2HWMA

Crystal structure of lys12val/cys117val mutant of human acidic fibroblast growth factor at 1.60 angstrom resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPVLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSVKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spackling the crack: stabilizing human fibroblast growth factor-1 by targeting the N and C terminus beta-strand interactions.
pubmed doi rcsb
molecule keywords Heparin-binding growth factor 1
molecule tags Hormone/growth factor
source organism Homo sapiens
total genus 35
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2hwmA00
3CA5A 3N7KA 3FJJA 3BRDA 2KH2A 1DFQA 1SZ6B 4KEIA 4A7ZA 3FJHA 1HWPB 3FJKA 3IM6A 4H9WA 3NBEA 1QQLA 4IYBA 4GOVA 2K43A 3H6RA 1G82A 4KC3A 1AVWB 2AAIB 2VSEA 4LO7B 1BA7A 3F1RA 3OGFA 2F2FA 3V0AA 1W3AA 2HZ9A 4EB2B 1ISWA 2R9KB 1R8NA 3H6RB 3E8LC 4P0JA 3FJ8A 3FJEA 2BEAA 3FUQA 3VSFA 2P23A 2FFVA 2AXMA 4G6JA 3V0AB 4JRAA 5BXRA 1ISVA 4F34A 1MD6A 2ET2A 4GOYA 1YF8B 3QYDA 5GAQA 3H6QA 3TC2A 3A07A 2NTDA 1WBCA 2E4MA 5D62A 3HOMA 4AN7B 4L4IA 4A7YA 3BA5A 3VT0A 4J2XA 2D44A 3ZC8A 1I1BA 3UDAA 1S0DA 1Q03A 4OWJA 3NBNA 1JY0A 1Q1UA 3AKFA 3CQAA 2Y9GA 3OBRA 4I8MA 3V0BA 1V6VA 1PUUB 2MIBA 3O5WB 3UJ0A 1ONKB 3FJIA 4PC4A 3AKGA 3R4UA 2RQ9A 9ILBA 3W9TA 3V0BB 1HWMB 1BLAA 5B2HA 3Q7YA 3AZWA 3OJ2A 3VT2A 2AQZA 3FJDA 4IONA 2M49A 2KLLA 3Q7XA 1AVUA 1EPWA 4P0LA 1AXMA 1WBAA 1W3GA 4I4QA 3O3QA 2FDBM 3VT1A 2ZQNA 3ZXGA 2ESUA 5HPZA 2IWTB 3NJ5A 4JPZA 4QD2B 4J2KA 4JP0A 4F83A 3CA4A 2D22A 4ZGRB 3F62B 1KNMA 3I2AA 2RG9B 3WO4A 3RTIB 4OWKA 2DRZA 3MALA 4IQPA 1SR4C 1JT5A 2HWAA 3O4AA 3V79C 3AKHA 4D0ZA 2IHOA 4Q9GA 4LO3A 4ZFWB 4R6UB 3UD8A 4ZOTA 2UUSA 1YBIA 1BFGA 5FZYA 2GO2A 5DSSB 1TIEA 1P63A 4XFSA 3UJ4A 1UPSA 4G1RA 1M16A 4FVVA 1BFFA 4J2SA 1QQKA 4LO0C 3AZVA 1XHBA 2BFHA 3UD9A 1FN0A 3CAHA 1K5VA 4I4UA 1CVSA 5BP5C 1D0HA 1TOOA 3VWCA 5BQUC 4QC4A 4XFTA 3RTJB 2VUAA 1S0EA 1FMZA 4EEEB 3BB2A 3BADA 3OJMA 1J0SA 1YXWA 3Q7WA 1IRAX 4IZXA 1EYLA 5BXPA 4OEFA 1BLDA 2X2SA 1JQZA 2L5XA 3QR5A 3HMYA 3NBDA 3LTQA 4WBCA 3WA1A 1TTUA 3CRHA 1E0OA 2D1ZA 2DREA 1XG6A 3IM7A 4JKQA 1EVTA 1G9CA 4IY9A 3FJCA 2YUGA 3P6JA 4I96A 4JAWA 5DZUA 3AH2A 3CRIA 4L4HA 4Q9PA 4X38A 3ILAA 4J2YA 3WO3A 3OBTA 3HALA 4JKXB 1WD3A 4I4RA 4X3AA 4OEGA 4I2SA 5DUYA 3BRGC 2I1BA 3OJVA 4OEEA 2D20A 2QYIB 1YTOA 3O4DA 5BXTA 3JUTA 4I6IA 1DQOA 1TFMB 3BAGA 3HBWA 3N0KA 1ISZA 3A21A 4D8HA 3CRGA 1TWMA 3SNVA 1JT3A 3BAQA 1PZZA 3PMEA 1YYNA 4A7KA 5JLVA 1TP0A 1HWNB 2Z49A 5E24E 2K4AB 3K1XA 3RMYA 1DLLA 1CE7B 3CA0A 5F8WA 4ZA3B 4EKXB 3HN1A 1IRPA 2VLCA 1RY7A 3AKIA 2Q9XA 3POKA 3VUOA 1DQGA 1HKNA 1ISXA 3RSJA 4FGFA 5EG6C 2VU9A 5FNXA 2GZBA 4ZBVB 3BTAA 4AN6A 3ZXDA 1S0CA 2P39A 3EF2A 4Z9WB 1EV2A 2FFUA 3AH1A 3PUBA 1G9BA 1DIWA 3FFZA 1V6WA 2KKIA 4X37A 4X39A 3FJ9A 3S8JA 2WRYA 2ZR1B 1Z4SA 4II0A 1RMLA 3RMXA 1Z0HA 4I1EA 4ISRA 1SR4A 1GGPB 3A22A 4EFPA 3IAGC 1BASA 1T4QA 4JQ0A 2HWMA 4DEPA 4G9NA 1PWAA 5EC5A 5F90A 4XFUA 3WMVA 3FJBA 3WMUA 1T9FA 4IY8A 4QALA 1BFBA 1S0LA 3AJ6A 2Z48A 3BAOA 4ENDA 3KMVA 4Q91A 5FNWA 1A8DA 4I4OA 4LO1C 3VSZA 2Y9FA 1G9DA 4KEJA 2D7RA 3LLPA 4LO0A 5FZUA 4I0YA 5EHAA 4YOLA 5D61A 3UD7A 4J23B 4CJMA 5BP5A 4P6AA 1DZCA 4I3NA 4QO3A 5BQUA 5BOWA 1IJTA 1DFCA 2ZQOA 1DZDA 1M2TB 3I29B 1FQ9A 4OW4A 4EFRA 4LO2C 2KI4A 5F8SA 4D0TA 4I4XA 4I37A 1ABRB 4KBBA 1JTCA 3BX1C 4ZLBB 1ITBA 1QXMA 1BFCA 2Q3NB 1JT4A 4GP0A 1I1EA 3PHZA 3A23A 3NBCA 3WINC 4EFQA 8I1BA 1IT0A 1HWOB 2RSTA 3O4OA 4P0KA 3H6SE 4Z8SB 2Y9XE 4OWLA 2NM1A 1FV2A 3AH4A 1AVXB 2XOAA 1DJSB 2D7IA 3AJ5A 2K8RA 4LO7C 1II4A 1TWEA 5BXSA 4DENA 4XKIA 4GAIA 31BIA 1HCEA 1NZKA 1VCLA 21BIA 2F2FC 3OGGA 4G6MA 1JLYA 3O49A 2VXRA 4ZFUB 4I4YA 1XZZA 4OUJA 3IM5A 4TLPA 1PC8B 3ZX7A 4KEKA 2VSAA 1OQLB 3FJFA 1JLXA 1NUNA 3BAVA 1W3FA 1HIBA 3P53A 4QKRA 2D24A 1IOBA 4H04A 1XYFA 3P6IA 3O44A 4QBCA 3B9UA 3ZC9A 3I2XA 4I4PA 1V6XA 1JT7A 3IIRA 7I1BA 1K5UA 4DCKC 3N7MA 3VEQA 3BA7A 2E4MC 1IILA 2NVHA 1AFCA 5I1BA 3CA1A 3HSMA 3R4SA 5F8YA 2KI6B 4QKSA 2J3PA 1V6UA 1G9AA 3CA3A 1IHKA 2D23A 3O4BA 1S0BA 1FWVA 2AFGA 2ERMA 3CU1B 3T8SA 2X2TA 3D7WB 4LO8B 2VXTI 4I1BA 5JMCA 3C9ZA 1Q04A 6I1BA 4IZEA 3PG0A 2NZ9A 2LIEA 1PUMB 4USPA 1Z2VA 1FWUA 3WO2A 2MC2A 5G00A 2Y9WC 2LIQA 2DRYA 3BA4A 2FO1A 3FGMA 4LO1A 2NP0A 1S0GA 3BAUA 1FMMS 3N7JA 2FGFA 5FZZA 3CA6A 3O4CA 1MC9A 4QD2C 5D63A 4QBVA 3FJAA 3MPPG 1WD4A 2NYYA 2WBCA 2MLLB 4I4SA 4I7IA 4HJJA 2F8XC 1RZOB 2DS0A 4G9MA 4GP3A 1AVAC 1BARA 2HW9A 2BEBA 2QN4A 4LO2A 1FV3A 1HCDA 4ZFYB 3JRRA 1L2HA 5BVPI 3S8KA 3BAHA 5DVHA 1N4KA 4ISQA 2D43A 1R8OA 4USOA 4HR6C 1AF9A 3N7LA 4I4VA 1ILR1 1ISYA 1F31A 4GAFA 4HA2A 3WINA 3BRFA 3FUOA 4IHZA 1S0FA 1FGAA 41BIA 4ZKTB 1RG8A 4LO3C
chains in the Genus database with same CATH superfamily
3CA5A 3N7KA 3FJJA 3BRDA 2KH2A 4MZGB 1DFQA 1SZ6B 4KEIA 4A7ZA 3FJHA 1HWPB 3FJKA 3IM6A 4H9WA 3NBEA 1QQLA 4IYBA 4GOVA 2K43A 3H6RA 1G82A 4KC3A 1AVWB 2AAIB 2VSEA 4LO7B 1BA7A 3F1RA 3OGFA 2F2FA 3V0AA 1W3AA 2HZ9A 4EB2B 1ISWA 2R9KB 1R8NA 3H6RB 3E8LC 4P0JA 3FJ8A 3FJEA 2BEAA 3FUQA 3VSFA 2P23A 2FFVA 2AXMA 4G6JA 3V0AB 4JRAA 5BXRA 1ISVA 4F34A 1MD6A 2ET2A 4GOYA 1YF8B 3QYDA 5GAQA 3H6QA 3TC2A 3A07A 2NTDA 1WBCA 2E4MA 5D62A 3HOMA 2NS2A 4AN7B 4L4IA 4A7YA 3BA5A 3VT0A 4J2XA 2D44A 3ZC8A 1I1BA 3UDAA 1S0DA 1Q03A 4OWJA 3NBNA 1JY0A 1Q1UA 3AKFA 3CQAA 2Y9GA 3OBRA 4I8MA 3V0BA 1V6VA 1PUUB 2MIBA 3O5WB 3UJ0A 1ONKB 3FJIA 4PC4A 3AKGA 3R4UA 2RQ9A 9ILBA 3W9TA 3V0BB 1HWMB 1BLAA 5B2HA 3Q7YA 3AZWA 3OJ2A 3VT2A 2AQZA 3FJDA 4IONA 2M49A 2KLLA 3Q7XA 1AVUA 1EPWA 4P0LA 1AXMA 1WBAA 1W3GA 4I4QA 3O3QA 2FDBM 3VT1A 2ZQNA 3ZXGA 2ESUA 5HPZA 2IWTB 3NJ5A 4JPZA 4QD2B 4J2KA 4JP0A 4F83A 3CA4A 2D22A 4ZGRB 3F62B 1KNMA 3I2AA 2RG9B 3WO4A 3RTIB 4OWKA 2DRZA 3MALA 4IQPA 1SR4C 1JT5A 2HWAA 3O4AA 3V79C 3AKHA 4D0ZA 2IHOA 4Q9GA 4LO3A 4ZFWB 4R6UB 3UD8A 4ZOTA 2UUSA 1YBIA 1BFGA 5FZYA 4MZHA 2GO2A 5DSSB 1TIEA 1P63A 4XFSA 3UJ4A 1UPSA 4G1RA 1M16A 4FVVA 1BFFA 4J2SA 1QQKA 4LO0C 3AZVA 1XHBA 2BFHA 3UD9A 1FN0A 3CAHA 1K5VA 4I4UA 1CVSA 5BP5C 1D0HA 1TOOA 3VWCA 5BQUC 4QC4A 4XFTA 3RTJB 2VUAA 1S0EA 1FMZA 4EEEB 3BB2A 3BADA 3OJMA 1J0SA 1YXWA 3Q7WA 1IRAX 4IZXA 1EYLA 5BXPA 4OEFA 1BLDA 2X2SA 1JQZA 2L5XA 3QR5A 3HMYA 3NBDA 3LTQA 4WBCA 3WA1A 1TTUA 3CRHA 1E0OA 2D1ZA 2DREA 1XG6A 3IM7A 4JKQA 1EVTA 1G9CA 4IY9A 3FJCA 2YUGA 3P6JA 4I96A 4JAWA 5DZUA 3AH2A 3CRIA 4L4HA 4Q9PA 4X38A 3ILAA 4J2YA 3WO3A 3OBTA 3HALA 4JKXB 1WD3A 4I4RA 4X3AA 4OEGA 4I2SA 5DUYA 3BRGC 2I1BA 3OJVA 4OEEA 2D20A 2QYIB 1YTOA 4H75A 3O4DA 5BXTA 3JUTA 4I6IA 1DQOA 1TFMB 3BAGA 3HBWA 3N0KA 1ISZA 3A21A 4D8HA 3CRGA 1TWMA 3SNVA 1JT3A 3BAQA 1PZZA 3PMEA 1YYNA 4A7KA 5JLVA 1TP0A 1HWNB 2Z49A 5E24E 2K4AB 3K1XA 3RMYA 1DLLA 1CE7B 3CA0A 5F8WA 4ZA3B 4EKXB 3HN1A 1IRPA 2VLCA 1RY7A 3AKIA 2Q9XA 3POKA 3VUOA 1DQGA 1HKNA 1ISXA 3RSJA 4FGFA 5EG6C 2VU9A 5FNXA 2GZBA 4ZBVB 3BTAA 4AN6A 3ZXDA 1S0CA 2P39A 3EF2A 4Z9WB 1EV2A 2FFUA 3AH1A 3PUBA 1G9BA 1DIWA 3FFZA 1V6WA 2KKIA 4X37A 4X39A 3FJ9A 3S8JA 2WRYA 2ZR1B 1Z4SA 4II0A 1RMLA 3RMXA 1Z0HA 4I1EA 4ISRA 4MZFB 1SR4A 1GGPB 3A22A 4EFPA 3IAGC 1BASA 1T4QA 4JQ0A 2HWMA 4DEPA 4G9NA 1PWAA 5EC5A 5F90A 4XFUA 3WMVA 3FJBA 3WMUA 1T9FA 4IY8A 4QALA 1BFBA 1S0LA 3AJ6A 2Z48A 3BAOA 4ENDA 3KMVA 4Q91A 5FNWA 1A8DA 4I4OA 4LO1C 3VSZA 2Y9FA 1G9DA 4KEJA 2D7RA 3LLPA 4LO0A 5FZUA 4I0YA 5EHAA 4YOLA 5D61A 3UD7A 4J23B 4CJMA 5BP5A 4P6AA 1DZCA 4I3NA 4QO3A 5BQUA 5BOWA 1IJTA 1DFCA 2ZQOA 1DZDA 1M2TB 3I29B 1FQ9A 4OW4A 4EFRA 4LO2C 2KI4A 5F8SA 4D0TA 4I4XA 4I37A 1ABRB 4KBBA 1JTCA 3BX1C 4ZLBB 1ITBA 1QXMA 1BFCA 2Q3NB 1JT4A 4GP0A 1I1EA 3PHZA 3A23A 3NBCA 3WINC 4EFQA 8I1BA 1IT0A 1HWOB 2RSTA 3O4OA 4P0KA 3H6SE 4Z8SB 2Y9XE 4OWLA 2NM1A 1FV2A 4UY4A 3AH4A 1AVXB 2XOAA 1DJSB 2D7IA 3AJ5A 2K8RA 4LO7C 1II4A 1TWEA 5BXSA 4DENA 4XKIA 4GAIA 31BIA 1HCEA 1NZKA 1VCLA 21BIA 2F2FC 3OGGA 4G6MA 1JLYA 3O49A 2VXRA 4ZFUB 4I4YA 1XZZA 4OUJA 3IM5A 4TLPA 1PC8B 3ZX7A 4KEKA 2VSAA 1OQLB 3FJFA 1JLXA 1NUNA 3BAVA 1W3FA 1HIBA 3P53A 4QKRA 2D24A 1IOBA 4H04A 1XYFA 3P6IA 3O44A 4QBCA 3B9UA 3ZC9A 3I2XA 4I4PA 1V6XA 1JT7A 3IIRA 7I1BA 1K5UA 4DCKC 3N7MA 3VEQA 3BA7A 2E4MC 1IILA 2NVHA 1AFCA 5I1BA 3CA1A 3HSMA 3R4SA 5F8YA 2KI6B 4QKSA 2J3PA 1V6UA 1G9AA 3CA3A 1IHKA 2D23A 3O4BA 1S0BA 1FWVA 2AFGA 2ERMA 3CU1B 3T8SA 2X2TA 3D7WB 4LO8B 2VXTI 4I1BA 5JMCA 3C9ZA 1Q04A 6I1BA 4IZEA 3PG0A 2NZ9A 2LIEA 1PUMB 4USPA 1Z2VA 1FWUA 3WO2A 2MC2A 5G00A 2Y9WC 2LIQA 2DRYA 3BA4A 2FO1A 3FGMA 4LO1A 2NP0A 1S0GA 3BAUA 1FMMS 3N7JA 2FGFA 5FZZA 3CA6A 3O4CA 1MC9A 4QD2C 5D63A 4QBVA 3FJAA 3MPPG 1WD4A 2NYYA 2WBCA 2MLLB 4I4SA 4I7IA 4HJJA 2F8XC 1RZOB 2DS0A 4G9MA 4GP3A 1AVAC 1BARA 2HW9A 2BEBA 2QN4A 4LO2A 1FV3A 1HCDA 4ZFYB 3JRRA 1L2HA 5BVPI 3S8KA 3BAHA 5DVHA 1N4KA 4ISQA 2D43A 1R8OA 4USOA 4HR6C 1AF9A 3N7LA 4I4VA 1ILR1 1ISYA 1F31A 4GAFA 4HA2A 3WINA 3BRFA 3FUOA 4IHZA 1S0FA 1FGAA 41BIA 4ZKTB 1RG8A 4LO3C
chains in the Genus database with same CATH topology
3CA5A 3N7KA 3FJJA 3BRDA 2KH2A 4MZGB 1DFQA 1SZ6B 4KEIA 4A7ZA 3FJHA 1HWPB 3FJKA 3IM6A 4H9WA 3NBEA 1QQLA 4IYBA 4GOVA 2K43A 3H6RA 1G82A 4KC3A 1AVWB 2AAIB 2VSEA 4LO7B 1BA7A 3F1RA 3OGFA 2F2FA 3V0AA 1W3AA 2HZ9A 4EB2B 1ISWA 2R9KB 1R8NA 3H6RB 3E8LC 4P0JA 3FJ8A 3FJEA 2BEAA 3FUQA 3VSFA 2P23A 2FFVA 2AXMA 4G6JA 3V0AB 4JRAA 5BXRA 1ISVA 4F34A 1MD6A 2ET2A 4GOYA 1YF8B 3QYDA 5GAQA 3H6QA 3TC2A 3A07A 2NTDA 1WBCA 2E4MA 5D62A 3HOMA 2NS2A 4AN7B 4L4IA 4A7YA 3BA5A 3VT0A 4J2XA 2D44A 3ZC8A 1I1BA 3UDAA 1S0DA 1Q03A 4OWJA 3NBNA 1JY0A 1Q1UA 3AKFA 3CQAA 2Y9GA 3OBRA 4I8MA 3V0BA 1V6VA 1PUUB 2MIBA 3O5WB 3UJ0A 1ONKB 3FJIA 4PC4A 3AKGA 3R4UA 2RQ9A 9ILBA 3W9TA 3V0BB 1HWMB 1BLAA 5B2HA 3Q7YA 3AZWA 3OJ2A 3VT2A 2AQZA 3FJDA 4IONA 2M49A 2KLLA 3Q7XA 1AVUA 1EPWA 4P0LA 1AXMA 1WBAA 1W3GA 4I4QA 3O3QA 2FDBM 3VT1A 2ZQNA 3ZXGA 2ESUA 5HPZA 2IWTB 3NJ5A 4JPZA 4QD2B 4J2KA 4JP0A 4F83A 3CA4A 2D22A 4ZGRB 3F62B 1KNMA 3I2AA 2RG9B 3WO4A 3RTIB 4OWKA 2DRZA 3MALA 4IQPA 1SR4C 1JT5A 2HWAA 3O4AA 3V79C 3AKHA 4D0ZA 2IHOA 4Q9GA 4LO3A 4ZFWB 4R6UB 3UD8A 4ZOTA 2UUSA 1YBIA 1BFGA 5FZYA 4MZHA 2GO2A 5DSSB 1TIEA 1P63A 4XFSA 3UJ4A 1UPSA 4G1RA 1M16A 4FVVA 1BFFA 4J2SA 1QQKA 4LO0C 3AZVA 1XHBA 2BFHA 3UD9A 1FN0A 3CAHA 1K5VA 4I4UA 1CVSA 5BP5C 1D0HA 1TOOA 3VWCA 5BQUC 4QC4A 4XFTA 3RTJB 2VUAA 1S0EA 1FMZA 4EEEB 3BB2A 3BADA 3OJMA 1J0SA 1YXWA 3Q7WA 1IRAX 4IZXA 1EYLA 5BXPA 4OEFA 1BLDA 2X2SA 1JQZA 2L5XA 3QR5A 3HMYA 3NBDA 3LTQA 4WBCA 3WA1A 1TTUA 3CRHA 1E0OA 2D1ZA 2DREA 1XG6A 3IM7A 4JKQA 1EVTA 1G9CA 4IY9A 3FJCA 2YUGA 3P6JA 4I96A 4JAWA 5DZUA 3AH2A 3CRIA 4L4HA 4Q9PA 4X38A 3ILAA 4J2YA 3WO3A 3OBTA 3HALA 4JKXB 1WD3A 4I4RA 4X3AA 4OEGA 4I2SA 5DUYA 3BRGC 2I1BA 3OJVA 4OEEA 2D20A 2QYIB 1YTOA 4H75A 3O4DA 5BXTA 3JUTA 4I6IA 1DQOA 1TFMB 3BAGA 3HBWA 3N0KA 1ISZA 3A21A 4D8HA 3CRGA 1TWMA 3SNVA 1JT3A 3BAQA 1PZZA 3PMEA 1YYNA 4A7KA 5JLVA 1TP0A 1HWNB 2Z49A 5E24E 2K4AB 3K1XA 3RMYA 1DLLA 1CE7B 3CA0A 5F8WA 4ZA3B 4EKXB 3HN1A 1IRPA 2VLCA 1RY7A 3AKIA 2Q9XA 3POKA 3VUOA 1DQGA 1HKNA 1ISXA 3RSJA 4FGFA 5EG6C 2VU9A 5FNXA 2GZBA 4ZBVB 3BTAA 4AN6A 3ZXDA 1S0CA 2P39A 3EF2A 4Z9WB 1EV2A 2FFUA 3AH1A 3PUBA 1G9BA 1DIWA 3FFZA 1V6WA 2KKIA 4X37A 4X39A 3FJ9A 3S8JA 2WRYA 2ZR1B 1Z4SA 4II0A 1RMLA 3RMXA 1Z0HA 4I1EA 4ISRA 4MZFB 1SR4A 1GGPB 3A22A 4EFPA 3IAGC 1BASA 1T4QA 4JQ0A 2HWMA 4DEPA 4G9NA 1PWAA 5EC5A 5F90A 4XFUA 3WMVA 3FJBA 3WMUA 1T9FA 4IY8A 4QALA 1BFBA 1S0LA 3AJ6A 2Z48A 3BAOA 4ENDA 3KMVA 4Q91A 5FNWA 1A8DA 4I4OA 4LO1C 3VSZA 2Y9FA 1G9DA 4KEJA 2D7RA 3LLPA 4LO0A 5FZUA 4I0YA 5EHAA 4YOLA 5D61A 3UD7A 4J23B 4CJMA 5BP5A 4P6AA 1DZCA 4I3NA 4QO3A 5BQUA 5BOWA 1IJTA 1DFCA 2ZQOA 1DZDA 1M2TB 3I29B 1FQ9A 4OW4A 4EFRA 4LO2C 2KI4A 5F8SA 4D0TA 4I4XA 4I37A 1ABRB 4KBBA 1JTCA 3BX1C 4ZLBB 1ITBA 1QXMA 1BFCA 2Q3NB 1JT4A 4GP0A 1I1EA 3PHZA 3A23A 3NBCA 3WINC 4EFQA 8I1BA 1IT0A 1HWOB 2RSTA 3O4OA 4P0KA 3H6SE 4Z8SB 2Y9XE 4OWLA 2NM1A 1FV2A 4UY4A 3AH4A 1AVXB 2XOAA 1DJSB 2D7IA 3AJ5A 2K8RA 4LO7C 1II4A 1TWEA 5BXSA 4DENA 4XKIA 4GAIA 31BIA 1HCEA 1NZKA 1VCLA 21BIA 2F2FC 3OGGA 4G6MA 1JLYA 3O49A 2VXRA 4ZFUB 4I4YA 1XZZA 4OUJA 3IM5A 4TLPA 1PC8B 3ZX7A 4KEKA 2VSAA 1OQLB 3FJFA 1JLXA 1NUNA 3BAVA 1W3FA 1HIBA 3P53A 4QKRA 2D24A 1IOBA 4H04A 1XYFA 3P6IA 3O44A 4QBCA 3B9UA 3ZC9A 3I2XA 4I4PA 1V6XA 1JT7A 3IIRA 7I1BA 1K5UA 4DCKC 3N7MA 3VEQA 3BA7A 2E4MC 1IILA 2NVHA 1AFCA 5I1BA 3CA1A 3HSMA 3R4SA 5F8YA 2KI6B 4QKSA 2J3PA 1V6UA 1G9AA 3CA3A 1IHKA 2D23A 3O4BA 1S0BA 1FWVA 2AFGA 2ERMA 3CU1B 3T8SA 2X2TA 3D7WB 4LO8B 2VXTI 4I1BA 5JMCA 3C9ZA 1Q04A 6I1BA 4IZEA 3PG0A 2NZ9A 2LIEA 1PUMB 4USPA 1Z2VA 1FWUA 3WO2A 2MC2A 5G00A 2Y9WC 2LIQA 2DRYA 3BA4A 2FO1A 3FGMA 4LO1A 2NP0A 1S0GA 3BAUA 1FMMS 3N7JA 2FGFA 5FZZA 3CA6A 3O4CA 1MC9A 4QD2C 5D63A 4QBVA 3FJAA 3MPPG 1WD4A 2NYYA 2WBCA 2MLLB 4I4SA 4I7IA 4HJJA 2F8XC 1RZOB 2DS0A 4G9MA 4GP3A 1AVAC 1BARA 2HW9A 2BEBA 2QN4A 4LO2A 1FV3A 1HCDA 4ZFYB 3JRRA 1L2HA 5BVPI 3S8KA 3BAHA 5DVHA 1N4KA 4ISQA 2D43A 1R8OA 4USOA 4HR6C 1AF9A 3N7LA 4I4VA 1ILR1 1ISYA 1F31A 4GAFA 4HA2A 3WINA 3BRFA 3FUOA 4IHZA 1S0FA 1FGAA 41BIA 4ZKTB 1RG8A 4LO3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CA5 A;  3N7K A;  3FJJ A;  3BRD A;  2KH2 A;  1DFQ A;  1SZ6 B;  4KEI A;  4A7Z A;  3FJH A;  1HWP B;  3FJK A;  3IM6 A;  4H9W A;  3NBE A;  1QQL A;  4IYB A;  4GOV A;  2K43 A;  3H6R A;  1G82 A;  4KC3 A;  1AVW B;  2AAI B;  2VSE A;  4LO7 B;  1BA7 A;  3F1R A;  3OGF A;  2F2F A;  3V0A A;  1W3A A;  2HZ9 A;  4EB2 B;  1ISW A;  2R9K B;  1R8N A;  3H6R B;  3E8L C;  4P0J A;  3FJ8 A;  3FJE A;  2BEA A;  3FUQ A;  3VSF A;  2P23 A;  2FFV A;  2AXM A;  4G6J A;  3V0A B;  4JRA A;  5BXR A;  1ISV A;  4F34 A;  1MD6 A;  2ET2 A;  4GOY A;  1YF8 B;  3QYD A;  5GAQ A;  3H6Q A;  3TC2 A;  3A07 A;  2NTD A;  1WBC A;  2E4M A;  5D62 A;  3HOM A;  4AN7 B;  4L4I A;  4A7Y A;  3BA5 A;  3VT0 A;  4J2X A;  2D44 A;  3ZC8 A;  1I1B A;  3UDA A;  1S0D A;  1Q03 A;  4OWJ A;  3NBN A;  1JY0 A;  1Q1U A;  3AKF A;  3CQA A;  2Y9G A;  3OBR A;  4I8M A;  3V0B A;  1V6V A;  1PUU B;  2MIB A;  3O5W B;  3UJ0 A;  1ONK B;  3FJI A;  4PC4 A;  3AKG A;  3R4U A;  2RQ9 A;  9ILB A;  3W9T A;  3V0B B;  1HWM B;  1BLA A;  5B2H A;  3Q7Y A;  3AZW A;  3OJ2 A;  3VT2 A;  2AQZ A;  3FJD A;  4ION A;  2M49 A;  2KLL A;  3Q7X A;  1AVU A;  1EPW A;  4P0L A;  1AXM A;  1WBA A;  1W3G A;  4I4Q A;  3O3Q A;  2FDB M;  3VT1 A;  2ZQN A;  3ZXG A;  2ESU A;  5HPZ A;  2IWT B;  3NJ5 A;  4JPZ A;  4QD2 B;  4J2K A;  4JP0 A;  4F83 A;  3CA4 A;  2D22 A;  4ZGR B;  3F62 B;  1KNM A;  3I2A A;  2RG9 B;  3WO4 A;  3RTI B;  4OWK A;  2DRZ A;  3MAL A;  4IQP A;  1SR4 C;  1JT5 A;  2HWA A;  3O4A A;  3V79 C;  3AKH A;  4D0Z A;  2IHO A;  4Q9G A;  4LO3 A;  4ZFW B;  4R6U B;  3UD8 A;  4ZOT A;  2UUS A;  1YBI A;  1BFG A;  5FZY A;  2GO2 A;  5DSS B;  1TIE A;  1P63 A;  4XFS A;  3UJ4 A;  1UPS A;  4G1R A;  1M16 A;  4FVV A;  1BFF A;  4J2S A;  1QQK A;  4LO0 C;  3AZV A;  1XHB A;  2BFH A;  3UD9 A;  1FN0 A;  3CAH A;  1K5V A;  4I4U A;  1CVS A;  5BP5 C;  1D0H A;  1TOO A;  3VWC A;  5BQU C;  4QC4 A;  4XFT A;  3RTJ B;  2VUA A;  1S0E A;  1FMZ A;  4EEE B;  3BB2 A;  3BAD A;  3OJM A;  1J0S A;  1YXW A;  3Q7W A;  1IRA X;  4IZX A;  1EYL A;  5BXP A;  4OEF A;  1BLD A;  2X2S A;  1JQZ A;  2L5X A;  3QR5 A;  3HMY A;  3NBD A;  3LTQ A;  4WBC A;  3WA1 A;  1TTU A;  3CRH A;  1E0O A;  2D1Z A;  2DRE A;  1XG6 A;  3IM7 A;  4JKQ A;  1EVT A;  1G9C A;  4IY9 A;  3FJC A;  2YUG A;  3P6J A;  4I96 A;  4JAW A;  5DZU A;  3AH2 A;  3CRI A;  4L4H A;  4Q9P A;  4X38 A;  3ILA A;  4J2Y A;  3WO3 A;  3OBT A;  3HAL A;  4JKX B;  1WD3 A;  4I4R A;  4X3A A;  4OEG A;  4I2S A;  5DUY A;  3BRG C;  2I1B A;  3OJV A;  4OEE A;  2D20 A;  2QYI B;  1YTO A;  3O4D A;  5BXT A;  3JUT A;  4I6I A;  1DQO A;  1TFM B;  3BAG A;  3HBW A;  3N0K A;  1ISZ A;  3A21 A;  4D8H A;  3CRG A;  1TWM A;  3SNV A;  1JT3 A;  3BAQ A;  1PZZ A;  3PME A;  1YYN A;  4A7K A;  5JLV A;  1TP0 A;  1HWN B;  2Z49 A;  5E24 E;  2K4A B;  3K1X A;  3RMY A;  1DLL A;  1CE7 B;  3CA0 A;  5F8W A;  4ZA3 B;  4EKX B;  3HN1 A;  1IRP A;  2VLC A;  1RY7 A;  3AKI A;  2Q9X A;  3POK A;  3VUO A;  1DQG A;  1HKN A;  1ISX A;  3RSJ A;  4FGF A;  5EG6 C;  2VU9 A;  5FNX A;  2GZB A;  4ZBV B;  3BTA A;  4AN6 A;  3ZXD A;  1S0C A;  2P39 A;  3EF2 A;  4Z9W B;  1EV2 A;  2FFU A;  3AH1 A;  3PUB A;  1G9B A;  1DIW A;  3FFZ A;  1V6W A;  2KKI A;  4X37 A;  4X39 A;  3FJ9 A;  3S8J A;  2WRY A;  2ZR1 B;  1Z4S A;  4II0 A;  1RML A;  3RMX A;  1Z0H A;  4I1E A;  4ISR A;  1SR4 A;  1GGP B;  3A22 A;  4EFP A;  3IAG C;  1BAS A;  1T4Q A;  4JQ0 A;  2HWM A;  4DEP A;  4G9N A;  1PWA A;  5EC5 A;  5F90 A;  4XFU A;  3WMV A;  3FJB A;  3WMU A;  1T9F A;  4IY8 A;  4QAL A;  1BFB A;  1S0L A;  3AJ6 A;  2Z48 A;  3BAO A;  4END A;  3KMV A;  4Q91 A;  5FNW A;  1A8D A;  4I4O A;  4LO1 C;  3VSZ A;  2Y9F A;  1G9D A;  4KEJ A;  2D7R A;  3LLP A;  4LO0 A;  5FZU A;  4I0Y A;  5EHA A;  4YOL A;  5D61 A;  3UD7 A;  4J23 B;  4CJM A;  5BP5 A;  4P6A A;  1DZC A;  4I3N A;  4QO3 A;  5BQU A;  5BOW A;  1IJT A;  1DFC A;  2ZQO A;  1DZD A;  1M2T B;  3I29 B;  1FQ9 A;  4OW4 A;  4EFR A;  4LO2 C;  2KI4 A;  5F8S A;  4D0T A;  4I4X A;  4I37 A;  1ABR B;  4KBB A;  1JTC A;  3BX1 C;  4ZLB B;  1ITB A;  1QXM A;  1BFC A;  2Q3N B;  1JT4 A;  4GP0 A;  1I1E A;  3PHZ A;  3A23 A;  3NBC A;  3WIN C;  4EFQ A;  8I1B A;  1IT0 A;  1HWO B;  2RST A;  3O4O A;  4P0K A;  3H6S E;  4Z8S B;  2Y9X E;  4OWL A;  2NM1 A;  1FV2 A;  3AH4 A;  1AVX B;  2XOA A;  1DJS B;  2D7I A;  3AJ5 A;  2K8R A;  4LO7 C;  1II4 A;  1TWE A;  5BXS A;  4DEN A;  4XKI A;  4GAI A;  31BI A;  1HCE A;  1NZK A;  1VCL A;  21BI A;  2F2F C;  3OGG A;  4G6M A;  1JLY A;  3O49 A;  2VXR A;  4ZFU B;  4I4Y A;  1XZZ A;  4OUJ A;  3IM5 A;  4TLP A;  1PC8 B;  3ZX7 A;  4KEK A;  2VSA A;  1OQL B;  3FJF A;  1JLX A;  1NUN A;  3BAV A;  1W3F A;  1HIB A;  3P53 A;  4QKR A;  2D24 A;  1IOB A;  4H04 A;  1XYF A;  3P6I A;  3O44 A;  4QBC A;  3B9U A;  3ZC9 A;  3I2X A;  4I4P A;  1V6X A;  1JT7 A;  3IIR A;  7I1B A;  1K5U A;  4DCK C;  3N7M A;  3VEQ A;  3BA7 A;  2E4M C;  1IIL A;  2NVH A;  1AFC A;  5I1B A;  3CA1 A;  3HSM A;  3R4S A;  5F8Y A;  2KI6 B;  4QKS A;  2J3P A;  1V6U A;  1G9A A;  3CA3 A;  1IHK A;  2D23 A;  3O4B A;  1S0B A;  1FWV A;  2AFG A;  2ERM A;  3CU1 B;  3T8S A;  2X2T A;  3D7W B;  4LO8 B;  2VXT I;  4I1B A;  5JMC A;  3C9Z A;  1Q04 A;  6I1B A;  4IZE A;  3PG0 A;  2NZ9 A;  2LIE A;  1PUM B;  4USP A;  1Z2V A;  1FWU A;  3WO2 A;  2MC2 A;  5G00 A;  2Y9W C;  2LIQ A;  2DRY A;  3BA4 A;  2FO1 A;  3FGM A;  4LO1 A;  2NP0 A;  1S0G A;  3BAU A;  1FMM S;  3N7J A;  2FGF A;  5FZZ A;  3CA6 A;  3O4C A;  1MC9 A;  4QD2 C;  5D63 A;  4QBV A;  3FJA A;  3MPP G;  1WD4 A;  2NYY A;  2WBC A;  2MLL B;  4I4S A;  4I7I A;  4HJJ A;  2F8X C;  1RZO B;  2DS0 A;  4G9M A;  4GP3 A;  1AVA C;  1BAR A;  2HW9 A;  2BEB A;  2QN4 A;  4LO2 A;  1FV3 A;  1HCD A;  4ZFY B;  3JRR A;  1L2H A;  5BVP I;  3S8K A;  3BAH A;  5DVH A;  1N4K A;  4ISQ A;  2D43 A;  1R8O A;  4USO A;  4HR6 C;  1AF9 A;  3N7L A;  4I4V A;  1ILR 1;  1ISY A;  1F31 A;  4GAF A;  4HA2 A;  3WIN A;  3BRF A;  3FUO A;  4IHZ A;  1S0F A;  1FGA A;  41BI A;  4ZKT B;  1RG8 A;  4LO3 C; 
#chains in the Genus database with same CATH topology
 3CA5 A;  3N7K A;  3FJJ A;  3BRD A;  2KH2 A;  4MZG B;  1DFQ A;  1SZ6 B;  4KEI A;  4A7Z A;  3FJH A;  1HWP B;  3FJK A;  3IM6 A;  4H9W A;  3NBE A;  1QQL A;  4IYB A;  4GOV A;  2K43 A;  3H6R A;  1G82 A;  4KC3 A;  1AVW B;  2AAI B;  2VSE A;  4LO7 B;  1BA7 A;  3F1R A;  3OGF A;  2F2F A;  3V0A A;  1W3A A;  2HZ9 A;  4EB2 B;  1ISW A;  2R9K B;  1R8N A;  3H6R B;  3E8L C;  4P0J A;  3FJ8 A;  3FJE A;  2BEA A;  3FUQ A;  3VSF A;  2P23 A;  2FFV A;  2AXM A;  4G6J A;  3V0A B;  4JRA A;  5BXR A;  1ISV A;  4F34 A;  1MD6 A;  2ET2 A;  4GOY A;  1YF8 B;  3QYD A;  5GAQ A;  3H6Q A;  3TC2 A;  3A07 A;  2NTD A;  1WBC A;  2E4M A;  5D62 A;  3HOM A;  2NS2 A;  4AN7 B;  4L4I A;  4A7Y A;  3BA5 A;  3VT0 A;  4J2X A;  2D44 A;  3ZC8 A;  1I1B A;  3UDA A;  1S0D A;  1Q03 A;  4OWJ A;  3NBN A;  1JY0 A;  1Q1U A;  3AKF A;  3CQA A;  2Y9G A;  3OBR A;  4I8M A;  3V0B A;  1V6V A;  1PUU B;  2MIB A;  3O5W B;  3UJ0 A;  1ONK B;  3FJI A;  4PC4 A;  3AKG A;  3R4U A;  2RQ9 A;  9ILB A;  3W9T A;  3V0B B;  1HWM B;  1BLA A;  5B2H A;  3Q7Y A;  3AZW A;  3OJ2 A;  3VT2 A;  2AQZ A;  3FJD A;  4ION A;  2M49 A;  2KLL A;  3Q7X A;  1AVU A;  1EPW A;  4P0L A;  1AXM A;  1WBA A;  1W3G A;  4I4Q A;  3O3Q A;  2FDB M;  3VT1 A;  2ZQN A;  3ZXG A;  2ESU A;  5HPZ A;  2IWT B;  3NJ5 A;  4JPZ A;  4QD2 B;  4J2K A;  4JP0 A;  4F83 A;  3CA4 A;  2D22 A;  4ZGR B;  3F62 B;  1KNM A;  3I2A A;  2RG9 B;  3WO4 A;  3RTI B;  4OWK A;  2DRZ A;  3MAL A;  4IQP A;  1SR4 C;  1JT5 A;  2HWA A;  3O4A A;  3V79 C;  3AKH A;  4D0Z A;  2IHO A;  4Q9G A;  4LO3 A;  4ZFW B;  4R6U B;  3UD8 A;  4ZOT A;  2UUS A;  1YBI A;  1BFG A;  5FZY A;  4MZH A;  2GO2 A;  5DSS B;  1TIE A;  1P63 A;  4XFS A;  3UJ4 A;  1UPS A;  4G1R A;  1M16 A;  4FVV A;  1BFF A;  4J2S A;  1QQK A;  4LO0 C;  3AZV A;  1XHB A;  2BFH A;  3UD9 A;  1FN0 A;  3CAH A;  1K5V A;  4I4U A;  1CVS A;  5BP5 C;  1D0H A;  1TOO A;  3VWC A;  5BQU C;  4QC4 A;  4XFT A;  3RTJ B;  2VUA A;  1S0E A;  1FMZ A;  4EEE B;  3BB2 A;  3BAD A;  3OJM A;  1J0S A;  1YXW A;  3Q7W A;  1IRA X;  4IZX A;  1EYL A;  5BXP A;  4OEF A;  1BLD A;  2X2S A;  1JQZ A;  2L5X A;  3QR5 A;  3HMY A;  3NBD A;  3LTQ A;  4WBC A;  3WA1 A;  1TTU A;  3CRH A;  1E0O A;  2D1Z A;  2DRE A;  1XG6 A;  3IM7 A;  4JKQ A;  1EVT A;  1G9C A;  4IY9 A;  3FJC A;  2YUG A;  3P6J A;  4I96 A;  4JAW A;  5DZU A;  3AH2 A;  3CRI A;  4L4H A;  4Q9P A;  4X38 A;  3ILA A;  4J2Y A;  3WO3 A;  3OBT A;  3HAL A;  4JKX B;  1WD3 A;  4I4R A;  4X3A A;  4OEG A;  4I2S A;  5DUY A;  3BRG C;  2I1B A;  3OJV A;  4OEE A;  2D20 A;  2QYI B;  1YTO A;  4H75 A;  3O4D A;  5BXT A;  3JUT A;  4I6I A;  1DQO A;  1TFM B;  3BAG A;  3HBW A;  3N0K A;  1ISZ A;  3A21 A;  4D8H A;  3CRG A;  1TWM A;  3SNV A;  1JT3 A;  3BAQ A;  1PZZ A;  3PME A;  1YYN A;  4A7K A;  5JLV A;  1TP0 A;  1HWN B;  2Z49 A;  5E24 E;  2K4A B;  3K1X A;  3RMY A;  1DLL A;  1CE7 B;  3CA0 A;  5F8W A;  4ZA3 B;  4EKX B;  3HN1 A;  1IRP A;  2VLC A;  1RY7 A;  3AKI A;  2Q9X A;  3POK A;  3VUO A;  1DQG A;  1HKN A;  1ISX A;  3RSJ A;  4FGF A;  5EG6 C;  2VU9 A;  5FNX A;  2GZB A;  4ZBV B;  3BTA A;  4AN6 A;  3ZXD A;  1S0C A;  2P39 A;  3EF2 A;  4Z9W B;  1EV2 A;  2FFU A;  3AH1 A;  3PUB A;  1G9B A;  1DIW A;  3FFZ A;  1V6W A;  2KKI A;  4X37 A;  4X39 A;  3FJ9 A;  3S8J A;  2WRY A;  2ZR1 B;  1Z4S A;  4II0 A;  1RML A;  3RMX A;  1Z0H A;  4I1E A;  4ISR A;  4MZF B;  1SR4 A;  1GGP B;  3A22 A;  4EFP A;  3IAG C;  1BAS A;  1T4Q A;  4JQ0 A;  2HWM A;  4DEP A;  4G9N A;  1PWA A;  5EC5 A;  5F90 A;  4XFU A;  3WMV A;  3FJB A;  3WMU A;  1T9F A;  4IY8 A;  4QAL A;  1BFB A;  1S0L A;  3AJ6 A;  2Z48 A;  3BAO A;  4END A;  3KMV A;  4Q91 A;  5FNW A;  1A8D A;  4I4O A;  4LO1 C;  3VSZ A;  2Y9F A;  1G9D A;  4KEJ A;  2D7R A;  3LLP A;  4LO0 A;  5FZU A;  4I0Y A;  5EHA A;  4YOL A;  5D61 A;  3UD7 A;  4J23 B;  4CJM A;  5BP5 A;  4P6A A;  1DZC A;  4I3N A;  4QO3 A;  5BQU A;  5BOW A;  1IJT A;  1DFC A;  2ZQO A;  1DZD A;  1M2T B;  3I29 B;  1FQ9 A;  4OW4 A;  4EFR A;  4LO2 C;  2KI4 A;  5F8S A;  4D0T A;  4I4X A;  4I37 A;  1ABR B;  4KBB A;  1JTC A;  3BX1 C;  4ZLB B;  1ITB A;  1QXM A;  1BFC A;  2Q3N B;  1JT4 A;  4GP0 A;  1I1E A;  3PHZ A;  3A23 A;  3NBC A;  3WIN C;  4EFQ A;  8I1B A;  1IT0 A;  1HWO B;  2RST A;  3O4O A;  4P0K A;  3H6S E;  4Z8S B;  2Y9X E;  4OWL A;  2NM1 A;  1FV2 A;  4UY4 A;  3AH4 A;  1AVX B;  2XOA A;  1DJS B;  2D7I A;  3AJ5 A;  2K8R A;  4LO7 C;  1II4 A;  1TWE A;  5BXS A;  4DEN A;  4XKI A;  4GAI A;  31BI A;  1HCE A;  1NZK A;  1VCL A;  21BI A;  2F2F C;  3OGG A;  4G6M A;  1JLY A;  3O49 A;  2VXR A;  4ZFU B;  4I4Y A;  1XZZ A;  4OUJ A;  3IM5 A;  4TLP A;  1PC8 B;  3ZX7 A;  4KEK A;  2VSA A;  1OQL B;  3FJF A;  1JLX A;  1NUN A;  3BAV A;  1W3F A;  1HIB A;  3P53 A;  4QKR A;  2D24 A;  1IOB A;  4H04 A;  1XYF A;  3P6I A;  3O44 A;  4QBC A;  3B9U A;  3ZC9 A;  3I2X A;  4I4P A;  1V6X A;  1JT7 A;  3IIR A;  7I1B A;  1K5U A;  4DCK C;  3N7M A;  3VEQ A;  3BA7 A;  2E4M C;  1IIL A;  2NVH A;  1AFC A;  5I1B A;  3CA1 A;  3HSM A;  3R4S A;  5F8Y A;  2KI6 B;  4QKS A;  2J3P A;  1V6U A;  1G9A A;  3CA3 A;  1IHK A;  2D23 A;  3O4B A;  1S0B A;  1FWV A;  2AFG A;  2ERM A;  3CU1 B;  3T8S A;  2X2T A;  3D7W B;  4LO8 B;  2VXT I;  4I1B A;  5JMC A;  3C9Z A;  1Q04 A;  6I1B A;  4IZE A;  3PG0 A;  2NZ9 A;  2LIE A;  1PUM B;  4USP A;  1Z2V A;  1FWU A;  3WO2 A;  2MC2 A;  5G00 A;  2Y9W C;  2LIQ A;  2DRY A;  3BA4 A;  2FO1 A;  3FGM A;  4LO1 A;  2NP0 A;  1S0G A;  3BAU A;  1FMM S;  3N7J A;  2FGF A;  5FZZ A;  3CA6 A;  3O4C A;  1MC9 A;  4QD2 C;  5D63 A;  4QBV A;  3FJA A;  3MPP G;  1WD4 A;  2NYY A;  2WBC A;  2MLL B;  4I4S A;  4I7I A;  4HJJ A;  2F8X C;  1RZO B;  2DS0 A;  4G9M A;  4GP3 A;  1AVA C;  1BAR A;  2HW9 A;  2BEB A;  2QN4 A;  4LO2 A;  1FV3 A;  1HCD A;  4ZFY B;  3JRR A;  1L2H A;  5BVP I;  3S8K A;  3BAH A;  5DVH A;  1N4K A;  4ISQ A;  2D43 A;  1R8O A;  4USO A;  4HR6 C;  1AF9 A;  3N7L A;  4I4V A;  1ILR 1;  1ISY A;  1F31 A;  4GAF A;  4HA2 A;  3WIN A;  3BRF A;  3FUO A;  4IHZ A;  1S0F A;  1FGA A;  41BI A;  4ZKT B;  1RG8 A;  4LO3 C; 
#chains in the Genus database with same CATH homology
 3CA5 A;  3N7K A;  3FJJ A;  3BRD A;  2KH2 A;  4MZG B;  1DFQ A;  1SZ6 B;  4KEI A;  4A7Z A;  3FJH A;  1HWP B;  3FJK A;  3IM6 A;  4H9W A;  3NBE A;  1QQL A;  4IYB A;  4GOV A;  2K43 A;  3H6R A;  1G82 A;  4KC3 A;  1AVW B;  2AAI B;  2VSE A;  4LO7 B;  1BA7 A;  3F1R A;  3OGF A;  2F2F A;  3V0A A;  1W3A A;  2HZ9 A;  4EB2 B;  1ISW A;  2R9K B;  1R8N A;  3H6R B;  3E8L C;  4P0J A;  3FJ8 A;  3FJE A;  2BEA A;  3FUQ A;  3VSF A;  2P23 A;  2FFV A;  2AXM A;  4G6J A;  3V0A B;  4JRA A;  5BXR A;  1ISV A;  4F34 A;  1MD6 A;  2ET2 A;  4GOY A;  1YF8 B;  3QYD A;  5GAQ A;  3H6Q A;  3TC2 A;  3A07 A;  2NTD A;  1WBC A;  2E4M A;  5D62 A;  3HOM A;  2NS2 A;  4AN7 B;  4L4I A;  4A7Y A;  3BA5 A;  3VT0 A;  4J2X A;  2D44 A;  3ZC8 A;  1I1B A;  3UDA A;  1S0D A;  1Q03 A;  4OWJ A;  3NBN A;  1JY0 A;  1Q1U A;  3AKF A;  3CQA A;  2Y9G A;  3OBR A;  4I8M A;  3V0B A;  1V6V A;  1PUU B;  2MIB A;  3O5W B;  3UJ0 A;  1ONK B;  3FJI A;  4PC4 A;  3AKG A;  3R4U A;  2RQ9 A;  9ILB A;  3W9T A;  3V0B B;  1HWM B;  1BLA A;  5B2H A;  3Q7Y A;  3AZW A;  3OJ2 A;  3VT2 A;  2AQZ A;  3FJD A;  4ION A;  2M49 A;  2KLL A;  3Q7X A;  1AVU A;  1EPW A;  4P0L A;  1AXM A;  1WBA A;  1W3G A;  4I4Q A;  3O3Q A;  2FDB M;  3VT1 A;  2ZQN A;  3ZXG A;  2ESU A;  5HPZ A;  2IWT B;  3NJ5 A;  4JPZ A;  4QD2 B;  4J2K A;  4JP0 A;  4F83 A;  3CA4 A;  2D22 A;  4ZGR B;  3F62 B;  1KNM A;  3I2A A;  2RG9 B;  3WO4 A;  3RTI B;  4OWK A;  2DRZ A;  3MAL A;  4IQP A;  1SR4 C;  1JT5 A;  2HWA A;  3O4A A;  3V79 C;  3AKH A;  4D0Z A;  2IHO A;  4Q9G A;  4LO3 A;  4ZFW B;  4R6U B;  3UD8 A;  4ZOT A;  2UUS A;  1YBI A;  1BFG A;  5FZY A;  4MZH A;  2GO2 A;  5DSS B;  1TIE A;  1P63 A;  4XFS A;  3UJ4 A;  1UPS A;  4G1R A;  1M16 A;  4FVV A;  1BFF A;  4J2S A;  1QQK A;  4LO0 C;  3AZV A;  1XHB A;  2BFH A;  3UD9 A;  1FN0 A;  3CAH A;  1K5V A;  4I4U A;  1CVS A;  5BP5 C;  1D0H A;  1TOO A;  3VWC A;  5BQU C;  4QC4 A;  4XFT A;  3RTJ B;  2VUA A;  1S0E A;  1FMZ A;  4EEE B;  3BB2 A;  3BAD A;  3OJM A;  1J0S A;  1YXW A;  3Q7W A;  1IRA X;  4IZX A;  1EYL A;  5BXP A;  4OEF A;  1BLD A;  2X2S A;  1JQZ A;  2L5X A;  3QR5 A;  3HMY A;  3NBD A;  3LTQ A;  4WBC A;  3WA1 A;  1TTU A;  3CRH A;  1E0O A;  2D1Z A;  2DRE A;  1XG6 A;  3IM7 A;  4JKQ A;  1EVT A;  1G9C A;  4IY9 A;  3FJC A;  2YUG A;  3P6J A;  4I96 A;  4JAW A;  5DZU A;  3AH2 A;  3CRI A;  4L4H A;  4Q9P A;  4X38 A;  3ILA A;  4J2Y A;  3WO3 A;  3OBT A;  3HAL A;  4JKX B;  1WD3 A;  4I4R A;  4X3A A;  4OEG A;  4I2S A;  5DUY A;  3BRG C;  2I1B A;  3OJV A;  4OEE A;  2D20 A;  2QYI B;  1YTO A;  4H75 A;  3O4D A;  5BXT A;  3JUT A;  4I6I A;  1DQO A;  1TFM B;  3BAG A;  3HBW A;  3N0K A;  1ISZ A;  3A21 A;  4D8H A;  3CRG A;  1TWM A;  3SNV A;  1JT3 A;  3BAQ A;  1PZZ A;  3PME A;  1YYN A;  4A7K A;  5JLV A;  1TP0 A;  1HWN B;  2Z49 A;  5E24 E;  2K4A B;  3K1X A;  3RMY A;  1DLL A;  1CE7 B;  3CA0 A;  5F8W A;  4ZA3 B;  4EKX B;  3HN1 A;  1IRP A;  2VLC A;  1RY7 A;  3AKI A;  2Q9X A;  3POK A;  3VUO A;  1DQG A;  1HKN A;  1ISX A;  3RSJ A;  4FGF A;  5EG6 C;  2VU9 A;  5FNX A;  2GZB A;  4ZBV B;  3BTA A;  4AN6 A;  3ZXD A;  1S0C A;  2P39 A;  3EF2 A;  4Z9W B;  1EV2 A;  2FFU A;  3AH1 A;  3PUB A;  1G9B A;  1DIW A;  3FFZ A;  1V6W A;  2KKI A;  4X37 A;  4X39 A;  3FJ9 A;  3S8J A;  2WRY A;  2ZR1 B;  1Z4S A;  4II0 A;  1RML A;  3RMX A;  1Z0H A;  4I1E A;  4ISR A;  4MZF B;  1SR4 A;  1GGP B;  3A22 A;  4EFP A;  3IAG C;  1BAS A;  1T4Q A;  4JQ0 A;  2HWM A;  4DEP A;  4G9N A;  1PWA A;  5EC5 A;  5F90 A;  4XFU A;  3WMV A;  3FJB A;  3WMU A;  1T9F A;  4IY8 A;  4QAL A;  1BFB A;  1S0L A;  3AJ6 A;  2Z48 A;  3BAO A;  4END A;  3KMV A;  4Q91 A;  5FNW A;  1A8D A;  4I4O A;  4LO1 C;  3VSZ A;  2Y9F A;  1G9D A;  4KEJ A;  2D7R A;  3LLP A;  4LO0 A;  5FZU A;  4I0Y A;  5EHA A;  4YOL A;  5D61 A;  3UD7 A;  4J23 B;  4CJM A;  5BP5 A;  4P6A A;  1DZC A;  4I3N A;  4QO3 A;  5BQU A;  5BOW A;  1IJT A;  1DFC A;  2ZQO A;  1DZD A;  1M2T B;  3I29 B;  1FQ9 A;  4OW4 A;  4EFR A;  4LO2 C;  2KI4 A;  5F8S A;  4D0T A;  4I4X A;  4I37 A;  1ABR B;  4KBB A;  1JTC A;  3BX1 C;  4ZLB B;  1ITB A;  1QXM A;  1BFC A;  2Q3N B;  1JT4 A;  4GP0 A;  1I1E A;  3PHZ A;  3A23 A;  3NBC A;  3WIN C;  4EFQ A;  8I1B A;  1IT0 A;  1HWO B;  2RST A;  3O4O A;  4P0K A;  3H6S E;  4Z8S B;  2Y9X E;  4OWL A;  2NM1 A;  1FV2 A;  4UY4 A;  3AH4 A;  1AVX B;  2XOA A;  1DJS B;  2D7I A;  3AJ5 A;  2K8R A;  4LO7 C;  1II4 A;  1TWE A;  5BXS A;  4DEN A;  4XKI A;  4GAI A;  31BI A;  1HCE A;  1NZK A;  1VCL A;  21BI A;  2F2F C;  3OGG A;  4G6M A;  1JLY A;  3O49 A;  2VXR A;  4ZFU B;  4I4Y A;  1XZZ A;  4OUJ A;  3IM5 A;  4TLP A;  1PC8 B;  3ZX7 A;  4KEK A;  2VSA A;  1OQL B;  3FJF A;  1JLX A;  1NUN A;  3BAV A;  1W3F A;  1HIB A;  3P53 A;  4QKR A;  2D24 A;  1IOB A;  4H04 A;  1XYF A;  3P6I A;  3O44 A;  4QBC A;  3B9U A;  3ZC9 A;  3I2X A;  4I4P A;  1V6X A;  1JT7 A;  3IIR A;  7I1B A;  1K5U A;  4DCK C;  3N7M A;  3VEQ A;  3BA7 A;  2E4M C;  1IIL A;  2NVH A;  1AFC A;  5I1B A;  3CA1 A;  3HSM A;  3R4S A;  5F8Y A;  2KI6 B;  4QKS A;  2J3P A;  1V6U A;  1G9A A;  3CA3 A;  1IHK A;  2D23 A;  3O4B A;  1S0B A;  1FWV A;  2AFG A;  2ERM A;  3CU1 B;  3T8S A;  2X2T A;  3D7W B;  4LO8 B;  2VXT I;  4I1B A;  5JMC A;  3C9Z A;  1Q04 A;  6I1B A;  4IZE A;  3PG0 A;  2NZ9 A;  2LIE A;  1PUM B;  4USP A;  1Z2V A;  1FWU A;  3WO2 A;  2MC2 A;  5G00 A;  2Y9W C;  2LIQ A;  2DRY A;  3BA4 A;  2FO1 A;  3FGM A;  4LO1 A;  2NP0 A;  1S0G A;  3BAU A;  1FMM S;  3N7J A;  2FGF A;  5FZZ A;  3CA6 A;  3O4C A;  1MC9 A;  4QD2 C;  5D63 A;  4QBV A;  3FJA A;  3MPP G;  1WD4 A;  2NYY A;  2WBC A;  2MLL B;  4I4S A;  4I7I A;  4HJJ A;  2F8X C;  1RZO B;  2DS0 A;  4G9M A;  4GP3 A;  1AVA C;  1BAR A;  2HW9 A;  2BEB A;  2QN4 A;  4LO2 A;  1FV3 A;  1HCD A;  4ZFY B;  3JRR A;  1L2H A;  5BVP I;  3S8K A;  3BAH A;  5DVH A;  1N4K A;  4ISQ A;  2D43 A;  1R8O A;  4USO A;  4HR6 C;  1AF9 A;  3N7L A;  4I4V A;  1ILR 1;  1ISY A;  1F31 A;  4GAF A;  4HA2 A;  3WIN A;  3BRF A;  3FUO A;  4IHZ A;  1S0F A;  1FGA A;  41BI A;  4ZKT B;  1RG8 A;  4LO3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...