 2PFFB 1S59A 2PDAA 2M52A 2NXEA 1T9VA 2C2KB 2FYXA 2N7YA 2I5JA 5CAAA 3X3UA 1WHWA 1FFWB 3P45B 5ETTA 3OBIA 2KJVA 3WHIA 1C1CB 3EGVA 2DH9A 4ILRA 2JC1A 5D4OA 2J9DE 3PO4A 3MHYA 2ZHBA 3Q8UA 1YJWS 5CCMA 4RW8B 4A8WA 4LR9A 1YVFA 2Z2LA 4JI2F 1Q95G 3OVBA 1F9FA 1VDHA 4EYIB 4Q2MA 1SL0A 2KZMA 2EEYA 3T1YJ 2HNDA 2QO3A 3PW0A 1EETB 4DN0A 1C4AA 1I3OB 3POTA 3R7NB 4W98A 3HP6A 3QO9B 4LVOP 3KK1B 4WKRA 1EQMA 3DOMB 4TKTA 1FA0A 2PIIA 4CLFA 1HNIB 3VR1A 2DGQA 5D15A 2QV6A 3TA0A 1MROB 4ED5A 2CQIA 1IKXB 4F0HA 1TQLA 4MTPA 3K5PA 2KG0A 3DC2A 2DNRA 3LP0B 4ECUA 4NXNJ 3OLBA 2UUCJ 2JDJA 1X7VA 3UDCA 3CMES 2ZD1B 3QQCD 4USIA 5DJBA 5KTQA 1HARA 3MEGA 5DGBA 3BO2A 5E33A 4ID5A 4PCQA 2OTLS 1PYOB 1QY7A 2ASDA 3MCSA 1LV5A 3VGUA 4F2SA 3D1OA 2HGLA 4QIGA 2EK6A 4ZJLA 1VCTA 3PX6A 3PW5A 1GMWA 2DY9A 4NEYA 1ZTTA 3D6MB 3EE3A 3EGNA 3EDQB 5CZVA 2Z30B 3QYYA 3OR2B 4J9PA 3TUPA 2J8AA 4J9MA 2IVFB 1C0TA 1YTYA 1HWUA 3UWTA 1VQ9S 3KUHA 4CWBA 1YG0A 5A8KA 4H4MA 3V6KA 4ES2A 5J2PB 4L3KA 3MAHA 4LF5J 2HBZB 1RBAA 1EZZB 3J80U 4F8RA 3IBCB 3D54A 3GG1A 2ZHOA 5E3QA 4YR2A 2EFPA 2GW8A 1S7IA 2A2CA 3TZWA 2JWNA 2JLEA 3UR0A 5F8MA 4LBIA 3OJUA 5J2MA 2R7UA 3DN9A 3M6WA 1RB0A 1VQYA 5D0RA 2HS4A 5KFVA 1J5OA 2VC0A 3G4SS 1CC7A 1H72C 4F0MA 3ILIA 4GVLA 5J2NB 4CM2A 5DZ6A 1X9MA 3BJYA 1KKHA 2GHPA 2LQ8A 3TUZC 1WDDA 3NGSA 3IWNC 2OTJS 5KFNA 2H4WB 2L41A 3V4MA 1WTBA 4NMXA 2MZRA 3HSDA 4R25A 1FFSB 4P9SA 3BGOP 4URSA 4JI6F 1SC1B 2RU3A 2MB0B 5G0RB 1REVB 1VQLS 1BC6A 3E2EA 2MQMA 4LF9J 1C1CA 1U1OA 4ZCMA 5F8LA 3V6DB 1KD1T 1M5OC 3HHLD 2BBEA 2LQ9A 1Y0HA 1KDNA 5D0GA 4ZMMA 3W9IA 3GV8B 4EBCA 1I94J 4LUBA 4NYPA 8RUCA 2FTRA 3HVTA 2XSJB 3N01A 2DGOA 4M5GA 3UD5A 4WJBA 9RUBA 5I3QA 1F9EB 4DJBA 1S4EA 2ZNYA 5D0HA 5HROB 1LWFA 1VJQA 3THPA 1R31A 2VODA 1QE1A 1UVKA 2D1CA 2VPYB 4N8NA 5KFBA 2FUG9 4ECZA 1NBEB 3TZYA 2AYMA 3AB4B 4S0MA 1LW2A 2ZH9A 4NLGA 2HHWA 4RNFA 3HZEA 3MDFA 3Q86A 3HPOA 2R42A 3C8YA 1O0PA 3K5LA 1FNXH 2D7SA 1P9QC 4ECWA 2HWIA 1PYTA 2V8DA 1RAOA 4ZIWA 1LWCB 2HGNA 5EN1A 4DR7J 3AXMA 3SQGB 5H9FJ 5K9FA 3FFIA 2PA3A 4OZ5A 2J7WA 2QFIA 3AOBA 3QFHA 4DOZA 2LA4A 1E6VA 1IKVA 2MSTA 1HBUA 2OAUA 2DR7A 2WONA 3QT7A 3EGZA 4X4PA 1PC4A 3LGNA 3N6NA 1TK8A 1N5TA 3VWSA 2JC0A 2H9ZA 4KSEB 3KK3B 5IC4B 1KR4A 3G71S 1PBUA 3NMRA 5EUHA 2RVJA 5DQGA 2YH1A 2XM3A 3NCQA 1TU0B 2YPZA 1S1TB 3GCXP 3ISNC 1SL1A 3U02A 1UWAA 2QEXS 2A3JA 2ZH8A 4RW7B 2FD2A 3MD3A 3FK4A 4GO5X 3OR1A 3R5CA 1Y5NB 3W5ZA 4PG8A 5IT4A 5GMEA 4DR6J 1PBAA 2H48B 2NYHA 4NRTA 4WCEQ 1HR0F 3EICA 3SEOA 2EI5A 3UI3A 2LEBA 4AL5A 3VAFA 2WCXA 2CKWA 3C14A 3QAUA 2DO0A 4E98A 1DARA 5T14A 3GIIA 4XAKA 1HD1A 2V8HA 3C6TB 4ZLLA 1DQ8A 4USHA 2DVIA 1TVRA 2ZD1A 1XJWB 2FJDB 3FMWA 4NASA 4DCJB 3CJQA 3I9ZA 2KI2A 3G82B 4U8YA 2NQPA 3RR8A 2AW0A 4PG7A 4JI3F 5AT1B 4C9DA 4KR0B 3CCES 4DWIA 4FF2A 2UP1A 2GCFA 3GJSB 3G6VA 1CJVA 1KLNA 2CA9A 2M70A 2MQQA 2MDAA 3AQOA 3FSIA 3PEHA 1IBLF 3MAAB 5LJ3Y 2R8JA 1UEVA 3MEEA 2JFKA 1RE1B 2RU9A 4K2XA 4ZVQB 2QFJA 4MAKA 4WYWA 3RW6A 5KFXA 1Q53A 1U8SA 4PXCA 4Z37A 3KLHB 5C42B 5HMWA 4USJC 3MEEB 3F73A 3KHHA 1NEEA 1RT5A 3UDEA 3VQSA 2Z2ZA 3JB9k 1F60B 4WFYA 5K14A 2B6AA 2FLLA 2IMWP 4UOFA 2UXCF 2YWFA 1KFDA 4WKYA 2UVVA 4DPOA 3I4HX 1X4BA 1S5ZA 2CUYA 1EP4A 3OFHA 4C0BA 5C24A 3GP9A 3GSIA 2XMVA 3PM9A 4DV2J 2MY8A 3H42A 4GRSA 1RWNB 4Q0BA 2FY8A 2JL9A 4ENOA 4ED2A 2GVZA 4M5HA 5KFGA 3PR4A 4DFKA 1JMTA 2BVZA 1SV5B 5DETA 4C2MA 3MMBA 2QLBB 4E2FB 2DGVA 1YJNS 3DDIA 4WFBQ 2WSCC 1NHUA 1IM4A 2DH8A 1ZYQA 1IBKJ 2HMIB 2JEGA 1FKPB 1OS5A 1D09B 3IR7B 2OLWA 2C2EA 4U7UD 4LSNA 2F8EX 1VQ6S 4OI0A 3DLGA 2AP6A 2Z2YB 3SIPB 4KHPF 2YXLA 2ZM6J 1HBNB 4DUZF 3A8KA 1WTFA 4WTYA 2R7VA 2Z57B 1H73A 3A13A 8AT1B 2AHOB 4NA2A 4O3NA 3VGVA 4KPYA 1PO6A 2KTQA 3ZFVA 2JH3A 2GO9A 3PRDA 4IYQA 2RQCA 2QX0A 3PYDA 4KGMA 3NGRA 2RILA 3ZTRA 5FDLA 4OJHA 3W9JA 4DSFA 1VQMS 1AXQA 2JLFA 4DSLA 4X66J 2UVWA 1TKTA 3MEDA 2M9KA 2KN4A 3QATA 4ZP7A 1C2PA 2D3ZA 2KYXA 2Y0SD 4OI1A 4B9MA 1IWAA 4B9TA 3QWPA 5FJ4A 4NPOA 2EG2A 4HI1A 1PILA 4LIWA 5HQMA 3SCKE 3P5BP 4P73A 3R7SB 2V2QA 1S6OA 2E1PA 3BH7B 3OTEA 3W2WB 3OLAA 1DJ0A 1VHIA 2W4PA 3H8YA 3QJPA 4LFAJ 2PFDA 4RW9B 5C5JA 4I68A 1RWVB 4P2XA 7FD1A 1NPPA 2DXEA 4QIEA 1MN7A 1WC6A 2VB6A 3HM9A 3S6EA 3KJVA 1IQTA 3BSAA 4X4QA 4GVBB 1HNVB 1FO1A 3RRHA 1FHTA 2XI2A 1S1WB 1NU4A 4PYAA 3ZNJ1 3KJVB 4B3SJ 3SDEB 1VQ8S 4DPYA 1SJQA 3KHRA 1ACMB 2IA6A 4IO1A 3DI6A 3QIPA 4ES3A 2R7WA 2C2RA 1WNEA 2R8IA 4FYDA 1HI8A 3PJWA 4UOHA 1FEHA 3D28A 1HBMA 1P6TA 5B0DA 5DM6Q 4CNYA 4EBDA 1JLBA 1VMBA 1NSQA 4I6YA 1VBKA 4EGLA 2XSFA 1Q78A 2D41A 3JYTB 1NK8A 1VJWA 5J2NA 1RTDA 2YX1A 1VQ4S 5IOLA 1HBMB 4Y2MA 1P1LA 3MR3A 2GS8A 2QSFA 3PX4A 1W7WA 2XZTB 3PNIA 1FXDA 2IYGA 3NP5A 4FN5A 5CHCB 3TX0A 2FHOB 1V6HA 3HDSA 1F5BA 1IR2A 1OQ3A 2LVWA 3I9V9 1BQMB 4M5LA 1NKCA 4ZLJA 2ILZA 2F9JA 2LYVA 4G1PA 1RT6A 4QWCA 2J0SD 3EGWB 3H2UB 1FE0A 3VAIA 2DJWA 3B82A 1RZMA 4FS1A 4FP9A 2LU2A 5B0FA 1JJHA 2R7TA 4IFYA 1CG2A 4R8UB 3JTOA 3LOUA 3M2RA 3PYGA 3HKWA 2VFUA 3IG1A 4OJ3A 2J6SA 4PRFA 1BWEA 1HQUB 1XNRJ 3WC2A 3IGNA 2CG4A 3E3XA 4I2PB 4OX7A 2JSXA 5A8WB 1YHQS 1U1QA 4JI4J 1TV6B 2WSFC 3D3BJ 2AX1A 4OYOA 4ZDNA 3CCLS 3RR7A 3NL0A 3A12A 2V9KA 3THVA 2VOPA 3CCTA 4ZPTR 3AJ1A 5D6GA 2EK1A 2DHHA 1V3RA 3CD5A 4RUHA 4A8SA 2FVPA 1SJ3P 2IDLA 1RAHB 4U7CA 4M94A 2DT9A 2OMLA 1YBTA 2AEJA 2XWYA 2MLYA 2J76E 4O4RA 2HGMA 4HKQA 1RAGB 3MM5B 1Y10A 4MYUA 3W8GA 4K4WA 3PZPA 5D3GB 1SIZA 2DGTA 1VQPS 1KC8T 2XNRA 4QWAA 3OL7A 3BSOA 2IDEA 3ENAA 2XMUA 3J7Z5 3PR5B 3HLUA 3QJJA 2M8HA 2Z8QA 2DRDA 3R7BB 3W5YA 2VQFF 1IVZA 4MIWA 1GK8A 2FVSA 2PMHA 3BKTA 4QIFA 3HD2A 3RRGA 4V19X 3RAXA 1N5SA 5EX3A 5B08A 3U1LA 4OI6A 2HNDB 4QIVA 4C8MA 1TELA 3R1HA 4NLVA 1FDDA 2AJFE 4C8NA 4Q43A 1VQNS 3QIPB 1U45A 3HFVA 1AUDA 4X4UA 4DX5A 4OZ1A 3H40A 1G6BA 3ZZOA 3SDEA 5ETSA 3HF5A 1GXTA 1ZETA 1FK9A 2I38A 4ELTA 3CCWA 3N28A 4ID8A 5DDPC 4E0DA 4JV1A 2QLWA 1DLOA 2YNFB 3IBFB 4ECYA 4PQAA 4OHZA 2VBYA 4A8QA 2MZQA 2G2YA 3Q2SC 2CZ9A 3W8PA 3PTWA 2Z56B 2ASJA 1NXIA 2VJVA 4IH7A 1RTZA 4LSLA 3TVYA 3UW1A 2ZH3A 2BEFA 5KAKA 2F63A 3FCWA 2MGZA 1MU2A 3HFZB 1FRMA 1RWXB 3KNGA 4LRCA 1NSPA 2FY1A 1UVIA 5L46A 2P9GA 2XS2A 4PWDA 5BJRA 2BE2B 4RW7A 1RACB 2CPDA 3KJQB 4F25A 4ZVEA 4NL5A 3SFGA 4PPZA 3I0SA 2VBXA 4UT4A 1Y3KA 4I2QA 2UUCF 2N82B 1NH7A 3M8YA 3DM2A 4F04B 3RG6A 1RT7B 2VG7A 1C0UA 3I0SB 2E1CA 1BLUA 2M88A 3IN5A 3NGUA 5F9LA 1F2GA 3KK2B 4WZMA 2G0CA 2OD6A 2UUTA 4F7VA 1FKOA 2N3OA 3M05A 3QIDA 4RNNA 2ZBQA 3H2LA 4LBPA 2F4FA 3LTOA 3FQKA 1FTRA 5DS7A 2JEFA 2E9ZA 1F5AA 2L48A 3M30B 2IC3A 3CJ0A 3E51A 3BR8A 3Q8SB 2CG8A 2C3UA 3I82A 3IRXB 3S01A 2BJ9A 1BD6A 3TRGA 3G6YA 1GEHA 2V4QA 2CNOB 3FDSA 3MCOA 4ANEA 4DS5A 2DD8S 3G86A 4ANDA 1URRA 3RU0A 5K20B 4X65J 2L9DA 3CDEA 2RDJA 4NCAA 1VFJA 2YNGB 4RR5A 3MFIA 1Y11A 3RAMA 2H1YA 4MKAA 3RGIA 1G7CB 2C2OB 2FHMA 1U02A 1FJEB 2YNGA 3EDRB 4LF4F 2XBPA 2W25A 1X5OA 3G8QA 4DEZA 1T0TV 2L9NA 2AWZA 2KU7A 3I87A 3T19A 5H1SV 2CPHA 4K8RA 1NK6A 2ZM6F 3PJXA 4K2JA 1Q8BA 3DRXA 4DUZJ 1K1SA 1OPIA 3Q8YA 2MQNA 3LALA 4USUA 2ZH2A 2DPIA 4G1QA 2K7JA 5KG0A 4I6WA 5KFRA 5GAHU 1VQ7S 4AL7A 1NHVA 3FZ2A 4LQ3A 3EWGA 5IWAJ 5GAHI 2FLNA 1S0VA 4P71A 5C25A 4J9RA 2XHWA 4MKYA 4NZ6A 4CH0S 2RRNA 2LEPA 4KGZB 2VOOA 4OIXA 2BQ3A 3G82A 1VGYA 1HW9A 2MZJA 5M2PA 1RKJA 4U95A 1YDLA 1U24A 4IR1A 4WE1A 4D3HA 4C8LA 1TL4A 1V3SA 2CXEA 2G9OA 2VG6A 1RHUB 2W7AA 3BM7A 3DRYA 4RNHA 4I6AA 4L75A 4OMFG 4WXOA 5K5MA 4O4GB 3RBXA 4EO6A 3DI6B 3LGMA 4K4XA 4ZITA 2HLTA 1R0BG 2H4YB 3KJFB 4P10A 3LUYA 1ZM9A 1TL7A 2GNKA 3EVMA 4G6VB 4DLGA 3CF5Q 5D4PA 3N0VA 4RNMA 1WHVA 3W3SA 1QVFR 1OSDA 5IC6B 3FQLA 1M1GA 2J0WA 1D9AA 3I5AA 3HHKA 1J5OB 3HHLA 4PPDA 4ECTA 5A2QY 3BQ2A 2R3VA 1UEKA 3D5MA 4CI0B 1NSKL 5C7PA 2FVRA 4PEOA 4DV6F 2W7PA 1M1HA 5M2RA 3O44A 5THWA 1S12A 1PGZA 1MMLA 4B3MJ 4IR9A 5HN0A 2E7VA 3C6UB 1K73T 3KWMA 3TEHB 3PEJA 4DR1J 2DYAA 3KJNB 3W7BA 3K58A 4OHYA 2OPRA 3LPYA 2HHVA 1FJCA 5BYRA 1YJ7A 2MQLA 5I3PA 2DXFA 5HVFA 4L76A 3OR2A 4LQ9A 5B0BA 4DL7A 2OPRB 1YIJS 3MAQA 1WEZA 2C22A 3NOCA 4NLXA 3Q89A 2QLXA 3HMJG 1N4LA 1KWMA 3P3DA 1HQUA 4J9VA 2W9CB 3CJTA 3HO1A 1P9YA 1AYEA 4Z7YA 3KDOA 1MW7A 4QWEA 4CYUB 1B7FA 2KRRA 2HHSA 2MLZA 3DLLQ 3HHLC 4YHHF 4JI3J 1Q86T 3GPAA 4K4YA 2DGXA 5L1KA 3T1HJ 2VA2A 3I55S 5HLFA 5A2QU 4CYUA 3R6LB 2P5VA 4B9VA 1S77D 2AT1B 3R5AA 2YWEA 3PDNA 1BQMA 1SB6A 3PYFA 4KO0B 1GXUA 3MMCB 1IKVB 2W4CA 3M6VA 3BGUA 3H5UA 3J81j 3M8SA 3ONQA 3CCSS 1OY6A 2OEMA 2P9CA 2J9DA 2ZH5A 3KK1A 5B0CA 1S1UB 1FKAF 4WE1B 4YB5A 4RZRA 1OSCA 3KXDA 4ECRA 4DX6A 4ZPCA 4B9LA 1GX6A 1TK0A 3RBZA 3O1LA 1UVMA 2RRAA 1LEOA 2F65A 4HLBA 4I56A 2XMAA 4FBUA 2YWHA 1DZ5A 1J5EF 4DV6J 4N41A 3PX0A 4CDIA 4F4XA 2OPQA 3MM6A 2BACA 4JI5J 1WEXA 3PCOB 2DNKA 3I0RB 3GJRB 3TAQA 4L3NA 2UU9F 1FEEA 3M7VA 1B70B 2VA3A 3K17A 1W25A 3MMJA 3OL6A 2MGZB 2OELA 4LSLB 4KGVB 1B3TA 2MQPA 2B9YA 1RWUA 5KFOA 3SXLA 2UUWA 4MKVA 2HHHF 1UTAA 3GYNA 3CD0A 2RUGA 1PAEX 4RX6A 4JYAF 2KT5A 3MI7X 4O3QA 1TL3B 2BV3A 5DM7Q 2N3LA 1HWIA 2ADCA 3J7A1 4RUBA 2XY5A 4DR3F 4J7CA 3IBWA 5EGYA 4F4KA 2AJ0A 4DUTA 4IG3A 3Q8QB 3FBEA 1Q8KA 1NM2A 1SJRA 2OP5A 2W9CA 1CPZA 1Q1KA 3K5MA 1S1VB 3KLHA 1TUGB 1N6QB 1VC6A 2HRTA 2WOMA 2KFNA 1ZZNA 3CMAS 1VOMA 1PC5A 4BBYA 3DCAA 4DPXA 2R2SA 2DO4A 2F5GA 2BX6A 3TEGA 2KT3A 2ZKTA 3P6YC 5KG4A 3ZNUA 3TAMA 4HH1A 5KG7A 1HD0A 2Q79A 5GMKa 2G13A 3BYRA 3L4BC 4ILMA 5CYQA 3KG1A 4O44A 4YR3A 1KFSA 5HK4A 4N76A 1IKYA 4QPTA 4LF1A 4C97A 3CT9A 4UF4A 4BC9A 4OFZA 3VF0B 3R1LA 4O3RA 3RB3A 1UP1A 4ECQA 1VQSA 1T05A 2G1DA 1HFEL 2WBRA 1YK9A 4ZK7M 5KT3A 2R7RA 2JEJA 1NH8A 4JI7F 4OYMA 2F4VF 2IM3A 5B0AA 4ZCIA 3LANA 3B4MA 2HHPA 3CJKA 1WOOA 1RTIA 1DTQA 3KOAA 1GFWB 3CJRA 4I2PA 2XCPA 2GO8A 4DV3F 4G3IA 1YITS 3FNNA 2Q43A 4FZVA 4X4TA 1GQEA 4DV7F 3UD4P 1YGYA 3U27A 1XC9A 3QRRA 2HBYB 2PN6A 4OYBA 5K8NA 4JOUA 1RT5B 5EX0A 2B8QA 3DOMA 1X4EA 2ZJQQ 5KG1A 1JJ2R 3QBCA 4PXBA 2EC2A 3E01A 1EP4B 4NLYA 5J1PA 4OI3A 2DRAA 3DLBA 4MFBB 1J2VA 2IJFA 5KT4A 1E6VB 5E5NA 3VGTA 4BC7A 4DZDA 5U47A 5C25B 2B3TB 2HS0A 1WF0A 1Q82T 2PC6A 2D3OR 4JI8F 3GJQB 5J1NA 5CYMA 2CWXA 2GMJA 2MJNA 3N5FA 4IRCA 1JLAA 3TANA 2ZJPQ 3DGPB 5CYJA 3MUMP 3UNGC 3KNAA 3OFEA 4QYZK 2ZUGA 4FVCA 4F3QA 2ZHAA 2FJXA 1FKPA 3MECB 1GTEA 1X0FA 3GFXA 2HNZA 1Z4UA 2OO4A 1URNA 4ZN1A 2GAGC 2VFVA 4IFVA 2HLUA 4OZ3A 2CRLA 4WP8A 3LP1B 1HNZJ 2ZEJA 1A0OB 2HHQA 3LP2B 1GT8A 4QOTA 1CS4A 1NNDA 1RGVA 3AB2B 4J91A 5DG8A 2IMOA 3BEGB 2QN6B 1O8BA 2XHCA 1S1WA 2ALYB 3QMQA 5ITHA 3ENQA 4QQBA 5A8KB 1YJUA 3IWLA 1YJRA 5JJBA 5L8RC 1WG1A 4RUCA 1TVRB 4B3TJ 1B4SA 1VK8A 3MD1A 3C6TA 3DHWC 1K47A 5J1EA 3KLGB 1I6JA 4ELVA 1QAXA 2FC8A 3DLKA 4DSKA 3CD6S 1JK9B 4NYZA 1UKUA 3UPFA 1VQKS 2DTJA 1Q7YT 4C4WA 2GC8A 4NLOA 2W24A 3EYZA 3SCIE 1T02A 3OPKA 2FZGB 3Q0AA 3DOLA 2IM0A 4C6AA 5GAEU 5HMZA 4CLKA 1MNEA 2ZZNA 1K1QA 4AXJA 3VZIA 3CC7S 3H5XA 3KLFA 2MTLA 1IKYB 2IM1A 1KQFB 2LKZA 2HZVA 2CNKB 4YFUA 2RB7A 3T5HA 1C1BA 1QTNB 2PMWA 3HI9A 3UNYA 1D8YA 2NXJA 2XS5A 2CQDA 4TYAA 2YKOA 4R0JA 4LBHA 2Y1RI 3A3PB 3TP2A 4UZBA 5LMUJ 3SYZA 2AYBA 1TMJA 2EXUA 2DIVA 1C0TB 4K5RA 4ED4A 2KG1A 1NDPA 2LECA 3GIRA 3AA9A 3HHLB 1N32J 2BYCA 4ITSA 3HVTB 2HBQB 3K8VA 2E7WA 3HCXA 1FFGB 2PGCA 3AJ2A 4HDGA 3U1MA 2VJUA 4CLUA 1T3OA 3AAWB 4PG6A 2V68A 2XLJA 4OYPA 1TL5A 3GQCA 5D78A 1EKSA 1XMOJ 2YWGA 3EJMA 1AA1B 1Y7PA 3QLHB 4TU9A 2WZ1A 3QRQA 1SI9A 1AFIA 1RAFB 2KRBA 4N7TA 4C48A 3G96A 1QSSA 4PWUA 4DX8H 4O44B 3FJ2A 3J80Y 1WC3A 2H5IB 4KBIA 4YY3F 4RBVA 4JI0J 1WI8A 1G1XA 1CSJA 2LQBA 3JSYA 3FBFA 3KUEA 2HVDA 3D6FB 3CJ4A 3FVYA 4PXDA 2K1RB 3LP1A 2HNYA 1EIYB 4JV5F 2BE9B 3MM7A 2V5HG 3J81Y 1WHXA 3WC0A 3OHBA 4A8FA 5CZXA 2FHJA 5L1LA 2PI5A 1R89A 2WOMB 3QRPA 2UU9J 1F5CA 1SH2A 2V2ZA 4UOCA 1T8EA 2KB2A 3PFOA 3BGRA 5J2QA 2XMTA 1U1KA 3MOJB 3MEDB 4QU7A 3QT8A 3QGPA 1SJ4P 2HHTA 4JBCA 2W2PP 3WX4A 2KM8B 3DDKA 4RL1A 3WIVA 3RBDA 2CQGA 2EFVA 4ZVRB 4E8UA 1KVKA 2ZWPA 2KYZA 4ZVFA 5I42A 4TU8A 4DU8A 1UJ5A 1KEKA 3AH6A 2GFFA 1S1UA 2ABYA 4DL0C 2K06A 3OFFA 2GX8A 4P7VA 2PO4A 4ID5B 4GVBA 1TKDA 3D7SB 3J7AN 2JHEA 5L1IA 4NLWA 3PJ9A 3VALA 1QSLA 4HEA9 2BDPA 1UZDA 2NPIA 4WBFA 4AE5A 3ZTSA 5KFFA 1Y5LB 1C4CA 3O2IA 1U2FA 2GHWA 1R6YA 3KLEB 1RT1B 1FRHA 1VBYA 3OL9A 1RAJA 2OFHX 2CAJA 1S1TA 4AT1B 2Y1JA 4EBEA 4M5NA 1ZOTA 3AOCA 3NG8A 2AD9A 3VVUA 4MT1A 3NGDA 2YNIB 1M5VC 4QWBA 1QLNA 1H38A 1FE4A 4MFBA 5L1JA 4ZVPB 1XMQF 1HPZA 2ASYA 1WSRA 2DNNA 2LDYA 2YNIA 3R5DA 4O23A 3RZAA 1HWKA 1UPPA 2G4BA 2M5YA 3MR2A 1VRQC 2MHEA 1F2HA 3SMZA 3CPWR 1ZPVA 4QW8A 3TQ1A 1QVGR 1WACA 2C28A 1KTVA 4YB6A 3H5SA 5A8RA 3DOLB 3ZTPA 3FEZA 3UCUP 1IJEB 4HTIA 1TKZB 1OY8A 3DNCA 2R2UA 1S9GB 1UFWA 2APOA 1D0EA 4Y2AA 2OFGX 2MZTA 2AGQA 1HR0J 3C3LA 3C46A 1A9NB 1WI6A 3GR0A 2B8PA 4N56A 2HMIA 3QJLA 4DQSA 1EJ7L 4LF9F 4R0EA 3Q24A 3KLIB 1S6QA 1R8BA 1LWFB 3EM1A 3MPUB 1UZHA 2ALZA 2ZOFA 4Y00A 2RKIA 3GFYA 2FLPA 1TV6A 1LOUA 3Q8PB 4WIQA 4KTQA 1U2RA 1U09A 4TU7A 4HH0A 2XEXA 3M9OB 4U67Q 4AQYJ 2B5JA 4J9KA 3GZ7A 3M30A 4WP3A 1O5JA 2RQKA 4A8XA 3T1HF 2J9EA 1FRIA 4NI2B 2PI4A 3JAMU 3R6GB 3D6TB 3VAGA 1N5YB 3NNAA 2M2BA 3HKZD 5HQ8A 4QIWD 1RKIA 2BJ1A 4WWSA 1Q8IA 1CJKB 3U1NA 1JWWA 2QZ8A 4PWWA 3MM8B 2Z2MA 3CW2C 5ADZA 4M5JA 3EPIA 1RHQB 2COLA 4L73A 1YBAA 3HSZA 3KK3A 2F8HA 1NJWA 3J7YU 3RBEA 2HQDA 4QCLA 1H98A 5IT0A 1HNVA 3NS6A 1VQ5S 2RD5C 3ILJA 2AIRB 4C8YA 1S1XA 2ACMA 3C14B 4USKA 4Y65A 2HQIA 3CWJA 3W65A 4DQQA 2Q6BA 1AZSA 5C2GA 2E5JA 5T41A 4OI2A 2AMCB 2YQ1A 3RB4A 2GJIA 1U6BA 2VFTA 1VK3A 2LXFA 1P27B 2CJAA 2VICA 3PHEA 3H0PA 3BSNA 3QFWA 1FDAA 1RI7A 3Q23A 1F3FA 3L9ZA 3H59A 2FHJD 2LFVA 1TKTB 3CD7A 5F9NA 1RHKB 5BR8J 4O3PA 3K0JA 3ZZYA 2RF2A 1UETA 5KT5A 4FPRA 4P6QA 3TI0A 2HYIB 4NMLA 1UJ6A 2R8GA 2BOAA 2XYPB 4IUFA 2POKA 3PV8A 1OWXA 3W2WA 2R9LA 4X84A 1T9XA 3CJ2A 1J27A 2D9OA 1CS4B 1NHKL 3O8WA 5GAGU 2H65B 3GIJA 3G6ES 2A6MA 4I67A 1EB0A 5KFTA 3VCDA 2MMYA 1IBKF 2OPSB 4ZVUB 3MR5A 2C3PA 1SUQB 4B3OB 2CQBA 5IV4A 2CWKA 1DAXA 2B9WA 3TWZA 3J7YI 1RAIB 2DGSA 5C42A 2OPSA 3I96A 2W2QP 1MWQA 1DHMA 1X4AA 4DV5J 2B4PA 3KYLA 1MG7A 1ZAVA 3N6MA 3PFEA 4ZN3A 1NAQA 3Q83A 2UVRA 3DLEB 1N52B 3WZ0A 4DQRA 1N33F 2RRBA 3TJAA 3W66A 3DKDA 5LL6d 4CT9A 4LF8F 4UOGA 3PIOQ 2JJ4D 3TNVA 3M32A 4KIAA 3R2DJ 1ICEB 4KAIA 3IMQJ 4KFBB 1NKBA 3TJ8A 2HQCA 2K3KA 1LW0A 5IFMA 3HJVA 4OQJA 3R8YA 3ITHA 3HVAA 1DTTB 4PAAA 4CIOA 2RJZA 2QL7B 4ZS6A 4TLQA 1KRPA 3DRPB 3PHTA 4PQUA 5DRKA 1R43A 2B7CB 5EHHA 3W61A 3MMAA 3V6JA 5ETLA 4DR7F 1IBMF 1BQXA 4IOBA 4O4GA 2KL8A 4LREA 4NZ7A 2DY1A 2R4FA 2GZOA 3ZZUA 4YQWA 3CJKB 2H51B 1BUXA 1CQNA 2BOPA 1NDCA 3IXQA 4GO7X 4DL5A 3S1TA 4U8VA 2F3JA 1XNQJ 4YEAA 3BQ0A 5ETRA 1RHRB 5JXSA 3SI8A 1FJGF 4UY85 2R2RA 4LF2A 2GAHC 3TR5A 1IN0A 4ED7A 3ISND 4ZPVR 2CPEA 4WZQA 3BN7A 4DV4J 3AA8A 1WHYA 3HSGA 4K5SA 2WONB 3M4XA 2V69A 3E01B 1VC0A 3LQVA 1HLWA 2IAJA 3EXYA 5KFZA 2OPPA 1DY3A 4NLUA 1XMOF 1HI1A 1Q5VA 2RNEA 2YKQA 4Y28C 1WEYA 4WFNQ 1E6YB 2IA0A 5D3GA 4ZVHA 2XY6A 1PJ5A 4P7TA 1KBRA 1ZM3A 3L3CA 3OJSA 2HK3A 1NK7A 4FPIA 1JXEA 2IJNA 3CIZA 2M7SA 2C42A 4A8YA 4FS2A 2ZH4A 1XK8A 1FXLA 1SJ1A 2UXCJ 2CQ0A 5CH7B 2E5IA 3ET6B 2W8KA 2V63A 3BYPA 2V0NA 4K0KJ 2CQ1A 2MKHA 1IBLJ 4DV2F 5H9FK 2O1PA 2YVSA 1YJTA 3T9ZA 2DBBA 3NY0A 4Y34A 4K7QA 1S6PA 1YI2S 1UCNA 1FWLA 2QLJB 4MMOA 3OUYB 1XNRF 5T7LB 1X8DA 4DZ6A 1N56A 1AFJA 1FX2A 2BMBA 2K7KA 2LXIA 2KM8C 3KLFB 2E9RX 5EDWA 3BB5A 3OVSA 2XGPA 1RTDB 2XTJP 4TN2A 1TFYA 2VKZG 4GKJJ 1JLGA 3DU6A 2WVEA 4FXWA 2W9BA 4W92B 2B0GA 2A0FB 2IM2A 4CLZA 3GIMA 1SQEA 3V4IB 1V5IB 3OVAA 2RH3A 2JOQA 2VASA 4CO1A 2LP4A 1KONA 1MMNA 1ZH5A 4EK2A 1T9UA 3I5BA 2IFXA 1EAYC 1R7IA 2ZKUA 1N48A 4Y2CA 3V4IA 3WQPA 2XNQA 2YWWA 1NJZA 7AT1B 4WPAA 4CO5A 1RQ0A 3M9MB 1WKKA 2W8LA 2BXJA 4UQTA 1GH8A 1UAWA 2LQJA 4KE5A 2HZAA 3PRBA 3ZZTA 1JXVA 1KVJA 2JVRA 5EWEA 3CCUS 2QA4G 2KFZA 1FVSA 1X4CA 2D69A 2WW8A 3MPVA 5IQQA 3EXCX 3MMCA 2GVZB 5E0OA 1WD6A 1WC0A 5HJXA 2J5AA 3IM8A 3T3FA 5JVGQ 4WU3A 4ZJQA 4P2SA 2IRXA 2C1EB 4RW6A 1RHJB 3A3NB 3M32B 3UFCX 5KFWA 2KFYA 1CULB 4CP5A 4OZLA 2H5JB 4IO9Q 4C0OC 5B0GA 1ZA2B 2GQQA 2HNZB 3VQTA 5JMNA 4ER8A 3KFWX 4ZJOA 2RSQA 2QMWA 2MPUA 1T03B 2C2DA 3QAEA 1E6YA 4EO8A 5KFCA 4M8LA 3P8BB 1RCXB 2CJQA 2CVIA 5F8HA 4W90B 4ICLA 4OZNA 3H5YA 4USTA 4HHHA 4YUDA 5LXRA 4YDDB 5AE3A 2BM1A 2HNYB 2OEJA 1P1TA 3TARA 4JI1F 4GKJF 1FWPA 5AXLA 3CGIA 1NUEA 5G4DA 1PCAA 3KLEA 4F4AA 2VV5A 4OZ0A 1S6PB 1JLCA 4YR0A 5LMNJ 3UD3P 1VI7A 2CQHA 4C0HA 5GADI 2YBVA 3G8SA 1HIYA 1UWBB 2Q6CA 4L74A 4YY3J 4K4ZA 1FK9B 2GIQA 2YWKA 5B09A 5DG9A 2XLIA 3BO3A 4ZPAA 2FLOA 2ZBIA 3CVKA 2HVZA 4LF7F 2VDHA 3MEGB 5FD1A 3V81B 1TL3A 3SV3A 3P96A 1SKRA 4FF3A 4JI5F 4NEZA 1BWVA 3CNQP 5I42B 5EWFA 1IKWB 2YX7A 1IR1A 3JSRA 4RW4B 2ZZTA 3JAMY 4RU9A 2DR6A 3SCJE 4OX9J 3V81A 2UUAF 3NWRA 4ZVSB 4R8UA 2DEIA 3VVTA 4HI2A 4ED3A 1VIXA 3IAM9 4YDXA 1MSWD 1TP7A 4ETZA 1RLCL 2P9EA 2XULA 3N5BA 4TLRA 4F4YA 4FYWB 2WW4A 2DIUA 2NXNA 1CBKA 2XG8A 5DGAA 3M8QA 3BR9A 1QM9A 5KT6A 1TFWA 3W1YC 4EWTA 4ECSA 3CJ5A 1DURA 3IA0A 3W2VA 2DNYA 2HURA 2NPFA 2X1BA 4F67A 1K0TA 5GVQA 3BQ1A 2Y8WA 1NKEA 3SQGA 4DPTA 1L3TA 1B7YB 4LT6A 1LQ9A 1Z1ZA 2VPXB 3N6LA 3NBPB 4TY8A 5D4LA 4DG1A 5MLCV 4XPCA 2FVCA 2W1BA 2YKMB 3DGVA 3MEKA 5IV3A 1JLAB 2XB2D 2R8HA 1SIWB 4B9UA 1U0HA 5HMYA 4NRUA 2YY3A 3E8OA 4RWXA 4BHQA 1Y4ZB 3LO3A 3QLHA 1V9OA 1WUUA 4QZVB 1RT4A 1NK4A 3ZZRA 1RWOB 4IH5A 5AJ3J 2AQ4A 2V2VA 4OV6A 1GAOA 2M3DA 2VG6B 2DB1A 3MTJA 2QLFB 4KH1B 3FCHA 5EWGA 5LMNF 4QYRA 3G6XA 4C8OA 4P52A 2C3YA 4X2BA 1XMQJ 1JB0C 3FUYA 1FJGJ 1Q5YA 1D8ZA 4A4JA 1R8HA 1M0SA 1S57A 2QMUB 3ELHA 3HHEA 4JV5J 3KLIA 4OL8A 3X1LB 5DDQC 3CIMA 3FSYA 4LR8A 4Q8EA 2CQCA 1LFPA 1OIAA 4M63A 1F9HA 2R7QA 3CCZA 1N0UA 1JNRB 4X62J 8ATCB 2DK2A 2FB0A 3BREA 3EVWA 3FRZA 2UXBJ 4TY9A 3ILOA 5B7WA 5KFHA 1H2UX 2RQMA 1RISA 4DLEA 3QGGA 1HNXJ 3WBZA 3SV4A 4J9OA 3EZ5A 3W64A 1S72S 2CQ4A 4BWMA 5IWAF 4LFCJ 4C98A 2P6SA 3OV7A 3MZIA 3MCMA 2FJVA 1OPZA 2AV5A 5L9NA 2HW3A 4KHMA 4C3MA 1N5VA 4V1Ak 3EVOA 5LSLA 5FLXU 3ET6A 1M5PC 1QDUB 5KG5A 4JI8J 1W2BR 1TZ0A 3DLGB 3CO0P 3UR3C 3QNWB 3ILLA 4RPFA 5LSRA 1B0PA 2P6TA 2I6WA 3FBCA 1WC4A 2D3O1 1AB8A 4FXDA 1HMVA 1RA7A 1D9DA 4DN9A 4HVZA 1RTHB 4NLRA 2ZUAA 4RUAA 4FNHA 1RP5A 2JX2A 5KFUA 3ULHA 4AUKA 5AJ3F 2BW2A 3TA2A 1CJTB 3O3LA 4CO0A 2JLGA 4GC7A 2XLKA 1FNMA 2B43A 3FMBA 4ZVOB 2IY5B 2XY7A 2G2OA 1HQEA 3I5CA 3IO1A 5F0UA 4WK3A 2ZH1A 3PIPQ 3B4DA 3MGJA 1VBXA 1REVA 1WELA 3UN3A 2ROGA 3FBBA 1APSA 1I5OB 4A47A 2V34A 2IRYA
chains in the Genus database with same CATH topology
1VRTA 1U4BA 4JUZA 2M8DB 1VHFA 5IM0A 1I1GA 4F26A 2WTFA 4FF1A 1FESA 3KMQA 1S9GA 5IQ6A 1NK9A 3KK2A 3OTDA 4PG4A 4TXSA 2E1MC 2FIUA 3B78A 2B56A 1ULRA 4Z2XA 2GQCA 5D4NA 1SUQA 2YKAA 1RT2A 3Q2TC 2Z4PA 3L7OA 4EZ9A 1AW0A 2CPZA 3UE2A 3M8QB 3DOKB 4O0IA 2DHSA 4IDKB 2RT3A 2DH7A 2XMWA 3CDAA 1LK7A 4DMZA 7FDRA 2BQUA 3G9CA 1JLQA 3IR6B 4AFFA 1IXKA 3A8EA 1T3NA 1S4FA 2N4CA 2IBOA 3PW7A 2Q1LA 4PQUB 4MIBA 3ENWA 1R3NA 2ZC4A 4KJIA 2QT7A 4RW4A 3MURP 2AU0A 2QE5A 1NJIT 1S48A 5GAEI 4KFBA 4QPXA 2QRRA 2HIQA 2GMLA 5KG3A 4K50A 1TKZA 4OHWA 3K5NA 1NO8A 1T05B 3GWCA 3FGVA 1HHSA 2O67A 5HP1A 4JV0A 2DNPA 1KQSR 3JTPA 4DSIA 4EFAC 2X1FA 1ZAWA 1IR0A 3OW2R 2BRLA 3HFKA 1D9FA 5HL7Q 4HYKA 2J0QD 2LLZA 1U26A 2DNMA 1JX4A 3AQPA 1U48A 1KVIA 2V4JA 2GGPA 1RTHA 4F3MA 2OSQA 2XMKA 2I5JB 4DR6F 1UFLA 4KO0A 1UVNA 3DRSA 1R8PA 1YJVA 2JRSA 3PACA 4KHRA 3MMBB 4A8MP 4B08A 4I1TA 2FC9A 2IVMA 2VPZB 1K8AT 2F7VA 2RF2B 3QZ7A 2ZE2B 1AROP 2ROPA 2D74B 3IS9B 3CXCR 6FD1A 3DLJA 5KFYA 5KFQA 3G8TA 3M9NB 1L3SA 4KV8A 4IG0B 3H2VE 4ZHRB 1IUJA 1SKSA 2LCWA 3DM2B 4AL6A 1FCAA 2O66A 1S1XB 4OHVA 1GTHA 1FF2A 3VAFA 1W2IA 2WBMA 3EZUA 2DHGA 1XERA 4K4UA 2E29A 4DV5F 4WU2A 1JLGB 5KFIA 3AHPA 4X62F 3C6UA 4KKOA 2EFOA 4ZP9A 1JLBB 2VONA 4XK8C 3EX7B 3OXFA 5CYMB 2NXUA 1S49A 2QSWA 2LU1A 4DS4A 2XMMA 4MIAA 5FIIA 4LVNP 1HQEB 4CTAB 4NX9A 3NGKA 1HI0P 2V4RA 4UW2A 4AXIA 2MKCA 1XR5A 2A18A 2W9AA 4FBTA 4GKKF 4J9QA 2WAQD 2I2YA 4BDPA 1U25A 1RT3B 5G0RA 2DNGA 2HVHA 3T1AA 3T5KA 4M5DA 3NNHA 2HPUA 2EKYA 2NYIA 3VAHA 3ZZPA 5KFPA 4PKDB 1ZBTA 3H25A 2IRUA 4FVMA 2YKNB 1UA1A 4RBTA 3IG1B 2NR0A 2UV8A 3I31A 2YNHB 3GV5B 2ERRA 1X9SA 1UL3A 4F3OA 3FEYB 2GGPB 5L9XA 2BABA 4FNIA 4J5OA 2CZ4A 5K8OA 1U1LA 4DHVA 3VAJA 5E41A 2MKKA 4H54A 4ZCLA 3TOQA 3IRXA 4WIIA 1KHWA 4DR5F 1NB7A 3UCZP 3HX9A 2VL1A 4N8OA 4ZPBA 2GMHA 4JV2A 2AJ4A 2O3DA 4XO0A 4IQXA 3QO9A 1KOHA 4QR2A 4EYHB 3MECA 1Q4RA 1RTJA 5KG6A 3BS9A 1XWLA 1S1VA 1ZPWX 3D0IE 5E3CA 3JSMB 1N6QA 2VG7B 4NYOA 4C3KA 4BS2A 4PUOA 2YTCA 2R7XA 3CDUA 3LAMA 1YRTA 3CCMS 1NK5A 2L08A 4OX6A 3DHXA 3H4DA 4B3SF 5E7OB 2EWHA 5LMUF 4KV8B 2XMJA 2DPJA 1QAYA 3H4BA 1QSYA 1JLQB 3T9NA 3R27A 3IRWP 2YX4A 4X4SA 4DFMA 2DR5A 3BSCA 2HAIA 4DF8A 4TNOA 4QW9A 2R7OA 4GC6A 1S9FA 2QA2A 1FT8A 4Q44A 1JXLA 3J7ZT 4GMKA 4NLSA 4EUVA 1R0AA 3BGLA 3ITHB 2W4DA 2J0XA 3DRSB 5F3ZA 5DLFA 4WK1A 1RTIB 3TVZA 2F40A 4IQMA 2ADBA 2YKPA 3P5TL 2LXUA 4NLTA 2XS7A 4LF5F 3T6JA 2D9PA 1RT2B 1Q8LA 2CJ9A 1IJFB 1LK5A 1KNZA 1ROFA 1KQGB 2I0XA 2AJQA 2BZ2A 4IG0A 1FERA 4DR2F 3JYTA 1SL2A 1NRKA 3TAMB 5LJ5Y 2RS8A 2GHVC 1K9MT 3MF5A 3NMAA 5T7LA 3QGHA 5KFLA 2KXNB 5E3PA 3GSDA 2ASLA 2J6UA 1DTTA 5DLGA 3CC2S 4KRWA 2PMZD 2CFXA 1XTZA 1O51A 2J7KA 4QR1A 3MR6A 3L09A 4NXNF 5DO2A 1SV5A 2ZE2A 2OKQA 3IGVA 4FF4A 3D0GE 5F3TA 2QA1A 4UQGA 1U7LA 2XSJA 2BJDA 3H98A 4NLDA 3S7RA 4CO3A 4ZCKA 5AXMA 3JSMA 4PUOB 3DOKA 2FVQA 4OI4A 2E9TA 4MKBA 2FJWA 4X64F 4UUXA 4M5DB 3M8RA 2ZJRQ 2BM0A 5K14B 4ICLB 3PKYA 2V4JB 3CCQS 5HMXA 3IWXA 3DMJB 1X0PA 3BGRB 1CEZA 2BJEA 1HNZF 2IAJB 2RDIA 3TUJC 2EFQA 3NCPA 3MM5A 4G1IA 3KG4A 4X65F 2ZC3A 3GE9A 2XO7A 1S9EB 2EFGA 1H2VZ 2WB1D 1MU2B 3LAKA 3RW7A 5KFJA 3OL8A 2DR8A 1XNQF 3OFGA 3TW0A 2DRAA 3GFZA 2BA9A 4B3TF 4IOAQ 2KVIA 4Y2IA 4LFBF 3MOZA 1I94F 4TQSA 1RJJA 4ETXA 4N47A 5DDOC 5E3RA 3K8WA 4PG5A 3DFEA 1G3OA 1XBWA 4H4MB 4U7UK 2B9XA 3MXHP 4IKAA 4ES1A 4EU0A 2DITA 2DNQA 3PO5A 3HJFA 2PA8D 1FD8A 2B6AB 2GJ2A 4URQU 2LEAA 1T7PA 4DL2A 3TX8A 1HNXF 2CPYA 2VFSA 2AGOA 3CC4S 3P49B 5KFMA 2VD3A 3M1VA 1LWEB 4Q2LA 3C2PA 3W2VB 1DQ9A 1FD2A 3CE8A 1UWBA 4KB7A 4X4NA 3RYLA 4DL4A 1HPZB 4B17A 3JTNA 5K8PA 4ZP8A 5I4MA 2N4DA 1TAQA 4MYTA 5DQIA 3PW2A 2BE2A 2E66A 1HBUB 4QWDA 2DNLA 4C8KA 3K7RA 4C11B 3R5BA 3PVXA 5D8HB 4ED6A 4K4TA 2WK4A 4HL9A 4I64A 2WSEC 4WXWA 2IHR1 2KHDA 2RIJA 1JJ4A 1X4HA 2M4MA 1N5QA 4NZ0A 1RYRA 1DTQB 2EBEA 4HDHA 3RB0A 3BDEA 4UUWA 1FRKA 4BWJA 2FDNA 4MK8A 5HLFB 5D77A 4I69A 1U6ZA 4DSJA 1S0NA 1Z2LA 4HHJA 3LF0A 2M0GB 1D1UA 2LDIA 4CTAA 1S7HA 2XGQA 1LFWA 2HFOA 1WG4A 4EEYA 1FXRA 2HQ3A 3GYXB 3NNCA 3NWGA 4OJGA 2YQ3A 4L6V3 2MY7A 3OXGA 5KG2A 2DGUA 4XDDA 5LSOA 1L5UA 3ZZ0A 1KHVA 3N4WA 4CO2A 1T03A 1U1PA 4M1KA 1S76D 3BGFA 4X4RA 2E1RA 1FDNA 1RA6A 3PW4A 4ILLA 2ZNZA 4PR6A 2NUHA 3GMGA 3NCRA 1YRUA 5KT2A 4DQIA 1SH0A 4Q7AA 2XCAA 3HXMA 3T5JA 4C8ZA 1LWCA 3KMSA 4DUYF 2DR9A 5A8WA 2B4UA 3V6HA 3M2UA 1FRXA 1TUVA 5GADU 4H4KA 3GB0A 4QR0A 2MZ1A 4ECVA 1UW4A 2HVIA 2X3GA 2MSSA 1CQMA 3OUYA 4CNZA 4KT0C 3F44A 1LW0B 2HFZA 3F41A 1HW8A 2ZH7A 2R2TA 2UP1A 1VBZA 2RMLA 3OTBA 5BR8F 1CVJA 1WF2A 2DNHA 2WB4A 1UA0A 4B02A 3CDBA 4ZLPA 2ATLA 2QMXA 1S6UA 1R8CA 1S6QB 1A7GE 5CXTA 2KHCA 2NLWA 4B3MF 2OD4A 1SJFA 4R5PA 1TKXA 2X1GA 1TR0A 4YOEA 1SH3A 4IH6A 1B0TA 2KXHA 1HA1A 1QUPA 2Q3PA 2AJ1A 3QGIA 4N77A 4C3LA 4QYZJ 2E5LF 2UXDF 2ZZMA 2W7OA 3DMJA<