2HWD2

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
253
structure length
253
Chain Sequence
b'DRIMQITRGDSTISSDDVANAVVGYGVWPHYLTPQDATAINKPTQPDTSSNRFYTLESKHWNGSSKGWWWKLPDALKDMGIFGENMYYHFLGRSGYTVHVQCNASKFHQGTLLVAMIPEHQLASAKHGSVTAGYKLTHPGEAGRDVSQERDASLRQPSDDSWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMLRHNNWCLVIIPISPLRSETTSSNIVPITVSISPMCAEFSGARAKNIKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 1A COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 1a
molecule tags Virus
total genus 43
structure length 253
sequence length 253
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwd200
5JZGA 1BMV1 3J8F1 2RS52 4FTSA 2RR11 2WZR3 5AC93 2WFF1 4WM8C 5FOJB 1GFF2 1B35A 1FMD3 1RUH1 3DPRC 5LK7B 4IV3B 4Y4YA 2PLV2 2XPJA 1TME3 4NWWA 4IV1A 4RQPB 4WM7B 1RUC1 1RUI3 1AR83 1R1A2 1A6CA 1MQTB 4CDXC 2ZZQA 3TN91 1R081 5C8CA 4N53C 2TBVA 1B35C 2WLPA 3ZFEA 1RUG2 1Z7S1 1VBA2 5D8AB 1FOD3 1POV3 1M06G 2RM22 4YVSA 1HRI3 1AYN3 1POV0 4JGZC 1F2NA 1AYM3 3HAGA 2WS93 1RUD2 3VBHB 3J8F3 2RR13 1C8NA 1RUF2 1H8TA 1AR71 2WFF3 1QJX2 1VBB1 2BFUS 1TMF2 3ZFEC 3ZFFA 1BEV1 1HQNA 4CDXB 3CJIB 4N53B 1BBT2 2XBO2 4CDUA 1RUC3 1PIV2 1RMU2 5C9AC 1AUYA 2GSYA 3TN93 1VBC1 4YVWA 1H8TC 1R083 2IZWA 2HWB3 3ZFFC 1Z7S3 1AL21 2HWC2 1PO22 2R042 2HWD2 5J96B 4QPGA 4CDUC 1IHMA 5L7OA 1R1A1 4Q4Y2 1NA1B 1ASJ2 5FMOL 2R062 3VBOB 1ZBA2 3VBFB 1FMD1 1X36A 1AR73 4YVWC 1RUG1 4CEWB 5BNNB 1VBB3 5C9AB 1MEC2 4FSJA 1BEV3 3JD72 4JGYA 3ZFGA 1VBD3 4CEYB 5ACA1 1AR91 4PDWB 4QPGC 3IDEA 5L7OC 3JBG2 1PGW2 4GH4B 1NCQA 1VBC3 4QPIA 3VDDB 1OOPC 2RS32 2BBVA 2HWE2 4RS5B 4N43A 1AL23 4JGYC 3ZFGC 5BNPB 3FBMA 1HXS1 1QJU2 1EV12 2RS12 3M8LA 1VRH2 3ZXAC 1AYM1 1PIV1 1RMU1 2WS91 2X5IB 2MEV1 1R1A3 1RB8G 1R091 3VBSB 5BNOB 5D8AA 4Q4X1 3VBRB 1VBE2 1OHFA 4RR3A 5A32A 5C4WB 1PVC2 4RHV1 4CDWB 1RUG3 4QPIC 2VQ0A 1PO21 2R041 3VBUB 5CFCB 3NAPB 4N43C 2RM23 5ACA3 1AR93 1NOVA 4Q4W2 4Q4Y1 1ND3A 3S6PA 1ASJ1 2DF7A 5JZGC 1D4M2 1ND2A 1AR62 1RVF1 1TMF3 1COV2 4RR3C 1HRV2 1DDLA 1PGL2 2HWB1 4WM8B 1HXS3 3DPRB 1QJY2 1V9U2 4IV1C 1PIV3 4AEDA 1NY72 1RMU3 2MEV3 2R071 5A33B 1ND3C 5CFDA 1R093 4Q4X3 5FMOS 1ND2C 2Y26A 5AC92 2RS31 4RHV3 5C8CC 1K5MA 4Z92B 5JZGB 1PO23 2R043 5J98B 1VBD1 1RHI1 2RS11 2HWD3 4Q4V1 4CDQA 1QQP2 1TME2 1VRH1 1B35B 4YVSC 5K0UA 2RS51 5DDJ2 4Q4Y3 4AEDC 4FTEA 2ZTNA 1RUI2 1ASJ3 1AR82 5CFDC 5ABJA 1RVF3 4JGZB 2PLV1 1RUJ2 1NCRA 1FOD2 4CDQC 2RMU2 3ZFEB 5K0UC 1D4M1 1AR61 1VB4A 2R073 1BMV2 4SBVA 2RR12 1X33A 5ABJC 1COV1 4GB32 1PGL1 2RS33 1RUH2 1VBA1 1NCRC 2RM21 4Q4V3 1RHI3 2RS13 1H8TB 1VRH3 1OPOA 1NY71 3ZFFB 1C8M2 1RUD1 2RS53 1VB2A 4IV3A 1RUF1 1VBE3 2HWF2 4CDUB 1QJX1 1TMF1 1FPN2 3TN92 4RQPA 4NWVA 4WM7A 2PLV3 1QQP1 1BBT1 1MQTA 2XBO1 1HX6A 4YVWB 2BPA2 5DDJ1 1D4M3 1AR63 1W39A 4IV3C 4QPGB 1RUE2 1COV3 1E57A 1AR72 5L7OB 1NCQC 1RUJ1 4RQPC 1VBA3 2HWC1 1BEV2 2HWD1 4GMP0 3VBHA 1ZBE2 1MQTC 1OOPB 3JB4C 4JGYB 3ZFGB 1RUD3 2R061 1ZBA1 4CDXA 3CJIA 1RUF3 5D8AC 4GB31 1PO12 4N53A 1QJX3 2BUKA 4Y5Z0 1MEC1 1AL0G 1VBC2 1WCDJ 3JD71 1EAH2 1QQP3 1AL22 1BBT3 2XBO3 3VBHC 1NCQB 4JGZA 4QPIB 1C8M1 3JBG1 5DDJ3 1PGW1 4EJRA 4N43B 2HWF1 2WZR2 1FPN1 3CJIC 1SMVA 1FMD2 2WWSA 2HWE1 1RUJ3 1F8VA 2HWC3 1QJU1 1EV11 2RMU3 4BCUA 1NA1A 5A32B 4RR3B 1CD3G 3VBOA 3VBFA 5ACA2 1AR92 4FTBA 4CEWA 5BNNA 5C9AA 1VBE1 2R063 1ZBA3 1RUE1 5GKAC 1PVC1 4CEYA 4GB33 4IV1B 1RUH3 4PDWA 1MEC3 1ND3B 3JD73 1K5MC 2GH8A 1ND2B 1ZBE1 1CJDA 4GH4A 4Q4W1 5C8CB 1NA1C 1HXS2 1HRI2 3VBOC 3VBFC 1AYN2 1C8M3 3VDDA 1AYM2 3JBG3 5BNNC 4CEWC 2WS92 4RS5A 2MEV2 2HWF3 1PO11 1R092 3J8F2 4YVSB 5BNPA 4Q4X2 1FPN3 4CEYC 1HRV1 2FZ1A 2WFF2 4AEDB 4RHV2 4GMP1 2HWE3 4PDWC 1EAH1 2X5IA 5CFDB 3VBSA 4RFT0 5BNOA 1QJU3 1EV13 1QJY1 1V9U1 3VBRA 4GH4C 1NG0A 5C4WA 1K5MB 4CDWA 3VDDC 1RUC2 4CDQB 2WZR1 4RS5C 3VBUA 5AC91 5CFCA 3NAPA 1RUE3 1PVC3 5BNPC 1RVF2 5K0UB 1OOPA 2BFUL 1R082 4LLFA 2X5IC 2HWB2 1TME1 1Z7S2 5ABJB 1ZBE3 3VBSC 5BNOC 3VBRC 4Q4W3 2ZAHA 5C4WC 1RUI1 1NCRB 1AR81 4CDWC 2FZ2A 2R072 1PO13 4WM8A 3VBUC 5CFCC 3NAPC 1VAKA 3DPRA 1HRV3 3LOBA 2QQPA 4GMP3 1VBB2 1EAH3 3JB8A 4WM7C 1FOD1 5A33A 2RMU1 1POV1 1QJY3 1HRI1 1VBD2 1RHI2 1AYN1 1QJZA 1V9U3 4Q4V2
chains in the Genus database with same CATH superfamily
2JG8B 4MLOA 2JB8A 1UU5A 2C1FA 2JICA 3N3HA 2GMEA 1BMV1 4BXSV 1IS4A 2O14A 2WZR3 5FP3A 1W90A 5D1IA 4JHZA 2VQTA 3IIAA 5FOJB 2LS6A 2ZABA 4AAPA 1TNFA 2EXJA 5FO7B 2ATFA 3FUOA 1SBFA 4XURA 3VKMA 5LK7B 5FZAA 1OA3A 3HOBA 1IPSA 3W20A 2XPJA 4XBLA 2J42A 1O3TA 4JX0A 2VNGA 2DCKA 2VUAA 1CIWA 2W08A 2BBAA 4F8AA 2ZGPA 3ES1A 3OGJA 3ZN6A 5IK7A 1IG3A 3MV01 4Q0UA 4ZXEA 1JS9A 1A6CA 1MQTB 5F2WA 5KXEA 4LKEA 3LGRA 5A7NA 4XZUG 3LE0A 1S0EA 5LK5A 3VD4A 3WT3A 2IXCA 1VR3A 2DFBA 5JXGA 1B35C 5E89A 5T5JA 3ZFEA 3OYWA 3LKJA 1P8JA 1YC61 2EIBA 2JKBA 3EQEA 3K3OA 4H2AA 1Z7S1 3BOPA 1VBA2 4QPYA 4XJZA 5LBBA 1FOD3 1LOGA 1SPPA 1G9AA 3GBWA 3K3NA 3OF1A 3CZUA 2ET1A 1B09A 1POV0 2OXBA 3K75B 1PHMA 4XIKA 2DVAA 4YPJA 3RYKA 4UW5A 3UT0A 2WUHA 4JQTA 3Q8AA 4FOQA 4JAAA 5FIXA 3O5SA 1RUD2 4UYBA 4EWAA 5F3EA 3KF5A 1H6YA 4K20A 3O1UA 4KMQA 3LPFA 5B4XA 1QJX2 4Z2WA 1WMFA 1DGRA 3FHIB 4Q26A 2WA3A 4DRRA 3A0KA 4CDXB 3M3OA 1CWPA 1JYCA 2SLIA 3HQUA 3DEMA 3PIGA 4N53B 4OI0A 1W3VA 5IFPA 4GWMA 3IBMA 1FV3A 4RGGA 4BQ3A 1XSRA 4AHZA 5KXDA 1CPNA 3AYCA 1IQDC 1RUC3 1LULA 3M7AA 1H8VA 4I3GA 5F39A 1S2BA 5C9AC 5JIUA 4IEWA 1AUYA 1DHKB 4HVQA 1BCXA 1DBNA 1VBC1 4NRMA 4YVWA 1R083 2R1DA 5CNAA 4DZGA 2P34A 4H14A 4UFLA 2A6ZA 2EXHA 2QDNA 1ZYBA 4XILA 4I2OA 1DZTA 1U5XA 2CYFA 3R4DB 2HWC2 4B8EA 3KS7A 4XCAA 2PAMA 3RNSA 1REFA 3AKRA 2VOXA 3NRUA 4TLGA 3AZXA 3T2QA 1W0OA 4QKNA 4AI2A 4HPKB 5LRSA 4E4ZA 4Q0PA 2R49A 5FZ3A 4QDQA 2XWJB 4MVTA 3PURA 4NO4A 5FMOL 3WNOA 1TG7A 4W4ZA 1JN2P 5I91A 1X36A 2E9QA 3EBRA 1AR73 5A3TA 4IEOA 1OH4A 4R9CA 5E88A 1UZWA 3I8TA 2K2SA 2JE9A 3PVBB 5FLIA 1ENSA 3GGLA 1GNHA 1JMUB 1XBFA 1QY4A 2WA4A 3JD72 3KLSA 5FUIA 1VBD3 5J37A 1REEA 1JOJA 4CP1A 3HBZA 2WN3A 3H1WA 1CAVA 5IK4A 2ZGNA 4M4PA 4QPGC 4L92A 2C24A 1JUHA 5H9QA 1L3JA 1WLWA 4QXKA 5A7WB 1PGW2 3CNAA 3D4KA 1G9CA 3S57A 4IGPA 2A6YA 4B4QA 4AQSA 3J4UH 1M4WA 4YW3A 1V6OA 2FCVA 3D8CA 3CO2A 5CISA 2PAEA 2RS32 4IEXA 4AI3A 2WINB 4LOSA 2VJXA 3TEYA 4XBQA 4XZPA 4DNYA 4JGYC 3HQRA 5DZFA 4F83A 3KV9A 3OY8A 2VD7A 4Y5SA 4Q8KA 1CZTA 1EPWA 3KHCA 3I2OA 3ZXAC 3ACFA 2X5IB 3LEMA 1JHNA 4M3CA 4F7ZA 1R1A3 4HKWA 1G6NA 1G7YA 5FY1A 1L7LA 3ROUA 4GXLA 3TBDA 1HJFA 3BYWA 2GP5A 1QEXA 3QH6A 2QQNA 2WNVC 2CAVA 3LDKA 2J1UA 1OHFA 2ZGQA 3SISA 3VUOA 1JTZX 2PHUA 4BMEA 1OKQA 4M0HA 1DGLA 3PTYA 4QPIC 3LOIA 2WNUC 1Q8VA 2VQ0A 3SCHA 4YSFA 4YRDA 1HQWA 2PHRA 1BK1A 1ULEA 5T5LA 2F17A 2GNTA 5KHIA 3UNPA 2WO1A 1SQ4A 4Q4W2 4GJZA 1GSLA 2V09A 1YHFA 3ENRA 4LHLA 3RQ0A 5C70A 3S6PA 5FZOA 1OT5A 3O0VA 1D4M2 1W8HA 3O1MA 1AR62 1HQLA 2JIJA 4IEUA 5JI9A 3S7IA 1BKZA 1COV2 4J1XA 1JU4A 4QD2A 1LECA 4FO9A 3UKNA 3P3NA 4BQWA 4KGQA 1NUKA 2FCUA 5K9YA 4BIOA 4YGBA 5DXDA 5JUVA 3ZM8A 1HXS3 1AJOA 1JYNA 3I3MA 3RI8A 3POBA 4MSVA 4D7SA 3A22A 1NY72 4LQRA 2MEV3 4HSJA 2VG9A 3VHNA 1ZA7A 1APNA 4OQ9A 3OB8A 4DXSA 3JU9A 1H9WA 3OPTA 1ZRCA 5KC5A 1UIKA 4QHOA 1CAWA 3OCPA 1XPWA 2RS31 2VUDA 5FMBA 3VZMA 1W6NA 2RE9A 1YRZA 2UWAA 4JCKA 4C0BA 2WT0A 4QT6A 1PO23 1FYUA 3M1HA 3RZJA 3WNKA 1VBD1 4CDQA 4CU8A 3ZX7A 1TME2 1B35B 1UNBA 5I8TA 2ZEWA 2P3IA 1ENXA 1KJLA 1OUSA 4HKLA 4XFHA 2RS51 3BOWA 1ZRRA 2PQQA 4UXAA 4AEDC 2GDFA 2R0HA 3LWCA 4UFHA 4DXZA 1RUI2 3B02A 1XB9A 3OBZA 3P1IA 4YG3A 4CCNA 5CFDC 1YWKA 2VMCA 1GZCA 4LBJA 4LKDA 2ZJCA 2GZWA 4XC9A 5FZMA 1DZRA 1JOPA 5DAVA 3U1XA 1UL9A 2FBEA 2XJTA 3CF6E 5LATA 4W6YA 2X10A 1YI7A 4YW1A 1NLQA 1JZ8A 4M3CE 5A3OA 1ZRDA 1XNAA 1ZM1A 3EYPA 2FQPA 4K40A 4P00B 1DGRN 4D7YA 4Q5OA 3KWVA 2Z69A 3IAQA 1XE0A 3VN4A 4AR2A 1D4M1 1AR61 2PMWB 4IEZA 5FBZA 5IK8A 2ZGSA 2Q8EA 5ABJC 1COV1 2D44A 1ZVFA 3WEZA 4IERA 4YLZA 4WBBA 4YZ3A 2WL1A 3NKTA 2JG8A 3BODA 4YYOA 2Q1MA 5A1AA 1UZ0A 3ZKYA 4HANA 2ZGOA 3O14A 1D2SA 1NCRC 3E5UA 2E7AA 2RS13 2R6QA 5FPLA 2ARCA 3K77A 4MHRA 2XJVA 3LFIA 1NY71 1LU1A 4YM1A 1JZ7A 5IW0A 1C8M2 4BU2A 2A7AA 2HYKA 4XQWA 5I93A 1GNYA 4HOOA 2Q1FA 1G86A 5C3PA 4UOJA 5DUVA 3THTA 1QXPA 4JQRA 3TN92 1N1SA 3OD0A 4P14A 2OZJA 4QGMA 4N8MA 1UMZA 4NWVA 2ZPXA 3AX4A 1JUIA 2PLV3 4S2DA 1F5FA 1SLTA 3A7QA 1MQTA 4QKDA 1CESA 5HV4A 2W1UA 3SKJE 5FPBA 4A42A 3OPWA 3ZDVA 2ZX1A 1HN0A 2E32A 2P17A 3WNNA 2B46X 3M3QA 2AYHA 4XQDA 3KB5A 2Q4SA 4MG2A 1W39A 2J1SA 3RZKA 4HLTA 4QPGB 1W6PB 2RJLA 2IXKA 3CU7A 1E57A 2UURA 4RGAA 3W58A 2OZ6A 1VMFA 4XIOA 5LA1A 5AFBA 2D3RA 4LBOA 4NHKA 2PHFA 4I0WB 1W28A 5CIRA 2BWAA 2GNDA 5HPOA 3FL7A 4ZU7A 2VMGA 1HB2A 4N9HA 4KU8A 2WABA 4JGYB 3PTRB 1URXA 5JXJA 1UZZA 2R061 5I0UA 1F4AA 1OF3A 1Z78A 1ZBA1 3O12A 1RUF3 4P5HA 4XJ9A 4CDXA 5FY5A 1O7FA 5D21A 5KWRA 1YFWA 4N53A 3RI9A 5A6YA 4KI5M 4XACA 1C1FA 4Y5Z0 5J36A 1LRHA 1LOBA 2ZHKA 1UCXA 4R4XA 1UYXA 2CDOA 3LAGA 3O1TA 5B2GB 3T0BA 1YJKA 3FJSA 5JXHA 4OUEA 4R9AA 3KT1A 3RFRA 2UWBA 2WNVB 5HV0A 3CL1A 3QD6A 1AL22 1CIYA 2WNOA 2XBO3 1LODA 4FI9A 1J83A 3I3DA 4YWAA 1NCQB 2JKXA 4JGZA 4QPIB 2WNUB 1C8M1 2VCMA 4HSLA 3JBG1 2YV8A 1UYYA 1S2KA 2X53S 2IFRA 4NJ4A 3H3ZA 1SLIA 3ALQA 4Q0QA 2ZGLA 4P9GA 5JSPA 1Y43B 2XMLA 3C7GA 3B5LB 1S55A 4URAA 4E8DA 2VU9A 4FPOB 1FMD2 3O1SA 2HWE1 1PNFA 3WF1A 5TSWA 1F8VA 4QDRA 1DCSA 4HPKA 4AQTA 1EV11 2YBPA 3PMSA 4AAXA 1S2EA 4CCEA 4COUA 2O0OA 3SCFA 1GU3A 4AHWA 4FFHA 1AR92 4FTBA 1F5JA 1QNWA 2WYFA 3ATGA 3E5QA 4YARA 2J1VA 2R30A 4PLMA 3LA7A 3ORJA 3SC7X 2UWCA 4IUGA 4HL0A 1Q56A 3KT7A 2XLFA 4Q1RA 2WN2A 2OX0A 3HEIA 5GKAC 1PVC1 4LK6A 3LQCA 1RUH3 4XYXA 1STMA 3ZN6B 5FP7A 5L36A 5FWEA 1GWLA 1YUDA 4UFIA 4EE2A 2GH8A 2JDPA 3DECA 5A7WA 1EP0A 2GAUA 5FZ9A 3WP5A 2LRPA 3I59A 3INAA 4NN0A 4EV0A 1LOFA 1PX3A 1HRI2 1TE1B 1AYN2 1PM4A 3HBKA 4FT8A 3VZNA 3ZYHA 1AYM2 3KSCA 4DMIA 4CEWC 4YZ5A 4ORFA 5EFUA 1GZWB 4NAMA 2ZEYA 3LSEA 1NYWA 3J8F2 2EA7A 3N7KA 4KG0A 4BDVB 3IZOA 3K46A 4XTMA 5FY7A 3N9OA 2C6SA 5IAVA 4AEDB 4PDWC 5D2AA 4P02B 1JYWA 2W0XA 2X5IA 3C7EA 4JRLA 5CFDB 3B7MA 3KCYA 3SQOA 2V5DA 4JDNA 4RFT0 4BK4A 1LU2A 1V9U1 4EN7B 1JXNA 4JKLA 4LO5B 2JENA 1QF3A 4K8FA 4DXRA 1K5MB 1AX1A 1IPKA 4ZY9A 5F1RA 1WMEA 2D5HA 4ZZ5A 1JZ6A 4JC1A 4XAEA 2E53A 3VL9A 5A3WA 3VHPA 1RC6A 4RS5C 3ABZA 4FOVA 3VDBA 1RUE3 1H2MA 2BV4A 4M01A 5C3RA 1OA4A 1CX1A 4PLNA 1RVF2 3AXDA 4INDA 4EWEA 1XNTA 4AI1A 4MGIE 1FT9A 3OOXA 3ASIA 4Y33A 1K3IA 4LLFA 1XYOA 2HWB2 4AI9A 5ABJB 4XMIA 2I74A 3D3AA 5BNOC 4DB5A 5E1RA 2XXZA 3VBRC 1ZZ7A 3S30A 1Y9GA 1LTEA 3H9AA 1FI2A 1NCRB 4CDWC 4CXWA 4AW7A 3CZJA 3WNLA 4CCKA 1KEXA 2TNFA 4AHYA 1XNDA 4GAZA 2VMEA 3CQOA 1HRV3 2P1BA 3I3BA 4LK7A 5IT6A 5EWSA 2QQPA 3LOBA 2JECA 1W9TA 3I2JA 4QGNA 1VBB2 3GZEA 1ZRFA 2A6WA 3WDUA 4E2SA 5C6CA 5C3OA 4BYYA 5FPUA 3LF7A 4XQ4A 1QJY3 1WKYA 1HRI1 1AYN1 1GQGA 1QJZA 3HD8B 1O6UA 3VDCA 3ZXKA 3ZSLA 2BQPA 3D5OA 5H9SA 4Z8BA 4CCMA 2AENA 4ONUA 4I09A 2XDVA 3J8F1 5FREA 4FTSA 2RR11 3PIJA 5C5UA 5FYSA 5AC93 3CIHA 2VZVA 5FYCA 4WM8C 4RD7A 5T52A 1B35A 1RUH1 3I2IA 3LB9A 5J1XA 2DUPA 4LORA 3VHOA 2B5HA 1JH5A 1S0IA 4KNCA 3QBQA 3RVHA 1H30A 3PMEA 3U4SA 1RUNA 2QZ3A 3VKNA 3BTXA 3BTZA 4DEQA 2UU8A 5FLHA 1HDKA 1YQ2A 2ARBA 1AR83 4R8HA 3VL8A 4PQQA 1MVQA 4PT6A 4CDXC 2EICA 1VIWB 3PUQA 2XLGA 3HN3A 1X8MA 2QBXA 4N53C 4WV8A 3TWIA 5C8CA 5CVRA 1H2LA 5C7GA 4HFSA 3LEIA 4LOTA 2LTNA 3I3QA 5FZ1A 4ASKA 1RUG2 4DINB 1O3QA 2VPVA 4NIAA 2WSUA 2WZEA 3ETPA 2WZ8A 4YVSA 3WVJA 4CRQA 3PHMA 2VGDA 2BVBA 4JGZC 1YIPA 2LM3A 1QOOA 3HAGA 2JXAA 2WS93 3H3LA 1DQ4A 3BPZA 2F4LA 3BU7A 2W46A 3V0BB 2Q5TA 2AGSA 3AP7A 5FXVA 4Y24A 3MZHA 1R64A 3WXPA 5FRAA 3I4IA 4OZXA 4R9DA 3MPBA 1DFQA 4FFGA 4Q1PA 1VBB1 4IEQA 2BNNA 2ARXA 2VW0A 2VOVA 1BEV1 3LEKA 3AP4A 4AFCA 1MS4A 4LJHA 1K12A 5HBAA 1VE0A 3ZYJB 2D97A 5DG2A 1Z0HA 2WC2A 1YEWA 5FK8A 1BBT2 3AP5A 2ID4A 2ZGUA 3W5NA 3FUQA 3ZMNA 1G9FA 3AC0A 2QFEA 2WQ4A 3AYDA 1PIV2 1NQDA 1PVXA 3KZ4C 4KGGA 4LHKA 3R4SA 2FDKA 3DN7A 3I54A 2VXRA 5FJKA 2YB7A 1E5IA 1Q8QA 1IOAA 2VBPA 3K2OA 5FZKA 4DQAA 4CCLA 2IZWA 1BVVA 2VW1A 4H7MA 5FDBA 3VDAA 2XR4A 5C5TA 5IVCA 1Z7S3 5F3GA 5IVYA 1DQ0A 2R042 2HWD2 1WW7A 2HYXA 3D82A 2YFZA 4AGGA 4QPGA 2YHJA 1W6PA 3Q8FA 1WCQA 5FYMA 4CDUC 5SV5A 3BKZA 3MDPA 5FZEA 4BJ0A 4Q4Y2 4NVPA 1VALA 2VMHA 1ASJ2 4WVMB 1RUOA 2CNAA 1S0JA 2OQ7A 3MHZA 4CEWB 1RGSA 1GBGA 1JBCA 1RUG1 1MEC2 2V72A 4BQ5A 5CU1A 2Y6HA 4JGYA 3J9SA 3WF4A 4KWUA 5LBCA 3MUY1 4YM2A 1W8NA 1W2UA 1I5PA 2AUYA 5DUUA 4EZ4A 5ACA1 2MNGA 4PDWB 3NV3A 3NSTA 3IDAA 4FPEA 4E9KA 1PNGA 3IDEA 4M3CF 2OKXA 1OURA 4XPVA 4UW6A 3TNQA 5FTTC 1FNYA 2D6NA 2WNVA 2Y34A 5EJZB 3WCSA 2C26A 1ZZ9A 2YU2A 4QHBA 4MHUA 4MV2A 1NCQA 1VBC3 3BN6A 3E6BA 2DTWA 1BYHA 2WNUA 1JHJA 4QPIA 5FZ4A 3WNXA 3HQXA 4P5YA 5FYVA 3X29B 2ET7A 3IN9A 4RS5B 1CGPA 1UY1A 4LE3A 1V6LA 4QB1A 2CWSA 3LDBA 3SNMA 1DYPA 1C4RA 4XF3A 5EP9A 1LJ7A 3ZFGC 1QJU2 3GZUC 4COZA 4TLFA 5DG1A 5FUPA 2XONA 1T6GC 1VRH2 2QQWA 1QGLA 4A7YA 1PIV1 1W9FA 2Q8DA 5CZKA 2WS91 1ACCA 4NOTA 1R091 2QCSB 5BNOB 2IFWA 5D8AA 4CE8A 4EQVA 4Q4X1 1GZ9A 2DV9A 2O1QA 3OGRA 3VBRB 3MIDA 3ZMOA 2H0VA 3ZOIA 1VBE2 1O4YA 1FNZA 3PVEA 4UFKA 3MI8A 4QXCA 4RHV1 2W68A 4CDWB 3RZZA 2A5ZA 3MW4A 5IFTA 1OKOA 1N47A 3ZR5A 2R041 3S5AA 2XLAA 3IDCB 3IMNA 3A23A 3NV2A 4FQ4A 1SDDB 4AG4A 3NWKA 2B7YA 1V6IA 2DCJA 3DYMA 1X8EA 4ZZ8A 1NOVA 1S4CA 1XC6A 2KA3A 2WQZC 2XH6A 3FMGA 4LIVA 4AFAA 4YZ1A 4Q4Y1 1IKPA 2ZCWA 3ST7A 2YUEA 3TYJA 1ASJ1 4ZU4A 3WW4A 5EJ1B 5DAWA 2VO5A 5T3NA 2QUOA 2VZSA 1OPMA 4LEJA 4RR3C 1PZ7A 3MUZ1 4GQ7A 1US3A 2Y6GA 2VNOA 4IE4A 1UYPA 2VBDA 2WBKA 5LRRA 2NQYA 2W52A 1FATA 5H9PA 2DUOA 1H9PA 4A44A 1GZWA 4WM8B 4OHZA 4C1XA 1SLBA 4QU1A 1MZFA 2DUQA 3THDA 2RDQA 2NPIA 4HKOA 3T0AA 3WV6A 4AGRA 5HXVA 1XU1A 2QJVA 4AEDA 4XF9A 4DIQA 2JD9A 2YG0A 2R071 5A33B 1UYZA 1ND3C 5CFDA 2VXJA 2VVFA 1UOBA 1YXWA 4YFWA 4A3ZA 2UY9A 3RPQA 4XUPA 3UGHA 3O1VA 2ES3A 3AB0A 5C8CC 1K5MA 4QQHA 2YC0A 5JZGB 5JMOA 4AQ2A 3GJAA 3ZIXA 2YROA 2C5DA 3ZLIA 4Q4V1 1RHI1 2BTVC 1VRH1 4NR1A 4YVSC 4QU2A 1DIWA 3NJYA 3Q8BA 3VB9A 3DL3A 1GOGA 3JCIA 3ON7A 5DDJ2 1AVBA 2OW4A 5FZLA 3WG1A 2ZTNA 3AMMA 1SCSA 5IATA 1EPZA 4DS0A 1DF0A 1DQ2A 5ABJA 1JZ4A 3FX3A 4UI9L 1QOSA 4JGZB 2ZX2A 3FE5A 4BIFA 3GBFA 2BU9A 4ITCA 4CUBA 5JOXA 2GU9A 2RG4A 2VMFA 3C7FA 3ZVXA 4CYDA 2JJ6A 1RUJ2 4QM8A 1MS0A 1NKGA 1NCRA 2QQOA 4YW4A 2N7GA 1FOD2 2EIDA 1EUUA 2VNVA 3DXUA 3NW4A 2DCYA 5GM0A 2XHKA 3KQRA 3PUIA 5A70A 3WW3A 3VKOA 3H8UA 4P9XA 2JDYA 2Y0IA 4Y1UA 3WDYA 2B39A 2R1BA 3IWZA 2PA7A 4XFCA 5E8AA 4FBFA 2RS33 2CSGA 3B94A 1VBA1 3WZ1A 5IJRA 2DWRA 3AXEA 3ZSJA 4XJUA 1ULFA 4FXKB 1W05A 5BV6A 3PDQA 4LT5A 2ERFA 5LZ6A 3AZYA 2G9GA 4AFMA 1RUD1 2RS53 5F8PA 3I59B 2JB4A 2KD7A 3N35A 5B4NA 2B8MA 3PLQA 4CDUB 1QJX1 4X8PA 1AHSA 1FPN2 3P3PA 5DZEA 3U78A 5FY9A 3ZXJA 4BQXA 3LD8A 2IXJA 1HB4A 2D7FA 5LY2A 2J7MA 4Q8LA 4AVVA 2A73B 5C8WA 1GUIA 3WUCA 3WCRA 1MS9A 1OQ1A 5F5AA 4L11A 3GJBA 1HX6A 3POSA 3BUCA 4AVBA 1EY2A 2C9AA 2QNKA 3N9LA 4YW5A 1J3RA 1ZZ6A 5DDJ1 3DYPA 4I30A 3HWJA 4E8CA 1D4M3 4D69A 5FYYA 4QWNA 1AR63 1W2AX 1PK6C 4N90A 1S1AA 1RXFA 1E5RA 3O0XA 4ES8A 4RSUA 4M4RA 1COV3 3T0DA 1LHWA 1MZEA 1LAJA 1AR72 1NCQC 1RUJ1 4K21A 4RQPC 2DVGA 5FJHA 2HWC1 3LIGA 3S7EA 4EROA 5JMCA 2XJQA 1KDMA 5I0RA 4COWA 3VLBB 1DP0A 3V0BA 2QQUA 5EZWA 4AOCA 1ZBE2 4PIYA 4W8JA 3VHRA 5A3LA 4AGVA 1LOAA 4AEKA 2OA2A 2OIIA 2P6CA 3ZFGB 1DLLA 3VD7A 3OUIA 4CP2A 4I3PA 4QGLA 2Q30A 3SHRA 4HETA 5D8AC 1GLHA 1W04A 2EXKA 1DQ1A 4PLOA 2BGPA 2BUKA 5H9RA 2BW8A 1NX9A 3JD71 1J3PA 2WT1A 4IEVA 1X50A 5L9BA 5KR7A 4UFMA 1KRIA 5L9RA 1C3HA 2C4XA 1X9PA 5EYXA 5FYHA 3DF0A 5FOBB 3QLQA 3VBHC 1OLMA 2W1WA 3WDWA 4Y1VA 4CUAA 3C8XA 3DV8A 4FPKA 1PGW1 1QMJA 4GULA 5FKCA 4XW3A 1UY3A 1ULDA 1YO8A 2G1MA 2QQVA 2W39A 4ISRA 3JQWA 3ZYGA 5JXIA 3RDIA 3ZYPA 4HMZA 1FPN1 1UY4A 1SMVA 1YNAA 1SLCA 1WA4A 4FPFA 4R52A 2YDEA 2ARAA 5IYYA 3ZKUA 2RDSA 1AXZA 2ADEA 1LOEA 1LHOA 2A1XA 4LMFA 4NRQA 5F37A 2NMNA 2BGOA 1CAXB 3HT1A 4Y4RA 4H3WA 1SBDA 3N7JA 4RR3B 4WVMA 5FK7A 5A32B 2NM1A 4D8MA 4NMIA 5IHRA 5KXBA 3POIA 4GJYA 3WQ1A 4CEWA 3PU8A 4QQPA 4O61A 1XJAA 4KWLA 2QQMA 4PIZA 3QACA 1TVGA 1W6MB 3KGLA 5DAXA 2FDIA 2R063 5JDBA 1ZBA3 4Q27A 1MACA 1Y4WA 3AKSA 3MICA 3K4DA 1U0AA 2J1AA 2A3YA 4PDWA 4E2GA 3EXUA 2CHHA 1ND3B 4YG6A 3M70A 1K5MC 4XHXA 2DCTA 1T6BX 2QZ2A 5T5PA 1ZBE1 3PJYA 1X7NA 4IGQA 4NE9A 5SV8A 1N1VA 1UIJA 4Q4W1 5F2SA 1NA1C 5C8CB 5FP4A 1HXS2 2VCCA 3VBOC 1W0NA 4HK8A 2C0ZA 4MADA 4ARXA 1C8M3 2CV6A 2BNMA 4YZ2A 2JDMA 2B45X 3JBG3 5BNNC 2VR4A 2E31A 4RS5A 2MEV2 3DCQA 5IVJA 1RINA 4KQ7A 4YGCA 5BPXA 2EAAA 1YFYA 2ENRA 2CY6A 4U36A 4YVSB 5KHJA 2YYOA 4Z82A 3AL6A 1HB3A 3OSDA 4BM8A 4CEYC 3VV1A 4DRVA 2WFF2 4N7UA 4QX7A 5FO8B 2G4IA 1VPHA 2VZ1A 4ZPIA 2HWE3 2ZKNA 3VD3A 2BYVE 1YCIA 2ZGKA 1WW5A 3H7YA 3ZDSA 5FKBA 5BNOA 1EV13 1HKDA 2BWCA 1D0GA 3C2UA 3VBRA 3K48A 3KVAA 3CEWA 1XRUA 3ES4A 4AF9A 4GH4C 3U14A 4OUMA 1JZ3A 3AFKA 4BA6A 4NHMA 5I0SA 4GD4A 4D7TA 4CDWA 4FXGB 3GM8A 4OVEA 1Y7BA 1U12A 4OHXA 1I1EA 2WO7A 4Y20B 2ZGTA 2MHFA 4EN9B 4I0BA 4NIHA 2V4VA 3NJVA 4JZRA 3A21A 1PVC3 2QE3A 2QKDA 4Q29A 5BNPC 1JYTA 4S2GA 1XOYA 1OLME 1L7QA 4PI0A 4PHZA 1KFXL 2AACA 4A3XA 3G7DA 3Q8EA 3MLJA 4KH9A 1LCLA 2ZHLA 4OZOA 2K0GA 2JD4A 5FZDA 1TME1 4D0QA 3T30A 3U10A 1IS6A 2ZAHA 1GNZA 1O5UA 4IGOA 4YGEA 5GZEA 4Y1YA 5GALA 1RUI1 1W2TA 4QX5A 1ZRIA 3POEA 3RRDA 4GKYA 4OUSA 1RITA 4DOUA 2PHTA 3E5XA 1DU3D 5GLUA 4WM8A 3NAPC 4BMBA 1VAKA 3I3EA 4FAHA 3UV9A 4F3JA 2DURA 4G9SB 1OFSA 3JB8A 4I02A 4Z07A 4IE5A 5A33A 3MGUA 5CG8A 1POV1 1BQPA 2SBAA 1XE7A 2HKXA 2VCAA 2WO2A 2YBSA 4ZXKA 5CYYA 4NIIA 1GR3A 1V9U3 3VKFC 5F9TA 2G9ZA 2WFPA 4HVOA 3U4XA 1RJ7A 1OBNA 3OJBA 3KF3A 4GKXA 5JZGA 2GMPA 2W87A 1O3SA 4XUQA 2XB6C 3AJZA 4ATEA 2WFF1 2AH2A 1LR5A 1GFF2 1CAUB 1FMD3 4D6RA 3J7MA 4RFRB 1PK6B 3N9QA 5FBJA 3SH4A 2Z4FA 1NZIA 4AZZA 2D3SA 2PLV2 1UQXA 4RN5A 1LENA 3SXWA 3H1MA 3OD4A 3BI3A 4XABA 4BQ2A 2D98A 5FZCA 1IQAA 3POYA 4RQPB 1OC1A 5JLVA 2WO3A 2PXJA 2QQLA 5DABA 2A75A 3L2YA 3PL0A 3U75A 4XFGA 3ACGA 3VD5A 4OCTA 4TZDA 4DPNA 4AE2A 1R1ZA 5GZDA 2ZS6B 4XOGA 3TN91 5CADA 1H4HA 1LESA 4P9WA 4R9BA 3USUB 4IQPA 4CUGA 4KWKA 5CB7A 2DFCA 3B69A 3HIFA 3H8OA 3O7OA 2OUHA 1CPMA 2QQKA 2W9XA 1YYNA 4YW2A 5D8AB 5FMCA 3BALA 4LA3A 2EALA 2EIGA 3T2PA 1W9YA 4EYUA 1WW4A 2RM22 1HRI3 5EV7A 3D0JA 1AYN3 4MGTA 2W2IA 2V4AA 4PBOA 1F2NA 1Q3EA 1AYM3 1ULCA 4C90A 5LBFA 4PF1A 2PQSA 3SEEA 3WDXA 4XVHA 4FQZA 3BPSA 1ST8A 3VBHB 3J8F3 2RR13 3J7HA 1VAVA 1RYYA 2CGNA 1ZREA 4GWJA 3MIEA 1C8NA 1RUF2 3MIBA 4GIQA 3V64A 4BE3A 1OA2A 2HBTA 3KVBA 5T55A 2HH9A 4N7IA 2DBIA 1YQ8A 2HLEA 5IVVA 2BFUS 1TMF2 1XYPA 2ZA9A 4R4ZA 2D5FA 3WG2A 1KS5A 4XMAA 2VL4A 3CJXA 1Q8PA 3F95A 1W03A 2QQJA 1BLZA 2H0BA 1V70A 5FWJA 2XBO2 4CDUA 1KXGA 3G6JB 3IM0A 2AZ5A 2UYBA 1A3KA 4LHNA 4Y5TA 1RMU2 2ZAAA 4P08A 4XJ8A 5FZFA 3R05A 3SH5A 3RYRA 2I45A 3W9AA 1AX2A 2Q1ZB 4XXPA 1Q8SA 2GSYA 2ETEA 2VZOA 4HN1A 4K9SA 4M0NA 2WSVA 1H8TC 1W8ZA 2PYTA 3ECQA 5LCWL 5FZGA 3CDZB 2HWB3 3MW3A 3ZFFC 4O9GA 1AL21 3FLRA 4GWNA 2Z2SB 5JOWA 2A6VA 1E5SA 1YQCA 1IZ3A 1O91A 5AVAA 3OG2A 4LR4A 3UKVA 1UKRA 1XNBA 1GOHA 3DKWA 3AL5A 5EPAA 3IAPA 4Y3OA 2X8KA 4L99A 2QDRA 5FPVA 4C8DA 4JHTA 4KBZA 3U11A 2B9VA 4L9BA 1GZTA 5CG9A 1YLLA 2QTWB 1NA1B 5JAXA 4CXXA 2B42B 2RHPA 3VBOB 1UW8A 1FMD1 3KV4A 1PMIA 4H7LA 1W6OB 5BNNB 3WP6A 1VBB3 2VMDA 1HN1A 2RDRA 1OI6A 2Y33A 4ISQA 1BEV3 1X9TA 4BQYA 4FSJA 3ZFGA 2ZMNA 2CAUA 4LNVA 3RYPA 4XHBA 3T4HB 4E4DX 3WQBA 3K4AA 2WR9A 1A78A 2GN3A 5APAA 1QU0A 4XAAA 5T54A 2LUWA 2Q8OA 4CEYB 1AR91 3N36A 3A0NA 3VZJA 4CCCA 1K5JA 1L7RA 2P4EA 2W95A 1XYNA 3GBGA 3POJA 4QB2A 2H6CA 3KV5A 4XDPA 1H1IA 3L2HA 5L7OC 5JI7A 1HJGA 3CKHA 2A70A 1WMDA 1EUTA 4GH4B 4O65A 4B7KA 1JODA 1ENQA 3UJOA 2DBNA 4FOYA 5GJ6A 4IESA 3H8XA 4XJAA 5FP8A 2P2KA 2BBVA 3OBTA 3F2ZA 4A7ZA 5I8SA 4LUKA 5A3MA 1K42A 4COVA 5BNPB 3FBMA 3ELNA 3ZYBA 2VUCA 3M8LA 4PF5A 4IW3A 3WLUA 2NP0A 2JIGA 2WIIB 1AYM1 3BIWE 1W9SA 1OD5A 2E7TA 3RZGA 1RMU1 4KL1A 4CP0A 1LGNA 4ET7A 3E6DA 1CVNA 2WQ8A 4NROA 2HBUA 5J09A 2WZPP 1CAXA 1T2XA 2BZDA 5A32A 4RR3A 1H2KA 4UT5A 1C28A 1UU4A 1W6QB 1VLNA 4HZFA 3CLPA 1UKGA 1RUG3 3LDRA 1D7PM 3OGGA 1WCKA 4MGYE 4OHWA 4D94A 3AMNA 4LKFA 2UYAA 2WYSA 3E97A 1W6MA 3NAPB 1PZ9A 4N43C 1J59A 3RG0A 2F4PA 3U0ZA 1W8WA 4ZS3A 3WDTA 5ACA3 2D6PA 2W3JA 3QH7A 5T5OA 2A71A 2CWMA 4LULA 1OH3A 2JDAA 5EQUA 1ND3A 4JKKA 3FWEA 4IE6A 4ATFA 1E5HA 4U2AA 2TUNA 5JZGC 5KBFA 3ZYFA 2IVIB 1Q8OA 1XE8A 2Y8KA 4AVTA 4D6SA 1RVF1 1SDWA 3B01A 4P9IA 5BXXA 2WWJA 3H3UA 1SEFA 3H0OA 3Q9OA 1J1TA 5LA9A 4D3WA 3IKWA 2J22A 1HRV2 2W94A 2R0FA 1PGL2 2HWB1 4MXWB 2ORZA 3E1F1 4WZCA 4P9LA 4QXHA 4LO6B 3NNGA 1QJY2 2RDNA 5CKQA 2IWGB 4B1LA 1NLRA 1PIV3 1YJLA 2ZBJA 3R0RA 2YFUA 4C0HA 3PJQA 4XF1A 1R093 1GQPA 3IB3A 2QQIA 3MLKA 4Q4X3 3SITA 1ND2C 2Y26A 2CTVA 1ULPA 4UBHA 2HEYF 3NNLA 4HXCA 1AF9A 3USSA 4A2UA 3WDVA 5AC92 4RHV3 1RXGA 2PELA 2RJKA 3OBAA 2VMIA 3RWNA 4DEVA 5BY5A 1RJ8A 2R043 4MGKE 4Y20A 3A4UA 1KQRA 2HWD3 2DTYA 3MLLA 1QQP2 4AHXA 1YFUA 3AP9A 3B3QE 1JI6A 3ZXEA 5I0TA 1BK0A 1VRBA 1ZZBA 3ACHA 5GLWA 4Q4Y3 2Q8CA 4PQ9A 1QXRA 1NZCA 1N1TA 2E33A 1ASJ3 1AR82 4TYSA 2ADDA 5KXCA 4COYA 5HCBA 3AMPA 1IS3A 1MS3A 4IDZA 1TZOA 4BXFA 1SFYA 1PZ8A 2ORXA 4QQ2A 2ZEXA 3TEXA 3RWKX 5FPZA 1TQ5A 1XQNA 1QDOA 1GYKA 1YIFA 4B4RA 2ZGMA 1YI9A 2RMU2 2XOMA 1MVEA 3AK0A 4OI4A 3SKVA 3RGBA 5FYBA 3UGFA 4BOWA 2OS2A 3H7JA 4J25A 3ITQA 1PMHX 5K0UC 4OMDA 1G9DA 5A6ZA 4LBKA 1O8PA 1HW5A 3CHXA 3GALA 2BEOA 1VB4A 2R073 1BMV2 1GOFA 2A3XA 2JG9C 4SBVA 4QXBA 1X33A 3NL1A 3M3EA 4MGSA 4GB32 2YC2A 1PGL1 4LO7A 5BNQA 3JZVA 4XCBA 3TB0A 1MZ5A 5DQ0A 5DUXA 4Q4V3 1RHI3 1O3RA 1H8TB 1FXZA 1VRH3 2J1TA 1OPOA 4FCAA 3WX5A 1CAUA 1U5ZA 3GHNA 4HK9A 5EXOA 1NXMA 2GALA 3ZFFB 1N3PA 2DYCA 2NYYA 5FYZA 2VZRA 2Y6JA 2XJRA 5K8SA 1PK6A 1WMXA 1UMIA 4WZFA 4LE4A 4GALA 1GMMA 4OQ8A 1LB2A 3K51A 1VBE3 2HWF2 2Y6FA 1KGYA 3VGIA 3H1YA 1H1AA 1CJPA 2Y60A 4RQPA 3FBYA 5JOZA 3J26N 4FP3A 4CP9B 5G04L 3D0SA 5ISLA 4HBNA 1QQP1 2E6VA 4BB3A 4NHLA 1BBT1 5IK5A 3ZXLA 4LHSA 3AMHA 1ZZCA 5T50A 5J7MA 2NLRA 1C5IA 1QJEA 3USUA 4ASLA 1ZZ8A 1DGWX 1O8SA 3HNBM 1S0GA 1OMIA 1ULOA 4YZ4A 4LBMA 4IV3C 3WF3A 3KCXA 1JYVA 4K1ZA 4BQ1A 4ARYA 3KMHA 4XUOA 2O8QA 3GZAA 5L7OB 1KITA 4L97A 1J3QA 1W9WA 1VBA3 2W5FA 3MPPG 4KG8A 2D6KA 1U5IA 2FHRA 5FZIA 5A7PA 4ES9A 2NN8A 2HWD1 4FFFA 3GXUA 1D4VB 4OMCA 3SLIA 2IUWA 3VBHA 2IVJA 4AFBA 1ZNPA 1RTVA 4PI2A 2JEMA 4FPHA 1QDCA 1N3QA 4FPCA 2X29A 3JB4C 1NLSA 4E27A 1RUD3 3LPGA 3POWA 4Y1ZA 3WF2A 5HXMA 3U07A 4V1PA 5AVPA 4GB31 2W92A 1OVPA 1PO12 2XJSA 2GMMA 2DVDA 1QJX3 1GWMA 3LEGA 1MEC1 2VTXJ 1OUXA 3ZPYA 1AL0G 3O0WA 1VBC2 3SEPA 3DXTA 5FV3A 2JDZA 3DGTA 4LITA 2HEVF 2ZKLA 3ZXFA 1EAH2 1S0DA 4MOAA 4TXWA 4BH9A 3MYXA 2ZACA 5G05L 4FAGA 1C5HA 3OPZA 2GC2A 1NAEA 1C57A 3DYOA 2D6LX 1IGOA 5JR7B 3K4ZA 3GCXA 1WW6A 3PVOA 4ZS2A 5DDJ3 4ZU5A 3ZSKA 3FC0A 4EJRA 3ZYRA 3MFAA 4N43B 4G4FA 2HWF1 5LASA 4NHYA 1WBLA 5FP9A 5IWFA 1OXCA 2WZR2 1HIXA 3CJIC 4C91A 4K3UA 4YW6A 5FY0A 4XFIA 4C1WA 2XJUA 4P9JA 3KGZA 3UJQA 1TNRA 1I6XA 2WWSA 3UL2A 1MS8A 1RUJ3 5A3PA 3EMRA 2VOKA 2A3WA 2VBBA 3I97A 4TSVA 1GWKA 2HWC3 2XL9A 1KD7A 4I01A 1QJU1 1DYOA 5JWPA 4BCUA 3ZSEA 1NA1A 3DKQA 3L9JT 3VBOA 1LKNA 1KDKA 5F3CA 1UO9A 2BOJA 2KR2A 3T4VA 1W6OA 2PFWA 5BNNA 4A4AA 5CKMA 1V6MA 1C1LA 2AEYA 1QH7A 4BPZA 4EN8B 2JWPA 1VBE1 1AJKA 2OQ6A 1REDA 4FPJA 4CEYA 1O4ZA 3I49A 1IG0A 2GC3A 3C3VA 4WVVA 1DLCA 4ZONA 3JD73 1H1MA 3HNMA 1H6XA 2ZHMA 3ME2A 4IEPA 5EYYA 2E7QA 1ND2B 1HV0A 1CJDA 2AR6A 2P5BA 1F4HA 4LBQB 5HCFA 4LKSA 4RL7A 4GH4A 4XBNA 4JTOA 4ZHNA 3TRSB 5FY8A 3VBFC 3E6CC 1LOCA 1BZWA 2GNMA 2Y38A 1GICA 3AKQA 4UFJA 5HCHA 5A1FA 4JV4A 1PO11 3MW2A 5DAQA 3BIEA 5BNPA 3QOPA 1BHGA 1FPN3 3T2TA 2WKKA 4UF0B 5ANQA 2KM2A 2XVLA 2FZ1A 4LBQD 4DO0A 5CAZA 5LY1A 4A41A 2ZHNA 4GMP1 2PHWA 4HG6B 1EAH1 1QJFA 1W8UA 3WG3A 4AXOA 5C33A 1CQ9A 3VKLA 3O1RA 3POFA 2YXSA 3AMQA 4KWJA 3KHBA 2VY0A 2R16A 4XFBA 2GC0A 4W65A 5DAPA 4OULA 1O59A 1W6QA 1UY0A 3I2DA 3VDDC 4NPRA 4AK3A 5LWBA 1RUC2 2OUJA 5LEKA 2WZR1 3H50A 3UGGA 4XJWA 3IMMA 4Y26A 3APBA 3NNJA 3NAPA 3FHAA 5F7UA 4Y22B 1A8MA 1V6JA 2LW8A 2TEPA 2FDGA 4LUMA 5K0UB 1OOPA 2BFUL 2I07B 1R082 4Z1VA 1ALYA 5DMYA 5LA2A 3FFZA 5FY4A 2JG9B 2WAAA 5EJ3A 4FFIA 3RSJA 3V0AB 3WUDA 2GC1A 1ZBE3 3ZO0B 1DGWA 3U37A 3VBSC 4AFDA 2VC9A 4UW4A 5FXXA 1DZQA 4Q4W3 1ZX5A 2FMYA 4AEMA 3B9IA 3LCPA 5C4WC 3VZLA 3WP4A 5C3QA 4L0PA 2O8OA 1QXJA 2PAKA 4OFGA 2FZ2A 5IVFA 2CL2A 4MXWA 2P37A 3VBUC 2ZOEB 5CFCC 2EF6A 2ZEZA 3OGSA 2VZTA 4H55A 1UZVA 1AX0A 4XFAA 1WLTA 2WLQA 1A34A 1FOD1 1DYKA 1LGCA 5KHKA 3IIIA 3UESA 4EN6B 5L19A 1VBD2 4E2QA 1JYXA 3IDBB 2VE1A 2YY1A 3HR9A 4BZ4A 4CTEA 4DUXA 4CPBD 4O7XA 3H42B 3JUUA 3P5BA 4LTAA 4RGKA 2RS52 4AYUA 1RL3A 2D40A 1JOBA 4K8RB 4MGQA 1W2OA 2W91A 3RS6A 3DPRC 4MO3M 1IPJA 4Q2FA 4HT1T 1QKQA 3BTAA 1DQ6A 1WBFA 5FLJA 3ILFA 5FZ7A 5FCCA 4M00A 4IV3B 3AZVA 3OTFA 4PIXA 4Y4YA 3WHUA 5C3SA 3PUAA 2UY8A 2VZPA 1TME3 3PU3A 4NWWA 1JZ5A 3THPA 4UBGA 3AKTA 3ZPOA 1HLCA 5KHHA 1BXHA 4IV1A 1CONA 4OI1A 1VAMA 5FO9B 1I3HA 4WM7B 1RUC1 4MZUA 1ODNA 2P3KA 1RUI3 1PX4A 4A45A 1R1A2 1WUVA 1OQEA 4I0AA 1Q43A 3WOGA 1K45A 1SCRA 4CSWA 5J48A 2ZZQA 3V56A 4PBPA 1WLDA 4W6XA 1R081 4OYUA 2WDBA 4XFFA 2TBVA 3TEZA 3T1LA 1O4TA 2WLPA 2C9KA 3BVCA 4P9YA 2FDHA 2FD8A 3J7LA 4QX3A 5LB6A 5GZFA 4DY5A 1EYBA 3T1MA 4AVSA 1POV3 2BVVA 1WCUA 3MV11 1M06G 2X05A 4LO8A 3RZLA 3IPVB 2VQAA 4Y1XA 1NE4A 1QWRA 4JDMA 4NHXA 5A7OA 5JSRA 4A6OA 4CXYA 3AVSA 2JDNA 4GWIA 3RZMA 2LROA 4YG0A 3MFCA 2D3PA 5JVVA 1H8TA 1AR71 1GKBA 2WFF3 5IVBA 2ZMLA 1LEMA 5F5QA 1Y9MA 3WNMA 4HN0A 3NJXA 5HCAA 5JIAA 3WW2A 1QHDA 2EIEA 3ZFEC 3ZFFA 4NIGA 4ZKTB 2NZ9A 2ZX3A 4TWTA 5FZBA 1HQNA 5GZCA 1MZ6A 3CJIB 2XQXA 3W59A 5JCTA 3S5QA 3T09A 5L73A 3FFQA 2YC4A 1WD4A 2IXLA 3WW1A 2VM9A 4QMAA 1UPIA 4FP2A 3N9MA 5A3UA 2D43A 2PHLA 4DY3A 4CP9A 4QM9A 1HV1A 1UX7A 4AL9A 2ZZJA 4YFZA 3RMXA 1OQDA 3HPNA 5DUWA 3KD4A 5JOYA 2XUMA 3TN93 3ZYIB 4BLIA 3NNMA 2XKOA 4QKBA 5LEJA 5FMDA 1IKQA 2JDUA 4QKFA 5K7PA 1XSQA 1PO22 2BOIA 2WWUA 4JVAA 3AZWA 3UETA 3UK9A 3AYAA 3P6BA 5J96B 4CU7A 4AWDA 2CGPA 2W1SA 3WG4A 2XG3A 4K6BA 1CX4A 1IHMA 3BCWA 4BWOA 3HT2A 5L7OA 1POQA 1R1A1 1ZA4A 1UXZA 4AVAA 3T3YA 1YQ6A 2Z5WA 2W1QA 2R062 3BTYA 1ZBA2 3VBFB 4CCJA 3RZHA 1WD3A 1N1YA 4EN0A 5LW9A 4YVWC 3WSOA 5C9AB 1UOGA 1NT0A 3V65A 1F35A 3HNYM 3J7NA 5LBEA 3UYJA 4XEZA 3GHMA 1OFNA 2FDFA 3LIHA 4WVZA 4QQLA 3PUSA 4FVVA 5F6LB 2XUEA 4JKMA 4MYEA 2YPDA 4NRPA 4A6SA 1XNCA 1WLCA 5FYUA 1PMJX 3JBG2 3OUHA 2OYZA 5JPNB 4CU6A 3HN1A 4E4SA 3MF6A 1F9KA 2YMZA 1NXD1 3I2HA 2BERA 4LBNA 4JDOA 2DVBA 1UZYA 4LIUA 3BU0A 3VDDB 1KS4A 2D93A 5IVEA 1OOPC 2J1EA 1SG3A 1Q5OA 2HWE2 3NMBA 5IAXA 2K46A 4N43A 2VQUA 1AL23 4BK5A 1OD3A 1HXS1 1EV12 1NE6A 2RS12 4IEYA 3POGA 3W21A 3WF0A 1BVP1 4DFSA 5JSOA 1OSGA 2OT7A 3KV6A 4V2VA 3C7HA 4XUNA 3QCWA 4YNIA 2MEV1 2D6MA 3BB6A 4EWDA 1GP5A 3AM2A 4K7JA 3NV4A 1RB8G 3RJ2X 3IT8A 3VBSB 3GF6A 1JYIA 3N7LA 4AI8A 3AFGA 4X8NA 5C4WB 1PVC2 2OPWA 2V73A 2Y6LA 1UU6A 1V6NA 4Z2AA 2H6BA 5EIYB 1QOTA 2WAOA 1PO21 1XNKA 1JU3A 3PNAA 4A7KA 1GP6A 5CBLA 2XKPA 3VBUB 5CFCB 5FZ8A 4X6QB 2RM23 1A8DA 4QX8A 2AREA 1ULGA 2E26A 1AR93 1ONAA 4GZ9A 2ILMA 2FCTA 4ASMB 2DF7A 1ND2A 3B9CA 3MIHA 1PM7A 4LBQA 1IS5A 1OVSA 2XL7A 5ANNA 1TMF3 4G3YC 4OHVA 1QIQA 2CU5A 3N9NA 1DDLA 1SLAA 3FLTA 4MUVA 4IE0A 5FQ0B 3ZR6A 2ZMKA 3TEWA 4MH0E 1CZVA 3O1PA 4AVCA 2RJ2A 2Z79A 3KM5A 4QX1A 1MR5A 3DPRB 3CMGA 1V9U2 4UF0A 4IV1C 2XWBB 4CVUA 2VZ3A 2OVUA 3GNEA 1RMU3 1J84A 3D6EA 1QH6A 1LNSA 3KCCA 1H4GA 5BUVA 1US2A 2ZGRA 3I2KA 2YPJA 5FMOS 1VP6A 4NUBA 5K4LA 1WCSA 2Y6KA 3AJYA 1FAYA 2EXIA 1MS1A 1QNYA 4Z92B 1S0FA 1DG6A 1G9BA 5J98B 1GP4A 1YFXA 2RS11 4B7EA 4BISA 2L9LA 2P3YA 1LHNA 4Y22A 1YQ5A 2CGOA 2IC1A 2R32A 1WZXA 2VVDA 2X09A 4AQ6A 2BGCA 5K0UA 2XVKA 2G9FA 2XHNA 3MIFA 4QQOA 4B4PA 2Y0OA 3ETQA 1ENRA 4FTEA 2JG9A 2FDJA 2WRAA 4N9IA 5JR2A 3V0AA 1WGPA 5IUQA 5FFOC 5FXWA 1RVF3 1ODMA 3THCA 2VNRA 3KQ4B 2PHDA 4Q0SA 3BGAA 3I2GA 4AEJA 2Z42A 3JQXA 3Q8CA 1H0BA 1JZ2A 2PLV1 3N4MA 2EAKA 4XDQA 4BHPA 3URFA 1W8FA 4DUWA 2AC1A 3C7OA 4QB6A 4CDQC 2Y64A 4J1WA 5FR3A 1NQJA 1I9RA 4LA2A 4CPBA 3ZFEB 4W6WA 3OYWB 3LSDA 5F32A 2BP6A 3N9PA 1W99A 5FPXA 1LHUA 1SPPB 3T08A 4CA9A 4PJYA 3UKTA 1HB1A 1XU2A 2GP3A 2RR12 4MGZE 3HVDA 3EB7A 2VUJA 3JXSA 4L8QA 4UWDA 4FPLA 4J6GA 4URTA 3R6SA 1RUH2 1W8OA 4DUVA 3DUIA 2NMOA 4HVRA 5F5IA 2VCBA 4IXLA 2GNBA 2RM21 1S0BA 4AI0A 4DXTA 2JE8A 2LALA 2ZXQA 3VD9A 1CN1A 2YU1A 3AZZA 3TNPB 3ACLA 1LGBA 3CBNA 4QX2A 4QX0A 1CZSA 2XGXA 3T2OA 2IXHA 1VB2A 1KFUL 4IV3A 3R4UA 1O5LA 1RUF1 2GH2A 1UX6A 4Q0VA 5FAXA 1S0CA 2VTFA 5L9VA 1SZBA 1TMF1 2WJSA 2RV9A 4X6RB 1UY2A 2VULA 3NQHA 3WY6A 4WM7A 3LA2A 2JG8C 1AXKA 3AYEA 2PTMA 2XBO1 3ZN5A 3HJRA 2JDKA 4YVWB 4YW7A 1JW6A 4LXLA 3I2FA 2BPA2 3SH3A 4LLOA 3NV1A 4JRAA 2G19A 2P3JA 2QVSB 3M2MA 1W06A 5A7QA 1W0PA 4O9EA 5A6QA 3B93A 5C71A 1RUE2 3FZ3A 3M3CA 2DVFA 3WNPA 5BYNA 2VAUA 1VJ2A 4E4HA 4RA0A 1VMJA 3IPVA 3ZSMA 5FPAA 4XXAA 2KXLA 4TN7A 3FN9A 1UWWA 1BEV2 4FPYA 4GMP0 2VOWA 4LBLA 4HONA 1MQTC 3NJZA 2F6BA 4SLIA 1OOPB 2DU0A 1GQHA 4CZSA 2JDHA 2MPFA 3AP6A 4JTNA 3AKPA 2DCZA 1FV2A 2XQRA 5E6HA 2XVGA 3ILNA 1V6KA 3M4FA 1FX5A 4K1YA 3CJIA 5GLZA 1SFNA 3GYDA 4IE7A 1Y3TA 1CAVB 5FYTA 3VZKA 2FMDA 4CU9A 2VH9A 4XETA 1WCDJ 2PHXA 2XJPA 3KT4A 1X82A 3MEPA 1OLQA 2VTXA 3ACIA 4META 4UAPA 5EHDA 3S0MA 3GCWA 4BQ4A 1D2QA 1QQP3 5J3UA 1BBT3 4XUTA 3M3IA 1LEDA 3I7DA 1G8WA 1U5YA 2BDRA 2I2SA 3EO6A 4YM0A 5GLVA 4XF0A 4IL7A 4GA9A 2DU1A 1UOJA 1UOFA 5I8YA 2CDPA 2VECA 3WQ0A 3PVNA 4LPLA 4KBBA 1VMHA 3OY8B 1OF4A 1W3XA 4V2WA 3H8RA 2B4KA 3ILRA 5JPMB 4M3CB 1V00A 5A80A 2E63A 4NAOA 4XF4A 2RMU3 1D0HA 3TOJA 1CD3G 1DQ5A 5F6KA 5AFEA 3VBFA 2HJIA 3WR0A 1LHVA 2BNOA 1GV9A 1UPSA 5ACA2 2OPKA 5FYIA 5C9AA 2YGLA 2JX9A 1SLLA 5A1LA 2JE7A 1KJRA 3WP3A 3AVRA 1RUE1 4FPGA 4XTPA 4GB33 4IV1B 3OBRA 2VZQA 3EJKA 4PCRA 5DPNA 1UF2C 2VVEA 2BJSA 1Y9QA 1MEC3 4B29A 2P6HA 3MBWA 3EHKA 3VZOA 3LZZA 1CR7A 4S2HA 5DZGA 5FZOB 3SMHA 3MO4A 1UMHA 4KU7A 3WINE 5CA6A 1RIRA 2V5YA 5F5CA 2R7EB 2DDUA 3FHQA 1F31A 3B00A 3WHTA 3VDDA 2A6XA 5KHGA 3LFMA 1AZDA 5FZ6A 2WS92 3MF9A 2HWF3 3NNFA 1R092 4B1MA 5A6XA 4OLLA 4Q4X2 1SHWB 5E16A 3W5MA 1HRV1 2HEWF 4TTGA 5DN2A 1SACA 2ZX0A 4RHV2 2YGMA 3RJRA 2YBKA 3OUJA 1UXXX 4FOWA 2J1RA 5FZHA 3VBSA 4MXVA 5A3NA 1H2NA 1QJU3 1QJY1 2B9UA 4NPLA 1MS5A 1LOFC 5CEHA 1CAWB 2Q0AA 1NG0A 5C4WA 1W6NB 4LO4B 3OEBA 3OGVA 2WT2A 2AEZA 3MIGA 4QHZA 3OEAA 5FUNA 3ZXDA 3LA3A 5M0TA 4OHYA 1W8TA 1WA6X 4QAWA 4CUCA 1J58A 3SCGA 1I5ZA 4CDQB 2VZUA 2YZ4A 5A7SA 4WVWA 3VBUA 2PN5A 5AC91 5CFCA 4CCDA 5FXZA 1V0AA 3RMYA 3GZTB 1F15A 3ZIWA 4XDOA 3N7MA 5LA0A 4W50A 2RVAA 4YGDA 2X5IC 3FLPA 5GLTA 4EZHA 1Z7S2 3HMYA 1N3OA 2K9ZA 1XXNA 3O1OA 2EVXA 2ZX4A 1PGSA 4IETA 1WWYA 3ZXGA 4S2FA 4NPMA 4L2NA 3WQ7A 3NKGA 4CCOA 5FZ0A 5ERLA 3WD5A 1AR81 4QDSA 5FQ0A 1W2NA 4NIDA 2R072 1UAIA 1AXYA 3GDBA 1J1LA 1PO13 4BLJA 3ZN4A 1TEIA 2D6OX 3DPRA 3TAYA 1GANA 4MX3A 5HI0A 4RYDA 3PUHA 2W47A 1UD1A 1SFPA 5I0DA 3NVCA 4GMP3 1BJQA 4YM3A 1EAH3 1UN1A 4WM7C 2GN7A 5F3IA 4D6QA 2RMU1 5CKNA 2BRTA 1SBEA 4XE9A 5GZGA 5KC6A 4Q4V2 1RHI2 4QPWA 4UW3A 2WNEA 2E51A 2VW2A 3NO8A 4OI2A 4B3NA 1MPXA 2IXIA 1OLRA 2VOTA
chains in the Genus database with same CATH topology
2JG8B 4MLOA 2JICA 1UU5A 2C1FA 3N3HA 1BMV1 2GMEA 1IS4A 2WZR3 5D1IA 3IIAA 5FOJB 2ZABA 1TNFA 2EXJA 5FO7B 2ATFA 3FUOA 1SBFA 3VKMA 5LK7B 1OA3A 2XPJA 4XBLA 1O3TA 2VNGA 2DCKA 2VUAA 1CIWA 2W08A 4F8AA 2ZGPA 3ES1A 3OGJA 3ZN6A 5IK7A 4Q0UA 1A6CA 1MQTB 5KXEA 3LGRA 1S0EA 5LK5A 3WT3A 2IXCA 1VR3A 2DFBA 1B35C 5E89A 5T5JA 3ZFEA 3OYWA 3LKJA 2JKBA 3VHOA 3EQEA 4QPYA 1Z7S1 3BOPA 1VBA2 4XJZA 1FOD3 1LOGA 1G9AA 3GBWA 3OF1A 2ET1A 1B09A 1POV0 3RYKA 1PHMA 4XIKA 2DVAA 4UW5A 4FOQA 4JAAA 3O5SA 1RUD2 4EWAA 4K20A 1QJX2 4Z2WA 1WMFA 1DGRA 3FHIB 4Q26A 2WA3A 4DRRA 3A0KA 4CDXB 3M3OA 1JYCA 2SLIA 4N53B 4OI0A 4GWMA 3IBMA 1FV3A 4RGGA 4AHZA 5KXDA 1CPNA 3AYCA 1RUC3 1LULA 3M7AA 1H8VA 4I3GA 5C9AC 1S2BA 5JIUA 4IEWA 1AUYA 1DHKB 4HVQA 1BCXA 1DBNA 1VBC1 4YVWA 1R083 2R1DA 5CNAA 4DZGA 2P34A 4H14A 4I2OA 2A6ZA 2EXHA 2QDNA 1ZYBA 4XILA 1DZTA 1U5XA 2CYFA 3R4DB 2HWC2 4B8EA 3KS7A 2PAMA 3RNSA 1REFA 3AKRA 2VOXA 3AZXA 1W0OA 4AI2A 4HPKB 5LRSA 4E4ZA 4Q0PA 2R49A 2XWJB 4MVTA 4NO4A 5FMOL 1JN2P 5I91A 1X36A 2E9QA 3EBRA 1AR73 4IEOA 4R9CA 5E88A 3I8TA 2K2SA 2JE9A 3PVBB 5FLIA 1ENSA 1GNHA 2WA4A 3JD72 1QY4A 3KLSA 1VBD3 5J37A 1REEA 1JOJA 4CP1A 3HBZA 3H1WA 1CAVA 5IK4A 2ZGNA 4QPGC 4L92A 5H9QA 1JUHA 1L3JA 1WLWA 4QXKA 1PGW2 3CNAA 3D4KA 1G9CA 2A6YA 4B4QA 4AQSA 3J4UH 1M4WA 4YW3A 1V6OA 3D8CA 3CO2A 2PAEA 2RS32 4IEXA 4AI3A 2WINB 4XBQA 4XZPA 4DNYA 4JGYC 5DZFA 4F83A 3OY8A 4Q8KA 1EPWA 3ZXAC 2X5IB 1JHNA 4M3CA 4F7ZA 1R1A3 4HKWA 1G6NA 1G7YA 3ROUA 4GXLA 3TBDA 3QH6A 2WNVC 2CAVA 3VUOA 1OHFA 2ZGQA 3SISA 1JTZX 2PHUA 4BMEA 1OKQA 4M0HA 1DGLA 3PTYA 4QPIC 3LOIA 2WNUC 1Q8VA 2VQ0A 3SCHA 4YSFA 4YRDA 1HQWA 2PHRA 1BK1A 1ULEA 5T5LA 2GNTA 5KHIA 1SQ4A 4Q4W2 1GSLA 2V09A 1YHFA 3ENRA 4LHLA 3RQ0A 3S6PA 3O0VA 1D4M2 1AR62 1HQLA 4IEUA 5JI9A 3S7IA 1BKZA 1COV2 4J1XA 4QD2A 1LECA 4FO9A 3UKNA 3P3NA 4KGQA 5K9YA 4BIOA 4YGBA 5DXDA 1HXS3 1AJOA 3RI8A 4MSVA 4D7SA 1NY72 2MEV3 4HSJA 2VG9A 3VHNA 1APNA 3JU9A 1H9WA 1ZRCA 5KC5A 1UIKA 1CAWA 3OCPA 2RS31 3VZMA 1W6NA 2RE9A 1YRZA 2UWAA 4JCKA 4C0BA 2WT0A 4QT6A 1PO23 1FYUA 3M1HA 1VBD1 4CDQA 3ZX7A 1TME2 1B35B 5I8TA 2P3IA 1ENXA 1KJLA 4HKLA 4XFHA 2RS51 3BOWA 2PQQA 1ZRRA 4UXAA 4AEDC 2GDFA 2R0HA 3LWCA 4DXZA 1RUI2 3B02A 4YG3A 5CFDC 1YWKA 4LBJA 1GZCA 2ZJCA 2GZWA 1DZRA 1UL9A 2FBEA 2XJTA 3CF6E 4W6YA 1YI7A 4YW1A 4M3CE 1ZRDA 1ZM1A 2FQPA 4K40A 1DGRN 4D7YA 2Z69A 3VN4A 1D4M1 1AR61 4IEZA 5FBZA 5IK8A 2ZGSA 5ABJC 1COV1 2D44A 1ZVFA 4IERA 4YLZA 4WBBA 4YZ3A 2WL1A 3NKTA 2JG8A 3BODA 4YYOA 2Q1MA 4HANA 2ZGOA 3O14A 1D2SA 1NCRC 3E5UA 2E7AA 2RS13 2R6QA 2XJVA 1NY71 1LU1A 4YM1A 1C8M2 2A7AA 2HYKA 4XQWA 5I93A 1G86A 5DUVA 3THTA 1QXPA 4JQRA 3TN92 1N1SA 3OD0A 4P14A 2OZJA 4QGMA 1UMZA 4NWVA 2ZPXA 3AX4A 1JUIA 2PLV3 4S2DA 1F5FA 1SLTA 1MQTA 1CESA 2ZX1A 2P17A 2B46X 3M3QA 2AYHA 4XQDA 3KB5A 2Q4SA 1W39A 4HLTA 4QPGB 1W6PB 2RJLA 2IXKA 3CU7A 1E57A 2UURA 4RGAA 3W58A 2OZ6A 4XIOA 5AFBA 2D3RA 4LBOA 4NHKA 2PHFA 4I0WB 5CIRA 2BWAA 2GNDA 4ZU7A 2VMGA 4N9HA 4KU8A 4JGYB 1URXA 1UZZA 2R061 5I0UA 1Z78A 1ZBA1 3O12A 4P5HA 1RUF3 4XJ9A 4CDXA 1O7FA 5KWRA 1YFWA 4N53A 3RI9A 5J36A 1C1FA 4Y5Z0 1LRHA 1LOBA 2ZHKA 1UCXA 4R4XA 3LAGA 5B2GB 1YJKA 3FJSA 4R9AA 3KT1A 2UWBA 2WNVB 3CL1A 3QD6A 1AL22 2XBO3 1LODA 1NCQB 4JGZA 4QPIB 2WNUB 1C8M1 4HSLA 3JBG1 2YV8A 1S2KA 2X53S 2IFRA 3H3ZA 1SLIA 3ALQA 4Q0QA 2ZGLA 4P9GA 5JSPA 1Y43B 3B5LB 1S55A 2VU9A 4FPOB 1FMD2 2HWE1 1PNFA 5TSWA 1F8VA 4HPKA 4AQTA 1EV11 3PMSA 4COUA 2O0OA 3SCFA 4AHWA 1AR92 4FTBA 1F5JA 1QNWA 3E5QA 3ATGA 4YARA 2R30A 4PLMA 3LA7A 2UWCA 4HL0A 1Q56A 3KT7A 2XLFA 4Q1RA 5GKAC 1PVC1 1RUH3 4XYXA 3ZN6B 5L36A 1YUDA 2GH8A 1EP0A 2GAUA 3WP5A 4EV0A 3I59A 3INAA 4NN0A 1LOFA 1HRI2 1TE1B 1AYN2 4FT8A 3VZNA 1AYM2 3KSCA 4DMIA 4CEWC 4YZ5A 4ORFA 5EFUA 1GZWB 3LSEA 1NYWA 3J8F2 2EA7A 3N7KA 4KG0A 4XTMA 4AEDB 4PDWC 2W0XA 2X5IA 4JRLA 5CFDB 3B7MA 3KCYA 4JDNA 4RFT0 1LU2A 1V9U1 4EN7B 1JXNA 4LO5B 2JENA 1QF3A 4K8FA 1K5MB 1AX1A 1IPKA 5F1RA 1WMEA 2D5HA 4JC1A 2E53A 3VL9A 3VHPA 1RC6A 4RS5C 4FOVA 1RUE3 1H2MA 4M01A 1OA4A 4PLNA 1RVF2 3AXDA 4INDA 4EWEA 4AI1A 4MGIE 1FT9A 3ASIA 4LLFA 1XYOA 2HWB2 5ABJB 4XMIA 2I74A 5BNOC 4DB5A 5E1RA 3VBRC 1ZZ7A 3S30A 1LTEA 3H9AA 1FI2A 1NCRB 4CDWC 4AW7A 2TNFA 4AHYA 1XNDA 1HRV3 3LOBA 5IT6A 5EWSA 2QQPA 2JECA 4QGNA 1VBB2 1ZRFA 2A6WA 3WDUA 4E2SA 5C6CA 4BYYA 4XQ4A 1QJY3 1HRI1 1AYN1 1GQGA 1QJZA 3HD8B 3ZXKA 3ZSLA 2BQPA 3D5OA 5H9SA 4Z8BA 2AENA 4ONUA 4I09A 3J8F1 5FREA 4FTSA 2RR11 5AC93 4WM8C 4RD7A 5T52A 1B35A 1RUH1 3LB9A 2DUPA 2B5HA 1JH5A 1S0IA 4KNCA 3QBQA 1H30A 3PMEA 1RUNA 2QZ3A 3VKNA 2UU8A 5FLHA 1HDKA 4R8HA 2ARBA 1AR83 3VL8A 1MVQA 4CDXC 1VIWB 2XLGA 1X8MA 4N53C 4WV8A 5C8CA 3TWIA 5CVRA 1H2LA 4HFSA 2LTNA 1RUG2 4DINB 1O3QA 2VPVA 2WSUA 3WVJA 4YVSA 4CRQA 3PHMA 2VGDA 2BVBA 4JGZC 1YIPA 2LM3A 1QOOA 3HAGA 2JXAA 2WS93 1DQ4A 3BPZA 3BU7A 3V0BB 2Q5TA 2AGSA 3AP7A 3MZHA 4Y24A 3WXPA 5FRAA 3I4IA 4OZXA 4R9DA 3MPBA 1DFQA 4Q1PA 1VBB1 4IEQA 2BNNA 2ARXA 2VW0A 2VOVA 1BEV1 4AFCA 3AP4A 1MS4A 5HBAA 3ZYJB 2D97A 5DG2A 1Z0HA 2WC2A 1BBT2 3AP5A 2ZGUA 3FUQA 3ZMNA 1G9FA 2QFEA 2WQ4A 3AYDA 1PIV2 1NQDA 1PVXA 3KZ4C 4KGGA 4LHKA 3R4SA 3DN7A 3I54A 2VXRA 1Q8QA 1IOAA 4DQAA 2IZWA 1BVVA 2VW1A 4H7MA 5FDBA 1Z7S3 1DQ0A 2R042 2HWD2 1WW7A 3D82A 4AGGA 4QPGA 2YHJA 1W6PA 4CDUC 5SV5A 3MDPA 4Q4Y2 4NVPA 1VALA 2VMHA 1ASJ2 4WVMB 1RUOA 2CNAA 1S0JA 4CEWB 1RGSA 1GBGA 1JBCA 1RUG1 1MEC2 5CU1A 4JGYA 3J9SA 5DUUA 4YM2A 5ACA1 1W2UA 2AUYA 2MNGA 4PDWB 3NV3A 3NSTA 4FPEA 4E9KA 1PNGA 3IDEA 4M3CF 4XPVA 4UW6A 3TNQA 5FTTC 1FNYA 2D6NA 2WNVA 3WCSA 1ZZ9A 4QHBA 4MV2A 1NCQA 1VBC3 3E6BA 4QPIA 2DTWA 1BYHA 2WNUA 3WNXA 3HQXA 3X29B 2ET7A 3IN9A 4RS5B 1CGPA 4LE3A 1V6LA 3ZFGC 2CWSA 3SNMA 1DYPA 1C4RA 4XF3A 4COZA 1LJ7A 1QJU2 3GZUC 4TLFA 5DG1A 1T6GC 1VRH2 1QGLA 4A7YA 1PIV1 2WS91 4NOTA 1R091 2QCSB 5BNOB 2IFWA 5D8AA 4Q4X1 1GZ9A 2DV9A 2O1QA 3VBRB 3ZMOA 3MIDA 4E27A 2H0VA 1VBE2 1O4YA 1FNZA 3PVEA 3MI8A 4RHV1 2W68A 4CDWB 3RZZA 2A5ZA 3MW4A 1N47A 2R041 2XLAA 3IDCB 3IMNA 3NV2A 4FQ4A 4AG4A 3NWKA 2B7YA 1V6IA 2DCJA 1X8EA 1NOVA 2KA3A 2WQZC 2XH6A 3FMGA 4AFAA 4YZ1A 4Q4Y1 1IKPA 2ZCWA 3ST7A 2YUEA 3TYJA 1ASJ1 4ZU4A 3WW4A 5T3NA 2QUOA 4LEJA 1OPMA 4RR3C 1PZ7A 4GQ7A 2VNOA 5LRRA 2NQYA 2W52A 1FATA 5H9PA 2DUOA 1H9PA 1GZWA 4WM8B 4OHZA 4C1XA 1SLBA 1MZFA 2DUQA 2NPIA 4HKOA 3WV6A 4AGRA 5HXVA 1XU1A 2QJVA 4AEDA 4XF9A 2R071 5A33B 1ND3C 5CFDA 2VVFA 1YXWA 4YFWA 2UY9A 3RPQA 2ES3A 3AB0A 5C8CC 1K5MA 4QQHA 2YC0A 5JZGB 4AQ2A 3ZIXA 2YROA 2C5DA 4Q4V1 1RHI1 2BTVC 1VRH1 4NR1A 4YVSC 4QU2A 1DIWA 3DL3A 3JCIA 5DDJ2 3WG1A 1AVBA 2OW4A 2ZTNA 3AMMA 1SCSA 1EPZA 4DS0A 1DF0A 1DQ2A 5ABJA 3FX3A 1QOSA 4JGZB 2ZX2A 3FE5A 4BIFA 3GBFA 5JOXA 4ITCA 2GU9A 3ZVXA 4CYDA 2JJ6A 1RUJ2 4QM8A 1MS0A 1NCRA 4YW4A 2N7GA 1FOD2 3NW4A 2DCYA 5GM0A 2XHKA 3KQRA 3WW3A 3VKOA 3H8UA 4P9XA 2Y0IA 4Y1UA 3WDYA 2B39A 2R1BA 3IWZA 2PA7A 4XFCA 5E8AA 4FBFA 2RS33 3B94A 1VBA1 3WZ1A 2DWRA 3AXEA 3ZSJA 4XJUA 1ULFA 4FXKB 5BV6A 4LT5A 2ERFA 3AZYA 2G9GA 4AFMA 1RUD1 2RS53 3I59B 3N35A 2B8MA 3PLQA 4CDUB 1QJX1 4X8PA 1AHSA 1FPN2 3P3PA 5DZEA 3ZXJA 2IXJA 2D7FA 4Q8LA 4AVVA 2A73B 5C8WA 3WUCA 3WCRA 1MS9A 1OQ1A 4L11A 3POSA 1HX6A 4AVBA 1EY2A 2C9AA 2QNKA 4YW5A 1J3RA 1ZZ6A 5DDJ1 4I30A 3HWJA 1D4M3 4D69A 1AR63 1PK6C 4N90A 1S1AA 3O0XA 4ES8A 4RSUA 1COV3 1LHWA 1MZEA 1AR72 1NCQC 1RUJ1 4K21A 4RQPC 2DVGA 4EROA 2HWC1 3S7EA 5JMCA 2XJQA 1KDMA 5I0RA 4COWA 3VLBB 3V0BA 5EZWA 1ZBE2 4PIYA 3VHRA 5A3LA 4AGVA 1LOAA 4AEKA 2OA2A 2OIIA 3ZFGB 1DLLA 4CP2A 4I3PA 4QGLA 2Q30A 3SHRA 4HETA 5D8AC 1GLHA 2EXKA 1DQ1A 4PLOA 2BUKA 5H9RA 2BW8A 3JD71 1J3PA 2WT1A 4IEVA 1X50A 1KRIA 1C3HA 5EYXA 3DF0A 5FOBB 3QLQA 3VBHC 3WDWA 4Y1VA 3DV8A 4FPKA 1PGW1 1QMJA 4GULA 4XW3A 4ISRA 1ULDA 1YO8A 2W39A 3JQWA 3ZYGA 3RDIA 3ZYPA 4HMZA 1FPN1 1YNAA 1SMVA 4FPFA 1SLCA 1WA4A 4R52A 2YDEA 1AXZA 1LOEA 1LHOA 2NMNA 1CAXB 3HT1A 4H3WA 1SBDA 3N7JA 4RR3B 4WVMA 5A32B 4EWDA 2NM1A 5KXBA 3WQ1A 4CEWA 4QQPA 4KWLA 4PIZA 3QACA 1W6MB 3KGLA 2R063 5JDBA 1ZBA3 4Q27A 1MACA 3AKSA 3MICA 1U0AA 4PDWA 2A3YA 4E2GA 3EXUA 1ND3B 4YG6A 3M70A 1K5MC 4XHXA 2DCTA 2QZ2A 5T5PA 1ZBE1 3PJYA 1X7NA 5SV8A 1N1VA 1UIJA 4Q4W1 5C8CB 1NA1C 1HXS2 3VBOC 4HK8A 2C0ZA 1C8M3 2CV6A 2BNMA 4YZ2A 3JBG3 2B45X 5BNNC 4RS5A 2MEV2 1RINA 4KQ7A 4YGCA 5BPXA 2EAAA 1YFYA 2ENRA 2CY6A 4U36A 4YVSB 5KHJA 2YYOA 4Z82A 4CEYC 4BM8A 3VV1A 4DRVA 2WFF2 4N7UA 5FO8B 2G4IA 2HWE3 2ZKNA 2BYVE 1YCIA 2ZGKA 1WW5A 3H7YA 3ZDSA 5BNOA 1EV13 1HKDA 2BWCA 1D0GA 3C2UA 3VBRA 3K48A 4AF9A 3CEWA 1XRUA 3ES4A 4GH4C 4OUMA 3AFKA 4BA6A 4NHMA 5I0SA 4D7TA 4CDWA 4FXGB 4OVEA 1Y7BA 1U12A 4OHXA 1I1EA 4Y20B 2ZGTA 2MHFA 4EN9B 4I0BA 1PVC3 2QE3A 2QKDA 4Q29A 5BNPC 4S2GA 4A3XA 1KFXL 3G7DA 3MLJA 4KH9A 1LCLA 2ZHLA 2K0GA 2JD4A 1TME1 3U10A 1IS6A 2ZAHA 1GNZA 1O5UA 4YGEA 5GZEA 4Y1YA 5GALA 1RUI1 4QX5A 3RRDA 4GKYA 4OUSA 1RITA 4DOUA 2PHTA 3E5XA 1DU3D 5GLUA 4WM8A 3NAPC 4BMBA 1VAKA 4FAHA 3UV9A 4F3JA 2DURA 4G9SB 1OFSA 3JB8A 4I02A 4Z07A 5A33A 3MGUA 5CG8A 1POV1 1BQPA 2SBAA 1XE7A 2HKXA 4ZXKA 3VKFC 5F9TA 1GR3A 1V9U3 2WFPA 4HVOA 3U4XA 1RJ7A 3OJBA 4GKXA 5JZGA 1O3SA 2GMPA 2XB6C 3AJZA 4ATEA 2WFF1 2AH2A 1LR5A 1GFF2 1CAUB 1FMD3 1PK6B 3SH4A 2D3SA 2PLV2 1LENA 3SXWA 3H1MA 3OD4A 2D98A 1IQAA 3POYA 4RQPB 5JLVA 2A75A 3L2YA 4XFGA 4TZDA 4DPNA 4AE2A 1R1ZA 5GZDA 2ZS6B 4XOGA 3TN91 5CADA 1H4HA 1LESA 4P9WA 4R9BA 3USUB 4IQPA 4KWKA 5CB7A 2DFCA 3B69A 3HIFA 3O7OA 2OUHA 1CPMA 4YW2A 1YYNA 5D8AB 3BALA 4LA3A 2EALA 2EIGA 1WW4A 2RM22 1HRI3 5EV7A 3D0JA 1AYN3 4PBOA 1F2NA 1Q3EA 1AYM3 1ULCA 4C90A 3WDXA 4FQZA 3VBHB 3J8F3 2RR13 1VAVA 1ZREA 2CGNA 3MIEA 1C8NA 1RUF2 3MIBA 4GIQA 3V64A 4BE3A 1OA2A 5T55A 4N7IA 2BFUS 1TMF2 1XYPA 2ZA9A 4R4ZA 2D5FA 3WG2A 1KS5A 4XMAA 3CJXA 1Q8PA 2H0BA 1V70A 2XBO2 4CDUA 1KXGA 3G6JB 3IM0A 2AZ5A 2UYBA 1A3KA 4LHNA 1RMU2 2ZAAA 4XJ8A 3SH5A 3R05A 3RYRA 2I45A 3W9AA 1AX2A 2Q1ZB 4XXPA 1Q8SA 2GSYA 2ETEA 4HN1A 4K9SA 4M0NA 2WSVA 1H8TC 2PYTA 3ECQA 2HWB3 3MW3A 3ZFFC 4O9GA 1AL21 3FLRA 4GWNA 2Z2SB 5JOWA 2A6VA 1IZ3A 1O91A 5AVAA 4LR4A 3UKVA 1UKRA 1XNBA 3DKWA 2X8KA 4L99A 2QDRA 3U11A 4L9BA 5CG9A 1YLLA 1NA1B 5JAXA 2B42B 2RHPA 3VBOB 1UW8A 1FMD1 4H7LA 1PMIA 1W6OB 5BNNB 3WP6A 1VBB3 1OI6A 4ISQA 4FSJA 1BEV3 3ZFGA 2ZMNA 2CAUA 4LNVA 3RYPA 4XHBA 4E4DX 4CEYB 1A78A 2GN3A 1QU0A 5T54A 2Q8OA 2LUWA 1AR91 3N36A 3A0NA 3VZJA 3GBGA 1XYNA 2H6CA 5L7OC 1H1IA 3L2HA 5JI7A 2A70A 1WMDA 4GH4B 4B7KA 1ENQA 3UJOA 4FOYA 5GJ6A 4IESA 4XJAA 2P2KA 2BBVA 3OBTA 4A7ZA 5I8SA 4LUKA 5A3MA 4COVA 5BNPB 3FBMA 3ELNA 3M8LA 4PF5A 3WLUA 2NP0A 2WIIB 3BIWE 1AYM1 2E7TA 1OD5A 1RMU1 4KL1A 4CP0A 1LGNA 3E6DA 1CVNA 5J09A 2WZPP 1CAXA 5A32A 4RR3A 1H2KA 1C28A 1UU4A 1W6QB 1VLNA