2HW5A

The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
260
structure length
260
Chain Sequence
ANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human enoyl-coenzyme A (CoA) hydratase short chain 1, ECHS1
rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Enoyl-CoA hydratase
total genus 90
structure length 260
sequence length 260
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 2hw5A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2hw5A01
1HNOA 4U0HA 1K39A 2GTRA 3PZKA 5DUFA 4FN8A 3GMAA 4L8KA 2A81A 3T89A 3RSIA 5MGBA 3TVWA 4Q1IA 3G64A 4RYFH 5JBXA 5IKLB 1VRGA 4GM2A 3SLLA 2J5SA 1XX4A 1MJ3A 3Q0JA 1EY3A 3Q0GA 4OG1A 1YG6A 3H0SA 1K32A 1YG8A 4WCZA 2UZFA 3R9TA 3U9TB 2CE3A 3QKAA 4B3JA 2W3PA 3H0JA 3R0OA 1WZ8A 2WTBA 1TYFA 3SWXA 1XNVA 5DKPA 4I42A 4I4ZA 1X0UA 2VX2A 3ISAA 3OMEA 2Q2XA 2NP9A 3KTIA 1UIYA 5E0SA 4KNPA 3TT6A 1XO6A 3STAA 3GF7A 4EMMA 4F47A 3T8BA 4ZDDA 2CBYA 3H0QA 3V5IA 2F9YA 3BF0A 2C8TA 4MOUA 2J5GD 4OLQA 2X24A 2PPYA 5CTBA 4JOTA 5JBWA 3HLN1 3U9RB 3JU1A 1WDMA 4JJTA 2ZQQA 4RCNA 4K29A 3ZWBA 4U1AA 4QIIA 3T8AA 4FN7A 4U0GH 3IAVA 1Q52A 1EF9A 5DZKH 3V5EA 3P5MA 1XNYA 1DUBA 5CTCA 2J5GA 4U18A 3FDUA 2EJ5A 1HZDA 3QK8A 5DU4A 5E0NX 3KQFA 1PJHA 4WZ8B 2BZRA 5FUSA 4FB8A 4MI2A 4ZU2A 3FF6A 4JSBA 3H02A 2Q35A 3ZWCA 3T88A 4OMRA 3Q1TA 4JVTA 4K2NA 4FZWA 3KTJA 4ELWA 1EF8A 4IZCA 3TZ3A 1FC7A 2ZL3A 1J7XA 4HNKA 3ST9A 4DI1A 3IBBA 3KTHA 4ZDBA 3OT6A 3R6HA 4LK5A 4NEKA 1OD2A 4U0GA 4ZDFA 3TLFA 4JYJA 4L6WA 1FCFA 2ZL4A 5DZKA 3KTKA 4ZDCA 2A7SA 4JFCA 4JYLA 4WYOB 4I52A 4KD6A 3TVUA 3MYBA 4JWVA 3QREA 4K3WA 3P85A 5KDRA 4EMPA 3R9SA 2VSSA 5DTWA 4B3IA 1NZYA 3TRRA 4FNDA 4FNBA 3PGQA 1JXZA 2ZL2A 5INFA 2VSUE 4G2RA 1O8UA 1OD4A 4HC8A 2A7KA 3GLMA 4Q0GA 4KWBA 5DL1A 5KDRB 3DORA 3H0UA 3QYRA 1ON9A 3LAOA 3QXIA 3N6RB 1N6FA 4MXIA 3TDCA 5C9GA 3QWDA 3OC7A 3GKBA 5INGA 2VSUA 3T3WA 2F6QA 3TT7A 3VIVA 3ZW8A 4IZBA 3QXZA 2J5IA 3M6NA 3QMJA 2FBMA 3MFMA 5DU8A 4QIJA 3IB9A 2VSUF 4Z0MA 1UYSA 2ZQRA 1NZYB 1WDLA 3MOYA 3RSTA 5KJPA 2F6IA 5G1RA 2PG8A 3NJBA 4IZDA 1FC6A 1N6DA 1UYRA 5E0SH 4FJWD 2DEOA 1PIXA 2FZSA 3HRXA 4JCRA 3R9QA 1SZOA 1WDKA 3K50A 3WG5A 1DCIA 3HE2A 3PEAA 2VSSF 2VREA 2PBPA 1UYVA 1ON3A 3K8XA 2Q34A 3TV5A 2VSSE 4YLHA 3P2LA 4KPKA 3BPPA 4ELSA 2J5II 5G1SA 1HNUA 2DUBA 1UYTA 5DTPA 4JCSA 3HINA 5DUCA 2X58A 3U9SB 5C90A 3BEZA 3PE8A 2F9IA 2HW5A 4NNQA 4GHNA 3DJAA 3L3SA 3RRVA 1Q51A 1RJMA 3LKEA 3KTGA 4RYFA 5INIA 5G1QA 3ZW9A 1Y7OA 2F9IB 4U19A 3ZWAA 3Q7HA 1W2XA 1RJNA 2IEXA 1N6EA 2QQ3A 3M6MA 4ELXA 1TG6A 4JCQA 4FZWC 3HP0A 4ZDEA 1FC9A 4B3HA 1SG4A 3H81A 3NJDA 4QFEA 2VSUC 2D3TA 4ASIA 2J5IB 5DU6A 2ZL0A 4JCTA 3GF3A 1XNWA 2F9YB 4EMLA 2FW2A 5FIFA 3I47A 3MT6A
chains in the Genus database with same CATH superfamily
1HNOA 4U0HA 1K39A 2GTRA 3PZKA 5DUFA 4FN8A 3GMAA 4L8KA 2A81A 3T89A 3RSIA 5MGBA 3TVWA 4J2UA 4Q1IA 3G64A 4RYFH 5JBXA 5IKLB 1VRGA 4GM2A 3SLLA 3RQEA 2J5SA 1XX4A 1MJ3A 3Q0JA 1EY3A 3Q0GA 4OG1A 1YG6A 3H0SA 1K32A 1YG8A 4WCZA 2UZFA 3R9TA 3U9TB 2CE3A 3QKAA 4B3JA 2W3PA 3H0JA 3R0OA 1WZ8A 2WTBA 1TYFA 3SWXA 1XNVA 5DKPA 4I42A 4I4ZA 1X0UA 2VX2A 3ISAA 3OMEA 2Q2XA 2NP9A 3KTIA 1UIYA 5E0SA 4KNPA 3TT6A 3ADCA 1XO6A 3STAA 3GF7A 4EMMA 4F47A 3T8BA 4ZDDA 2CBYA 3H0QA 3V5IA 2F9YA 3BF0A 2C8TA 4MOUA 2J5GD 4OLQA 2X24A 2PPYA 5CTBA 4JOTA 5JBWA 3HLN1 3U9RB 3JU1A 1WDMA 4JJTA 2ZQQA 4RCNA 4K29A 3RQFA 3ZWBA 4U1AA 3AM1A 4QIIA 3T8AA 4FN7A 4U0GH 3IAVA 1Q52A 1EF9A 5DZKH 3V5EA 3P5MA 1XNYA 1DUBA 3RQGA 2YJGA 5CTCA 2J5GA 4U18A 3FDUA 2EJ5A 1HZDA 3QK8A 5DU4A 5E0NX 3KQFA 1PJHA 4WZ8B 2BZRA 5FUSA 4FB8A 4MI2A 4ZU2A 3FF6A 4JSBA 3H02A 2Q35A 3ZWCA 4GEHB 3T88A 3ADDA 4OMRA 3Q1TA 4JVTA 4K2NA 5HUQA 4FZWA 3KTJA 4ELWA 1EF8A 4IZCA 3TZ3A 1FC7A 2ZL3A 1J7XA 4HNKA 3ST9A 4DI1A 3IBBA 3KTHA 4ZDBA 3OT6A 3R6HA 4LK5A 4NEKA 1OD2A 4U0GA 4ZDFA 3TLFA 4JYJA 4L6WA 3W8HB 1FCFA 2ZL4A 5DZKA 3IRBA 3KTKA 4ZDCA 2A7SA 4JFCA 3A4LA 4JYLA 4WYOB 4I52A 4KD6A 3TVUA 3MYBA 4JWVA 3QREA 4K3WA 3P85A 4HDTA 5KDRA 4EMPA 3R9SA 2VSSA 5DTWA 4B3IA 1UX4A 1NZYA 3TRRA 4FNDA 4FNBA 3PGQA 1JXZA 2ZL2A 5INFA 2VSUE 4G2RA 1O8UA 1OD4A 4HC8A 2A7KA 3GLMA 4Q0GA 4KWBA 5DL1A 3A4MA 5KDRB 3DORA 3H0UA 3QYRA 1ON9A 3LAOA 3W8IB 3QXIA 3N6RB 1N6FA 4MXIA 3TDCA 5C9GA 3QWDA 3AJMA 3OC7A 3GKBA 5INGA 2VSUA 3T3WA 2F6QA 3TT7A 3VIVA 3ADBA 3ZW8A 4IZBA 3QXZA 2J5IA 3M6NA 3QMJA 2FBMA 3MFMA 5DU8A 4QIJA 3IB9A 2VSUF 4Z0MA 1UYSA 2ZQRA 1NZYB 1WDLA 3MOYA 3RSTA 3L8JA 5KJPA 2F6IA 5G1RA 2PG8A 3NJBA 4IZDA 1FC6A 1N6DA 1UYRA 5E0SH 3BPTA 3A4NA 4FJWD 2DEOA 1PIXA 2FZSA 3HRXA 4JCRA 3R9QA 1SZOA 1WDKA 3K50A 4NARA 2P63A 3WG5A 1DCIA 3HE2A 3PEAA 2VSSF 2VREA 2PBPA 1UYVA 1ON3A 3K8XA 2Q34A 3TV5A 2VSSE 4YLHA 3P2LA 4KPKA 3BPPA 4ELSA 2J5II 5G1SA 1HNUA 2DUBA 1UYTA 5DTPA 1UX5A 4JCSA 3HINA 5DUCA 1Y64B 2X58A 3U9SB 5C90A 3BEZA 3PE8A 3L8IA 2F9IA 3O4XE 2HW5A 4NNQA 4GHNA 3DJAA 3L3SA 3RRVA 1Q51A 1RJMA 3LKEA 3KTGA 4RYFA 5INIA 5G1QA 3ZW9A 1Y7OA 2F9IB 4U19A 3Q7HA 3ZWAA 1W2XA 1RJNA 2IEXA 1N6EA 2QQ3A 3M6MA 4ELXA 1TG6A 4JCQA 4FZWC 3HP0A 4ZDEA 1FC9A 4B3HA 1SG4A 3H81A 3NJDA 4QFEA 2VSUC 2D3TA 4ASIA 2J5IB 5DU6A 2ZL0A 4JCTA 3GF3A 1XNWA 2F9YB 4EMLA 2FW2A 5FIFA 3I47A 3MT6A
chains in the Genus database with same CATH topology
1HNOA 4U0HA 1K39A 2GTRA 3PZKA 5DUFA 4FN8A 3GMAA 4L8KA 2A81A 3T89A 3RSIA 5MGBA 3TVWA 4J2UA 4Q1IA 3G64A 4RYFH 5JBXA 5IKLB 1VRGA 4GM2A 3SLLA 2J5SA 1XX4A 1MJ3A 3Q0JA 1EY3A 3Q0GA 4OG1A 1YG6A 3H0SA 1K32A 1YG8A 4WCZA 2UZFA 3R9TA 3U9TB 2CE3A 3QKAA 4B3JA 2W3PA 3H0JA 3R0OA 1WZ8A 2WTBA 1TYFA 3SWXA 1XNVA 5DKPA 4I42A 4I4ZA 1X0UA 2VX2A 3ISAA 3OMEA 2Q2XA 2NP9A 3KTIA 1UIYA 5E0SA 4KNPA 3TT6A 1XO6A 3STAA 3GF7A 4EMMA 4F47A 3T8BA 4ZDDA 2CBYA 3H0QA 3V5IA 2F9YA 3BF0A 2C8TA 4MOUA 2J5GD 4OLQA 2X24A 2PPYA 5CTBA 4JOTA 5JBWA 3HLN1 3U9RB 3JU1A 1WDMA 4JJTA 2ZQQA 4RCNA 4K29A 3ZWBA 4U1AA 4QIIA 3T8AA 4FN7A 4U0GH 3IAVA 1Q52A 1EF9A 5DZKH 3V5EA 3P5MA 1XNYA 1DUBA 2YJGA 5CTCA 2J5GA 4U18A 3FDUA 2EJ5A 1HZDA 3QK8A 5DU4A 5E0NX 3KQFA 1PJHA 4WZ8B 2BZRA 5FUSA 4FB8A 4MI2A 4ZU2A 3FF6A 4JSBA 3H02A 2Q35A 3ZWCA 3T88A 4OMRA 3Q1TA 4JVTA 4K2NA 5HUQA 4FZWA 3KTJA 4ELWA 1EF8A 4IZCA 3TZ3A 1FC7A 2ZL3A 1J7XA 4HNKA 3ST9A 4DI1A 3IBBA 3KTHA 4ZDBA 3OT6A 3R6HA 4LK5A 4NEKA 1OD2A 4U0GA 4ZDFA 3TLFA 4JYJA 4L6WA 1FCFA 2ZL4A 5DZKA 3KTKA 4ZDCA 2A7SA 4JFCA 4JYLA 4WYOB 4I52A 4KD6A 3TVUA 3MYBA 4JWVA 3QREA 4K3WA 3P85A 4HDTA 5KDRA 4EMPA 3R9SA 2VSSA 5DTWA 4B3IA 1NZYA 3TRRA 4FNDA 4FNBA 3PGQA 1JXZA 2ZL2A 5INFA 2VSUE 4G2RA 1O8UA 1OD4A 4HC8A 2A7KA 3GLMA 4Q0GA 4KWBA 5DL1A 5KDRB 3DORA 3H0UA 3QYRA 1ON9A 3LAOA 3QXIA 3N6RB 1N6FA 4MXIA 3TDCA 5C9GA 3QWDA 3OC7A 3GKBA 5INGA 2VSUA 3T3WA 2F6QA 3TT7A 3VIVA 3ZW8A 4IZBA 3QXZA 2J5IA 3M6NA 3QMJA 2FBMA 3MFMA 5DU8A 4QIJA 3IB9A 2VSUF 4Z0MA 1UYSA 2ZQRA 1NZYB 1WDLA 3MOYA 3RSTA 5KJPA 2F6IA 5G1RA 2PG8A 3NJBA 4IZDA 1FC6A 1N6DA 1UYRA 5E0SH 3BPTA 4FJWD 2DEOA 1PIXA 2FZSA 3HRXA 4JCRA 3R9QA 1SZOA 1WDKA 3K50A 4NARA 3WG5A 1DCIA 3HE2A 3PEAA 2VSSF 2VREA 2PBPA 1UYVA 1ON3A 3K8XA 2Q34A 3TV5A 2VSSE 4YLHA 3P2LA 4KPKA 3BPPA 4ELSA 2J5II 5G1SA 1HNUA 2DUBA 1UYTA 5DTPA 4JCSA 3HINA 5DUCA 2X58A 3U9SB 5C90A 3BEZA 3PE8A 2F9IA 2HW5A 4NNQA 4GHNA 3DJAA 3L3SA 3RRVA 1Q51A 1RJMA 3LKEA 3KTGA 4RYFA 5INIA 5G1QA 3ZW9A 1Y7OA 2F9IB 4U19A 3ZWAA 3Q7HA 1W2XA 1RJNA 2IEXA 1N6EA 2QQ3A 3M6MA 4ELXA 1TG6A 4JCQA 4FZWC 3HP0A 4ZDEA 1FC9A 4B3HA 1SG4A 3H81A 3NJDA 4QFEA 2VSUC 2D3TA 4ASIA 2J5IB 5DU6A 2ZL0A 4JCTA 3GF3A 1XNWA 2F9YB 4EMLA 2FW2A 5FIFA 3I47A 3MT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNO A;  4U0H A;  1K39 A;  2GTR A;  3PZK A;  5DUF A;  4FN8 A;  3GMA A;  4L8K A;  2A81 A;  3T89 A;  3RSI A;  5MGB A;  3TVW A;  4Q1I A;  3G64 A;  4RYF H;  5JBX A;  5IKL B;  1VRG A;  4GM2 A;  3SLL A;  2J5S A;  1XX4 A;  1MJ3 A;  3Q0J A;  1EY3 A;  3Q0G A;  4OG1 A;  1YG6 A;  3H0S A;  1K32 A;  1YG8 A;  4WCZ A;  2UZF A;  3R9T A;  3U9T B;  2CE3 A;  3QKA A;  4B3J A;  2W3P A;  3H0J A;  3R0O A;  1WZ8 A;  2WTB A;  1TYF A;  3SWX A;  1XNV A;  5DKP A;  4I42 A;  4I4Z A;  1X0U A;  2VX2 A;  3ISA A;  3OME A;  2Q2X A;  2NP9 A;  3KTI A;  1UIY A;  5E0S A;  4KNP A;  3TT6 A;  1XO6 A;  3STA A;  3GF7 A;  4EMM A;  4F47 A;  3T8B A;  4ZDD A;  2CBY A;  3H0Q A;  3V5I A;  2F9Y A;  3BF0 A;  2C8T A;  4MOU A;  2J5G D;  4OLQ A;  2X24 A;  2PPY A;  5CTB A;  4JOT A;  5JBW A;  3HLN 1;  3U9R B;  3JU1 A;  1WDM A;  4JJT A;  2ZQQ A;  4RCN A;  4K29 A;  3ZWB A;  4U1A A;  4QII A;  3T8A A;  4FN7 A;  4U0G H;  3IAV A;  1Q52 A;  1EF9 A;  5DZK H;  3V5E A;  3P5M A;  1XNY A;  1DUB A;  5CTC A;  2J5G A;  4U18 A;  3FDU A;  2EJ5 A;  1HZD A;  3QK8 A;  5DU4 A;  5E0N X;  3KQF A;  1PJH A;  4WZ8 B;  2BZR A;  5FUS A;  4FB8 A;  4MI2 A;  4ZU2 A;  3FF6 A;  4JSB A;  3H02 A;  2Q35 A;  3ZWC A;  3T88 A;  4OMR A;  3Q1T A;  4JVT A;  4K2N A;  4FZW A;  3KTJ A;  4ELW A;  1EF8 A;  4IZC A;  3TZ3 A;  1FC7 A;  2ZL3 A;  1J7X A;  4HNK A;  3ST9 A;  4DI1 A;  3IBB A;  3KTH A;  4ZDB A;  3OT6 A;  3R6H A;  4LK5 A;  4NEK A;  1OD2 A;  4U0G A;  4ZDF A;  3TLF A;  4JYJ A;  4L6W A;  1FCF A;  2ZL4 A;  5DZK A;  3KTK A;  4ZDC A;  2A7S A;  4JFC A;  4JYL A;  4WYO B;  4I52 A;  4KD6 A;  3TVU A;  3MYB A;  4JWV A;  3QRE A;  4K3W A;  3P85 A;  5KDR A;  4EMP A;  3R9S A;  2VSS A;  5DTW A;  4B3I A;  1NZY A;  3TRR A;  4FND A;  4FNB A;  3PGQ A;  1JXZ A;  2ZL2 A;  5INF A;  2VSU E;  4G2R A;  1O8U A;  1OD4 A;  4HC8 A;  2A7K A;  3GLM A;  4Q0G A;  4KWB A;  5DL1 A;  5KDR B;  3DOR A;  3H0U A;  3QYR A;  1ON9 A;  3LAO A;  3QXI A;  3N6R B;  1N6F A;  4MXI A;  3TDC A;  5C9G A;  3QWD A;  3OC7 A;  3GKB A;  5ING A;  2VSU A;  3T3W A;  2F6Q A;  3TT7 A;  3VIV A;  3ZW8 A;  4IZB A;  3QXZ A;  2J5I A;  3M6N A;  3QMJ A;  2FBM A;  3MFM A;  5DU8 A;  4QIJ A;  3IB9 A;  2VSU F;  4Z0M A;  1UYS A;  2ZQR A;  1NZY B;  1WDL A;  3MOY A;  3RST A;  5KJP A;  2F6I A;  5G1R A;  2PG8 A;  3NJB A;  4IZD A;  1FC6 A;  1N6D A;  1UYR A;  5E0S H;  4FJW D;  2DEO A;  1PIX A;  2FZS A;  3HRX A;  4JCR A;  3R9Q A;  1SZO A;  1WDK A;  3K50 A;  3WG5 A;  1DCI A;  3HE2 A;  3PEA A;  2VSS F;  2VRE A;  2PBP A;  1UYV A;  1ON3 A;  3K8X A;  2Q34 A;  3TV5 A;  2VSS E;  4YLH A;  3P2L A;  4KPK A;  3BPP A;  4ELS A;  2J5I I;  5G1S A;  1HNU A;  2DUB A;  1UYT A;  5DTP A;  4JCS A;  3HIN A;  5DUC A;  2X58 A;  3U9S B;  5C90 A;  3BEZ A;  3PE8 A;  2F9I A;  2HW5 A;  4NNQ A;  4GHN A;  3DJA A;  3L3S A;  3RRV A;  1Q51 A;  1RJM A;  3LKE A;  3KTG A;  4RYF A;  5INI A;  5G1Q A;  3ZW9 A;  1Y7O A;  2F9I B;  4U19 A;  3ZWA A;  3Q7H A;  1W2X A;  1RJN A;  2IEX A;  1N6E A;  2QQ3 A;  3M6M A;  4ELX A;  1TG6 A;  4JCQ A;  4FZW C;  3HP0 A;  4ZDE A;  1FC9 A;  4B3H A;  1SG4 A;  3H81 A;  3NJD A;  4QFE A;  2VSU C;  2D3T A;  4ASI A;  2J5I B;  5DU6 A;  2ZL0 A;  4JCT A;  3GF3 A;  1XNW A;  2F9Y B;  4EML A;  2FW2 A;  5FIF A;  3I47 A;  3MT6 A; 
#chains in the Genus database with same CATH topology
 1HNO A;  4U0H A;  1K39 A;  2GTR A;  3PZK A;  5DUF A;  4FN8 A;  3GMA A;  4L8K A;  2A81 A;  3T89 A;  3RSI A;  5MGB A;  3TVW A;  4J2U A;  4Q1I A;  3G64 A;  4RYF H;  5JBX A;  5IKL B;  1VRG A;  4GM2 A;  3SLL A;  3RQE A;  2J5S A;  1XX4 A;  1MJ3 A;  3Q0J A;  1EY3 A;  3Q0G A;  4OG1 A;  1YG6 A;  3H0S A;  1K32 A;  1YG8 A;  4WCZ A;  2UZF A;  3R9T A;  3U9T B;  2CE3 A;  3QKA A;  4B3J A;  2W3P A;  3H0J A;  3R0O A;  1WZ8 A;  2WTB A;  1TYF A;  3SWX A;  1XNV A;  5DKP A;  4I42 A;  4I4Z A;  1X0U A;  2VX2 A;  3ISA A;  3OME A;  2Q2X A;  2NP9 A;  3KTI A;  1UIY A;  5E0S A;  4KNP A;  3TT6 A;  3ADC A;  1XO6 A;  3STA A;  3GF7 A;  4EMM A;  4F47 A;  3T8B A;  4ZDD A;  2CBY A;  3H0Q A;  3V5I A;  2F9Y A;  3BF0 A;  2C8T A;  4MOU A;  2J5G D;  4OLQ A;  2X24 A;  2PPY A;  5CTB A;  4JOT A;  5JBW A;  3HLN 1;  3U9R B;  3JU1 A;  1WDM A;  4JJT A;  2ZQQ A;  4RCN A;  4K29 A;  3RQF A;  3ZWB A;  4U1A A;  3AM1 A;  4QII A;  3T8A A;  4FN7 A;  4U0G H;  3IAV A;  1Q52 A;  1EF9 A;  5DZK H;  3V5E A;  3P5M A;  1XNY A;  1DUB A;  3RQG A;  2YJG A;  5CTC A;  2J5G A;  4U18 A;  3FDU A;  2EJ5 A;  1HZD A;  3QK8 A;  5DU4 A;  5E0N X;  3KQF A;  1PJH A;  4WZ8 B;  2BZR A;  5FUS A;  4FB8 A;  4MI2 A;  4ZU2 A;  3FF6 A;  4JSB A;  3H02 A;  2Q35 A;  3ZWC A;  4GEH B;  3T88 A;  3ADD A;  4OMR A;  3Q1T A;  4JVT A;  4K2N A;  5HUQ A;  4FZW A;  3KTJ A;  4ELW A;  1EF8 A;  4IZC A;  3TZ3 A;  1FC7 A;  2ZL3 A;  1J7X A;  4HNK A;  3ST9 A;  4DI1 A;  3IBB A;  3KTH A;  4ZDB A;  3OT6 A;  3R6H A;  4LK5 A;  4NEK A;  1OD2 A;  4U0G A;  4ZDF A;  3TLF A;  4JYJ A;  4L6W A;  3W8H B;  1FCF A;  2ZL4 A;  5DZK A;  3IRB A;  3KTK A;  4ZDC A;  2A7S A;  4JFC A;  3A4L A;  4JYL A;  4WYO B;  4I52 A;  4KD6 A;  3TVU A;  3MYB A;  4JWV A;  3QRE A;  4K3W A;  3P85 A;  4HDT A;  5KDR A;  4EMP A;  3R9S A;  2VSS A;  5DTW A;  4B3I A;  1UX4 A;  1NZY A;  3TRR A;  4FND A;  4FNB A;  3PGQ A;  1JXZ A;  2ZL2 A;  5INF A;  2VSU E;  4G2R A;  1O8U A;  1OD4 A;  4HC8 A;  2A7K A;  3GLM A;  4Q0G A;  4KWB A;  5DL1 A;  3A4M A;  5KDR B;  3DOR A;  3H0U A;  3QYR A;  1ON9 A;  3LAO A;  3W8I B;  3QXI A;  3N6R B;  1N6F A;  4MXI A;  3TDC A;  5C9G A;  3QWD A;  3AJM A;  3OC7 A;  3GKB A;  5ING A;  2VSU A;  3T3W A;  2F6Q A;  3TT7 A;  3VIV A;  3ADB A;  3ZW8 A;  4IZB A;  3QXZ A;  2J5I A;  3M6N A;  3QMJ A;  2FBM A;  3MFM A;  5DU8 A;  4QIJ A;  3IB9 A;  2VSU F;  4Z0M A;  1UYS A;  2ZQR A;  1NZY B;  1WDL A;  3MOY A;  3RST A;  3L8J A;  5KJP A;  2F6I A;  5G1R A;  2PG8 A;  3NJB A;  4IZD A;  1FC6 A;  1N6D A;  1UYR A;  5E0S H;  3BPT A;  3A4N A;  4FJW D;  2DEO A;  1PIX A;  2FZS A;  3HRX A;  4JCR A;  3R9Q A;  1SZO A;  1WDK A;  3K50 A;  4NAR A;  2P63 A;  3WG5 A;  1DCI A;  3HE2 A;  3PEA A;  2VSS F;  2VRE A;  2PBP A;  1UYV A;  1ON3 A;  3K8X A;  2Q34 A;  3TV5 A;  2VSS E;  4YLH A;  3P2L A;  4KPK A;  3BPP A;  4ELS A;  2J5I I;  5G1S A;  1HNU A;  2DUB A;  1UYT A;  5DTP A;  1UX5 A;  4JCS A;  3HIN A;  5DUC A;  1Y64 B;  2X58 A;  3U9S B;  5C90 A;  3BEZ A;  3PE8 A;  3L8I A;  2F9I A;  3O4X E;  2HW5 A;  4NNQ A;  4GHN A;  3DJA A;  3L3S A;  3RRV A;  1Q51 A;  1RJM A;  3LKE A;  3KTG A;  4RYF A;  5INI A;  5G1Q A;  3ZW9 A;  1Y7O A;  2F9I B;  4U19 A;  3Q7H A;  3ZWA A;  1W2X A;  1RJN A;  2IEX A;  1N6E A;  2QQ3 A;  3M6M A;  4ELX A;  1TG6 A;  4JCQ A;  4FZW C;  3HP0 A;  4ZDE A;  1FC9 A;  4B3H A;  1SG4 A;  3H81 A;  3NJD A;  4QFE A;  2VSU C;  2D3T A;  4ASI A;  2J5I B;  5DU6 A;  2ZL0 A;  4JCT A;  3GF3 A;  1XNW A;  2F9Y B;  4EML A;  2FW2 A;  5FIF A;  3I47 A;  3MT6 A; 
#chains in the Genus database with same CATH homology
 1HNO A;  4U0H A;  1K39 A;  2GTR A;  3PZK A;  5DUF A;  4FN8 A;  3GMA A;  4L8K A;  2A81 A;  3T89 A;  3RSI A;  5MGB A;  3TVW A;  4J2U A;  4Q1I A;  3G64 A;  4RYF H;  5JBX A;  5IKL B;  1VRG A;  4GM2 A;  3SLL A;  2J5S A;  1XX4 A;  1MJ3 A;  3Q0J A;  1EY3 A;  3Q0G A;  4OG1 A;  1YG6 A;  3H0S A;  1K32 A;  1YG8 A;  4WCZ A;  2UZF A;  3R9T A;  3U9T B;  2CE3 A;  3QKA A;  4B3J A;  2W3P A;  3H0J A;  3R0O A;  1WZ8 A;  2WTB A;  1TYF A;  3SWX A;  1XNV A;  5DKP A;  4I42 A;  4I4Z A;  1X0U A;  2VX2 A;  3ISA A;  3OME A;  2Q2X A;  2NP9 A;  3KTI A;  1UIY A;  5E0S A;  4KNP A;  3TT6 A;  1XO6 A;  3STA A;  3GF7 A;  4EMM A;  4F47 A;  3T8B A;  4ZDD A;  2CBY A;  3H0Q A;  3V5I A;  2F9Y A;  3BF0 A;  2C8T A;  4MOU A;  2J5G D;  4OLQ A;  2X24 A;  2PPY A;  5CTB A;  4JOT A;  5JBW A;  3HLN 1;  3U9R B;  3JU1 A;  1WDM A;  4JJT A;  2ZQQ A;  4RCN A;  4K29 A;  3ZWB A;  4U1A A;  4QII A;  3T8A A;  4FN7 A;  4U0G H;  3IAV A;  1Q52 A;  1EF9 A;  5DZK H;  3V5E A;  3P5M A;  1XNY A;  1DUB A;  2YJG A;  5CTC A;  2J5G A;  4U18 A;  3FDU A;  2EJ5 A;  1HZD A;  3QK8 A;  5DU4 A;  5E0N X;  3KQF A;  1PJH A;  4WZ8 B;  2BZR A;  5FUS A;  4FB8 A;  4MI2 A;  4ZU2 A;  3FF6 A;  4JSB A;  3H02 A;  2Q35 A;  3ZWC A;  3T88 A;  4OMR A;  3Q1T A;  4JVT A;  4K2N A;  5HUQ A;  4FZW A;  3KTJ A;  4ELW A;  1EF8 A;  4IZC A;  3TZ3 A;  1FC7 A;  2ZL3 A;  1J7X A;  4HNK A;  3ST9 A;  4DI1 A;  3IBB A;  3KTH A;  4ZDB A;  3OT6 A;  3R6H A;  4LK5 A;  4NEK A;  1OD2 A;  4U0G A;  4ZDF A;  3TLF A;  4JYJ A;  4L6W A;  1FCF A;  2ZL4 A;  5DZK A;  3KTK A;  4ZDC A;  2A7S A;  4JFC A;  4JYL A;  4WYO B;  4I52 A;  4KD6 A;  3TVU A;  3MYB A;  4JWV A;  3QRE A;  4K3W A;  3P85 A;  4HDT A;  5KDR A;  4EMP A;  3R9S A;  2VSS A;  5DTW A;  4B3I A;  1NZY A;  3TRR A;  4FND A;  4FNB A;  3PGQ A;  1JXZ A;  2ZL2 A;  5INF A;  2VSU E;  4G2R A;  1O8U A;  1OD4 A;  4HC8 A;  2A7K A;  3GLM A;  4Q0G A;  4KWB A;  5DL1 A;  5KDR B;  3DOR A;  3H0U A;  3QYR A;  1ON9 A;  3LAO A;  3QXI A;  3N6R B;  1N6F A;  4MXI A;  3TDC A;  5C9G A;  3QWD A;  3OC7 A;  3GKB A;  5ING A;  2VSU A;  3T3W A;  2F6Q A;  3TT7 A;  3VIV A;  3ZW8 A;  4IZB A;  3QXZ A;  2J5I A;  3M6N A;  3QMJ A;  2FBM A;  3MFM A;  5DU8 A;  4QIJ A;  3IB9 A;  2VSU F;  4Z0M A;  1UYS A;  2ZQR A;  1NZY B;  1WDL A;  3MOY A;  3RST A;  5KJP A;  2F6I A;  5G1R A;  2PG8 A;  3NJB A;  4IZD A;  1FC6 A;  1N6D A;  1UYR A;  5E0S H;  3BPT A;  4FJW D;  2DEO A;  1PIX A;  2FZS A;  3HRX A;  4JCR A;  3R9Q A;  1SZO A;  1WDK A;  3K50 A;  4NAR A;  3WG5 A;  1DCI A;  3HE2 A;  3PEA A;  2VSS F;  2VRE A;  2PBP A;  1UYV A;  1ON3 A;  3K8X A;  2Q34 A;  3TV5 A;  2VSS E;  4YLH A;  3P2L A;  4KPK A;  3BPP A;  4ELS A;  2J5I I;  5G1S A;  1HNU A;  2DUB A;  1UYT A;  5DTP A;  4JCS A;  3HIN A;  5DUC A;  2X58 A;  3U9S B;  5C90 A;  3BEZ A;  3PE8 A;  2F9I A;  2HW5 A;  4NNQ A;  4GHN A;  3DJA A;  3L3S A;  3RRV A;  1Q51 A;  1RJM A;  3LKE A;  3KTG A;  4RYF A;  5INI A;  5G1Q A;  3ZW9 A;  1Y7O A;  2F9I B;  4U19 A;  3ZWA A;  3Q7H A;  1W2X A;  1RJN A;  2IEX A;  1N6E A;  2QQ3 A;  3M6M A;  4ELX A;  1TG6 A;  4JCQ A;  4FZW C;  3HP0 A;  4ZDE A;  1FC9 A;  4B3H A;  1SG4 A;  3H81 A;  3NJD A;  4QFE A;  2VSU C;  2D3T A;  4ASI A;  2J5I B;  5DU6 A;  2ZL0 A;  4JCT A;  3GF3 A;  1XNW A;  2F9Y B;  4EML A;  2FW2 A;  5FIF A;  3I47 A;  3MT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...