2HWD2

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
253
structure length
253
Chain Sequence
DRIMQITRGDSTISSDDVANAVVGYGVWPHYLTPQDATAINKPTQPDTSSNRFYTLESKHWNGSSKGWWWKLPDALKDMGIFGENMYYHFLGRSGYTVHVQCNASKFHQGTLLVAMIPEHQLASAKHGSVTAGYKLTHPGEAGRDVSQERDASLRQPSDDSWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMLRHNNWCLVIIPISPLRSETTSSNIVPITVSISPMCAEFSGARAKNIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 1a
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 1A COAT PROTEIN (SUBUNIT VP1)
total genus 43
structure length 253
sequence length 253
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwd200
4IV1B 2MEV3 2TBVA 4CDWC 1AL21 1F2NA 3TN91 1PO13 2VQ0A 2DF7A 1POV1 4CDUC 1PIV1 2PLV2 4RHV3 5ABJC 1VBB1 3JBG3 1QQP2 1NCQA 5BNPC 5BNNB 1TMF3 1AL0G 2WS92 4RR3C 1AYM3 1RUJ2 1POV0 1RUD2 1ZBE1 1VBD1 4SBVA 1QJU2 1HQNA 1AR92 1VBE2 1RMU2 3VBRC 1EAH3 2BFUS 1X36A 4YVSB 1NA1C 1VAKA 3TN92 1BEV3 4CDXC 4CEYB 1V9U3 4JGZB 1HXS1 4N43A 1PIV2 1IHMA 1MEC3 1D4M3 5A33A 1QJZA 2R041 2FZ2A 4GH4C 4YVWB 2R073 3DPRB 1VBD2 3ZFFB 1VRH2 2RM22 1RUF2 5JZGA 3CJIB 1RUF1 5DDJ2 2HWB1 1B35C 2HWC1 5BNOB 4IV3B 4Z92B 2RMU3 1VBB2 2IZWA 2FZ1A 1ND2B 4RQPC 1C8M2 4Q4W1 4Q4V1 1NA1B 1FMD3 5ACA3 4CEYC 1RUJ3 1TME2 2R042 1BBT3 1M06G 1DDLA 2RS33 4CDQA 1RUG2 1AR91 1PVC3 1VBE1 1K5MC 1EV11 1ZBA1 4RS5C 4CDWB 1AR82 5L7OA 4Q4X2 5D8AC 5CFCC 1RUC2 1VB4A 1EV13 2ZTNA 4BCUA 3CJIC 2HWC2 1NY71 5CFDB 3LOBA 1HRI3 2XPJA 1B35B 4N53C 4NWWA 3ZFGA 4IV3C 1H8TA 1R1A2 1PO12 1RUG1 4Q4V3 2PLV3 3VBSC 3VDDB 1FPN3 3ZFEA 5LK7B 5J98B 5DDJ3 4CEYA 4QPGA 2WFF3 5FOJB 1F8VA 3J8F2 5C9AA 3JB4C 1FOD2 2XBO2 1MQTC 4JGZC 4RFT0 3VBOA 4LLFA 5C9AB 1RVF1 1VB2A 2RR13 2RS12 1AUYA 1Z7S3 2HWF2 2WS91 1NCRC 2X5IA 1V9U2 5AC91 1RHI3 1AYN2 1VBA1 2HWD3 1RUE1 1RUI3 2R063 3JD73 4PDWA 5C4WA 5CFDA 1RUI1 2R061 4CDXA 1RUE3 1VBD3 5C8CC 4GB33 1H8TB 1TMF1 3ZFGB 2RS52 3VBFC 1RUD1 1ZBE2 1RVF3 4FSJA 1VBB3 4RHV1 1PIV3 1OOPB 1AYN1 3VBUA 1RUC1 5AC92 4AEDB 1ASJ3 4EJRA 2WFF1 4Q4X1 2R072 2MEV1 1FPN1 4RR3A 4AEDA 1COV2 5BNNC 1R093 4PDWC 5C4WC 3NAPC 4Q4Y2 1HRV2 2WZR2 1RUH3 1NA1A 3ZFFA 4Q4W2 1C8M1 3IDEA 4YVWA 1HXS2 2GSYA 5BNOA 4FTSA 3VBFB 2BPA2 1CD3G 1RUD3 1ZBA3 1QJU1 1AR62 1QJY1 4YVSA 4GB32 1TME3 1SMVA 2MEV2 1GFF2 1QQP3 2WLPA 1RB8G 1OOPA 3S6PA 2BBVA 2HWD1 1VBA3 2Y26A 2RMU1 1RHI1 2HWB3 4RR3B 4GMP0 1RMU1 4CDQC 1AR72 1R083 1VBC3 1R092 1R081 1RMU3 4CDXB 3JD72 2R043 1D4M2 1D4M1 4JGYB 2HWE2 1NCQC 5DDJ1 2PLV1 4JGYA 4AEDC 2RR12 5CFDC 2RS13 3ZFFC 1AL22 3ZFEC 1HRI1 1HRI2 3VBHC 5L7OB 4PDWB 5C4WB 1BMV2 1QJU3 3VBOB 1RUI2 2R062 4CDQB 1PGW2 4Q4V2 2X5IB 3FBMA 4FTEA 4GH4A 5BNPA 1C8M3 3JB8A 4QPIC 4IV1C 2QQPA 1RUJ1 1PO11 5JZGC 1RUH2 1NCRA 1RUH1 2RS53 1FMD1 2HWE1 1B35A 1R091 4CDUB 4RS5B 3NAPA 5C8CA 4QPGB 4Q4X3 2HWC3 3ZFEB 1ASJ1 1RUC3 1VRH3 1AYN3 2RM23 3VBFA 4CEWA 1NG0A 1Z7S2 1HRV1 2WZR1 1FMD2 5FMOL 1R1A1 1FPN2 5K0UB 2RMU2 5A32B 1PO22 3VDDC 1ND3A 1EAH2 4GB31 4QPIA 4QPIB 2WWSA 1E57A 1MEC1 1HXS3 1ND2A 4WM7B 5K0UA 1MQTB 1BEV1 4NWVA 3JD71 1EAH1 1AR81 4JGYC 1EV12 5BNNA 1NCQB 1PVC2 4CEWB 5AC93 1AR83 1AYM1 1HX6A 3VBSA 2WS93 1Z7S1 3DPRA 3NAPB 2HWF3 2RR11 4RS5A 4CDUA 5BNOC 1RHI2 3J8F1 5A33B 4Q4Y3 2GH8A 3JBG1 1BEV2 3VBOC 4IV1A 3CJIA 1COV1 3TN93 3VBRB 4N53A 2RS32 4YVSC 2RM21 2WFF2 1VRH1 1RUG3 4WM8B 1AR71 3ZXAC 1WCDJ 3JBG2 5CFCB 5GKAC 1OOPC 2HWE3 4N43C 3DPRC 2RS51 1CJDA 4WM8A 1AR93 1PVC1 1VBE3 2RS31 3VBSB 3VDDA 1BBT1 1C8NA 1AR61 1NY72 1FOD3 2XBO3 4RQPB 1QJX1 1VBC2 5ACA2 1QJX2 5ACA1 4RHV2 5FMOS 4Q4W3 2BUKA 2HWB2 1BBT2 1PGW1 1PO21 4WM7A 1QJY2 2RS11 3VBHA 1NOVA 1K5MB 1RVF2 2BFUL 5A32A 4CDWA 1RUF3 5D8AB 5ABJB 4CEWC 1COV3 1ASJ2 1A6CA 2R071 2HWD2 5ABJA 5L7OC 1PGL2 2ZZQA 1RUE2 1K5MA 4N53B 4Y5Z0 4Q4Y1 3VBUC 3J8F3 1MEC2 1ND3B 1OHFA 1VBC1 3M8LA 5C8CB 2HWF1 1W39A 1V9U1 4IV3A 1H8TC 3ZFGC 1PO23 5JZGB 1ZBE3 4FTBA 1QQP1 4WM8C 1ZBA2 4GH4B 1QJX3 4YVWC 2XBO1 1FOD1 5C9AC 1AR63 1BMV1 4QPGC 1TMF2 1TME1 1AYM2 1OPOA 1QJY3 4N43B 1VBA2 1MQTA 1X33A 1NCRB 2ZAHA 4Y4YA 1POV3 5D8AA 5J96B 1R1A3 4JGZA 5CFCA 3VBUB 1AL23 1HRV3 2WZR3 3VBHB 1ND3C 5BNPB 1ND2C 5K0UC 3HAGA 2X5IC 4GMP3 4GMP1 3VBRA 1PGL1 4RQPA 1AR73 1R082 4WM7C
chains in the Genus database with same CATH superfamily
5CKQA 4YW4A 3UJQA 5A3TA 1W2TA 2TBVA 3NJYA 1JZ8A 3I3EA 4NHYA 2ZX2A 1DIWA 3CMGA 5AFBA 4QDRA 4RSUA 1QDOA 3M70A 1POV1 4KBBA 4CDUC 4EN0A 1FT9A 3NKGA 2UY8A 3PDQA 1QQP2 3KV5A 3KHBA 1UOGA 3JCIA 4B29A 1GBGA 1UU5A 3AZVA 1PX4A 4XCBA 1F5FA 4MXWA 3FLPA 4TLGA 3WUDA 1K5JA 5JIAA 1AYM3 4DXZA 5JSPA 3MIHA 4HANA 3VB9A 1UWWA 4OZXA 3T0AA 2MHFA 4A6SA 1S0IA 1X36A 3FC0A 1NA1C 4W65A 4XFGA 4BISA 4Y5SA 1BEV3 4LK7A 3QH7A 5F5IA 4CDXC 1V9U3 4JGZB 1IG3A 3T30A 2R49A 1GWKA 4FAHA 5KHIA 3BPSA 1KD7A 4JAAA 1YFWA 3O5SA 1QJZA 2R041 2WNOA 2ZGLA 4PCRA 5FZMA 2Q4SA 5FYSA 2KD7A 1REFA 4GH4C 1MZEA 1TEIA 4COYA 5IVCA 5J7MA 2Z69A 1GWMA 5C3PA 3PVBB 1VRH2 1H8VA 2VMDA 1FYUA 1X82A 2RM22 3P3PA 3P6BA 4CU6A 5JOZA 4PI2A 1ST8A 2DBIA 1WD4A 2VQAA 1ULDA 2IZWA 2YFUA 3UK9A 2FZ1A 1C1FA 2AUYA 1S2KA 4AHXA 2I2SA 3CDZB 4NE9A 1NA1B 1YWKA 3VD7A 3R4DB 5JWPA 2ZKNA 1ZRFA 3PVNA 1IQAA 4UFIA 3V0BA 4RGKA 5F2SA 3T1LA 3WP3A 1N1SA 1YJKA 3ITQA 2CNAA 1M06G 2BU9A 3UL2A 3VN4A 4C0HA 3GZUC 3UJOA 1VBE1 5EHDA 2GNMA 1DGLA 2OUJA 3C7EA 1ACCA 4RS5C 4HSJA 1OLMA 4OHVA 4COVA 2XJPA 2JICA 4XJ8A 1C5HA 4AF9A 5FZHA 1UMIA 2GNDA 5FZIA 5HXMA 3BOWA 4Q0VA 5FCCA 5FYUA 4KU7A 1OA3A 1UQXA 1W8HA 2GDFA 2G9FA 3LOBA 3PUHA 2VUCA 1CONA 2NPIA 2VCCA 3NV1A 3OOXA 4GWJA 4MLOA 4N53C 5T5LA 3VDCA 1S2EA 1GP6A 1RUG1 3KT1A 3IBMA 2ZGOA 5J98B 3DKWA 5IFTA 4QPGA 3INAA 3CU7A 4SLIA 4E8DA 2OQ7A 3ILFA 1UY2A 3POWA 3JB4C 2W68A 4UF0A 4AVCA 1UY0A 3PVOA 1YRZA 1MQTC 4XFHA 4A42A 4BDVB 2VU9A 5I93A 1VLNA 2AR6A 4YNIA 3SQOA 1O4ZA 4LLFA 2ZKLA 3KSCA 4M3CB 1W8TA 4QX7A 3WG2A 2ZABA 1ZRCA 2BRTA 3WHTA 4QWNA 4JKKA 1QH6A 4MXWB 1LULA 4LHLA 2EALA 1XNKA 2F4LA 1NCRC 3ACGA 2ORZA 2O0OA 5A7SA 3GDBA 2A6XA 5FZ1A 2ZX0A 2HWD3 3RDIA 4M4PA 1RUE1 2XLGA 1Z0HA 3B5LB 4M3CE 2XR4A 1V6MA 3ZSMA 4PDWA 4LA2A 5CFDA 1NLRA 2ES3A 5FPLA 4DS0A 5KXEA 4XMIA 1RUI1 2R061 4O61A 3WF0A 2V09A 1O3RA 1T6BX 3FLTA 4AZZA 2C6SA 1UYZA 1MS5A 5GLUA 1WW5A 2XLFA 4GB33 4M00A 3NV2A 4PF5A 4KMQA 3SITA 4NHLA 1ZBE2 1FNYA 2BVBA 4LR4A 1CIYA 1ZYBA 2BJSA 1CZTA 1FNZA 1QF3A 4R4ZA 1VE0A 1CWPA 3LGRA 4X8NA 4YM3A 2DVBA 4IEUA 4KI5M 3JZVA 4RHV1 4AOCA 3FFZA 1AYN1 4XURA 5CA6A 1RUC1 4LKDA 1NXMA 4AEDB 2QZ3A 3V56A 4EJRA 5FZ6A 1BCXA 1SDWA 2IXCA 1IGOA 2WA3A 3I3BA 2R072 2AREA 4ISRA 3KS7A 3OF1A 4UW5A 5DUVA 1OF4A 3RRDA 3VGIA 1W05A 2OS2A 4CUAA 3RZGA 4PDWC 2YY1A 4ZXEA 4BK5A 5CAZA 3OGGA 3S0MA 1HRV2 1V6IA 3RWNA 2FMYA 1NA1A 3E97A 3ZFFA 4GJZA 4V1PA 1AXZA 2P6HA 2QVSB 3BU7A 1PMIA 5ANNA 5LEKA 4YLZA 4YVWA 5FQ0A 1OD3A 3ZSJA 1JOBA 2VM9A 5BNOA 1JHJA 2DTWA 5FRAA 3WW1A 4EN9B 1QOSA 4ATEA 3IAPA 4CZSA 3ETQA 4LJHA 5T5OA 2FCUA 3POFA 4QKFA 2JG9A 3MEPA 4YG0A 4CP1A 3ME2A 1W99A 3GJBA 4FPEA 2VZQA 5CBLA 3I3MA 1I5ZA 4DXTA 1GLHA 1WWYA 4GB32 1TME3 2WNUC 1LECA 3WEZA 1GFF2 1LOBA 2ZMLA 1UMHA 3CZJA 4YW3A 4I3GA 3SISA 2Q30A 3NVCA 4LUKA 3RMXA 3VD4A 1W9TA 2YU1A 2D7FA 5FPZA 4BIOA 1WLDA 1RB8G 1POQA 4QQHA 5HI0A 4HT1T 1MS4A 2BBVA 2ZGKA 2Y26A 2ZMKA 3LEGA 3DXTA 1QGLA 2D6OX 5BY5A 5FK7A 3K2OA 1PM4A 3RZJA 1YHFA 2WQZC 3CF6E 4LPLA 3WXPA 5FYBA 4N9HA 3BN6A 1RMU1 5DAQA 4QKDA 4CDQC 3O0WA 2W95A 1VBC3 4EYUA 2BQPA 3WDTA 1FI2A 1YI9A 1CX1A 1U5ZA 3H1WA 4NPMA 4XJ9A 1LCLA 1YQ5A 5FPAA 3NJVA 2H6BA 5CIRA 5F32A 4UFJA 1A78A 1VIWB 5FMCA 4HVRA 4XFFA 1D4M1 4ES9A 1LGNA 2QCSB 1QNWA 1IPSA 2CTVA 4LBOA 1SLLA 4HKWA 3O1PA 5D21A 4QX0A 5LBCA 1PK6B 4JGYA 4A3ZA 3ZX7A 3AMQA 3NNMA 2ZACA 4IGQA 1CX4A 1LOFA 4HKOA 5KWRA 1UOJA 1JI6A 2V5DA 1MVEA 2D6KA 1GZWA 4YW7A 4LE3A 4NO4A 4GWNA 4B4RA 2IC1A 4D3WA 1WLCA 1P8JA 3AMPA 2IVJA 3O1TA 3VZOA 3WP4A 4EWAA 1LHWA 1Y3TA 2XJSA 4I0WB 4K1ZA 4S2DA 5FMDA 1UZYA 4CDQB 4Q4V2 2HLEA 3C7FA 2PHRA 2OZ6A 2RE9A 3KF5A 5CG8A 3CNAA 3V0BB 3NKTA 4IEXA 1OKOA 4K8FA 1LAJA 2DURA 1C57A 3ZXEA 3AXDA 2V73A 4IV1C 4NJ4A 1PO11 1ENRA 5B2GB 3GGLA 5JZGC 4NHKA 1XE0A 3BKZA 2A5ZA 5FLJA 3NV4A 1FATA 1XE8A 2WKKA 2UU8A 1WMDA 5CZKA 4DRRA 3KT7A 3N7MA 1EY2A 4E8CA 1W9SA 2CAVA 5EJ1B 4OI2A 1GZCA 2WO7A 3FE5A 3POYA 4BK4A 4QPGB 2IXKA 2W0XA 4BQYA 1OMIA 4QB1A 2FDGA 2VY0A 1ASJ1 2OKXA 4XW3A 1FV2A 1ZA7A 2O8OA 4LKEA 2E6VA 5DZFA 1Z78A 3DYMA 1HRV1 1SCRA 4R9BA 5AVPA 1G8WA 3VZLA 5A7OA 3T2PA 4EV0A 3ZVXA 1FMD2 4MGSA 1FPN2 2E7QA 2QQNA 4CVUA 2RMU2 4E4DX 4FQZA 2UWAA 1LOGA 3URFA 1EAH2 3I7DA 4B1LA 4GB31 4GKYA 4DUVA 4NIHA 5EJZB 4QB6A 4NIAA 1ND2A 4WM7B 3A23A 1XYOA 4FP3A 1E5IA 1ULPA 5T55A 4NWVA 4COWA 1W6MB 2RJ2A 4CCOA 2D93A 1EV12 1ZA4A 2EIDA 2VR4A 1ZNPA 4QX2A 4XETA 5EYYA 5BNNA 1LB2A 3W59A 4KL1A 2IFRA 4CCKA 5FZDA 3E6CC 3MIBA 2PXJA 2ZGRA 3GYDA 3POIA 3J7LA 2EVXA 2VZVA 3H8UA 2AH2A 1WA4A 1G9CA 4ZXKA 5I8SA 2WZPP 3NAPB 3KVBA 5FBJA 2W52A 3FJSA 5F7UA 3H1YA 4CDUA 3I54A 2IFWA 3IKWA 5CNAA 4WVWA 1UX6A 2JE9A 4QX3A 4AR2A 4AE2A 4D8MA 3OGSA 2VNOA 1PM7A 3CJIA 3LEIA 4AI1A 1O5UA 1WBLA 2JB4A 3H42B 2BGPA 5DUXA 4N8MA 3E5UA 4MGKE 2DUOA 2VZ3A 1A8DA 3B9IA 3NWKA 4NROA 2BOJA 1K12A 2VE1A 4LK6A 5C6CA 1RUG3 3SMHA 4BMEA 1AR71 1L7LA 1PGSA 4NAMA 1KS5A 1WCDJ 1VMFA 1GZ9A 4A6OA 3ZXFA 3JBG2 5C3OA 4BB3A 5CFCB 1HB2A 4GZ9A 4AG4A 3LFIA 2DTYA 4AYUA 4N7UA 4XUNA 2CAUA 4K3UA 4YWAA 1TQ5A 1FX5A 1CAUB 1OD5A 5GZEA 4YPJA 5FP4A 5C5TA 3QACA 3ZYRA 4QQ2A 3FZ3A 4C91A 1OFSA 2CDOA 1LRHA 2R32A 4LBMA 4Y1UA 1AR93 5FZFA 2XVKA 5FZOB 2RS31 3H9AA 3TOJA 2JDAA 1IS3A 2KR2A 4K40A 4AVTA 1JYVA 1NY72 2WYSA 2XBO3 1QJX1 2EAAA 3W9AA 2X29A 2PN5A 5ACA1 2R0HA 1D7PM 1M4WA 1DQ6A 2BUKA 3AJZA 4MADA 3VDAA 5FWEA 5GJ6A 3AKTA 2YFZA 1PGW1 4ZPIA 4MGZE 2P2KA 4XQ4A 4EQVA 1QJY2 1SG3A 2EF6A 2X09A 5FKCA 2EXKA 3BB6A 4WVMB 1PX3A 4HONA 2BFUL 1LOFC 5A32A 1KJRA 3CHXA 2XJTA 4WVZA 4CEWC 1KS4A 4JX0A 1JTZX 2BV4A 1HB3A 3U78A 4JKLA 4KWKA 4UFMA 4XF3A 4LNVA 1A6CA 1OXCA 3K75B 2W2IA 4LORA 5ABJA 1DZRA 1VR3A 1WMXA 1LEMA 5FPBA 5DZGA 4P9XA 3MFAA 2PHDA 3MUZ1 4N53B 5H9RA 3AXEA 3ECQA 1CGPA 4MXVA 1YFXA 3ACFA 1SCSA 1L7QA 1OHFA 4H2AA 5C8CB 2HWF1 1HJGA 3WF1A 1IPJA 4IV3A 1H8TC 4P14A 3RZZA 1HN1A 5T54A 1CAVB 2WWUA 1DQ0A 3FN9A 3TAYA 5FZ4A 3GHMA 3WX5A 4FOVA 4RD7A 4EN8B 1CZVA 2KXLA 2W3JA 3ES1A 2YC0A 4LBQA 5GZDA 4FTBA 1VRBA 2ARXA 3USUB 1MZ5A 3LIGA 1LGCA 5G04L 1DG6A 4Y3OA 2V4VA 5ERLA 1I6XA 2CHHA 4WM8C 5DXDA 4GH4B 3AFGA 3GBGA 2OUHA 4Y5TA 5K4LA 5LASA 5EP9A 3LOIA 3ACLA 5DQ0A 1TMF2 2YUEA 1LTEA 1W06A 4KH9A 3RQ0A 1OPOA 1QJY3 3X29B 3TEZA 1VBA2 2ZAHA 1NCRB 1ZZ7A 4X8PA 4Y4YA 2EIBA 3BTAA 5A7WB 4XACA 1LOAA 5LY1A 4V2VA 4CTEA 5CVRA 3RPQA 5BNPB 4AEJA 1KJLA 1X7NA 4YGEA 1U5XA 3MIFA 1J1TA 5K0UC 3HAGA 3I2DA 1O59A 3FUQA 3BALA 4AGVA 4Y4RA 2X10A 2B9UA 1SZBA 1DF0A 1YEWA 2X5IC 4GMP3 1UXZA 4PQ9A 2W47A 3VBRA 5FP7A 3HNYM 3V64A 2K46A 4EWDA 5C3RA 3QH6A 4PJYA 5J1XA 1GUIA 2ENRA 4R9CA 4JZRA 1YQCA 3KF3A 5L73A 3ZXKA 1RUNA 2IUWA 3AK0A 3TN91 5AFEA 3KD4A 3B93A 1ULEA 3WNOA 2VVEA 1N3OA 1URXA 4PLNA 4XTPA 4YFWA 4AI8A 1PMJX 2DF7A 2ET1A 4FFIA 1DYKA 4MGIE 4AQ6A 3TEWA 4YZ1A 3PUSA 3THDA 1HQWA 2X53S 4URAA 3V0AA 1Q8SA 3JUUA 3SEPA 4B7KA 3ST7A 1NUKA 1S2BA 3RNSA 5BNPC 3K4ZA 5IW0A 1TMF3 1QEXA 1QOOA 3WNMA 4RR3C 2CGNA 4LQRA 3VKMA 2GMPA 1POV0 1RUD2 1ZZ6A 1QJU2 3M3EA 3MBWA 5FZ8A 4XZPA 5I0TA 3O0XA 1OH3A 3VBRC 4E2GA 2BVVA 2H6CA 4R52A 2BFUS 3U14A 5KHKA 4YVSB 2E26A 5FJKA 3FHIB 3J4UH 4CEYB 1S1AA 2PAMA 4DZGA 1GU3A 1HXS1 3Q8EA 4G4FA 1PIV2 1MEC3 5FZEA 1D4M3 1DZTA 1Q56A 1F35A 1SLBA 1OVPA 2ARBA 3KM5A 2FZ2A 3ZKYA 4P00B 4DQAA 4XZUG 2WINB 4HMZA 3EJKA 5LB6A 2IXIA 3H8OA 2CSGA 4A3XA 1NLSA 1TNFA 3ILNA 4XJZA 1BQPA 1SBEA 2ZEWA 3RI9A 1UZZA 3ZFFB 5FYVA 1HQLA 1A34A 4MH0E 5EYXA 5JXJA 1RUF2 2BNNA 5T3NA 5L9BA 2WNUA 5DDJ2 4RFRB 1ZVFA 3M3QA 2QKDA 2G4IA 4IV3B 1QKQA 2OPKA 2YB7A 3R0RA 2VCAA 3TNQA 5C33A 1TZOA 1S0JA 3K46A 4YYOA 4RQPC 1QXJA 2QQKA 4Q4W1 1FXZA 2QQLA 4XF0A 3WDWA 1QMJA 3VZMA 5FYTA 5ACA3 2VC9A 2YBSA 4CEYC 5ISLA 2DCYA 4ITCA 2JD4A 3UESA 4UAPA 4AHZA 1YI7A 4CCCA 1R64A 4E4HA 4BQ2A 3MLLA 2E7AA 3HPNA 2RV9A 5BUVA 3WW3A 4CDQA 4Q1RA 2PHLA 3UNPA 1PVC3 2ZJCA 2JENA 4KG8A 3VUOA 1EV11 4CDWB 5D8AC 2OX0A 4CPBD 5I8TA 4UFKA 2GNTA 1RUC2 2W39A 5FLHA 1IS4A 3ZYPA 2VECA 5E1RA 2HWC2 1XSQA 2W46A 4N9IA 1YCIA 1IZ3A 2D3SA 2ZGUA 1H9PA 4XJAA 3C8XA 3RJRA 4CCMA 2TEPA 4P9WA 3L9JT 4FPOB 4IV3C 1CPNA 1UZWA 2ZAAA 1H8TA 5BPXA 3P1IA 3MPBA 4OI4A 1KFXL 3A7QA 3EBRA 5GLTA 2PLV3 2P4EA 3VDDB 2XONA 5HV0A 1WMEA 3KCYA 5HCFA 5LK7B 5DDJ3 3HD8B 4CEYA 4K20A 4L0PA 4XDPA 1HV0A 2XB6C 2OA2A 2XBO2 4Q0PA 5FZGA 3PLQA 1ENSA 3T2TA 2WJSA 4MGQA 5A1FA 4D94A 3LAGA 3VBOA 5JSOA 1H6YA 3I3QA 4OUEA 4XFIA 5FXXA 4UF0B 5CYYA 4INDA 3B94A 3NJXA 4BOWA 2DDUA 1KXGA 2VUAA 2HEYF 5FJHA 5F3CA 4DINB 5JXIA 4YW1A 1QWRA 2WSUA 2XL7A 2WZ8A 4AFBA 1C3HA 4AI2A 1UYXA 4FO9A 4Q27A 2X5IA 2NMOA 1GP4A 1RHI3 2ERFA 3M3CA 2JE7A 3W5MA 4K21A 1KQRA 4UXAA 2CYFA 1RUI3 2R063 1AXYA 1W6NB 4W6XA 2G9ZA 3NV3A 2JG9B 3WY6A 2A6YA 4CDXA 1OA4A 4FAGA 4CU9A 2OPWA 2Z5WA 1X50A 3A0NA 3IIAA 1CIWA 5HPOA 4PHZA 4HLTA 5IVJA 2ZX3A 4YGBA 3BVCA 4D0QA 4CRQA 3ZFGB 1DGWX 3VHPA 3GM8A 4K6BA 3L2YA 5FIXA 3SKJE 5JIUA 3PIJA 1BZWA 2WUHA 2Y64A 4DPNA 3KV6A 2FDKA 4CP0A 1W2NA 2BOIA 4DIQA 4I01A 5FBZA 2Q5TA 5JPNB 1PK6C 4UW3A 5AC92 3JU9A 1ASJ3 1YNAA 1JYCA 3QOPA 2ZHLA 4GULA 5FY0A 3TB0A 2MEV1 4RR3A 4AEDA 4ISQA 5BNNC 1R093 3PHMA 2JG8A 3NAPC 3AYAA 4IL7A 5I0UA 1DU3D 4XIOA 1XOYA 3R05A 5L9RA 2WBKA 5FKBA 2SBAA 4JDOA 4EROA 1UIKA 2HEVF 1W8UA 2BYVE 3IDEA 2FD8A 3OEBA 1U5IA 4ORFA 5A3LA 1NX9A 4JQRA 4FTSA 2VMHA 2VOTA 1CAWB 1CD3G 1N3PA 4PQQA 1RUD3 5J09A 5FTTC 5DAXA 1ZBA3 2VVFA 5A7PA 3WSOA 4Q0QA 4TN7A 4QMAA 1QJU1 4QGLA 1AR62 2IXJA 2VZSA 2ZGQA 3OPWA 4YVSA 1SMVA 1W6NA 4PIXA 3ZOIA 3VHNA 2J42A 2E51A 3POSA 1F15A 2CWMA 2ZEZA 1JYTA 2CDPA 2I45A 4CCLA 4LKSA 2WLPA 4GKXA 4YFZA 4BA6A 1OOPA 3S6PA 5FWJA 3J7HA 3AL6A 1O3SA 1RHI1 4KGGA 3WG1A 2ID4A 5LA1A 3FUOA 3DUIA 1SLTA 1MR5A 2GH2A 1OA2A 3PMSA 2VTXJ 3E1F1 1R083 1UY3A 3HT1A 3IMNA 4MGYE 1R092 2JB8A 2ARCA 5FY7A 1LU2A 3IWZA 3VD9A 1G9AA 1GMMA 5A1LA 2DV9A 1C4RA 1ZZCA 1TE1B 1OF3A 3N9OA 1XRUA 4XQWA 5EWSA 3B02A 3OY8B 3OCPA 1DLLA 3DGTA 4XBQA 1JZ4A 2HWE2 5DDJ1 2BGCA 1KITA 4MVTA 4A45A 3IDAA 3THPA 4ZONA 1UOBA 5LZ6A 4O9EA 3OD4A 3RI8A 4FP2A 4LIVA 3CZUA 4LBJA 2WNEA 5CFDC 4GXLA 4OULA 1ULFA 4IEVA 4P9YA 2B8MA 3MI8A 3ZFEC 5LBBA 4D7SA 1WZXA 3WF2A 5A7WA 5C4WB 3RZHA 2VGDA 4NOTA 1AX2A 1A3KA 3WD5A 1GANA 3CIHA 1J59A 1I9RA 3WDXA 2DUQA 2B42B 3N36A 3TYJA 5L9VA 4J6GA 2W1QA 4GH4A 4YM1A 2E9QA 4Z2AA 1RTVA 2D6LX 2RDSA 2XH6A 2DWRA 2FDIA 3ZN6A 3GZAA 3POGA 3WG3A 2PHWA 2W94A 4QHZA 1DBNA 1QU0A 3BIEA 2ZGNA 1RUH2 3FL7A 3HBKA 1BJQA 2XJUA 5A80A 4FT8A 2MNGA 3OPZA 2HWE1 2EICA 1H9WA 1R091 2VMEA 1ZZ8A 1WW4A 4CDUB 4QKBA 1SEFA 1WBFA 1XC6A 2JEMA 3ALQA 4CE8A 1IS6A 3LIHA 1EUTA 4AFMA 3WDUA 1HB4A 2SLIA 2W1UA 2VZ1A 3PTRB 4ZS2A 4OI1A 3VZKA 3ZFEB 3FHAA 3ZYHA 1WCQA 4LUMA 1RUC3 5CKNA 1NXD1 1VRH3 2RM23 2Y0OA 2VG9A 1W9FA 1DLCA 1OVSA 2XGXA 2ZGTA 5LCWL 1OUSA 2B9VA 5BV6A 3AX4A 3ACIA 2BDRA 3UETA 2VMIA 2G19A 2ZX1A 3W21A 5FMOL 1GOGA 5GALA 4AHYA 1UX7A 5K0UB 5A32B 1PO22 4D6QA 3Q8AA 3K48A 1WCKA 1QJFA 1MPXA 4JQTA 2YGLA 4G3YC 1MEC1 2A6WA 3F2ZA 4MSVA 5LATA 5TSWA 3ZDVA 1N1TA 1GICA 2Q1MA 3FWEA 4CPBA 3OBZA 5K0UA 4I02A 2BP6A 5IYYA 3LPGA 3GNEA 2VD7A 2BBAA 3HEIA 3H1MA 1CPMA 4QU2A 3TEXA 2VOKA 3WT3A 4BHPA 4CEWB 4IEWA 2JDMA 3ZDSA 1HN0A 2QJVA 2YPDA 4E4SA 1H4HA 1KDMA 4BPZA 5LRSA 3R6SA 1Z7S1 4LITA 2LRPA 4JC1A 3UGFA 1UU4A 1Q8PA 5BXXA 3O1MA 1YLLA 4BQXA 1V6LA 1SBDA 4HFSA 2Y6KA 3OBAA 1W8FA 3MHZA 2YZ4A 1RHI2 4G9SB 3A22A 1LU1A 4DXRA 3IDCB 3FMGA 2AZ5A 3S5AA 2FBEA 4FPLA 1IKPA 3GALA 4DMIA 5FY5A 2X8KA 3ZN6B 3LDKA 2PFWA 1COV1 1WLTA 3I2GA 3TN93 3VBRB 4K9SA 4XE9A 3IDBB 2B7YA 2GZWA 4YVSC 3AP4A 2IWGB 4YW2A 2RM21 2HJIA 1LODA 1DQ4A 4LXLA 4WM8B 1Q5OA 3GZTB 4QD2A 2W5FA 1XB9A 1UZVA 5LW9A 4BJ0A 1J3QA 1N47A 5GKAC 3U1XA 1DFQA 1OOPC 1XU1A 2VTFA 5LBFA 3T4HB 1JYXA 3HNBM 4M3CA 3MW3A 1G6NA 1H30A 1J3RA 1J84A 1RITA 1CJDA 4I30A 4WM8A 3DKQA 3UKTA 1NT0A 3UT0A 5F1RA 1KFUL 4BXSV 1OQEA 1YYNA 1VBE3 2QFEA 3LZZA 3QCWA 2A3YA 3VDDA 4F3JA 1Y4WA 1VAMA 1O4TA 2UWCA 2YG0A 2ZEYA 2PTMA 3WINE 1AR61 4LBNA 4RQPB 3WNLA 1VBC2 2XLAA 2O14A 1QJX2 5CISA 1GKBA 5IWFA 3VKNA 2B5HA 2P17A 3RZLA 1BBT2 2R1BA 2VXJA 1W2UA 3GCWA 2Q8EA 4WM7A 3THTA 5JR7B 2WWJA 2QTWB 4XUPA 2VW0A 4UWDA 3O1VA 2LS6A 1NOVA 3QD6A 1ZRDA 1W0NA 2QQUA 1RJ8A 4CYDA 5A3UA 3FX3A 5D8AB 5J37A 4NPLA 3EHKA 1YFUA 3NJZA 1COV3 4CUCA 3D82A 4IE0A 2XJQA 1LOCA 3LFMA 1PNGA 3Q9OA 4AWDA 3UGHA 5HV4A 2HWD2 1DCSA 2VCBA 3D4KA 3VZNA 5IFPA 3BTXA 2Y38A 1PGL2 2NP0A 3GCXA 1RUE2 4FQ4A 3T2OA 3SEEA 5M0TA 4OFGA 4Q4Y1 3VBUC 1MEC2 2VVDA 4C90A 5HCBA 3USUA 4QXBA 2QBXA 1QXPA 2R0FA 3Q8BA 4ASKA 2UY9A 2ARAA 1BHGA 2ZOEB 4H7LA 2WAOA 3GJAA 4QXKA 3SCHA 3AP6A 1OFNA 4S2GA 1ZREA 4J25A 1AJOA 3ZYGA 4B7EA 1ZBE3 4JRAA 2VW1A 3VHRA 2JKXA 3HOBA 2C9KA 2VXRA 3H0OA 3WR0A 1QJX3 4HETA 1FOD1 1BMV1 2D98A 2AEYA 2JG8B 3ENRA 2PHUA 1OC1A 1IPKA 2ORXA 2GN3A 1NZIA 1D2QA 2Y60A 3I59B 3J26N 3N9MA 1OLME 4S2HA 1X33A 3L2HA 4PT6A 3K3OA 5DUUA 4AVBA 2XQRA 1R1A3 5D2AA 5I0SA 1BVP1 1BYHA 3H3ZA 4AQSA 5CFCA 5H9SA 3VBUB 4ASLA 2BW8A 1HRV3 3VBHB 1S0CA 4BYYA 4IERA 2ETEA 4P5HA 2ZCWA 2W91A 2BEOA 3GXUA 1UL9A 1VMHA 1DZQA 2RG4A 2YXSA 2PYTA 3AKPA 3MIEA 4LO5B 2A6ZA 4XUTA 4OHZA 4GMP1 2J7MA 5FZ0A 4H14A 4AVAA 1PGL1 2DCTA 4Z07A 3AP5A 3OYWB 4OHWA 4DEQA 3VV1A 4WVMA 1DGRA 3R4UA 1YO8A 3I2IA 3WV6A 3OPTA 1W6PA 4A41A 2Q8DA 4CDWC 1F2NA 2C26A 1W8NA 1AF9A 2DVFA 2IVIB 1GP5A 1WD3A 4XQDA 2J1VA 1UPSA 5FUNA 2PLV2 2YBKA 4CA9A 1NQJA 5E16A 2BWAA 1VBB1 3JBG3 5FZ9A 1E5RA 3LSEA 1JUHA 4UT5A 4O7XA 1KRIA 2TUNA 1V70A 2YPJA 4UFHA 3M2MA 4XFAA 5T50A 5J3UA 1NCQA 2EA7A 2RDRA 5FP9A 2E63A 3ZYFA 5BNNB 2W1SA 3KCXA 1LNSA 1U0AA 3PJYA 2F4PA 2Y6FA 5A7QA 1RUJ2 3AKSA 5T5JA 1ZBE1 2YROA 2Z42A 4ATFA 2HYKA 1VBD1 4KWJA 1SPPA 1AR92 1CAUA 3RG0A 1RMU2 1W9WA 1CZSA 1O5LA 1UD1A 4QDQA 5JUVA 2Y6JA 3D6EA 1LGBA 3KVAA 1YUDA 1UPIA 1V00A 3Q8FA 3KHCA 4QM8A 4UFLA 4AQTA 4DY3A 2XXZA 4R9DA 1SLAA 4AEKA 3HQRA 2JDUA 2XVLA 4TZDA 1IHMA 1PZ7A 1RXFA 3H3LA 5G05L 4UOJA 4AI9A 2BTVC 4YW5A 4YSFA 2W87A 1HLCA 3EYPA 2P1BA 4XTMA 4HN1A 4OYUA 4YVWB 3U37A 1BK0A 4CUBA 1JN2P 1J58A 3DPRB 4O65A 2YHJA 3C7HA 3PIGA 3ZXLA 1JU3A 3I2HA 4Q8LA 2C0ZA 5C71A 3CJIB 1RUF1 1BK1A 4ZU7A 1GOHA 2QDRA 2VH9A 1QDCA 1G9BA 5FO7B 2HWB1 1B35C 2Q8CA 3H50A 3JXSA 3ROUA 3TRSB 4W50A 5BNOB 4Z92B 2VBPA 3THCA 2B45X 5EV7A 4UW6A 1DQ5A 1FV3A 2P3JA 4Q4V1 5F39A 1O6UA 1FMD3 2O8QA 4FPGA 4BQ3A 4AVVA 3B01A 1O8PA 2XHNA 5JLVA 3BUCA 3UV9A 1HW5A 1U5YA 3NNLA 4MYEA 1RUJ3 1YIPA 2R042 2H0BA 4DEVA 3DXUA 2A71A 3IPVA 4HZFA 1D0HA 2D6MA 3WW4A 2UURA 3WDYA 1H1MA 1XPWA 1AR82 5T5PA 1XE7A 4Q4X2 3VHOA 5L7OA 1MS8A 4Q0UA 4ARYA 3S5QA 1EV13 4OQ9A 2ZTNA 2C4XA 2VW2A 4CXWA 3CJIC 4ZS3A 1GNYA 4D6SA 5JOYA 3WNPA 2VULA 5CFDB 2OZJA 1LKNA 3N4MA 5L36A 2WZEA 1HRI3 4YG6A 1B35B 3IT8A 4NWWA 3ZFGA 3KGZA 5JMCA 1PO12 2HEWF 2PHFA 2VQUA 1QY4A 2ZXQA 4IQPA 4E4ZA 3AZWA 3ACHA 1CAXA 3VBSC 5JOXA 1FPN3 1S0DA 1WUVA 3DL3A 3ZFEA 5L19A 2QQOA 2JDNA 2WFF3 3AZXA 3WP6A 5C9AA 2V4AA 1LHUA 1UZ0A 4XXAA 4B4PA 2OW4A 2LM3A 3CO2A 4I0AA 4HN0A 4RYDA 5DUWA 1OLRA 4Y22B 4MX3A 5F2WA 2Q1ZB 4XYXA 5C9AB 2JDYA 1RVF1 4RA0A 1XQNA 5IVFA 2A70A 4BXFA 2RR13 2RS12 4NVPA 5F5CA 5HBAA 2DFBA 3GHNA 4E9KA 3OUHA 4GWIA 4KG0A 3ZR5A 5A6XA 4FBFA 3T09A 1O3TA 2VNVA 3WQ7A 4LA3A 4OQ8A 5DPNA 3ABZA 1AYN2 2P37A 3LD8A 5GLVA 3KCCA 2JX9A 1JS9A 1UXXX 1SDDB 5C4WA 1JZ5A 3OY8A 4IUGA 2YMZA 5GLZA 1RUE3 4D6RA 3CLPA 5FY4A 4QXCA 1VBD3 1XNDA 1EUUA 3ZYJB 3ZN4A 3V65A 3ZMOA 3M7AA 3OGRA 5IK4A 3IPVB 2RS52 3WCRA 4Y33A 4HKLA 4YZ3A 1S0FA 3KV9A 5D1IA 1JBCA 1RVF3 2A3XA 4CCJA 4FSJA 1VBB3 1ALYA 2JIJA 2P3KA 4LMFA 1PIV3 4TLFA 4I0BA 1Y9QA 3RS6A 4QGNA 2AYHA 2W1WA 1GZTA 4Q4X1 3ETPA 1JODA 4UYBA 1EPZA 1FPN1 4TYSA 1JYNA 1Q8QA 1UCXA 2PHTA 5C4WC 2J1AA 2XVGA 1YC61 4D7YA 1DGRN 4Q4Y2 2WZR2 3ZR6A 1RUH3 2EXIA 4CU8A 3MV01 2XQXA 1MACA 5IK5A 3EO6A 1PZ8A 1CAWA 2J1EA 1HJFA 1HXS2 2GSYA 2XHKA 1ULGA 4YARA 2BPA2 1VAVA 4QU1A 4IEQA 3N9PA 5F6KA 3LB9A 1LESA 2RJLA 1YFYA 5CB7A 2XUEA 3WQ0A 2WIIB 5LK5A 4JVAA 3ELNA 4XBLA 4IESA 4NRMA 1QJY1 3LSDA 5FO9B 1NYWA 4YGDA 1FAYA 2D6NA 4Z8BA 3OUJA 1C1LA 4HVQA 3OBRA 4MOAA 2BGOA 2NLRA 1JH5A 5FPUA 2XG3A 1W3XA 1DP0A 3KZ4C 3NRUA 1ZZ9A 2VZPA 1QQP3 1H1IA 5FUPA 4U36A 5IUQA 3DCQA 3MICA 3VD5A 5FYZA 4XC9A 5C8WA 3RZMA 3PUQA 3I4IA 1VBA3 4QXHA 5FYYA 4DOUA 4QPYA 2DUPA 4QX8A 5FYIA 4N7IA 4BM8A 2JECA 3KGLA 4LO8A 3IMMA 2HWB3 3LKJA 3MO4A 3OBTA 1CQ9A 5LWBA 4LULA 2VBDA 2W08A 3SCFA 2QUOA 3BGAA 1AR72 2VZUA 5A6YA 3VKLA 1LEDA 5A6ZA 5JPMB 4QB2A 1R081 1G9FA 1XJAA 1RMU3 3U0ZA 4L92A 2A7AA 4CDXB 1GOFA 1UF2C 2YV8A 3JD72 3T3YA 2VZOA 5KXDA 2ZZJA 3OYWA 5DABA 3ZMNA 2TNFA 4OLLA 3BOPA 2DU0A 4L9BA 3LPFA 2PLV1 4HK8A 1S4CA 2ZEXA 2W9XA 3KV4A 1JW6A 3K77A 4Y1VA 1UYYA 4NHXA 2DCZA 2JE8A 4ARXA 4NHMA 5JOWA 2NYYA 4P08A 4XJWA 1H1AA 1HRI1 1OQ1A 4LKFA 4YZ2A 3QBQA 3AZZA 3T0BA 2QDNA 4CP9B 5I0RA 2K9ZA 4LBLA 2VMGA 1GQHA 4FOWA 5KXBA 1RINA 1V6NA 1RUI2 2A1XA 2R062 1PGW2 5FY9A 3SNMA 2X5IB 2EAKA 1GQGA 2KM2A 4LHSA 1K3IA 3U11A 2EIEA 4QDSA 5B4NA 2DU1A 4N90A 5FXVA 2WNVB 4HOOA 3VKOA 3WVJA 3JB8A 4QPIC 4WV8A 5F5QA 4LLOA 1IG0A 1RUJ1 4IE7A 5LA0A 2QQPA 3WZ1A 4BQ5A 2ZHKA 1NE6A 2VL4A 1W0PA 2DVDA 3HQXA 1RUH1 3ORJA 1MS3A 1JMUB 2NN8A 5C7GA 2ET7A 4YG3A 1F31A 4RS5B 3RSJA 1GV9A 2Y8KA 5F3GA 2WO1A 1G9DA 2JG8C 3NAPA 2AENA 4Q4X3 2A6VA 2B39A 1CAXB 1Y7BA 1BXHA 4A4AA 3LDBA 3S57A 2AC1A 4F7ZA 1NG0A 2F17A 3POEA 5F3EA 1GSLA 3ZYIB 2WZR1 5FQ0B 4DXSA 5FR3A 4LT5A 5FV3A 4C1XA 1W6OA 1ZZBA 2AGSA 2VZRA 2ZHMA 2K0GA 5EXOA 1STMA 3PU3A 3MZHA 1R1A1 4CXYA 2D5FA 3MV11 2WNVC 3S7EA 2C9AA 1TG7A 3N7JA 4QPIA 3OG2A 4QPIB 5IVYA 1E57A 1JZ2A 3R4SA 1OKQA 3MIDA 2YGMA 4M0HA 5C70A 5JDBA 5LEJA 5KC5A 3LWCA 5CKMA 2Y34A 5BNQA 4HG6B 1E5HA 3TNPB 1MQTB 2VMCA 4XHBA 1BEV1 4AI0A 3M1HA 2GMMA 3GZEA 1OH4A 1W6QA 1JUIA 3ILRA 3JD71 1AX1A 1B09A 3AVRA 1N1VA 1AR81 3KWVA 1X8EA 4JGYC 3USSA 2J1RA 1NCQB 1PVC2 2E33A 4XFCA 5JI9A 2WC2A 5JAXA 4BQ4A 4ZKTB 5AC93 1EYBA 3NNJA 1SACA 2WS93 5FXZA 2E31A 5FZOA 5IAVA 1SHWB 3DPRA 1SLCA 2KA3A 2RHPA 5IVVA 1IS5A 3RFRA 1H2LA 2VUJA 2DVAA 3DV8A 4UBGA 1R1ZA 1V6KA 4RS5A 2LUWA 5DMYA 3J8F1 5A33B 2XJRA 4BU2A 4Z82A 2JJ6A 3VBOC 3I49A 3EQEA 2Y6LA 3DN7A 3O7OA 4QQLA 2CL2A 3EXUA 4IETA 3K3NA 3CQOA 4LBQD 2RS32 4N53A 1XNAA 3W20A 4XDOA 4KWLA 4CXXA 3M4FA 2VAUA 4LIUA 4PBPA 4MHRA 4H55A 5EFUA 4Q1PA 1XU2A 3ZPOA 2ADDA 3GBWA 1DYPA 2WAAA 1C5IA 2ATFA 4IEZA 5KHJA 1TNRA 1U12A 1D4VB 5K7PA 1GWLA 5FXWA 3D0JA 2QQWA 1IOAA 1O8SA 2VO5A 2WSVA 2HWE3 1DQ2A 3B9CA 2VMFA 2Z4FA 1JYWA 3DPRC 5LA9A 4LBKA 4QAWA 1N3QA 3HR9A 1SPPB 2GC1A 3MW4A 4NAOA 4OUMA 5DAVA 5APAA 4OI0A 5FOBB 3PUIA 1S0EA 3MGUA 1ODMA 2EXHA 4H7MA 4A44A 4M01A 1PVC1 3BIWE 3JQWA 4FPCA 3B3QE 1L7RA 3SC7X 3AMMA 1BBT1 1C8NA 4S2FA 2VUDA 2W92A 3RZKA 4AAPA 4LBQB 4Y24A 1O4YA 2WFPA 4EZ4A 1FOD3 2RDNA 3DF0A 2FDFA 4QQPA 3OUIA 4AGGA 2XKPA 3HT2A 1JHNA 2IXHA 2ZHNA 3FBYA 3KLSA 5FMOS 5IJRA 2ILMA 4L8QA 4JV4A 2HWB2 2QQJA 4LOTA 4WBBA 4GQ7A 1PO21 1APNA 4B4QA 2DVGA 4RGAA 1QOTA 4COZA 1CN1A 5CADA 2RS11 1OPMA 2VOWA 4KNCA 5A3OA 1MZFA 3LCPA 3ZIWA 1OI6A 1UNBA 3SCGA 3AZYA 1W2AX 3MLJA 2E7TA 4B1MA 1RUOA 5JSRA 4NMIA 1S0GA 4GJYA 4ZU5A 5CG9A 2GC2A 3AP9A 2QQVA 1ASJ2 3T4VA 1WW6A 1OLQA 3KQ4B 4QHBA 3BYWA 1O91A 5L7OC 5FPXA 4IXLA 1SFNA 1NQDA 1K5MA 3C7GA 5FMBA 4AHWA 4XMAA 5F9TA 4IEOA 3AKRA 5F8PA 3J8F3 3MF6A 2WQ4A 3MIGA 1NAEA 1H2MA 4I3PA 3LEMA 1WLWA 3M8LA 4NIDA 1XNBA 1W39A 1V9U1 2CV6A 3HMYA 3HN1A 3I59A 3I3DA 3MUY1 5I8YA 4JHZA 1W28A 4XXPA 3RMYA 3ZFGC 3HIFA 1PHMA 3CBNA 2ZBJA 4P9JA 1RC6A 3RVHA 4HK9A 5I0DA 1JZ7A 1PO23 5K9YA 2HYXA 3PL0A 4X6QB 5F5AA 4GAZA 4AL9A 1GNHA 4XEZA 3KMHA 3ZSLA 3CKHA 1QQP1 4E2SA 3LQCA 2CGOA 3E5XA 4F8AA 1ZBA2 3PVEA 4YVWC 4NN0A 3FFQA 2QE3A 5E8AA 5C9AC 1AR63 2GALA 2CGPA 3ON7A 3AM2A 4C0BA 3E6BA 1TME1 1W6MA 5IAXA 4BIFA 4N43B 1REDA 3WHUA 5J96B 1O7FA 1QNYA 4IGOA 5DN2A 3AB0A 4JGZA 4JRLA 4COUA 3MW2A 4IE5A 1LOEA 4AXOA 4HXCA 3BPZA 3WDVA 3H7YA 1UN1A 3LA2A 1XYNA 3HVDA 3QLQA 5EJ3A 5FZ3A 3FHQA 4D7TA 2WNVA 4FFHA 1OBNA 2YC2A 5ANQA 2Q8OA 3UKVA 3W58A 4ZHNA 3U4SA 1UKGA 3N9NA 4XF4A 4FVVA 2HKXA 4BLJA 5JXHA 2VPVA 4NRPA 5KHGA 3SH3A 3RGBA 1OUXA 2ZX4A 3I8TA 3WQ1A 4RQPA 1R082 1ENXA 2OT7A 3DECA 3N35A 1ONAA 4Y26A 5FYMA 3KB5A 5GZGA 4CCEA 3N3HA 2C5DA 2MEV3 3HJRA 4IV1B 4LHNA 4BZ4A 2LTNA 1VPHA 1AX0A 1ZRIA 1AL21 3I2FA 4FPFA 3DEMA 1PO13 2VQ0A 3TWIA 3JQXA 3ZPYA 4X6RB 2XJVA 5LY2A 1PIV1 4QKNA 2AACA 2QQMA 4RHV3 4W6WA 1OSGA 1PMHX 3TBDA 3ZSKA 5FREA 5ABJC 4TTGA 3PJQA 3PTYA 5DZEA 2WT0A 3HQUA 2MPFA 3WUCA 2Z2SB 5FDBA 4P02B 4M4RA 2K2SA 2PHXA 1VJ2A 3POJA 1CVNA 2DYCA 2GC3A 2WA4A 4XABA 4FFFA 3RYRA 4B8EA 1AL0G 3B00A 1T6GC 2WS92 3NNGA 3H3UA 2NZ9A 3B69A 4SBVA 1HQNA 1VBE2 4A7YA 5JR2A 3BCWA 1EAH3 1ZRRA 3D3AA 4XHXA 1VAKA 2G1MA 3DYOA 3TN92 4QM9A 3SH4A 2VBBA 5IVEA 4D69A 3ZXDA 1PZ9A 3C3VA 2Y33A 2J1TA 4N43A 2EXJA 2Y0IA 1F4HA 4W6YA 3H8XA 2RVAA 5A33A 3VL9A 4HVOA 2UYBA 1ZM1A 4Y20B 5C5UA 2R073 5F6LB 2OVUA 1VBD2 2G9GA 3E5QA 3E6DA 1AVBA 3LA7A 2ZMNA 5JZGA 2D3RA 5DAWA 3CL1A 5FUIA 4DUWA 5I91A 1WW7A 3ZXJA 2BZDA 1ULCA 2HWC1 1HB1A 3AC0A 3AYDA 2XDVA 2RMU3 5DG1A 1AZDA 1J3PA 1VBB2 2R30A 1SQ4A 4OCTA 4PLOA 1ND2B 4DRVA 1C8M2 1XXNA 4AK3A 3U4XA 4K1YA 1UAIA 4KGQA 2PA7A 2PAKA 4FPKA 4XAEA 3N7LA 4W8JA 5E89A 3VKFC 1H0BA 5A6QA 3J7NA 2R1DA 1IKQA 3AMNA 1TME2 2XWBB 1BBT3 1F4AA 1DDLA 1MS1A 1KGYA 2RS33 1RUG2 4ZZ8A 1H2KA 2JDPA 2P5BA 4XBNA 1AR91 1K5MC 4C8DA 2Y6GA 2GP3A 1ZBA1 4YZ5A 3O1RA 1W9YA 1IQDC 3ASIA 5CFCC 2WQ8A 1VB4A 1EP0A 2WT2A 2XUMA 3WNKA 3OGVA 4BCUA 2PAEA 5HCAA 3SKVA 5EZWA 1NY71 5A3MA 1Q8VA 5A70A 3PNAA 1NLQA 2Z79A 3AMHA 3M3OA 2WN3A 2DBNA 3I97A 4BQ1A 3D0SA 2XPJA 1SFYA 2VNGA 4JHTA 2LALA 2FCTA 1L3JA 3N9QA 3ZO0B 4HPKA 1R1A2 5H9PA 2E32A 1KEXA 2A75A 4Q4V3 2XOMA 3OD0A 1V6JA 2P3YA 4Q29A 4A7ZA 5FYCA 3SXWA 1I1EA 1US3A 4KQ7A 1UY1A 2ZA9A 5FYHA 5FZ7A 4CP2A 5FOJB 1F8VA 2D97A 1BLZA 3J8F2 4Y1XA 3T0DA 4XF1A 4Y22A 5EQUA 1FOD2 3SH5A 2VCMA 4JGZC 1SLIA 5LRRA 2DCJA 4HSLA 2C1FA 4RFT0 5FY8A 4NIGA 2BNOA 3NQHA 2OQ6A 1VB2A 2L9LA 2WYFA 2GU9A 4DB5A 4FXKB 4IEPA 1AUYA 4OMDA 4CCDA 4IGPA 5JXGA 1Z7S3 2HWF2 2WS91 5GZCA 5AC91 1V9U2 1UO9A 2X05A 5A3NA 2ADEA 2D5HA 1VBA1 3ATGA 3DYPA 1GNZA 4XCAA 1DYOA 2QQIA 3JD73 1LR5A 5FP8A 4CP9A 1AHSA 1D0GA 3ZKUA 4RN5A 3AYEA 3P3NA 2Y6HA 3O12A 4Q5OA 2I74A 1LENA 2AEZA 4QX1A 4XUQA 4CUGA 5C8CC 5EIYB 5DAPA 1GR3A 1WMFA 2B46X 2WO3A 3ZN5A 1O3QA 2PQSA 5JCTA 1H8TB 1TMF1 1VP6A 2JDKA 5FO8B 4PF1A 3VBFC 4V2WA 1RUD1 4PIZA 3F95A 3PUAA 4C1WA 3D5OA 1OQDA 2R6QA 3WOGA 1NE4A 2FCVA 3OGJA 1VMJA 1W8OA 2V5YA 4BMBA 4NR1A 5EPAA 1UY4A 1JOJA 1OOPB 2GN7A 3T08A 3VBUA 1I3HA 4MHUA 4YM2A 1I5PA 1RXGA 3MYXA 4NUBA 2WFF1 3MF9A 4R8HA 5FZBA 4J1WA 4XF9A 5FAXA 4DFSA 1WKYA 1YQ2A 1OURA 2D6PA 3IZOA 2CWSA 4RL7A 4YZ4A 4GA9A 5A7NA 1COV2 4JTNA 3AL5A 3D8CA 4AFAA 5E88A 1DGWA 3IAQA 1MS0A 3APBA 5KR7A 3I2OA 4K7JA 2WO2A 1W04A 3W5NA 2J1SA 3C2UA 1MVQA 2VQTA 4L11A 4GALA 4Y1ZA 4KU8A 1W8ZA 2WN2A 4LEJA 4Q4W2 4GD4A 1C8M1 4ASMB 2WDBA 2XL9A 1XYPA 4YGCA 3AJYA 4LO6B 1D2SA 1WCSA 4LO7A 3VBFB 5B4XA 4XILA 2GAUA 4JTOA 4KBZA 3RYKA 1RJ7A 1HIXA 5GLWA 1CR7A 2P34A 4LOSA 5JI7A 1YJLA 4GIQA 1Q43A 1LJ7A 1UMZA 2E53A 1YQ6A 2D44A 1PNFA 2YBPA 2MEV2 4BE3A 2R7EB 4LE4A 3RWKX 4AFDA 3O0VA 1Q8OA 2UWBA 3N7KA 4MV2A 4M3CF 4TWTA 5FZLA 4AFCA 4ZY9A 3M3IA 2WL1A 2BNMA 4IEYA 4Y1YA 5AVAA 1UOFA 3N9LA 2HWD1 3ZM8A 1X9TA 2RMU1 4MGTA 1ENQA 3VD3A 3O1UA 3P5BA 3MPPG 2OXBA 4Z1VA 2OIIA 2CU5A 2P6CA 1ODNA 3BTYA 1N1YA 3EMRA 4RR3B 4GMP0 3IIIA 3IN9A 4DY5A 2YYOA 1BKZA 2J22A 2WABA 3O14A 4XUOA 1HKDA 1NKGA 3O1SA 1VALA 1X8MA 2Q1FA 3SHRA 4BLIA 1J1LA 2JKBA 3H7JA 1UKRA 4O9GA 3U10A 2R043 5CEHA 3O1OA 4A7KA 1D4M2 1OT5A 1GQPA 1PK6A 4JGYB 5FFOC 3V0AB 1NCQC 1K45A 4FPJA 4JKMA 4META 2VTXA 4P9GA 5F3IA 3U07A 5K8SA 3KT4A 3WG4A 3CEWA 3VLBB 1EPWA 3LA3A 2NQYA 2RDQA 3PU8A 4AEDC 2RR12 2RS13 2LROA 1LHVA 1W6PB 3ZFFC 1AL22 1S0BA 3HN3A 4K8RB 3H8RA 1BVVA 3G7DA 5KHHA 2OYZA 1K42A 3S7IA 4CSWA 1HRI2 3B7MA 3VBHC 1RGSA 5DG2A 5L7OB 1H6XA 4PDWB 5BYNA 5IVBA 1BMV2 1QJU3 3VBOB 3WLUA 3FLRA 4BH9A 1KDKA 5LA2A 3GF6A 4DO0A 1H2NA 1QIQA 4Z2WA 4WZFA 2YDEA 3BTZA 4EZHA 3FBMA 4FTEA 3OTFA 4FPHA 4EWEA 4I09A 1JZ3A 5J48A 3VDBA 3KQRA 5BNPA 1C8M3 2B4KA 3G6JB 4FXGB 1UW8A 2NMNA 4HBNA 3WNXA 4BQWA 5KXCA 4IDZA 4L99A 4XFBA 1NCRA 1Y9MA 5FZCA 5C3QA 3WP5A 4HPKB 2RS53 2VNRA 3IM0A 1FMD1 3RJ2X 3WF3A 1CAVA 2XMLA 3PURA 1B35A 2PELA 1JOPA 2QNKA 1T2XA 4KWUA 1UIJA 2WNUB 2PMWB 3ZSEA 4B3NA 4QHOA 4XJUA 5C8CA 5GM0A 2VZTA 5E6HA 2HWC3 3UGGA 4P9LA 2BWCA 1AYN3 2YU2A 3K4AA 4Q8KA 3VBFA 4CEWA 2HBTA 1DHKB 1G7YA 5IK7A 1PVXA 1Z7S2 4ZU4A 4NPRA 4FOYA 2C24A 2ZS6B 3WQBA 2WLQA 4U2AA 2JXAA 1SFPA 4AAXA 4WVVA 3IB3A 2FMDA 3VDDC 3LEKA 1ND3A 2VOVA 4BWOA 2WWSA 3NW4A 4PBOA 4NIIA 1HXS3 1YIFA 1DQ1A 4UW4A 2PQQA 4JCKA 4L2NA 5FLIA 1W03A 2GC0A 2Q0AA 2XKOA 1EAH1 5A3PA 4GWMA 3WCSA 1JU4A 1UU6A 4P9IA 4WZCA 4I2OA 1AR83 1AYM1 3LDRA 1HX6A 3OJBA 4MO3M 1XNCA 1QXRA 3VBSA 2F6BA 4OHXA 1YQ8A 3C7OA 2BERA 3NO8A 4OHYA 2VOXA 3ZLIA 1QHDA 2HWF3 2RR11 3AYCA 5A1AA 1JYIA 3LF7A 4PLMA 5BNOC 1W90A 4Q4Y3 2GH8A 3JBG1 1BEV2 1MZ6A 4A2UA 2GNBA 4IV1A 3Q8CA 1WCUA 4AGRA 4JDNA 4DUXA 2JG9C 1XNTA 4IE6A 5H9QA 3S30A 2FHRA 1ZX5A 2D3PA 1AXKA 1TVGA 1J83A 1W8WA 4Y20A 3J9SA 4L97A 5IHRA 3K4DA 4XDQA 3AVSA 2WFF2 4YRDA 1VRH1 5SV5A 4H3WA 2ZGMA 3BODA 3U75A 2O1QA 3ZXAC 1QJEA 2D43A 5JMOA 4XPVA 4J1XA 1RYYA 2P3IA 5FP3A 3ZXGA 4EE2A 4N43C 1Q3EA 2J1UA 3GBFA 2RS51 2DCKA 1X9PA 4URTA 3MFCA 3VZJA 3POBA 1RL3A 4QPWA 1GYKA 4AI3A 1HV1A 3EB7A 2WR9A 1JZ6A 3WW2A 2RJKA 3OB8A 4QQOA 4FOQA 4E2QA 2D40A 2FDHA 3VBSB 4Q0SA 4E27A 5F37A 4XAAA 4IE4A 4OVEA 2JD9A 2JDHA 3WF4A 5ACA2 4AEMA 5FY1A 1Y43B 5T52A 3HBZA 4LTAA 4RHV2 4XVHA 3A4UA 3A21A 4P5YA 4Q4W3 3J7MA 4M0NA 1JXNA 1XBFA 2EIGA 2A3WA 4OMCA 4RGGA 3UYJA 3HWJA 4F83A 4ZZ5A 2ZGPA 2FDJA 2GP5A 2LW8A 4YM0A 4CU7A 1V6OA 3VBHA 3RYPA 3ZYBA 1CESA 3I2KA 2R16A 1K5MB 1RVF2 1LHOA 4AW7A 5HXVA 3ZIXA 2N7GA 5KBFA 2JIGA 2UYAA 4CDWA 1RUF3 5ABJB 4LO4B 5J36A 3NL1A 3LE0A 1US2A 2ZPXA 4QX5A 1W6QB 1H4GA 2WRAA 4XIKA 3TEYA 1W0OA 2R071 1SBFA 5A3WA 5JVVA 4TXWA 4CCNA 4ET7A 2CY6A 4Q2FA 2ZZQA 5GZFA 1F5JA 4Q26A 4DNYA 2A73B 4Y5Z0 3I2JA 4ONUA 4PIYA 5SV8A 1W2OA 4UI9L 3NSTA 1ND3B 1ULOA 1VBC1 2HH9A 4R4XA 4YW6A 3NMBA 1XSRA 1C28A 2HBUA 1W6OB 4MUVA 1RIRA 4NRQA 4EN7B 5IK8A 3OEAA 3PMEA 5FPVA 1Y9GA 2NM1A 1YXWA 3ES4A 5JZGB 4FCAA 2VJXA 3UKNA 3HNMA 1MS9A 4LHKA 4QT6A 1HDKA 1LHNA 1NZCA 3K51A 2I07B 4XOGA 5CU1A 5LBEA 5C3SA 5IT6A 4QGMA 1A8MA 3SLIA 2XBO1 1REEA 3WNNA 4QPGC 5IATA 5HCHA 1UYPA 3AKQA 2H0VA 1AYM2 1QH7A 1WA6X 3A0KA 3AP7A 4JDMA 3VL8A 1G86A 2ZGSA 2GMEA 1MQTA 3T1MA 3T2QA 5D8AA 1POV3 1WGPA 2FQPA 4PI0A 4FPYA 1S55A 5FK8A 4MG2A 1GZWB 4AQ2A 1AL23 2WZR3 1ND3C 4MZUA 4R9AA 3MDPA 3MLKA 4TSVA 1CJPA 4ES8A 1ND2C 2JDZA 2IXLA 4AVSA 1F9KA 1W3VA 2JWPA 5FZKA 3NNFA 2V72A 2XWJB 3AFKA 5FZAA 2WT1A 4HL0A 4EN6B 1AJKA 4OZOA 4IW3A 3OSDA 1AR73 2QZ2A 4FI9A 4UBHA 4W4ZA 4WM7C 3BI3A 3BU0A 1V0AA 2YC4A 2DFCA 3CJXA 5KC6A 4FFGA 4OUSA 1E5SA
chains in the Genus database with same CATH topology
4YW4A 3UJQA 2TBVA 2ZX2A 1DIWA 5AFBA 4RSUA 1QDOA 3M70A 1POV1 4KBBA 4CDUC 4EN0A 1FT9A 3NKGA 2UY8A 1QQP2 3JCIA 4B29A 1GBGA 1UU5A 3AZVA 1F5FA 4MXWA 3FLPA 3WUDA 5JIAA 1AYM3 4DXZA 5JSPA 3MIHA 4HANA 4OZXA 2MHFA 1S0IA 1X36A 3FC0A 1NA1C 4W65A 4XFGA 1BEV3 4CDXC 3QH7A 1V9U3 4JGZB 2R49A 4FAHA 5KHIA 4JAAA 1KD7A 1YFWA 3O5SA 1QJZA 2R041 2ZGLA 4PCRA 2Q4SA 4GH4C 1REFA 4COYA 1MZEA 1TEIA 5J7MA 2Z69A 3PVBB 1VRH2 1H8VA 1FYUA 1X82A 2RM22 3P3PA 5JOZA 1WD4A 2VQAA 1ULDA 2IZWA 3UK9A 2FZ1A 1C1FA 2AUYA 1S2KA 4AHXA 2I2SA 1NA1B 1YWKA 3R4DB 5JWPA 2ZKNA 1ZRFA 3PVNA 1IQAA 3V0BA 3T1LA 3WP3A 1N1SA 1YJKA 1M06G 2CNAA 3UL2A 3VN4A 4C0HA 3GZUC 3UJOA 1VBE1 2GNMA 1DGLA 2OUJA 4RS5C 4HSJA 4OHVA 4COVA 2XJPA 2JICA 4XJ8A 1C5HA 4AF9A 2GNDA 3BOWA 4Q0VA 5FCCA 4KU7A 1OA3A 2G9FA 2GDFA 3LOBA 3NV1A 1CONA 2NPIA 4N53C 4MLOA 5T5LA 1RUG1 3KT1A 3IBMA 2ZGOA 5J98B 3DKWA 4QPGA 3INAA 3CU7A 4SLIA 3ILFA 3POWA 3JB4C 2W68A 4AVCA 3PVOA 1YRZA 1MQTC 4XFHA 2VU9A 5I93A 1VLNA 2AR6A 4YNIA 1O4ZA 4LLFA 2ZKLA 3KSCA 4M3CB 3WG2A 2ZABA 1ZRCA 3WHTA 1QH6A 4MXWB 1LULA 4LHLA 2EALA 1XNKA 1NCRC 2O0OA 2A6XA 2ZX0A 2HWD3 3RDIA 1RUE1 2XLGA 1Z0HA 3B5LB 4M3CE 1V6MA 3ZSMA 4PDWA 4LA2A 5CFDA 1NLRA 2ES3A 4DS0A 5KXEA 4XMIA 1RUI1 2R061 1O3RA 2V09A 3FLTA 1MS5A 5GLUA 1WW5A 2XLFA 4GB33 4M00A 3NV2A 4PF5A 3SITA 4NHLA 1ZBE2 1FNYA 2BVBA 4LR4A 1ZYBA 1FNZA 1QF3A 4R4ZA 3LGRA 4X8NA 4YM3A 2DVBA 4IEUA 4RHV1 3JZVA 5CA6A 3FFZA 1AYN1 1RUC1 1NXMA 4AEDB 2QZ3A 3V56A 4EJRA 1BCXA 1SDWA 2IXCA 1IGOA 2WA3A 2R072 2AREA 4ISRA 3KS7A 3OF1A 4UW5A 5DUVA 3RRDA 3VGIA 4PDWC 2YY1A 5CAZA 3OGGA 3S0MA 1HRV2 1V6IA 3RWNA 2FMYA 1NA1A 3E97A 3ZFFA 4V1PA 1AXZA 2QVSB 3BU7A 1PMIA 5LEKA 4YLZA 4YVWA 5FQ0A 3ZSJA 5BNOA 2DTWA 5FRAA 3WW1A 4EN9B 1QOSA 4ATEA 4CZSA 3ETQA 5T5OA 2JG9A 3MEPA 4YG0A 4CP1A 3ME2A 4FPEA 5CBLA 1I5ZA 1GLHA 4GB32 1TME3 2WNUC 1LECA 1GFF2 1LOBA 2ZMLA 4YW3A 4I3GA 3SISA 2Q30A 3NVCA 4LUKA 3RMXA 2D7FA 5FPZA 4BIOA 1WLDA 1RB8G 4QQHA 5HI0A 4HT1T 1MS4A 2BBVA 2ZGKA 2Y26A 2ZMKA 1QGLA 2D6OX 1YHFA 2WQZC 3CF6E 3WXPA 4N9HA 1RMU1 4CDQC 3O0WA 1VBC3 2BQPA 3WDTA 1FI2A 1YI9A 1U5ZA 3H1WA 4XJ9A 1LCLA 5CIRA 2H6BA 1A78A 1VIWB 4HVRA 4XFFA 1D4M1 4ES9A 1LGNA 2QCSB 1QNWA 2CTVA 4LBOA 1SLLA 4HKWA 1PK6B 4JGYA 3ZX7A 3AMQA 2ZACA 1CX4A 1LOFA 4HKOA 5KWRA 1MVEA 2D6KA 1GZWA 4LE3A 4NO4A 4GWNA 4B4RA 2IC1A 4D3WA 1WLCA 3AMPA 3VZOA 3WP4A 4EWAA 1LHWA 1Y3TA 2XJSA 4I0WB 4K1ZA 4S2DA 4CDQB 1UZYA 5I0RA 4Q4V2 2PHRA 2OZ6A 2RE9A 5CG8A 3CNAA 3V0BB 3NKTA 4IEXA 4K8FA 2DURA 1C57A 3ZXEA 3AXDA 2V73A 4IV1C 1PO11 1ENRA 5B2GB 5JZGC 4NHKA 2A5ZA 5FLJA 3NV4A 1FATA 1XE8A 2WKKA 2UU8A 1WMDA 4DRRA 3KT7A 3N7MA 1EY2A 2CAVA 4OI2A 1GZCA 3FE5A 3POYA 4QPGB 2IXKA 2W0XA 1OMIA 2VY0A 1ASJ1 4XW3A 1FV2A 2O8OA 2E6VA 5DZFA 1Z78A 1HRV1 1SCRA 4R9BA 5AVPA 1G8WA 3VZLA 4EV0A 3ZVXA 1FMD2 1FPN2 2E7QA 2RMU2 4E4DX 4FQZA 2UWAA 1LOGA 3URFA 1EAH2 3I7DA 4GB31 4GKYA 1ND2A 4WM7B 1XYOA 4FP3A 5T55A 4NWVA 4COWA 1W6MB 2D93A 1EV12 1ZA4A 4XETA 5EYYA 1ZNPA 5BNNA 1LB2A 3W59A 4KL1A 2IFRA 3E6CC 3MIBA 2ZGRA 3GYDA 2EVXA 3H8UA 2AH2A 1WA4A 1G9CA 4ZXKA 5I8SA 2WZPP 3NAPB 2W52A 3FJSA 3H1YA 4CDUA 3I54A 2IFWA 3IKWA 5CNAA 4WVWA 1UX6A 2JE9A 4AE2A 2VNOA 1PM7A 3CJIA 4AI1A 1O5UA 1WBLA 5DUXA 3E5UA 4MGKE 2DUOA 3B9IA 1A8DA 3NWKA 5C6CA 1RUG3 3SMHA 4BMEA 1AR71 1PGSA 1KS5A 1WCDJ 1GZ9A 3ZXFA 3JBG2 5CFCB 4AG4A 2DTYA 4AYUA 4N7UA 2CAUA 4K3UA 1TQ5A 1FX5A 1CAUB 1OD5A 5GZEA 3QACA 3ZYRA 4QQ2A 3FZ3A 4C91A 1OFSA 1LRHA 2R32A 4LBMA 4Y1UA 1AR93 3TOJA 2XVKA 2RS31 3H9AA 1IS3A 4K40A 4AVTA 1NY72 2XBO3 1QJX1 2EAAA 3W9AA 2X29A 2PN5A 5ACA1 2R0HA 1M4WA 1DQ6A 2BUKA 3AJZA 5GJ6A 3AKTA 1PGW1 4MGZE 2P2KA 4XQ4A 1QJY2 2EF6A 2EXKA 3BB6A 4WVMB 2BFUL 1LOFC 5A32A 1KJRA 2XJTA 4WVZA 4CEWC 1KS4A 1JTZX 4KWKA 4XF3A 4LNVA 1A6CA 5ABJA 1DZRA 1VR3A 1LEMA 5DZGA 4P9XA 3MFAA 2PHDA 4N53B 5H9RA 3AXEA 3ECQA 1CGPA 4MXVA 1YFXA 1SCSA 1OHFA 5C8CB 2HWF1 1IPJA 4IV3A 1H8TC 4P14A 3RZZA 5T54A 1CAVB 1DQ0A 3TAYA 3WX5A 3GHMA 4EN8B 4FOVA 4RD7A 2KXLA 3ES1A 2YC0A 4LBQA 5GZDA 4FTBA 2ARXA 3USUB 1MZ5A 1LGCA 1DG6A 1I6XA 5DXDA 4WM8C 4GH4B 3AFGA 3GBGA 2OUHA 3LOIA 3ACLA 1TMF2 2YUEA 1LTEA 4KH9A 3RQ0A 1OPOA 1QJY3 3X29B 1VBA2 2ZAHA 1NCRB 1ZZ7A 4X8PA 4Y4YA 3BTAA 1LOAA 4CTEA 5CVRA 3RPQA 5BNPB 4AEJA 1KJLA 1X7NA 4YGEA 1U5XA 3MIFA 1J1TA 5K0UC 3HAGA 3I2DA 3FUQA 3BALA 4AGVA 2B9UA 1DF0A 2X5IC 4GMP3 4PQ9A 3VBRA 3V64A 4EWDA 3QH6A 4PJYA 2ENRA 4R9CA 5L73A 3ZXKA 1RUNA 3TN91 3AK0A 3KD4A 3B93A 1ULEA 2VVEA 1N3OA 1URXA 4PLNA 4XTPA 4YFWA 4AI8A 2DF7A 4AQ6A 2ET1A 1DYKA 4MGIE 4YZ1A 1HQWA 2X53S 3V0AA 1Q8SA 3JUUA 4B7KA 3ST7A 1S2BA 3RNSA 5BNPC 1TMF3 1QOOA 4RR3C 2CGNA 3VKMA 2GMPA 1POV0 1RUD2 1ZZ6A 1QJU2 3M3EA 4XZPA 5I0TA 3O0XA 3VBRC 4E2GA 2BVVA 2H6CA 4R52A 2BFUS 5KHKA 4YVSB 3FHIB 3J4UH 4CEYB 1S1AA 2PAMA 4DZGA 1HXS1 4G4FA 1PIV2 1MEC3 1D4M3 1DZTA 1Q56A 1SLBA 2ARBA 3KM5A 2FZ2A 4DQAA 2WINB 4HMZA 3EJKA 2IXIA 4A3XA 1NLSA 1TNFA 3ILNA 4XJZA 1BQPA 1SBEA 3RI9A 3ZFFB 1UZZA 1HQLA 4MH0E 5EYXA 1RUF2 2BNNA 5T3NA 2WNUA 5DDJ2 1ZVFA 3M3QA 2QKDA 2G4IA 4IV3B 1QKQA 2OPKA 3R0RA 3TNQA 5C33A 4YYOA 1S0JA 4RQPC 1QXJA 4Q4W1 1FXZA 4XF0A 3WDWA 1QMJA 3VZMA 5ACA3 4CEYC 2DCYA 4ITCA 2JD4A 4AHZA 1YI7A 3MLLA 2E7AA 5BUVA 3WW3A 4CDQA 4Q1RA 2PHLA 1PVC3 2ZJCA 2JENA 4KG8A 3VUOA 1EV11 4CDWB 5D8AC 5I8TA 2GNTA 1RUC2 2W39A 5FLHA 1IS4A 3ZYPA 2VECA 5E1RA 2HWC2 4N9IA 1YCIA 1IZ3A 2D3SA 2ZGUA 1H9PA 4XJAA 3RJRA 2TEPA 4P9WA 3L9JT 4FPOB 4IV3C 1CPNA 2ZAAA 1H8TA 5BPXA 3MPBA 4OI4A 1KFXL 3EBRA 5GLTA 2PLV3 3VDDB 1WMEA 3KCYA 5HCFA 5LK7B 5DDJ3 3HD8B 4CEYA 4K20A 1HV0A 2XB6C 2OA2A 2XBO2 4Q0PA 3PLQA 1ENSA 3T2TA 2WJSA 4D94A 3LAGA 3VBOA 5JSOA 4XFIA 4INDA 3B94A 4BOWA 1KXGA 2VUAA 2HEYF 4DINB 4YW1A 1QWRA 2WSUA 2XL7A 4AFBA 1C3HA 4AI2A 4FO9A 4Q27A 2X5IA 2NMOA 2ERFA 1RHI3 3M3CA 2JE7A 4K21A 1KQRA 4UXAA 2CYFA 1RUI3 2R063 1AXYA 1W6NB 4W6XA 3NV3A 2JG9B 3WY6A 2A6YA 4CDXA 1OA4A 4FAGA 2Z5WA 1X50A 3A0NA 3IIAA 1CIWA 4HLTA 2ZX3A 4YGBA 4CRQA 3ZFGB 1DGWX 3VHPA 4K6BA 3L2YA 5JIUA 1BZWA 4DPNA 4CP0A 4I01A 5FBZA 2Q5TA 5JPNB 1PK6C 4UW3A 5AC92 3JU9A 1ASJ3 1YNAA 1JYCA 3QOPA 2ZHLA 4GULA 3TB0A 2MEV1 4RR3A 4AEDA 4ISQA 5BNNC 1R093 3PHMA 2JG8A 3NAPC 3AYAA 4IL7A 5I0UA 1DU3D 4XIOA 3R05A 2SBAA 4JDOA 4EROA 1UIKA 2BYVE 2HEVF 3IDEA 1U5IA 4ORFA 5A3LA 4JQRA 4FTSA 2VMHA 1CAWB 1CD3G 1N3PA 1RUD3 5J09A 5FTTC 1ZBA3 2VVFA 4Q0QA 4QMAA 1QJU1 4QGLA 1AR62 2IXJA 2ZGQA 4YVSA 1SMVA 1W6NA 4PIXA 3VHNA 2E51A 3POSA 2CWMA 2I45A 2WLPA 4GKXA 4YFZA 4BA6A 1OOPA 3S6PA 1O3SA 1RHI1 4KGGA 3WG1A 3FUOA 3DUIA 1SLTA 1MR5A 2GH2A 1OA2A 3PMSA 1R083 4MGYE 3HT1A 3IMNA 1R092 1LU2A 3IWZA 1G9AA 1C4RA 1ZZCA 2DV9A 1TE1B 5EWSA 1XRUA 4XQWA 3B02A 3OY8B 3OCPA 1DLLA 3DGTA 4XBQA 2HWE2 5DDJ1 2BGCA 1KITA 4MVTA 3THPA 4O9EA 3OD4A 3RI8A 4FP2A 4LBJA 2WNEA 5CFDC 4GXLA 4OULA 1ULFA 4IEVA 4P9YA 2B8MA 3MI8A 3ZFEC 4D7SA 5C4WB 2VGDA 4NOTA 1AX2A 1A3KA 3WD5A 1GANA 1J59A 1I9RA 3WDXA 2DUQA 2B42B 3N36A 3TYJA 4J6GA 4GH4A 4YM1A 2E9QA 1RTVA 2D6LX 2XH6A 2DWRA 3ZN6A 3GZAA 3WG3A 2PHWA 1DBNA 1QU0A 2ZGNA 1RUH2 1BJQA 2XJUA 4FT8A 2MNGA 3OPZA 2HWE1 1R091 1H9WA 4CDUB 1ZZ8A 1WW4A 1SEFA 3ALQA 1WBFA 2JEMA 1IS6A 4AFMA 3WDUA 2SLIA 3ZFEB 4OI1A 3VZKA 4LUMA 1RUC3 1NXD1 1VRH3 2RM23 2Y0OA 2VG9A 2XGXA 2ZGTA 5BV6A 3AX4A 2VMIA 2ZX1A 5FMOL 5GALA 4AHYA 5K0UB 5A32B 1PO22 3K48A 1WCKA 4MSVA 2YGLA 4G3YC 1MEC1 2A6WA 5TSWA 4BM8A 1N1TA 1GICA 2Q1MA 3FWEA 5K0UA 4I02A 3GNEA 3H1MA 1CPMA 4QU2A 3WT3A 2VOKA 4BHPA 4CEWB 4IEWA 3ZDSA 4E4SA 2QJVA 1H4HA 1KDMA 4BPZA 5LRSA 3R6SA 1Z7S1 4JC1A 1UU4A 1Q8PA 5BXXA 1YLLA 1V6LA 1SBDA 4HFSA 2YZ4A 1RHI2 4G9SB 1LU1A 3IDCB 3FMGA 2AZ5A 2FBEA 4FPLA 1IKPA 3GALA 4DMIA 2X8KA 3ZN6B 2PFWA 1COV1 1WLTA 3TN93 3VBRB 4K9SA 4XE9A 3IDBB 2B7YA 2GZWA 4YVSC 3AP4A 2IWGB 4YW2A 2RM21 2HJIA 1LODA 1DQ4A 4WM8B 1Q5OA 3GZTB 4QD2A 1J3QA 1N47A 5GKAC 1DFQA 1OOPC 1XU1A 4M3CA 3MW3A 1G6NA 1H30A 1J3RA 1RITA 1CJDA 4I30A 4WM8A 3UKTA 5F1RA 1KFUL 1OQEA 1YYNA 1VBE3 2QFEA 3LZZA 3QCWA 2A3YA 3VDDA 4F3JA 1VAMA 1O4TA 2UWCA 2PTMA 3WINE 1AR61 4LBNA 4RQPB 1VBC2 2XLAA 1QJX2 1GKBA 3VKNA 2B5HA 2P17A 1BBT2 2R1BA 1W2UA 4WM7A 3THTA 5JR7B 2VW0A 1ZRDA 3QD6A 1NOVA 1RJ8A 4CYDA 3FX3A 5D8AB 5J37A 3EHKA 1YFUA 3NJZA 1COV3 3D82A 2XJQA 1LOCA 3Q9OA 1PNGA 4AWDA 2HWD2 3VZNA 3D4KA 1PGL2 2Y38A 2NP0A 1RUE2 4FQ4A 4OFGA 4Q4Y1 3VBUC 1MEC2 2VVDA 4C90A 5HCBA 3USUA 1QXPA 2R0FA 2UY9A 2ZOEB 4H7LA 4QXKA 3SCHA 3AP6A 1OFNA 4S2GA 1ZREA 1AJOA 3ZYGA 4B7EA 1ZBE3 4JRAA 2VW1A 3VHRA 2VXRA 3H0OA 3WR0A 1QJX3 4HETA 1FOD1 1BMV1 2D98A 2JG8B 3ENRA 2PHUA 1IPKA 2GN3A 1D2QA 3I59B 3J26N 5DUUA 4S2HA 1X33A 3L2HA 4AVBA 1R1A3 5I0SA 1BVP1 1BYHA 3H3ZA 4AQSA 5CFCA 5H9SA 3VBUB 4ASLA 2BW8A 1HRV3 3VBHB 1S0CA 4BYYA 4IERA 2ETEA 4P5HA 2ZCWA 2BEOA 1UL9A 1DZQA 2YXSA 2PYTA 3AKPA 3MIEA 4LO5B 2A6ZA 4OHZA 4GMP1 1PGL1 4AVAA 4H14A 2DCTA 4Z07A 3AP5A 3OYWB 4OHWA 3VV1A 4WVMA 1DGRA 3R4UA 1YO8A 3WV6A 1W6PA 4CDWC 1F2NA 1AF9A 2DVFA 1WD3A 4XQDA 1UPSA 2PLV2 1NQJA 5E16A 2BWAA 1VBB1 3JBG3 3LSEA 1JUHA 1KRIA 2TUNA 1V70A 2YPJA 4XFAA 3M2MA 5T50A 5J3UA 1NCQA 2EA7A 2E63A 5BNNB 3KCXA 1U0AA 3PJYA 5T5JA 2F4PA 1RUJ2 3AKSA 1ZBE1 2YROA 2Z42A 4ATFA 2HYKA 1VBD1 4KWJA 1AR92 1CAUA 3RG0A 1RMU2 1O5LA 1UD1A 3D6EA 1LGBA 1YUDA 1UPIA 1V00A 4QM8A 4AQTA 4DY3A 4R9DA 1SLAA 4AEKA 2XVLA 4TZDA 1IHMA 1PZ7A 2BTVC 4YW5A 4YSFA 4XTMA 1HLCA 4HN1A 4YVWB 1JN2P 1J58A 3DPRB 2YHJA 3ZXLA 4Q8LA 2C0ZA 3CJIB 1RUF1 1BK1A 4ZU7A 2QDRA 2VH9A 1QDCA 1G9BA 5FO7B 2HWB1 1B35C 3H50A 3ROUA 3TRSB 5BNOB 4Z92B 2B45X 5EV7A 4UW6A 1DQ5A 1FV3A 2P3JA 4Q4V1 1FMD3 2O8QA 4FPGA 4AVVA 3B01A 5JLVA 3UV9A 1HW5A 1U5YA 4MYEA 1RUJ3 1YIPA 2R042 2H0BA 2A71A 3IPVA 4HZFA 1D0HA 2D6MA 3WW4A 2UURA 3WDYA 1H1MA 1AR82 5T5PA 1XE7A 4Q4X2 3VHOA 5L7OA 1MS8A 4Q0UA 1EV13 2ZTNA 2VW2A 3CJIC 5JOYA 2VULA 5CFDB 1LKNA 2OZJA 3N4MA 5L36A 1HRI3 4YG6A 1B35B 3IT8A 4NWWA 3ZFGA 3KGZA 5JMCA 1PO12 2HEWF 2PHFA 1QY4A 4IQPA 4E4ZA 3AZWA 1CAXA 3VBSC 5JOXA 1FPN3 1S0DA 1WUVA 3DL3A 3ZFEA 5L19A 2WFF3 3AZXA 3WP6A 5C9AA 1LHUA 4XXAA 4B4PA 2OW4A 2LM3A 3CO2A 4I0AA 4HN0A 5DUWA 1OLRA 4Y22B 4MX3A 2Q1ZB 4XYXA 5C9AB 4RA0A 1RVF1 1XQNA 2A70A 2RR13 2RS12 4NVPA 5HBAA 2DFBA 3GHNA 4E9KA 4KG0A 4FBFA 1O3TA 3WQ7A 4LA3A 1AYN2 2P37A 5GLVA 3KCCA 2JX9A 5C4WA 3OY8A 2YMZA 5GLZA 1RUE3 3CLPA 1VBD3 1XNDA 3ZYJB 3ZN4A 3V65A 3ZMOA 3M7AA 5IK4A 3IPVB 2RS52 3WCRA 4HKLA 4YZ3A 1S0FA 5D1IA 1JBCA 1RVF3 2A3XA 4FSJA 1VBB3 1ALYA 2P3KA 1PIV3 4TLFA 4I0BA 1Y9QA 3RS6A 4QGNA 2AYHA 4Q4X1 1EPZA 1FPN1 4TYSA 1Q8QA 1UCXA 2PHTA 5C4WC 2XVGA 4D7YA 1DGRN 4Q4Y2 2WZR2 1RUH3 2EXIA 1MACA 5IK5A 3EO6A 1PZ8A 1CAWA 1HXS2 2GSYA 2XHKA 1ULGA 4YARA 2BPA2 1VAVA 5F6KA 4IEQA 3LB9A <