2HWZH

Fab fragment of humanized anti-viral antibody medi-493 (synagis tm)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
227
structure length
227
Chain Sequence
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDDKKDYNPSLKSRLTISKDTSANQVVLKVTNMDPADTATYYCARSMITNWYFDVWGAGTTVTVSSASTKGPSVFPLAPSSAAAAGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a single tryptophan residue as critical for binding activity in a humanized monoclonal antibody against respiratory syncytial virus
rcsb
source organism Homo sapiens, mus musculus
molecule tags Immune system
molecule keywords Immunoglobulin Fab light chain
total genus 39
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2006-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hwzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hwzH01
4Y5YC 4CUCA 1QFWH 5A3IC 3U0PB 5I0ZA 3S37H 1OAUH 3KWWA 3AXLA 3Q3GB 1KPUA 3EHBD 4H20H 4LASL 2I60H 4FFVD 5CP3H 5EZIL 2YA1A 1JGUL 1JK8B 1SVZA 3WO4B 3QFJB 3MV7E 3AMKA 5T3ZL 3BRDA 3ARGD 4KKBC 3BKML 4OZ4B 4JFEB 4LHUA 1AHWC 1TVHA 3GSXB 3RKDD 35C8H 4L8SA 5DHYA 5IB5A 4DTGH 5BMFL 3HZKA 5L0QB 3TO2B 5JMRA 1A3LH 4QRRA 3PIQA 1JP5A 4KJYA 3DO3A 4WV1B 2X4RA 1B0RA 2EXYD 4LFHG 5I71C 5DHVB 3MJ8A 2E27L 2HH0H 3VRIA 3M8OH 4TRPH 2BVEA 3WXWH 2ED7A 1AE6H 2A0LC 3CLFH 4EUPB 2FO4B 3KYOA 2ZKHL 3O3EA 3QIBB 1T22A 1BVKA 5F3BB 4TVPH 4MS8D 2JIXB 3ZKXB 2PKDA 5D2LA 5EBWA 4OQ1A 2VR5A 1ORSB 4AEIH 1LP9B 3V5DA 4UBDC 4ODSH 1EVUA 5IEHA 5D9SB 3T0EE 3QUYC 5KSAA 5F6HI 4P2QD 1DUYA 2FJFA 1FL3A 1Z5LB 5HHOE 5HYFA 3SGDH 1MCKA 4R96A 4NC1C 3AU1A 5F9DC 1S9VB 1DP0A 2VLKA 3J8F7 4WGWB 3HI1A 1A8JH 3EYSL 4JE4B 1A2YA 2BRRL 2APBA 3RTQA 4WO4B 5JHDD 4YJZL 4OGXH 1OAKH 2DLGA 4EXKA 4KKCC 2MSPA 2NR6C 3O2DH 2IBBA 1ITBB 2L4OA 5F7LB 2AI0L 2GY7B 2M1KA 3L3IB 3QT2A 4NQDD 4P5TC 2PN5A 1KNOA 5K9OB 2QQKL 2XV6B 4Y5VA 1KEGH 3V95A 2EDEA 1FO0H 3HLAB 2AV7A 3KPOB 1HILB 4PJBF 2ATKA 3VFRA 3VDBA 4HS3A 5F9WC 1XGTA 3SDDA 4KAQH 3QRFM 1I8KB 1MPAH 3OJ2C 4M6OH 4F7CA 43C9A 4OD3L 4LGSB 5T5NG 1G7LA 4OZHA 1XGUB 5HHMB 5CZVL 1NC4D 4X4YA 5JW3H 2AXJA 3G04A 3IJYA 5BRZE 2NY3D 3RWEA 2Z0BA 1EHLH 5CGMA 3HZVA 2UZYB 3N06B 4EKXA 3FO1A 4JPIA 2C1PA 1YQVH 4P48A 3RWJB 2X2YA 4KVNH 4X7CC 8CGTA 1YY8B 4X7SL 4R8WL 4DK6A 3TVMD 5IMMA 1AO7B 3O4LE 4Z7NE 1R5IB 5LQBH 3UJTL 2HJKA 4F7TA 1MIML 2WM0A 1PZ5A 3P40A 4JB9L 4NKDB 2ORBH 5C0AA 3OXSB 4FQXB 4Y4HB 1YEIL 5DJ0B 4NNXA 1L0YA 3ET9F 4OZGA 4QTIL 2QADB 3HI5H 3KS0H 3VXSD 4TNVF 4E0RB 2LE9A 2P8LA 4HJ0D 2ZUVA 2XG4A 2NXZB 1TQBB 4XVUD 3BJ91 3B2VL 4EVNB 3B9AA 2YA2A 2C4FT 4IMKA 5F9JB 4QXUL 2GAZB 3SDXF 4IS6B 4R3SB 1CFVH 4PRHD 3OKOB 1UB5A 5IW6A 2HTKD 5EBGA 2GJ6B 3SE9L 1OSPL 2VIRB 1X4YA 2Y06L 5DJ8A 5EWIL 3P11L 3WUZA 1XMWA 2OK0L 4J3VA 1VESA 1CDHA 3PWUA 4QY8B 5AUMB 4R97C 5C08E 3UZVB 2X4QB 1QNZL 3WIFB 5GGSY 2UWEA 3ILPB 4K9EC 1AC6A 2FD6L 3LDBB 3PL6C 5DMYA 4DW2L 5I15H 3B9KB 1P7HL 3T0DA 4BFBD 2AEIT 2R2EA 4DZ8B 4Z8FH 1UXWB 2B39A 1G6RA 4LNRA 2JCCA 2DKSA 3K80A 4GS7B 2GIYA 1NCWL 3LIZH 3ARBC 1NDMA 5F88B 5BMFH 3WCYA 3BFOA 4S11A 4PJXA 1MQ8A 5I1GL 1K8IB 3T09A 3S5LG 2HT3C 3ARVA 1YEHL 4DGIL 2EYRA 3TBSB 4LSQH 1NUGA 1CT8B 1ZSDA 3DTXA 4IOIA 5D7KE 3C60D 3IDJA 4M43H 3HRZA 3W0WB 1GIGH 1LDPH 2F5BL 1DLHB 4Y19B 2HKFL 1HIMH 2FBOJ 1OP5K 2BOCA 1PY9A 2WK2A 1VB9A 1GZPB 1RV6X 1SY6A 2CLZA 3W2DL 1LK3L 1V8HA 3KPPB 4Z9KB 5F7MC 4LPYA 2R39A 4HFUL 1A1MA 2OCFD 2R4RH 3MYZA 2VXVL 4U0QB 6CGTA 2F54A 4HDIB 2CO7B 1WBYA 3CAFA 4DAGH 3QDGB 4RMUA 1YPZE 4NSKB 2XFXA 4XGZB 3D69B 3GMQA 4HEME 1JNNH 5E2VL 3HC3H 3TT1L 3BDBA 4FFZH 3MV8A 4GQPH 2V5TA 3SGEH 4L3EA 2X1WL 4JM2D 5HDBF 5J9PA 5GHWH 5GJSL 3RUGB 4KDVA 1T0NA 2ADGA 3KG5A 2P8MB 4S2SB 3WS3A 3G5VB 5ISZA 4GRWB 3Q48A 1NEUA 3HZMA 4G43A 5JA9A 3IXTA 3VJ6B 1RK1B 2DJUA 2QQKH 2X1PA 1RZGB 2P8PB 2V5RA 4XPAH 5FYKE 4F7EA 1BJ1H 4R2GC 1TTUA 1RUMH 1NCCL 4PRIE 5EZLB 3TWCL 2FDBP 1ITCA 3MJ9H 5A16A 5B3JE 3TT1H 3MOQA 3WXVH 4P2QE 1MCSA 3O6MH 5TDNA 2DQUL 2Y6SD 2ZJSL 1PG7X 2FATH 1E6JH 3I6KA 4QCIA 5EU4B 3RIAK 3TEUA 1YPZF 2IFGA 1QRNE 3G08B 5CLWA 4D0CB 4IRJD 1CDCA 4N0CC 4JFZH 4Y1AA 1TZHA 5JHLH 3QQ3A 1RZ7L 4S1SL 4URTB 3O11B 5JZ7D 3TBWA 12E8L 3TYGH 1Z6JT 4YDJA 3STLA 3T4AA 4F8QA 1GC1C 3HG1A 5F7NC 5E8NB 4F33B 4UNTA 2IADA 3AROA 2EC9U 1KC5H 4R7NA 1MHEB 5EG6C 1ZHLB 5C0JB 2I24N 2WBJB 1U36A 4HKJB 2EDOA 2PO6B 1KYOJ 4FFVC 4RMWA 4XPFL 3WUWA 4JFPA 2DN7A 3QDMD 1BIHA 5I30H 3OV6A 1KJVA 3RU8L 3VXOA 5KVFL 4M02A 5JHLL 2ZP0T 3EKCA 3HNVL 2ZUSA 3T3MF 5CJ5A 1A64A 1MNUH 2X9YA 3QEQE 3P4LA 3CGTA 5C6PB 2VDML 1CFSB 4NQXA 1M7DA 5J1AB 4LEXL 3BQUC 1X5XA 2AJXH 4R96B 4WHYH 5H94B 4LCYA 3F7RA 3ZT7A 4RQQA 4WUUE 5ITFB 5ADOH 2VB5A 2HKHH 4APQB 2IH3B 2J8OA 1FFPB 3RY6A 4MQSB 1VGKA 2CRYA 4OD2A 4B50A 2YD6A 4QT5A 4KI5C 12E8H 3LSOB 3L1OL 3T3PE 2DQCH 1ZA3B 3O9WB 5BRZD 3I50L 4JRYD 4JM2B 1MVFA 1ACYH 2Z35B 1XGQB 1B4RA 4ZXBB 4UUJB 2DQEH 1KULA 5BV7L 1F3RB 1A3RH 4WW1B 3KPOA 1AP2A 1MCNA 1NKOA 3MRKB 2D7OA 4P46C 1RZ8A 1UKSA 1NMCB 4HW6A 2ZCLL 1LO4L 5I1KL 4I0CC 1UB6B 1EZVY 3MC0A 3ARDD 2VQ1B 3SDXE 4ZUWA 4OLZH 1CG9A 3BIKA 3MCLL 3WBDA 2RQ8A 1CU4L 2H2PD 1NCNA 3VRLF 1G0YR 3WN5A 1FLTX 3LQMA 3G6DL 3GIZL 4U1LA 5D71H 1S7UA 2A6JA 2DF3A 3QXWA 1MI5A 2OTPA 3O2DL 4WEMB 1T5XB 4NO0A 1I7RB 2VH5L 2MQ0A 1FO0A 3KPMA 4QXUH 3RY5A 4EUPG 1IBGH 1LD9B 4EQ2A 1A7PH 2QQLH 4PFEA 5CGYC 3LD8C 1T66C 4XXCA 5F6IC 1P7KA 5FK9A 4ZFOL 4CMHB 5HDQL 2C3VB 4X8XA 4NM4L 4Z7WA 4NKDA 4ELMB 5CLTA 3AREB 1UACH 3BQUB 2ZSVA 5DJ0A 3B5HA 3ULUF 4WEBH 1JHKH 1EFXD 3VFSB 4YQXL 4E0RA 5CZKA 4WFGE 1UZ8B 4J3XA 2D2OA 3FB6B 3IDGB 1FZJB 4XNXH 5C6TL 1CFNA 1Q9WA 4NT6B 3MUGB 3RNQB 2EE2A 3OX8B 2DMBA 2EDNA 5E2UL 3HAEH 5C70A 2XQYK 2UWEE 1BVLB 3ZDZF 3GUTB 1LK2B 4JHWL 1UVQB 2D4DA 2BRQA 3O8XC 1GGTA 1FFOA 1KUMA 4P3DB 1I1CA 5FF6A 1MCHA 1FSKB 3F7YA 2DAVA 4GMSH 3EHBC 2Q6WB 2D0FA 4JRXE 1P4BH 4LPWA 5HDOA 1VPOH 1MIMH 5D6DC 4A6YA 3WIFA 4NOFA 5D96C 1ZTXH 3QDJA 1S5IH 4P0DA 1FGVH 1YNLH 1FV1A 4HC1L 3DVFA 4X6DA 3OGCB 5JUEL 4YE4H 3BT2L 2XZQH 2PCPB 4PJIF 1LEIA 1X7QA 3TVMB 1EEZA 2IALA 5IESH 3TWCH 4PJ9B 2FYYA 4UIMA 5IMLA 3W9EB 1VPOL 4GSDH 4HKBA 4D0DB 3TYFA 2APTA 1LO0L 3D2UB 3QCTH 4QF1A 2OLDA 4FQQA 3VA2C 5FUZH 1Q1JH 2R23B 2ITCB 1PSKH 3QUYB 2CR3A 3MLUL 2FL5B 1I9IH 4PJXB 5A1AA 1KXQE 5DYOA 3GSNB 4JY6B 2XT1B 1FJ1B 2Y06H 3GIVA 1FC1A 5CSZA 3B5GA 2GFBA 3HPJB 4OLWH 4PB0H 3FFCD 4H1LH 1CS6A 5CUSL 5DDHB 4GAJL 2X4NA 4YHIA 3FRPG 4YHLH 3L5XH 4L8SB 5IB5B 3RWGB 3QIWD 3DSFL 3TO4D 2AV1A 4NQVB 3U9UB 1YEEL 4KQ4L 1A1MB 2MQCA 3AS2A 3Q1SH 4I2XB 5T3XD 1ZT4B 3RGVD 3ARGA 4NFDA 2H41A 5DJZA 3TA3B 4FP8H 5FV1L 5ADPL 4CMMB 1TDQA 2ICES 3S96A 1CWVA 2D7TL 5I1CH 4XP9L 3ROLB 1SEBB 4D9RE 4JY4A 4D9QE 5J13B 2I9LB 4XNUL 1MY7A 5LGJA 3K1DA 3V4VH 4PTTA 4ZFZB 3WIIH 2XWJA 5JIKA 3V52H 2JIXA 4XMKL 1Q38A 1OGAE 3WFEL 1Z3GH 2PTTA 3QAZC 4FQ1H 2ZOKA 4H26B 1CDIA 4M43L 3MV8B 1OAXH 1GYAA 4KMTL 2ICWB 1OCWH 1T7YA 4HX1B 2X4PB 2K9UA 2BVOA 4PB9H 4TUOA 3IFPB 4XNUH 1DQQA 1Z5LA 5ISZB 3VFWA 1IARB 1KC5L 3HUJF 2F9BT 4HS6B 3FQUA 1IM9D 1U95A 3TP4A 4YHPA 2H3NB 1UM4H 4KI5F 1OM3H 4P3CL 3DV4B 1GAFH 1H5BB 1KTLB 4ORGA 4JFHD 5EZLA 1RMFL 5D2LE 4AG4H 2V17L 4ZUTB 4LDOB 5BCAA 3NPSB 1XGRA 2X4TA 4PGCB 1CE1H 4J7RA 1QLEL 2AXGA 2IQAA 5DHVH 4I2XE 1HQRB 3NCMA 3S37X 5IJVB 4GT7A 5CINL 2CKBH 3VFTB 2RCSH 4R9HA 5C07B 4M7JL 5D2NA 1U41A 3EOYG 4AM0B 1X5KA 3DYPA 5J3HC 2CDEA 3BJLA 4M1CD 3VRLE 4OAWA 5I9QC 3PJSA 4MJID 1A7RH 2IADB 2VE6B 1RSFA 3DMMA 1EK3A 2VZ3A 1FNGB 1KENL 1L7IL 1MCWM 1MLBB 4K94L 3SGEI 3DUUB 4LVHC 5DMJB 1C5BL 4EDXA 3NABL 4KRPD 4NHUA 2Z8SA 5C09D 1F6AB 4BQ6A 1A9EB 1Q0XH 3RWJA 1BVZA 3WHXB 1EXUB 5DVNA 4M00A 3D25B 1GGCH 4MAYB 3BHBB 5J1AA 3H0TB 5GIRB 2JJWA 2X10A 1LO3H 2RR3A 1ZLSL 5IW1B 1X5IA 4OLXL 3VRJA 4F7TB 4NQDB 5IFAH 1C16A 1MCRA 5DD3L 1CXKA 3DBXA 1SM3L 2IPKA 2QEJA 4CNIA 4NNXB 1KJMB 4JR9H 3BDYL 1T89A 1CQYA 1Q0YH 4LSUL 2E7BA 3D0LB 5DD6A 4C56E 1DANT 4IRJB 4GMSL 4M4RA 4QRSB 2IANA 4RAHA 3UYPA 1H5BC 8FABB 1HXYA 2OTWB 1CICC 2FX8L 4AYFA 2EICA 2BVPB 2UWEF 5I18L 4HF5H 3C6LD 1TCRA 3BZDA 3BVNA 3OKOA 2DWEA 3G6AB 5D6DA 4NNPL 4NQCA 3NN8A 5D1ZC 4PY7B 2ZUQC 4J2XA 4OLUH 4ZPVA 1ED3A 1NANI 4ZFOA 2FHFA 3PP4L 4JFEA 4LHUB 4LSRL 1LD9A 32C2B 1F90H 1HOCA 3AB0B 5DD3H 3GSQA 3QZWG 4QOKE 3UO1H 4NPYB 3OKKA 3PIQB 2R2EB 4DZ8A 3I2CL 3FO2B 5E7FA 4E9LA 4XX1G 3PWLA 3WFDL 4NQSB 2JCCB 4YHZL 2V9TA 3DIFB 1GGIH 1ZK9A 4OIBA 1F4WH 4IRZH 4LSRH 1OB1B 2J6EL 4XCCH 5EA0L 3IFLL 3GJFB 4F7PA 3EZJB 5HSFA 3EYSH 3TBSA 5C0AD 3QFDB 1ZAGA 4BKLB 3B9EA 4YHOH 1YNTA 1RZIB 1F90L 4F2MA 2B7DT 2OBGA 3ROOB 3EDEA 3M45A 4HMCA 1GZPA 3ILQD 3O4OC 1AR1C 4MAYD 4M48H 1XF5A 1NC4B 3JVGC 1HHKA 1QHOA 1SYVB 3LHPH 1H8NA 4Y4FC 2HT4D 5FF6B 2BNQD 4YHMH 5C0CB 1AXTL 1NL0L 2QSVA 3VD7A 1IKNC 1DN0A 1A2YB 4X7DC 3GSUB 3LQAH 3BUYB 3QCVL 4NSKA 3QDJB 3L3OB 3RZCB 3LHPL 5FO8B 3LKNB 3LY6A 4PYHA 3OGCA 1S7WB 1WZLA 4X5WB 4WDIA 5SWZD 4I77H 1MCIA 5C86A 4Y4HD 2EEBA 3FT2A 5FOBA 5LAXB 4JFDD 3HC4L 4HWBL 1WAAF 4ODBD 2XN9B 4E5XB 1X3DA 2FBJL 3CCHB 4JHWH 2ITCA 4MQ7A 3CVHL 4XPTH 4HS3B 2FL5A 1NAMH 5K33A 3LKSA 3ZYIA 5DYOB 4EI5C 1I7TB 1NLDH 1RIHH 1Y18A 2CIKB 3GHEH 2VLRB 3JBG7 3UTSA 2ENYA 1BZ7B 4QXTA 4FFWC 5DJCA 4G7YH 2B1AL 4I4WA 5C0BD 4BJLA 4U6HA 1FH5L 4QRPA 4JKLA 4P9MH 3CSPA 4LLDB 4PS4L 5ELIA 5HI3D 3RAJL 4NYLA 5FCUH 5HI5C 3HC4H 3QPXL 2DBJA 3PWVA 5C9KA 3UC0L 4D0CA 4NKIL 3DHJA 4MNQA 4K94H 1U92B 1C5DB 2R8SH 3RL2B 3ARGB 5EC1B 2D7MA 2P5EE 2OTUB 3BPLB 4YAQB 3S3JA 1QSFD 3FO0L 2PYFA 4HV8B 2W0LA 1WAAE 3MNWB 3P73A 5AEAA 3LB6C 4TYUA 2FH8A 4R4NC 5J89A 4PLOB 2XA8L 4LCUB 4OFIA 4GG6E 1F2QA 3U1SL 1IEHA 5L9DH 1GGBL 1B88A 2CKBL 1XR9A 2VDNL 4PJ9D 2MQ3A 5DD1L 2ZOKB 3SDAA 4LLVB 3RGVC 5ADOL 2NY1D 3P4OB 4DOHE 1BAFH 1EHNA 3BYTA 2BVOB 3DGGB 2XOTA 1NSNL 3QDHA 3FRUA 2FH6A 2XZCL 5E8EA 1MFEL 4IS6A 4R3SA 2DQHL 4X6EB 3LD8B 2DQJH 1OM3L 4Y1AD 3JV4B 4PGBB 1A22B 4OD1L 3UTSD 5IW6B 4PJDF 5F7EL 2ZUWA 5KBNC 4Z7WF 3UPAA 3QQNA 2IH3A 3QUXC 1MWAA 4X6CE 4MLSA 1N64L 3VDAA 3NIGE 3UROR 5CJBA 5DJYB 4IIQA 4F3FA 5EU7C 5SWZB 4J4PD 4HT1L 4L4VE 5F97E 4P9HH 4MDJB 3STZA 1FAKT 5IJVA 1JUFB 4WO4D 3S3SA 3N0PB 5CBEA 4BA8A 2VXUH 2XQBH 3E6FA 3KDMB 4WW1A 4LVNB 2Q3AA 2VDOL 4X5XA 5B8CC 2W9LA 5F89B 1RZ8B 3D87B 2V7NA 4B53A 2D7TH 1I3RB 3EDFA 3O3UN 1UB6A 1KT2B 4PJ7E 2X9WA 4JREC 4OGAD 1NBYA 4FNLL 3MRNB 1MUJA 1N4XH 4PV9B 1CD8A 1MLBA 4IJ3C 3LCYA 5BO1L 3U48A 3BD4A 3MA7B 4KZEH 1S3KL 1XZ0B 4TUKH 4AEIL 4HCRH 1WJ3A 1BBDH 2WWKT 1MRDH 2FX8H 4KUZH 4KJWC 4P46A 1UM5L 4JFDE 4WUUD 3VH8G 2YD1A 3HZKB 3KHOA 2CLZB 1A6TA 1T2XA 4HXAL 1HHGA 3ZDXF 2O5YH 2A9NH 4LLAA 4P49A 4LL9A 4V1DA 3TJEH 2FX7L 4UTBH 1BLNA 4R7DA 4P3CH 5E2WH 4MAYC 5KOMC 5BS0A 5J6HB 3NCEB 1N5YH 3WNPA 4Z7WB 3PUCA 4L4TA 1UKQA 3RL1A 4UQ3A 1EMTH 7FABH 4J4PA 1MFBH 1LMKA 4AK1A 2HVKA 2G60L 4JKMA 2GJ6E 3KAAA 4Z7UE 1WCBB 1I7ZB 3UTZB 1CZ8L 2E7LA 2IANB 2ZUUA 4OV5A 4QRTB 1LO4H 5I1KH 2AQ3A 2OYPA 3JVGA 3RIFK 5BOZG 2WMPA 2AI0H 3UYRL 3TF7C 1IVLA 5GGQL 3NZ8B 2ADGB 3LEYL 4PLJC 5JOPD 5DEGA 3MREA 1RUAH 1DE4A 3D3VD 5BW7A 3BPOB 2Y23A 5L2KA 4QHNA 5A2LH 1FZOA 4I8DA 5I8CA 3LMJL 2J3SA 4R90L 3VJ6A 1RK1A 5HPOA 5IVNA 4FMFA 4WWKA 3NN8B 3VD3A 1P6AB 2J5LB 4UT6L 1PYWB 3CLEL 4P59H 3ZE1E 1F5WA 3T77B 3WFZA 5TE6H 1U8MB 1V3MA 5EB9A 1OGAB 2XPGB 2CH8A 5JOFA 5IB1B 2YXFA 1BGXL 1VGEH 3SCMC 4JQVA 2DIBA 1A1OB 1R5VA 4HKBB 4KK9D 3SKNA 2YPLD 4Y2DA 3FCTA 1I9JH 2PXYB 2H2PC 3V0VB 5K9KA 3SE3A 5BRZB 1MPAL 1FYTE 4K7PY 1OB1A 3BN3B 3GMLB 1JPSH 5GGRB 5EOCH 5HHME 5A43C 3FFDB 4ZOBA 4R0LA 5HGAB 3NMEA 3ZE0E 2D0GA 4JZOA 4HPOL 4JANA 5CSZB 4PR5A 4X4YB 2XTLA 3PGDB 5MEPA 3FQTA 2MKLC 4WUUB 2KL6A 2UUDK 4P99A 3ROOA 3BP4B 4S10A 5B38B 2BVQB 1SEQH 3KXFD 3VXOB 2V2TA 1CLOH 4FG6D 3U9UA 4OZHF 1J0YA 5DEFB 3WSQL 3IJHB 4K71C 3MV01 4ZDHA 5HGHB 3Q5OA 3C8KA 4BH7B 3KLDA 3EYFA 3LVEA 1PZ5B 1FFPA 2BMKA 1YEIH 2NY4B 3GK8H 2BXZA 3G5XB 4RNRA 1TQCB 2HN7A 5B21A 3C5SB 2FIKB 4U1JA 2OMBA 4JFOA 4F9LA 4CN1A 2QADC 4G8FB 3MXWL 2FR4B 4N8PA 2BSSA 3CFJB 2FECL 3FT2B 5FOBB 1ZVSB 4GLRH 3VFMA 4ZOAA 3MOAH 1YMME 4TUOB 1XIWD 1YEGL 2EDHA 2ZPKL 3WIHL 1GAFL 1TZGH 4M48L 4NJAL 1WUNT 5IEKB 5D5ME 5K9JH 4W6YB 5EC2A 4KKLC 3BP6B 3I6LD 4ERSL 2FEEL 2QL1A 4ZPTA 2ED8A 2VIRA 1CG9B 3VGBA 3O3BB 3PWUB 5AUMA 3ALPA 1HHHB 4MQXC 3J7HA 4J6RH 3IT8D 1A6UL 5HHPA 2CGRL 1V7ML 4N0CD 1V7NL 5EBMA 1FO0B 2N1KA 4NO3A 1K2DA 2ERJC 3TA3D 3MOAL 1HH9A 3DX7B 3TT3L 2VYRE 3WDJA 4KJWD 2AEPH 2BCKB 2VLKD 1A3LL 5HHNB 1B0GB 4NQDE 3UTTB 2G5BB 4OCYH 4MJ4A 4NZUH 1DCLA 2ATPA 2EEDA 3RWHA 1NDMB 1KB5H 2BERA 3L5WB 1RAMA 4HV8A 4X6CA 2VLRE 2C3WA 4M1CC 5HI4D 2X9XA 4JFYB 5HVHB 1JGVH 3T1WA 3QR2A 4NUJA 3BAEH 5AD0A 3RWIA 1FGNH 4P2QA 4IOIB 3VFSA 1Z9OA 1N6QH 3QIBD 4BK5A 3MRMA 4O02L 3KLHD 3LH2L 4XPAL 4IOSD 2A6IB 3QI9A 1DLHA 3MUGA 4AEHL 4PD4K 4ERSH 3SDAB 1IM9B 1D5ZA 3V5KA 4XVTH 3WXVL 1IC4L 2B2XH 2NW2B 3RTQD 5JHDA 5D7JB 3NA9H 4L8SC 4MAYA 4XNQA 3JTTA 5C0NC 5EU6A 5I2IB 4J4PC 1CD1A 3QSKB 1YEKL 3LN9A 4B7LA 5FM5O 4CVXB 4K9EL 4GW1B 1YY9D 4A6YB 5FM4A 5CINH 2VABA 4O5LH 2VWEC 4YXHH 4O2FB 1BX2A 2H6PB 3X3FH 1ZVYA 5HYJB 3CZFB 4YHKH 4APQD 3STZB 3QHZH 4YBLB 4AMKL 4NZRL 1JGVL 3VXSE 1OAQL 3TYFB 3KDMA 4KK5D 1QSFB 4PJ9C 3MBEA 4X4ME 5MP6H 2ZSWB 1KN2H 1TIUA 5GS0L 1RU9H 3QUYA 3O9WD 4AL8L 2WWKO 4RIRB 1D5XA 2NX5E 3HMWL 4L3CA 4TOYH 1MFCL 4XCYB 3CK0L 2DWDB 3F5WB 3JWDC 4F7EB 2VSCA 5ISZD 2E9WA 3MODH 3VFNB 2XYCA 3VFPA 2NY1B 4Q9QH 1KCRL 1M1SA 1QSED 2VDKL 4HBQA 1I8MB 43CAA 4N8VG 3KPSE 3MLTA 4XTRC 3GGWB 3L5IA 4M5YH 3W11D 1FAIL 2NZ9C 4Y1AB 4M7LH 1FYTA 4TSAH 1DBJL 5JW4Q 4JRWA 3O11A 2JK5A 3NTCL 2R29H 1FDLH 2H32B 3QCUH 4KXZI 3TBWB 4X4ZA 4W4OA 4HJGA 1RVFL 5DJXA 4HJ0C 4YX2H 1ZS8B 1TCMA 3TGXA 2PR4L 3BKJL 3MFGB 5IV2A 4R7NB 6FABL 2P24B 4P2OC 3MZGB 4FQXD 4HKJA 5LGJB 2BDNL 1BECA 1N5AA 3PQYB 3SDAD 1I7ZA 3UTZA 3QO1B 3TNNB 3MBXH 4ETQB 2Q76A 5JXAL 1AGBB 2HAZA 2O61B 3S98A 4RCAA 3SKMB 1KN4H 1G9EA 5JDSB 4GKSA 4LLYB 4XPBL 4WCYH 3CFDB 4AY0A 1ADQL 1XF2B 4KC3B 2F53B 3BI9X 3GSNH 5C09B 5L2KB 3SJVD 5ITFA 2H3NA 4YDIH 5CP3A 1JNJA 3EGSA 1WCQA 5CAYB 4KTDL 4OF0A 2APXA 1JTTA 4XNMA 3BUYA 4P23A 2I27N 5IK3B 1XGRB 2CO6B 1ETZB 3C5ZB 4GG8B 2P45B 2IQAB 1KCUH 2AJYL 4Z5RA 1XGQA 4D2NA 4YGVB 4G9FA 1ZA6B 5DJAB 1IKNA 5HD8D 4ZXBC 1I75A 3CCHA 5TE7L 3O3DA 4NKMB 5H2BA 1A1NB 1BHGA 3P30L 4LPUA 5KSBA 4Z95H 5IMKA 2ED9A 2OQJB 2C5DC 1EHLL 1TNNA 1LVEA 4QTHA 4ODTH 4XHJD 5F9AC 2P46B 3TH4T 1CFQA 3BIKB 3I3BA 4JFDA 4ODSL 2J7LA 3RUGF 5ALCH 4UT7H 1OGTA 2OI9C 3MRRB 4JZOB 3FQXB 2P43B 3OB0H 1GPOH 1J5OH 4U1LB 5MHSE 4NP4L 2OL3B 3WDHA 4Q9CA 5T3XH 4WU5A 4WUUA 4NHUB 3PNWB 1RUQH 1KTKE 3GBMH 2WUBL 1N6QL 4PGEA 3S4SG 3I75B 3QWOA 3D25A 3HB3C 2QQNL 4JQIL 4QYOB 3OTTA 4EZMA 4DVBB 2YS4A 5FO9A 1QSEA 2DL2A 3OR7A 1ZWIA 1U3JA 4JRYE 3PGFH 1S9KC 4LRNH 1UQSA 5HYEA 5AG8A 4PLJD 5H37H 5B8CB 2NPLX 1LEKA 4ELMA 3DBXB 5D7SL 3E3QC 3HNSL 2IFFH 1KJMA 3OB0K 3G5YA 4BQ8A 5I0DA 2XN9D 4ODVL 2VKWA 5DQDL 4U1HB 1DR9A 4IRJA 1NBZB 4JZJB 4QXGL 1JE6A 5BV7B 4LLQB 2HWZL 3BSZH 4OGYH 1BZ9A 2BSSB 3RWFA 1FVCB 1RZFH 3RA7L 4HH9B 2VLRD 2Q7NA 2OR9L 4WWKC 3X14A 2F53D 4ZTOH 4EI6B 2F74B 3MROB 1T04B 1NGPL 1MCEA 2CXKA 2K7PA 4PBXA 4JFQA 3QXTA 3R06A 3BMWA 3QO0B 1TXKA 3O2VH 3U1SH 2EDKA 5ICYB 1S7VA 2NZ9D 1CLOL 1H8SA 2XKUA 4YBLC 4C58B 1UACL 2IBZX 1KB5A 2AW2A 3HNTH 3OG4B 4R2GD 3RKDC 3MUY1 4IDLA 4XX1E 5DK0B 1PKOA 4LHQB 1D9KC 4PJ9A 3QXUA 3WMSA 4O02H 1JIBA 3VH8A 3FO2A 5DVOA 3DVGB 2WNGA 1F3JA 5F89A 2O93L 2G5BA 1GL4B 2HTLC 4PJIA 1N6UA 4NO5B 3NBNA 5A40E 5E4IA 1UCTA 4G6FB 3WFCH 4HS8H 2GSIB 3FT3B 3KVQA 1MHPH 1KGCD 4U1SA 5JLZB 1DQMH 3OB8A 1UM4L 1RIUL 3HUJE 3ULSB 1P4LA 3VXRE 2JCCE 1CFVL 2ESVA 3JWDL 3LRGA 2PO6D 3TBTB 1CXEA 1IAOB 2F54E 4BUGA 5J6GA 4HIHB 4LQ1A 4WFED 4KVCL 1XIWB 3UBXA 2J8UF 3QDMB 4HLZH 3UYOD 1ZE3C 1IC5L 1A6TB 4QO1A 5EU5A 4MXQC 5DT1L 4EN3B 5KSAD 3MX0A 5D7IB 2VMFA 2RHEA 3MA9H 4HAGA 3BWUC 4CJ1A 1XH3B 2KZWA 2DQJL 3BGAA 1DDHA 4U1KA 3NACH 5FUCC 1MRCH 4Y7MA 3AS1A 3GSUA 4H0GA 4XB8A 5GGTL 1D6VL 2BX5A 1QKZH 3AS0A 4JEGB 4O2FA 5HDBE 5GGQH 1KLUB 4WTZG 4X7TB 5GRVK 3FB7A 5D96B 1MRDL 2B1HL 4Q9RH 5IR1A 2O5ZL 3MCG1 5BQ7B 4J3UA 4N5EC 1UC6A 1H15B 1UENA 1NGWB 1YC7A 2HG5A 4MJIA 4PRPB 2FNBA 5IFHH 4WFGD 4FS0A 2AK4E 3MBEB 1QEWB 5SWQA 3AXLB 3Q3GA 4GRLD 4G5ZL 4XVJH 1UYWL 3LS4L 3KLSA 2NY5C 1FNEA 2OJZH 1KTDA 1P2CB 4R4BA 3U4EB 4I3SH 4MXVE 2IPTH 5I1LB 4JN1H 4XCEB 2CKNA 4XXDA 1JPFA 1H3UA 1NFIB 2O5YL 4PLNC 2X4TB 1FL6B 1FZMA 5DRZB 3RVUC 4NYLB 1UJ3A 4F58H 43CAB 5DXWA 1IAMA 2XTJE 2WUCL 4RZCB 5IB1A 4YXKL 3IKCA 1U3HA 4RFEB 3TPUA 3VG9C 3HA0A 1R5VB 4P2RE 5ETUA 4IM8A 5C07A 5JW4N 2JK5B 4S0TD 4YZFF 1C7SA 5T3ZE 1E28B 4HJGB 4G9DA 4JRXA 4MAUH 4UV7H 3T2NL 3OPZL 3B8YA 3HI6L 3QXAB 3AM8A 4BYHA 1HSAB 1RIVL 1OT2A 4G6KH 5JHDE 4OLXH 1X44A 1EHXA 4JANB 3IS0X 1RUKH 3NAAL 2PYEB 4KKAD 5HYSG 5A2KH 3L7EA 5M95B 4GUPA 3I9GL 5E9DE 5LWYL 4LLVA 2V2TB 1W72H 3QEHB 3V4UL 5TFSH 5KSAB 5I18H 1ONQA 1BQLH 3P77A 1FL3B 3NFSH 2ADIA 1F4YH 4X6EA 4OF6A 2YSSB 5LBSL 4MJIE 3DROA 1F11B 4NQDA 2BMKB 4G6KL 3RDTA 5HHQA 5JQ6H 2IPKB 2Z91B 5FHAL 4MQXD 1M6OA 1YN7B 5DJYA 4JFED 5HXMA 2YPLB 5I75B 2R2BB 1X5YA 2W9DL 5DS8A 4JDZA 3BPCA 2AJZA 1UM5H 4P2RD 1UKTA 1AGCB 1P6FA 3LKQA 3ESVF 1JTOA 4MNHB 1A7PL 1ZA6A 3VXMD 3WKNA 4TSBL 1T3FA 3VXTA 1BQHA 3LAFA 2NX5B 4Z77B 5HHVH 3S34L 4FQJL 4HWUA 1LE9A 2G9HB 3BP6A 4OIIH 1Y0LB 4L4VA 1YNLL 4NQCB 4F9LC 5CKAA 43C9B 4JFDB 4QNPE 3RWDA 1NBYB 4W4NA 3NH7L 1JGLH 1OGTB 3BSZL 1RURH 4OGYL 2NXYD 4CL7A 3IJYB 2NY0C 4QHUA 4K23H 2WP3T 2DS4A 5C0IB 5KSBF 4S1RL 1NBVL 5J12C 1HH9B 3DX7A 1OP3H 3DI3B 3GSQB 2WAHA 3TO4B 4ZFFB 3SJVB 3IAPA 5FO9B 2HMID 1XGPA 1AXTH 1TENA 2EE6A 3ES6A 4LCWE 3EOAB 1LWRA 1KJ2L 4DGYL 5C6TH 3E1F1 4JN2B 4M7ZB 5D1XA 1T1XB 2B8OT 4JO3L 4ONHB 3T1FB 3ZSSA 5B4MD 3GJFA 4JHZA 3TFKD 4R8WH 1A4JB 1MY5A 5I16B 5C7XH 4NRXA 1DBKL 1IEBB 1YMMD 1YY9C 1QYGH 3OMZA 5F70A 2A6IA 1KIRA 2V7HA 4MX7B 5E1HB 2UVFA 4OLEA 4W6WB 4ORZC 5DK2B 1XF1A 3MRCB 3SPVA 5L6YH 5BS0E 3P3YA 5FOJA 1GOHA 1MCJA 4KMTH 3PXJA 3BN9C 4CU7A 2ZPKH 1HHKB 5AZ2L 3EDKA 1ZANL 3KPNB 4NDMB 1KOAA 2R4SL 4FFWD 2JE8A 4XNQB 2JB5L 3EO1A 4GBXC 3KNBB 2GEEA 1OTTC 1LHZA 4QHNB 3T65A 1CD1B 4Y5VC 4TNWF 2DMCA 1QFHA 4JFQB 1G1CA 4YBQD 5FO7A 3TBYB 1O5DT 2Y9RT 3L3OA 3I02A 3FQWB 4UIKL 1S7WA 3V6BR 3IFNH 2BNRE 1IEAB 1JV5A 1YYMH 4NQED 5EU3B 4QXGH 1T5WA 1E4XH 1AO7D 3SKNB 4HJJH 4AIZA 3JWOC 5L7XL 4LNRB 3GMPA 4MA1C 4MQ7B 3V0VA 5D7SH 5K9KB 4OGAC 1J88A 1OAZL 4NQCD 1RIHL 3GHEL 4GQ9L 4R0LB 3IDNB 2EYRB 3FT3A 3VCLA 1IGTA 1FGNL 3DURA 5D7JD 1PY4A 4RFOH 2DQIL 3DX6B 3ZYOA 2J4WL 1I3GL 1U3HC 1KIPA 3BP4A 3H3PL 3NCJL 2KH2B 1E4WH 1G7IA 3QHFH 2XACC 3MLTB 5DMIL 4FABL 3B9VA 3PWPB 3KPPA 4PREA 3WIHH 4UT9L 3D39A 3NGBB 5F7YC 4GAFB 3C8KB 4GRMA 4BH7A 1U93B 4ODWB 3BIBX 4ZS7H 1FORL 3GSVA 3VFGH 4JHAH 4X5LA 3MNWA 3W2DH 1RJZA 4X4XB 2BHZA 1TVBB 4EQ3A 2XWTA 5EIIA 2VZUA 5GS0C 5D72L 3DOSA 2R1YA 4YFDB 1R3LB 4G7VL 3TVMC 5KSUB 5KS9E 2X4OA 3W39B 3ARPA 3C6LA 2FEEI 4JPVH 4XC1H 5E6IB 1BQHG 5GS3A 4BZ1H 3G6JE 4Z7VF 3TNNA 2EYTB 2B4CL 2W38A 1SMOA 5F8RC 4L3EB 2HG5B 4XBGA 4RMRA 4W4OC 2AGJH 4AQOA 5HPMB 4JDVB 5JDSA 1U42A 2F53A 4R4ND 4CBPA 3CX5K 4YGAB 3IXTB 3MJ9L 1HH6A 1S5HB 4OZFB 3MOBL 1UWGH 4LU5H 4D8PB 2VISB 4PJCF 4XNMB 2IGFL 1D9KA 1N59A 4IIQB 3MGTA 4Y19D 4F3FB 2RBLA 2YD2A 3MRFA 1INEH 5EBMB 3C6SB 5EFIA 4JREB 3V7AG 3U4AA 1FIEA 2YK1H 5IP4A 1C5BH 4TRPL 3L5JA 1A3QA 4NCC2 3BKCL 1OTUC 1IRAY 2NY7L 4OLYH 1KENH 1K4CB 1XFPA 2NY2C 3HUJA 3VXRA 1A9BA 4N0UA 4OTXL 3CFEB 1YECL 5EZOL 1NGYA 3NPSC 1KLGB 2VUOA 4QTHB 2OI9B 4GG6F 1F4WL 1BQLL 3MCLH 1MHCA 4I18A 3CSGA 4OF5A 3G6DH 1A0QH 2O5ZH 2H2SD 2AQ2A 3THML 3C09C 3CH8A 3KPQB 3LKRA 1RHHB 3MLYL 2Q87A 3VXME 3WUWB 3L7EB 5JORB 3T0EB 4FXLA 3MLWL 1UCBH 1MCLA 5EUOB 4ELMF 3R8QA 3MO1A 3PWPD 5KW9H 3D5OF 3MNZA 3O6LH 2EO1A 2ZUTA 4JB9H 3P77B 2V17H 4ODXB 5DURD 4N90E 5D1XC 1QSEB 2BHYA 4XP5H 1DEDA 1JGEB 2NNAA 2MJWA 2VRAA 1ACYL 4RQQB 2YSSA 4BSVA 3VMPA 3KXFB 4RBPH 1SBSL 3V4PL 3VE0A 4MSWA 3BKYH 2V6HA 2ICCA 3RJQB 2D3VA 4MB3A 3CK0H 4KQ3H 5L8KB 4BZ2H 4M3KB 3SO3C 2HVKB 2W60A 3CXHJ 2H2SC 1DBMH 4LVOB 5EOQL 4JZJA 1I4FA 5KZCB 1DQLH 1KBGL 1O0VA 2XICA 3QWQB 4O2CA 1QLFB 1OSZB 3GM8A 4M6OL 4P5MA 3BO8A 3MLRL 4GBXA 3CVIL 5DEGB 3W82A 2VH5H 2CK0H 4XVUC 9CGTA 1KSRA 3VWKA 1WBZB 3LN5A 4WUKL 3S36H 1DE4B 4HXAH 4U1IB 1LE9B 4DN3H 4RIRA 2ENSA 3OR6A 4ZUWB 4WW2F 5MERB 2MHAA 4N8CL 4HLJA 1EDQA 5IF0A 5E08L 5D93C 1EBPA 2HFTA 7FABL 2W0FA 1U8MA 3BT2H 3MRPB 1HWHB 5DA4A 4Q7DA 5F7HA 5DK0A 5EA0H 5EORL 3RA7H 1ZHNB 3TO4A 4RA3A 2VZOA 3DVNB 3FB8A 1B0RB 3C5ZD 1MJUH 4U7KA 3EYOB 3JUYA 3MJ8B 4NO5A 5CEYB 4XBPB 2R2HB 3WSQH 3CC5A 2GQHA 3P0YH 4FQJH 3W9DA 1A6AA 4DCQA 3BQUA 3IFNL 3CDFA 5I16A 4OUUA 5HYQA 3FB6A 3IDGA 4OLVH 4ZXBD 5GGUB 1T2JA 5D2LB 4PRIA 5KTEH 2C7UA 4QNPF 4LCCA 4WVRA 5FYKU 5ICXB 3VXNB 1DL7H 1LP9A 1NC2D 2DD8H 3S8WA 3PG2A 3OX8A 1FFQA 4YZFE 5INDB 3UJJL 1V7NH 1AGBA 4F57H 3GUTA 5DD0H 3CH1A 5DURB 4Y4FB 1A6WH 2EH8H 5IQ7H 5I19H 1CXIA 1MI5D 5LVEA 4LLYA 1FFOB 4P3DA 1K4DA 2ZOLB 4TUJB 3RVTD 2OX5A 3LN4B 1IFHH 5C08B 1TPXC 3EYFB 1JYXA 5KJRL 2R1WB 1P53A 4WJ5B 2NXYB 4RRPG 1IQDB 3WLBB 3I02B 4GW5B 4BSWA 2EXWD 1ULVA 5BJTB 1L0XA 4QRUB 2OL3L 2PCPA 1LEIB 3P9WB 2AEPL 1T5WB 3CMOH 2LU4A 1ZVSA 5F9OL 5H37G 1KJ2H 4WHTA 2P4AB 4HXBL 1IM3B 3SDAC 5E8PA 1GGYA 4FQQB 1QFWI 1F4XL 1HILA 3RPIA 5BZWA 3GJEB 5E56A 5J56B 3MRQB 5MEOA 3Q6GH 1W0YT 1LDPL 2F5BH 4R4BB 5CJXC 1YEHH 4HQQH 3BEWA 1WTGT 4NNYA 1IL1B 1AKJA 2Y1VA 3FQXA 1DJSA 4Z0XA 2DQTL 3QH3A 1JYWA 4HUNB 4GRLA 1FL6A 2W07A 3DX6A 2CXGA 1KIPB 4RMVA 4MZ3A 4LIQH 4XT1C 5FGSA 2ITDB 3REVB 4EIZC 3RWGA 1OQOA 4XAKD 4L4TD 4Q6IC 4IDJH 4JY5L 4G6AC 4FTVA 1PKQB 4H5SA 4PLKD 1FLRH 4GRMB 1T7VA 1U91A 4DUWA 3ZTJH 3P0VL 4B5EA 3TA3A 1H3WM 5B22A 4X6CB 5B8CA 2OZ4L 3QIUA 4JG1H 2I9TB 2VLJE 1INDH 3L3HA 4M7JH 1F8TL 5SX5K 5AD0B 3G5YB 3KPRB 5JNYB 5A3ID 5E94A 3QWRD 1NDGB 3TBVB 2X1QA 1JRHH 3MOBH 1F4YL 4LIQL 3R0MA 4H26A 3RI5F 5IB3B 4BZ2L 2IAND 2N4IA 4RISH 4Y4FD 4YWGH 4EVNA 3X14B 3AFLA 1DQQB 4JDVA 4UI2A 2AK1H 2NYYC 1OTSD 2F74A 3MROA 3ZKMC 4ZYKB 5TDOB 4DKEL 3D3VB 3QPXH 2KQMA 1NMBH 3FFCB 4AIOA 4ZNCD 1KB5L 2UWEB 3PE9A 4AL8H 2RIKA 5SWSE 4YIQB 3HNVH 4D9RD 3D6GA 2VKXA 3FOLA 3O6LL 4H25A 2AXGB 4ZG1A 4KVCH 2P5WE 1OGAD 1OAQH 3L3GB 4DFIA 1FPTL 2JELH 1BGXH 1VGEL 3BWAB 3VWKC 1F42A 3ARBB 1KB9J 3DVGA 5ALBL 3EFFA 4X8JB 3V0WH 3WL9A 5I8KH 2ZSWA 2A6DB 1WSST 2OR8A 2PXYD 1FNHA 2UZXB 2VLME 3MRBA 4PJFF 5F88A 1NGYB 1PJ9A 2DQDL 3WD5L 3EUUA 5JW4R 2P5WA 4OGXL 4XCYA 1M4KA 5CP7A 1FNGA 3H42L 2JCCF 2VUYA 4OCRH 4U7SA 5E6ID 4X6BA 5SV4A 5DQ9A 2ESVB 4JFHE 1B2WL 4OZ4A 1MFNA 4RBPK 5J6GB 5ERWB 1CE6B 3VW3H 4DGYH 1TVHB 4HHAA 2V2XB 1JPGA 1G84A 1B9ZA 5TF0A 4Y88A 2NY5H 4WENB 2JB6A 4JFEE 2DLIA 3O2DA 1IMHC 1RULH 4Y2DC 4U1KB 1T1XA 3NZHL 2WBKA 3FHAA 1WBYB 1I7UA 2AERT 1FYTD 4LBEA 3QDGA 5C0CE 2NY4D 3KPRD 4L4VD 1BVKB 2P24A 4MMXC 4YHOL 3PDOB 4KKLD 2NX5D 4G3YH 4UV4L 3WJJC 4LIQE 4Y4HC 4PJAE 4CRPA 3MRCA 2Y72A 1OSZA 3KS0J 4OM1L 3SPVB 5IEHB 4BFGA 4E41E 1U2HA 2JJVA 1PDKA 2QADD 2BNUA 2CDFA 3VXSB 1QOKA 4XMPH 1RULL 1W0WB 1VFOA 3UJTH 1BBDL 2AEWA 1KCSH 3P0GB 4FQIH 3T65B 5GGRY 3EGSB 1HI6B 5IBTL 3BGFC 1NJ9B 2GY5A 4P2CG 2NY2B 1AJ7H 2EH7H 2YD9A 3MLVL 2Q8BL 3D18B 5JXEC 3FQWA 1BFOB 5EUKB 4F57L 1FZMB 2I26N 4JM2C 2CSPA 3HC0B 1FIGL 1EIBA 5I73B 3FZUD 1WFNA 1WAAA 4G6MH 2YKLL 1JBJA 1R3JA 4JPWH 5HVHC 5FIEA 1YMHB 3PWLB 2HT4C 4L4JA 4CVZA 2ATKB 3O3DB 3UCRA 3JTSA 3OKMB 4XMLH 3RUGE 3OAUH 4P2RB 3HG1B 4MHHI 5IMKB 1E28A 4NQEA 4PJFB 2FLRT 4L29A 5KSVA 3R8BB 3QXAA 1S7RB 1SJXA 2NCMA 2J2ZA 1IGTB 5DVLA 1RPQA 5HYQB 3MPCA 2FLBT 3JWOL 4TVSa 1P4IL 5IWLC 1T7ZA 2R1XB 4HIXL 2Y7QA 5F3HB 2EDQA 3GSWA 5EO9B 1RZIA 4PRIB 4OCNC 4GUPB 3UTSE 3T0WA 1C8PA 3MLUH 3QEHA 4F9PC 4NKIH 5FA3A 5HD8C 4PGEB 2H8PB 4PV8A 4C56B 3OKNB 2NXZC 1XEDA 5DD1H 4GKNA 3DSFH 1UG9A 5F6IB 3QIUC 1K4DB 1FFNB 2ZOLA 4TUJA 5F6HJ 1PLGH 2QBWA 3L3JA 4Z7VA 3ULVC 3CMOL 5F9OH 4YDKL 3MV11 5FGBA 1I1RA 2A83A 1RJZB 3QULA 3X12B 2FRGP 3M17A 3OJVC 3ZYZA 1ZTXL 4U05A 1ZT7B 4P5TA 5DUPH 4EDWL 5C0BE 4U1HA 1KJ2B 1NCAH 1V7MH 4JO1H 1T21B 5CFHA 2WWMD 5ACLA 4XBEH 4WY7L 2P5ED 4N5UA 2Z35A 2FD6H 4FQ2H 2E6JA 4OZFG 5LAXA 4P4KC 3HG1E 4Z7NF 5I74C 2DI8A 1YMMB 2A0LD 2XN9A 1IM3A 3ZTJG 2DM2A 3SDDC 4JVPA 3ZDYF 4RAUB 4QHKI 4CW1A 5KOVC 3MRQA 1RZJH 2X09A 1Y0LA 3GRWH 1CGWA 3LKSB 2HJFA 1VADB 3VI4F 4FZ8L 3O2VL 3BEWB 4PRPD 5GRJH 1EGJL 1BFTA 1J0HA 5IT2L 1HINL 3WFHB 3O4LD 5BZDA 4HBCL 4A2MA 5I1EH 4V1DE 5K9QI 1U8QA 3T3PF 4MXWL 5IGXL 4LLDA 4Y4KC 3C6SA 1DVFC 3EOBA 4NGHL 5EFIB 2VL5A 1RMFH 3BZFA 3HMXA 5TE4H 3KPMB 3TH2T 5C0IA 1QFWL 2BSTA 3WIHA 4PJ8C 2VAAA 3DX9B 4LAJH 3PWVB 4O4YH 3GSOB 4CN6A 3S35H 5DTFA 5C0CD 1WWBX 3RL2A 2X44D 4H5SB 4U2YA 5HJ3B 1JTPA 4N0UB 3OPZH 4Z7UA 2C3VA 4ONHA 3K4AA 4NHCH 1EGJH 3B6SB 5C0EB 5IB4A 3PP3K 3DXAD 3GHBH 2WQ8A 1MHCB 4LCCC 3C5JB 2OXGA 1JI2A 1C1EH 3NZHH 2CLRB 1TMCB 3MXVL 5SX5H 3PQYD 3SDCA 4TVPL 4HIHA 3RNQA 4N9OB 1MFBL 3N9GL 1F4AA 2BOCB 3U2SA 5CCKL 1YN6A 5DRNA 1UVQA 2CUIA 3NFNB 5TF1H 3IAQA 3RRQA 5D7IA 5DA0B 5IVXF 1KFAL 1QZ1A 4MNQD 3MLPA 3EO1B 3WNLA 1J12A 1T4KB 2DIJA 3FRPA 2HT2D 5L2KD 1AIFA 1WK0A 4FXKA 3FFCA 2D31A 1EEYB 3F58L 4WGVB 1A7NH 2VTFA 3MYJA 3WJJA 3D69A 4L9LB 3WE6B 3MXVH 1Q8MA 3CU1A 3MLSL 2DRUA 4P2OA 3S35X 4OI7A 1BFVL 4XP6L 4PBVC 1P84K 1AGDB 3QA3B 1YC8A 5J9PB 4N0YH 3ARBA 3V5KB 4M3JA 1FIGH 1DBJH 2BRRH 5CGYD 3QUMH 1Z0MA 4Q9QL 3O0RL 2NMSA 1RIVH 3VXPB 4JRYB 4N1EA 1T20A 4GW4A 1ZEAH 3BOVA 3GSNA 1HNGA 5JXEA 4JZJC 3ARFA 5MEQB 5DMKA 2DIAA 3IDYB 5A16B 3PV7A 4Z7WE 1FRGL 2Z92A 2XKSA 2APWA 3U7YL 1CGYA 4RGOL 2V2XA 3BKMH 1M7XA 3HE7A 4RAVB 3RX8A 4IJ3B 1ZHNA 3ULVE 1NCUA 3U4BH 2VDRH 2C26A 1TZHB 4G8IA 4DVRH 1J1XH 3ARZA 3KYAA 1RFDL 2YEZA 3T08A 3EOTH 4ODWA 1KV3A 1Q0YL 1ZEAL 4LSUH 5DVKA 4YHNA 2DDQH 4G9DB 5KTEL 4JJHA 5KZCD 2V2WB 3ISWA 3TH3T 1TVBA 3H9ZA 5J11B 3U6RB 1F6LL 1MHEA 3ETBF 2J12B 3GKWL 1JFQH 4KDWA 3QP3A 5CD3B 4U1MA 2HRLA 3SGKC 4G8EA 4NKOB 3W11C 3ZKSD 2PYEA 3B4NA 2KDGA 2HT2C 2Z4QA 3ARBD 1UWEL 3ARED 4HX1A 1AFVH 2W9DH 3BQUD 5I1IL 5I1AB 4LEXH 2B0SL 2BNRB 5FV2A 1NEZB 1LEGB 3IB4A 2BOBA 3MUZ1 3DLQR 2VR4A 4NN7B 2RB8A 4P4RA 5I1DB 1ZGLB 4HS6A 3DETC 2R0WH 1QRND 2BVYA 2I5YH 5I1JL 1JHTA 3DROB 3H42H 2E9JA 5HHVL 3RDTB 2ESVD 3U0TA 4XI5D 5TJWK 1YDPB 3DRTA 1M6OB 1YN7A 3HTLX 3D18A 4OIIL 1G7JB 1C08A 2YPLA 1MIEH 4MB4A 5ECJE 1JNHA 3UDWA 3LSOA 3EJJX 4QRUA 1OGAA 4CU6A 4HK0A 4JO4L 4O58H 3C2AH 4FN0A 1A1OA 4FOMA 4JCMA 3O9WC 3UPRB 2IJ0C 2CMRH 3OAYH 5E8PB 2VDQH 1J0IA 3G6JF 4BH8B 2P44B 3D9AL 4PJBE 3RPIB 3QUZC 5IHUL 4ACPA 5L2KE 5MEOB 2F53E 4L4VB 1U8NA 4WI7A 4ZUUB 5FDWB 4OUOA 5GQBA 4GRWE 4Y2OA 1BBJB 4NNYB 1T03L 4G6FD 2Z8WC 3ABZA 3K1KC 1KEML 4XH2A 2QQNH 4JQIH 2R1XA 4WY7H 5IB2B 3KPQA 2GCYA 1LILA 3ARWA 4IRSC 1MI5B 5C07E 4J3TA 4YHLL 1T66D 2DYPA 4C83A 1QBLL 2WINB 4WW2B 1F6AA 1J05B 2ITDA 3REVA 4PRNA 2VO5A 5KVGH 2E7MA 3I84A 3MNZB 5KJRH 5DD0L 2H8PA 4PV8B 4AH2A 5IM7A 4H1LB 1J10A 1G0DA 5MENA 5LCVL 1QRNA 5CJXA 5IHZB 3KYKL 3F7VB 2P7TB 2MNUA 4LCIH 3H0TA 5CEZH 3EO0A 4GXUN 3FOMB 2HLAA 1RJYB 1J8HE 3NIFE 3T1FA 4HZLA 1CVRA 3KJ4B 3ZKMD 4N8VB 1G9ML 1KFAH 1T7XA 1CD9B 1JWSA 3SDCC 4NZDA 4FQ2L 1F3DH 2R0LH 4XHJC 1I4FB 1DSFL 5ANMB 4D0BB 3IXAA 5E5RB 4GMTL 1HE7A 2XZZA 4JM4H 5ISZE 3CFJA 3MV7D 4NCC1 4X7FC 3QG7L 3STBA 5JUEH 1CLCA 1YMMA 2R4SH 1N64H 3IF1B 1BIIA 4Y16D 3KPNA 1LK3H 5IEKA 4G6JL 4JQVC 4U1IA 4YO0A 5TDOA 5KS9B 2DQHH 4L3ED 4ZO9A 2R9HD 2LQRA 4JM2F 5HYIA 1YPZA 4HIEB 5HY9B 4NN7C 3C60C 4D3CH 5LCVH 4PJCA 2J4WH 1E4JA 5CILL 5DJDB 4MCYA 4XCNA 5CIPH 4ZFOB 1BF2A 2ICEA 3PWNB 4HWZB 1ZLVH 4PJGB 1X7QB 1EFQA 1NANH 2VAAB 1JZ7A 2FYYB 4UIMB 2R4RL 4WTWA 5EO0B 4KRPC 1TITA 3GMPB 3PDDA 1Z9SA 1HCVA 5T1KB 2CIIB 5CEYA 1UXSA 1NGXA 2OS7A 3CC5B 4KY1L 3W9DB 1HSBB 4PJ7F 1SJHA 1GC1L 2WLYA 3O81A 3L95A 3MODL 1EEUA 5DVMA 4XC1L 4LRIA 2GFBB 3HPJA 1TVDA 5GS1C 3TZVC 3TNMA 4JFFA 4Z0BL 4AENB 4NWUL 1NCBL 2DBLL 3P9MA 5TE4L 1YN6B 2XZAH 3VG0H 5D7JA 1BPVA 4FQ1L 1CVSC 5CJQL 1A6PA 4MD5A 2EIBA 1YEFH 1YYLH 4NZRH 4UQ2A 3LN4A 4H20L 3GIZH 4OZIE 3VG0L 3G9VA 4M6MH 4OBSA 3VU2A 3RZCA 3WLBA 2DKUA 3QG6B 1BX2B 4L9LA 2NW3B 3B83A 4XC3H 4PTTB 2E5EA 5IW3A 4PRHA 2MCPL 1F58H 4E41A 4JDTL 3MBXL 1EERB 2B1HH 6FABH 2X4PA 4WHTB 5CZXC 4FFYL 1BWMA 1JHLH 2CLVB 4OQTL 5JIIA 5BZWB 4MJ6A 5MHSD 4PG2A 3Q6FB 3E6HB 1LP9F 2SEBA 1T20B 1Z2KA 1HH6B 4L3CB 1HI6A 2JJUA 5KS9F 3QQ9C 3IU3A 4BQCA 1BZ7A 1KPVA 2W92A 2CRZA 1WQVT 4OCXH 4I4WB 5DT1H 1INEL 4NZJA 1LP9E 4U6HB 3RHWK 3MACH 4CJ0A 2Y07H 1HQRA 4UV7L 3PGCA 4J3SA 3ZL4L 1FYTB 4Q6YA 3LRSB 4NFCA 7CGTA 3IU4H 2VZSA 2IH1A 3K4ZA 5EC1A 5KVDL 3JTSB 2AJVH 2XN9E 4WHDA 5J8OA 1QLRA 1KF9B 5DJXB 2C3GA 3SY0B 5JW5B 1R24B 3Q0HA 1PKQE 2I9TA 1S7RA 5CD3A 4KU1A 1MAMH 5JNYA 5JOPE 5E94B 4YPJA 5F7WC 3T0EA 2OSLB 1IGCL 1B3JA 4WI3A 4I5BA 3MO1B 1QSEE 1LO2H 1GZQB 3QUML 2GW5A 1C7TA 3WHXA 3DGGA 3RU8H 5I1AA 1DQLL 3CZJA 1FO0L 2E7HA 1TTGA 2BNQA 3DGCR 3U0WL 4O00A 3T04D 1RJLB 5IWLA 4WEBL 3REWB 4DZBA 3QQ4B 1MWAB 4MS8C 1FRGH 2A83B 3MCKB 1A7BA 2HTKC 4WFHE 1QBLH 2DB8A 1EO5A 2E3VA 5CBAB 4F9PA 1A7OL 3FOLB 1ETZA 2P49B 3C5ZA 3BH9B 4BQ9A 1EJOH 1T21A 1JUFA 5E8DH 5DJ2A 4YFEA 3BWAA 3QDJD 3MLWH 1B4JL 2JF1A 3BO8B 4GBXB 3JV0A 1JGDA 1NLBH 1U8IB 5EPMA 4G8GD 1QR1B 2V7NB 1MJJB 1U8NB 4ZUUA 4G80A 5KVEL 3MRRA 4X6BB 4C56D 4P4KA 5KN5B 4OD1H 3BUTA 4HS8L 4QGTA 3NCFB 2BSTB 2VQUA 1J05A 32C2A 1JPGB 5CEZL 3DX9A 5JQ6L 3NPZB 4PJ7B 4HWBA 2M2DA 5L6YL 5MENB 4ISVA 4KPHH 4NUGH 5C0BB 1KBGH 3DVNA 3BP5A 4NBXB 5F7KC 2HLAB 1RJYA 1RUQL 2R2HA 2OXHA 4L4TB 4XWGL 3RL1B 3SGDI 4N8VA 4LSQL 1MCWW 5ILTH 1VCAA 4OUUB 4NM4H 4PP1C 5LG1A 5D7IF 1N0XH 4MZ2A 3TZVA 3VGEA 5KAQG 1YUHA 3GSRB 3HCVA 4ENED 1QFPA 4FRWA 1NBZA 3LQAL 3WKML 2BFVL 3DJ9A 4J3OC 5E6ZA 4MLIA 4LCCB 4F2MB 5DUMH 4OV5B 4JO1L 1BZ9B 4QHKJ 3MXWH 4RGNE 3CU7A 4O2EA 3CH1B 5CILH 1EH9A 5I76B 3OXRA 2EC9T 4HAFA 5HTSA 3RY6C 1EO7A 2L7JA 3KPSA 4K7PH 3ZTNL 4PRID 1GIGL 4EI6A 1FSKC 3DX8B 3BGFB 3V6OA 3VGGA 4U1NB 1CBVH 2L0DA 5D72H 2VDLH 1RZFL 1FZOB 2AQ1A 4IDJL 1Z9MA 5GGVL 4LMQI 3OAZK 2R1WA 1PX3A 4HLZG 1H3PL 1J11A 1NUDA 1KIQA 2FGWH 4JPKL 1IGFH 1BFOA 5FDYA 4FQCH 1S7VB 5DJDA 3VXRD 2ARJA 3R1GH 4OZGE 3EYUH 2ICEB 4XMKH 5C0AE 5IG7A 5JQHC 4X4MA 5EO0A 2AK4B 3DXAB 1X4ZA 3VMOA 3ZTNH 1IKFH 3LQZA 4K9EH 3QDME 4V2BA 4RFOL 4G5ZH 4XVJL 1UXSB 2FWOA 1QFWM 2P5EB 4PJFA 4GW4B 1NUNB 4YH6A 1FVDB 1I7TA 2CIKA 3UXFA 4Z6AT 1PQZB 4C54A 1FLRL 2AJSH 3AMLA 1S3KH 4TUKL 4ZQKA 4EUPH 1QLEH 1CICD 4HMEA 4ZTPH 4Z0XB 4TSAL 4XXCC 5M94B 3ARXA 2MPAL 1IAOA 2Z92B 3B43A 1BQUA 4KRMB 1NAKH 3P9MB 2CR6A 4KUCF 4MYWB 1BREA 2VR9A 2F19L 2VDOH 4IRJC 4C56A 3S3PA 3FONB 5D2LF 2YEZB 4MD5B 2A2QT 4N1CA 4M5YL 3DHMA 1U91B 2QKIA 1FFNA 4TULH 5GJTL 2IF7A 1C12A 4XHQA 3JUZA 1UEMA 2LVCA 3P73B 3V6ZA 1G7QB 1FCCA 2Z31A 4U31A 1OVZA 4JGUA 2HN7B 3GNML 3QG6A 4EJ1C 3T0EC 1K85A 2VLLA 2BZDA 4G8FA 3ULUD 3K81A 4RX4A 1Z3GL 4ENEC 2YUWA 3GNMH 2VQTA 2G60H 3KJ6L 4WHCA 5SWQB 3P4NA 2OMNA 3TYGL 2DQIH 3Q6FA 4WEUD 4YBHA 4OCXL 1L7IH 2HJFB 1KTDB 1P2CA 5HHOA 3ME0A 1NUFA 1NAMB 4YHKL 5C3TA 3EO9H 1CYGA 3ZE2E 5HGGS 2MFNA 4M7KH 3BE1L 3BKCH 2BC4B 3QIWA 3VWJD 3HMXL 3ULVD 1GRWA 2W59A 1OAYH 3ORJA 1MCCA 4YIQA 1PZUB 5FYLH 3EOBB 4JLRA 1UJ3B 2WIMA 3S37L 4MDJA 3Q5YA 1Q9OB 3PGCB 1DQJA 2QV2A 3L3GA 1JL8A 2DKMA 3G5ZA 5DTFB 5TF1L 4PJ5A 4F8TA 3HKFA 1RZKC 3PDGA 5EBLA 4U6XB 3LV3A 3SQBA 2VXSL 5FYLL 1N2RA 1TJHH 1LO2L 4X0KB 1QLRB 2KZ1B 3LKOA 4QOKB 3H7BB 3SKJH 3DYMA 5CJOL 4LAQH 3H6JA 4PGDB 4JGMA 1BBJA 1KCUL 2LTQB 3MRNA 4WI4A 4JDTH 1IGCH 3MA7A 3MRMB 5C3LD 2BNRD 3A6CH 5DO2C 3PF2A 3RGVA 4KZDL 1AJ7L 1MREH 2P5WD 5ERWA 3PGFL 2AVGA 3CVHH 1G9NH 4XPTL 1ACZA 1SMAA 3V2AR 4J23A 3MMEB 5EIQA 1Q0XL 3VFUB 4N1HB 2ADJA 2VLJA 5SX4H 2XWBB 3ZL4H 4EIGB 3GBML 4XPBH 4G6ML 3WJLA 3ULUC 2B4CC 3QZWB 1DUZA 4L8CA 1FN4A 1U8PA 4M8QA 4QHMA 4FXKB 3C08H 5D8JL 1KELH 5AYUL 2VABB 4ALAL 4DGVL 5GS0D 2H6PA 4H88L 4BK4A 4JKPH 3D48R 2R0ZL 4M5ZL 4JDZB 1CL7I 4QRTA 5EN2A 4PJHF 3HPLB 4NJ9H 4MNHA 3VDCA 2BNUB 2APFA 2CDFB 1PVHA 1UJ3C 1T3FB 2CPCA 1BQHB 3OAUL 4IMLB 4KQ4H 3V6OC 3VXTB 1K8DB 1RZJL 1VFAA 1W0WA 4O51B 4R90H 4KFZC 4X6FB 2G9HA 4YO0B 4CU8A 2RGSA 4JJ5B 5I8CB 4HJJL 5C0FB 1NJ9A 4HIEA 5HY9A 2AJYH 3QDGE 4PJCB 5D7LD 2HTLD 4Q9BA 5CMAB 5J12B 5KN5A 5FYKL 5HHOD 5FM8A 5JOFB 1CU4H 4WFFE 1JGLL 2GSGA 5FKPB 3GGWA 4WI9A 1R3JB 5GGVH 1A4KA 1PLGL 4HULB 1T83A 4KROC 2H32A 4OFVA 2YPVH 3QDJE 3EOAA 1ND0B 3X11A 1YJDH 2PTUA 2FBJH 5GISL 5IESL 1BF8A 3F62A 3HFML 2AXHA 2M26A 1HSBA 4XP4L 3RVTC 4UAOC 2XZAL 1UJTA 1T22B 1MFAL 3ARSA 4I77L 5DUML 1F8TH 1S5IL 1N5AB 4YHYC 2Y7QB 4ODVH 5F3HA 1OLLA 3ARDC 4Y16B 4HWBH 3PGDA 5MEPB 2DM4A 1NGQH 2AJUH 4Q0XL 1A14H 3VXMB 4Y5YB 3V5DB 2BVQA 4ETQA 3TCLB 4GXUM 4KTEL 4NQCE 3BX7C 4RMSA 5EZJB 5CEZE 2YR3A 1DUYB 3E8UH 4DGIH 3OKNA 1NEZA 3MJGX 3KPSB 1I85C 5FEBA 1P7QA 4OCMC 4FZ8H 4Z7VB 1UA6H 3S97C 5FECA 1ZKAA 4CAGA 4XVTL 5FKAA 3BPLC 3RTQB 3QULB 4P23B 5E8OA 1TQBC 1VENA 5D7JC 3TFKC 4QGYA 4GG8A 4HPYH 4E41B 4TVPE 3VWJC 3F7QA 5JW4M 4UILH 4P9HL 4HGWB 5AAMA 5K9OA 3VFMB 1ZV5A 5MP6L 4U4BA 1DFBL 5HI4C 4X80H 5D7KD 5FB8B 4CGTA 3D0VB 3LEXA 3E6HA 4U1GC 3IDNA 3WFCL 1JPTL 2GJJA 1KPVB 4ZQKB 3GRWA 1G7LB 4OZHB 5DZLA 5F7FA 4C57C 3NIDE 3GMNB 4RFNB 4PP2A 5ESVB 4HPYL 4RSVA 3FQRB 4C83B 3TPKA 2X70A 1IFHL 2A74B 4UDUA 2EXYC 4WRLA 3PNWA 4PS4H 4KTDH 1G7IB 4GS7C 5F93C 5DGRA 3E0GA 3GSOA 4NQEE 1KPRA 4AH2B 2ADFL 3GFUA 2IQ9L 3QXDB 3FONA 3PV6A 5HHNA 3OR7B 5HJ3A 3P4MA 3EO0B 3P9LA 1LQSR 1U93A 2QKIB 4HMDA 2ATPB 5EZOH 3HMXH 2YWYA 4YR6A 1CTOA 3B6SA 5JO5B 4X4XA 3TZVD 3OXSA 3C5JA 1U8HA 1AR2A 4LP4A 3CUPB 2E9BA 1IAIH 4NKQB 4LLQA 3IXAB 4QRQB 3UAJC 4POZC 3RWFB 1DQDH 1HEZA 3CLFL 1Z0NA 3O6FD 4S1DC 4R26H 1X6NA 2PW1B 5GSRB 5F9JA 5FYKD 3E3QE 4HWEL 1T04A 3K8KA 5KVDH 2CQVA 2VN7A 2YD4A 1OWWA 1NC2A 5IFAL 2EXWC 4WI5A 5AZEH 5D1QC 1QPXA 1XF3B 3GMOB 4QY8A 2RJMA 3QO0A 5B39G 4YXKH 2HRPL 2J1KA 5D6CA 3UPCA 3MYJB 5ICYA 1NMBL 5DI8A 4TTDD 1IGMH 3GBNL 3QUXB 4UZGA 1BJMA 3PWNA 4HWZA 3U46A 1Q9OA 2EIDA 1RHFA 4RFNC 4NRYA 4H0HB 2A1WL 1J0ZA 3LV3B 4PPTA 2WLZA 2DICA 2CUHA 2GTWB 5T1KA 2AP2A 3VXPA 4C59B 1KLGA 5LQBL 3HG1D 4QWWD 4ZFGH 2RCSL 1SJHB 5DR5H 5ENWA 4U1SB 5HBBA 3L95B 2W0PA 4YFLI 4X7SH 1T0MB 5DMKB 2GK0A 1AD0A 1I8IA 1NGPH 5I8OL 2YKLH 3EYQC 3V4PH 1FNLA 2Z9TA 2GT9B 1OAYL 3DARA 3UBXB 2C9AA 4WTXA 3TIDB 4AENA 5EUOA 4NN6C 2XQYG 3P11H 4ALAH 2CRMA 3TO2A 1CCZA 3OBAA 1BOYA 4OF8A 1YZZA 2XWBA 3NH7H 3WFBH 1MJ8L 1XH3A 1IE5A 4M7KL 3C9NB 5IQ9B 4YHNB 2R2CA 3O4LA 3KXFA 1DUZB 4L8CB 2IFFL 1F97A 4KDTA 2GJZB 1QG3A 4M8VA 4EUPA 3AAZA 5T1DH 3ARDA 5TPWH 1U8LA 3OGOE 1V3JA 2O5XH 4OLVL 3SE4A 5J3HD 4NJ9L 1N3NA 5EBWB 1XGYL 5IR1B 2VXQH 1UM6L 4BM7A 4WI6A 2IAMC 4O2EB 5D9SA 1I85A 5I76A 4P5MB 3HI5L 2FJFB 4QOKD 3SKMA 1LEGA 2QSCL 3ZHDA 5DUBA 4LAQL 5MI0B 2OP4L 4MJ6B 3V6OE 4G42B 4PJEB 3OR6B 4PRBA 1OQXA 1YQVL 2EDYA 3MV7B 3OJMB 3QEUB 4LSTH 4WO4A 3IRPX 5I1LA 3U0TB 2G2RA 2VN4A 1NFIA 5CUSH 5IF0B 5MEND 3VWJA 2GHWB 3OWEA 3QJFA 4YK4C 3CIQA 4OZIF 2ARJB 3MRPA 4I3GA 4A2LA 4LPTA 3WS6C 4HK0B 3OAYK 1IJ9A 1TZGL 5CSGA 3S36X 5I1GH 4JQXC 3R4DA 4AZ8A 5I71B 4YGVA 3PHSA 2EYSA 1GHFH 1I8LA 2NLJB 1VHPA 3WLWD 5CEZD 2IH1B 4MMZC 4Z95L 2BJML 3VFOA 2IANE 1URLA 2YC1B 1XGTB 4JRXB 4O5LL 3SDCD 3SY0A 5GZNC 2JJTC 1X4XA 3VWKD 1PQZA 5C0GB 3QIUD 1L9MA 1A7QL 4DK3A 1DSFH 2Q86B 1LO0H 1CGXA 3BN9D 5D7LE 2C7UB 1FZKA 4I13B 5EOTA 2JJSC 2OSLA 4NWTH 3TCLA 3QUMB 5KANI 3RI5K 2R69L 1WWCA 5IM7B 2MCG1 1ZGLP 3BPOC 1B4JH 1IT9L 1CFSA 4NQXB 1ZMYA 4FABH 2DYPD 2EKSA 4LRNL 2H1PH 1ZWIB 4UB0L 5H94A 4DKDC 4I9WE 1XF4A 1MRCL 5EIVA 4DZBB 3OHXA 4I0PB 3VXUA 4PJEF 5HHQB 3MCKA 4WJ5A 1G7QA 4HUUB 5E8OB 1U6AL 4QEGA 5CBAA 5KVMC 2DJSA 1AGEB 3MRDB 2V9QA 3MRGA 2CUMA 3O6KH 4LARL 3QNXA 1ZA3A 3X3GH 3BPCB 1KEMH 1VEMA 2CRIA 3PHQB 2XTJC 3MZTA 5I8EA 4ZXBA 1FORH 3VFGL 3V52L 3WFEH 5BW7C 4HH9A 1J1PH 5LXGL 5GSVB 1F4HA 1QKZL 3BE1H 1AP2B 1E0OB 1GCFA 1CICB 1JGDB 2OL3H 5EU6E 1MJJA 1E4XI 5FAAA 3PHOB 1MJ7H 2AS5M 3A67H 5DJ8B 3ULUL 4HUXB 1Q94A 3HMWH 4UOW0 3MBED 4ELKB 1SJVA 4U6VH 4GRLB 2CDGA 4HT1H 4PJ8B 1QFUL 3SJVE 4HD9A 4X6DF 1ZLWH 3MQIA 1UFUA 1S9XA 4MA3B 3RVVC 4KUCD 4C55A 4ZAKA 4HWEH 3JWDH 3FZUC 1KPRB 3LRHA 1P7KB 4AMKH 4ISVB 1IQWH 2ARWA 3IDIA 5CEXB 3BP5B 3P4MB 3P9LB 2YD3A 3GDBA 4X0KA 4Y1AE 3EDDA 2IWGA 2CJUL 3QIUB 2K1MA 1F00I 2ZZUT 5D7IE 1MCFA 4GG6B 3L3HB 5HGDA 1OOAA 4NRXB 4TSBH 4E41D 1OD9A 4A6YH 2OJEA 3Q1SL 1A0QL 3IJSB 5IB3A 4RA0C 1S78C 3S5LA 5IMOB 1F02I 4QKXB 1L9NA 4OQTH 4Z7VE 1S9WA 1KLFA 3OXRB 5K59E 3VFUA 1HKLH 2NZIA 1WT5C 4KUZL 4U1NA 3O8XA 4I0PD 3HS0B 4HDIA 2HVJB 4ONFH 1QSFE 4MJ5B 3N50A 4OM0L 3SE4C 2XY1A 1G7PB 3H8NA 5DLML 4NN6B 1S7TA 1L6ZA 3LEVH 5CWSA 4KAQL 3BD5A 2HJLB 1OSPH 3FB7B 1FP5A 3DECA 3T4YB 3GMRB 5IG7B 1R3HA 5EN2B 1FC2D 5F7DB 2Q8BH 3BIAX 4U7MA 3D2UA 4Z0BH 3LQZB 2P8MA 4S2SA 1QEWA 4KQ3L 5IBUG 5BXFB 1DBAL 4H8WH 2A6DA 2GTWA 4JCLA 4MDIB 3WNMA 1KCSL 2EDLA 1MF2L 4HKXA 5D1QD 4X6FA 1JF1B 3OKEA 1KN2L 5GS0H 3NOIA 2HFGH 1DANU 5LGHH 3LS5H 2P5WB 5ENWB 4K8RC 3U4EA 4JY6A 2Q3ZA 4M6AA 5CP7B 2AJVL 4HUVB 1K6QH 5E70A 2V5SA 1UM6H 2YWZA 4AIXA 5I66B 2GK0B 4KHTL 4H8WL 4M7LT 3EFDH 1WZ1H 5JPNA 5I6XC 2VDKH 3D3VE 2AV1B 3U30B 4K3HA 4NNPH 4OV6F 5ETUB 3LRSA 4ZO7A 4YDIL 5IIEB 5I17B 5GRYA 4YDJB 4JFXB 3T4AB 3OKYA 2Q8AH 4S1RH 5E8NA 5TPWL 3KPTA 3UTPD 1I7UB 2GJZA 5T5NF 3QUZA 3QI9C 2ZCKL 1REIA 1ZHLA 3ZO0A 3HE6D 2LAAA 5T1LA 2JJSA 5KSUA 3CSYB 3KLAA 3QRGH 5FHAH 1JZ8A 2VLLB 2BDNH 3U7WH 2HFEB 5EU6D 1OT1A 3R0NA 3QIBC 2XZQL 5C1MB 3CPLA 5D1QA 1E27B 2X05A 5DUBB 1M7DB 2ADIB 1U8OA 1F2XK 3CVHB 3P4NB 1QHPA 1P7QB 2N7AA 3MR9B 2R15A 1TJIH 5IVXB 4LCYB 3FQUB 4Q97A 3SE8L 4APQA 3QQ4A 3FT4B 5HHOB 3X13B 2NQCA 3MLZH 5IROA 5JA8B 4FQCL 4ZOCA 5JTWA 4U6YA 4P9ML 4QT5B 4XPHH 4PGCA 3MRFB 5E5UB 5DS8B 3BH9A 5GRVL 1M7IB 1WWAX 1DQJB 1HINH 4LOUC 4HGWA 1II4E 1IAKA 3K8MA 5EORH 1MRFH 2D7PA 5HGBA 2UYLB 2G75B 4TTGA 5GGSA 1YMHA 1VACA 1HYRC 1U8IA 3HUJB 5EPMB 5DFTA 4OT1L 3VXRB 3OKMA 3VFOB 2DL9A 3LEXB 4NQEB 4ZUVA 2FSEA 4OAWB 1NGQL 2AJUL 5ITBL 2X1OA 2GITA 5GRJL 2VE6A 2PXYC 2FHCA 1NCTA 1SJEB 5F72S 3WN5B 1HHJA 3GMNA 4Y89A 5F8QC 3IVKB 1S7UB 2V5YA 3LKRB 3QFJE 3GSWB 5EO9A 5IBLD 3CJJA 1WICA 4EDXB 5JORA 1U9KA 1FHGA 5DQJA 1UH2A 2BNQE 1NSNH 5E2TH 2WBJC 2CK2A 4OZHE 1DTUA 2EC8A 4J6RL 1AXSB 1W72B 5FK9B 4ZFFA 4KDTC 5C0BA 3QXDA 4PJBA 5GIRA 1XGPB 1JGEA 3K2UL 4F15C 5I6XB 2MWCA 3QZWA 1FL5B 4JO4H 4O58L 4NZTH 3ARQA 3SO3B 1AQKL 1MCQA 2X4SA 5TQ0L 3VE0B 5JO5A 3ZE0F 5C0RL 2VOTA 3M17B 4HUUA 4KROD 3L3KB 1FQ9C 2YUVA 5D5MA 1MHPL 1UZ8A 4B7IA 2W60B 1YUHB 3HCVB 1FNSH 3MRDA 1VFBA 1KIRB 2V7HB 3CMGA 1EO8L 4NOBA 3OJDB 1FYHB 3BAEL 4HKZA 1AGFA 5L2JA 4NWTL 3ZDYE 3NIFF 3UTQA 4NQUA 5FCUL 1JVKA 4RAUA 1CICA 1YEDB 5IFHL 3VWKB 4O51A 3MRJA 3I3EA 4F7MA 5E9DD 2ZUYA 1IGML 1BOGA 1EO8H 4OFDA 4DKAA 1G6RL 2Y5TA 4P2YA 5MERA 2VXVH 5LJYH 3WS6A 3KPSD 3WFHA 2IG2L 5FO7B 1X5LA 1H3XA 4X6DB 2XRAH 1WITA 4ZPVB 3BISA 1IEAA 4U6TA 3RY4A 3U46B 4L9LC 4WNQA 4N0FB 2C4XA 5FYLE 1W0VB 4MXQD 5IMLB 4XAWH 4ZNEA 3LS4H 1KG0A 3KLHC 3ZMRA 1A4KB 3L6FB 2ZG3A 2NR6D 2R23A 1DBML 2K3TA 3GM0A 2PW2A 3MV8E 3LPGA 4OB5L 5KVFH 4XBPA 2P5EA 4F7PB 3S4SB 4WI8A 4GAGL 3A6CL 1VFUA 4KK8C 4NFBA 4G8GE 3X3GL 4PJAF 1FNAA 4BELD 1AD0B 3OZ9L 4LSVH 3WDIA 4NHCL 2XG5A 3FL7A 2D03H 2C3HA 3HN3A 1D5IL 1G6RH 1Q72L 2X4NB 1RUPL 1F58L 3GB7A 5DRNB 3S5LB 1J1OL 1JN6A 5EZJA 1IZJA 4BFIB 2FB4L 3NFNA 1WISA 4JVUA 15C8L 4PJDE 1SYVA 1EPFA 5GJTH 2NY3C 4I2XA 3D39B 1UGNA 2APVA 25C8H 5C0CA 5C08A 3T3ME 3O4LB 1BD2B 3HAEG 5FKAB 5T3ZD 3BGMA 2Z31B 5FA4B 3AAZB 1H3TA 4OBRA 2AXFA 3WE6A 1U8LB 4PJ5D 4KWUA 5CWSB 4ZFZA 2X4OB 2YPKA 1X5HA 2PTTB 2YRLA 1A02N 4YDVA 3ZKND 1PG7H 1T6VN 2EYTA 2UZIH 1R3IL 4YXHL 3KJ6H 3FFCE 4TNVK 2YK1L 4X9BA 4E5XA 4PJAA 5BXFA 3VFWB 2YN5A 1P9MA 4DOHB 3PABB 1Y18B 3VGAC 2CMRL 5DR5L 2X89D 1D5BA 1NGZA 4QXTB 1IL1A 1AKJB 2QQQA 1WEJH 4EI5A 4ZUTA 4YHZH 4ZSOB 3V0WL 4LKCA 3WNNA 1SBBA 5ITBH 4DGVH 1N8ZA 4PJXF 1WFTA 2EEAA 4MNQB 4CVUA 2D4FA 4RMQA 4PRDA 1I9RH 2EYSB 2NLJA 3B3IB 4G8IB 4U3HA 5D7LB 4OCWH 1JNLL 2LAGB 3FN9A 4FTVB 4FNLH 4WO4C 3V6FA 2OP4H 2R0KH 2BSED 3EJZC 1NFDB 3FN3A 3CFEA 3LKOB 4QOKA 4L3EE 4FXGB 3DRQB 4PGDA 2B0SH 4J8RA 4HFWA 3U79A 1RUAL 1NEZG 5C0ND 3THMH 1GPOL 2C3XA 4JQXA 3CUPA 1MREL 3CSYA 4Z7OF 1HQ4B 4FP8L 1XR9B 3ARFD 2LTQC 1Q9KA 5JIHA 4W68A 4DW2H 5I15L 1LGVA 2BSRB 3D39E 1HXMA 1Y6MR 5FHBH 3VD5A 2CGRH 4GRWH 2ID5A 1JFQL 3WNKA 5GRUL 1TJIL 1MIEL 1N5YL 3BW9B 2BNRA 5D1QB 4Z8FL 1QNZH 3MJ7A 1U8OB 3B9KC 5F1NB 3MGAA 1BD2D 5F1SA 1DBKH 4LGPB 4HEPG 1NC2B 2WUBH 3FT4A 3V79C 4PG9A 1NCAL 4MSWB 1FN4B 4QHMB 4PJEE 2H9GB 4U6YB 3HFMH 3Q5TA 1H3PH 1I9IL 5JOEA 4WFEE 3MRGB 2F8XC 4MVBC 1MHHB 2C4FU 4QRSA 4GMTH 4LLUB 3L7FA 4W6XB 3HPLA 4LVNC 4PJXE 4U2ZA 5GSVA 3ALWA 2BVPA 2ZG1A 4EI5D 3EFFB 1CE1L 4X8JA 2EDWA 2IAMB 3LKPA 1IC4H 2B2XL 1I3RA 3SOBH 1XCTA 1BM3H 4Y5XA 1GOFA 1JPTH 3HE6B 4RGMB 5FDWA 5JR1L 4WV1C 3TESA 1E6JL 3WV0A 4MA7L 4PY7A 5L88H 4DJMA 2QR0A 4XH2B 2R8SL 3JWOH 1H8OA 1O7VA 2GCYB 3RHWF 4KK6C 4NZTL 2Z8VC 3MFFB 1MH5A 35C8L 2DYPB 4UIKH 1L0QA 4RWYH 1GC1H 4HBCH 1CE6A 1LDSA 1P7QD 4LOUD 4F37K 2LV4A 4FTVD 1QRNB 3ZSTA 4V1DB 3IDUA 3TV3L 3RDTD 1ND0A 3GI8H 5ANME 4LQFH 1K5NB 5BS0B 2OJZL 4HZLB 4NQTA 4K7FB 4PUBL 4NJAH 1BAFL 4GG6A 5D5MB 4BKLA 3QEGH 3N1PC 3TV3H 4GRWF 5GGUA 4LVEA 3RVXC 1N3NB 1WFUA 5ANMA 4D0BA 1ZVHA 3VXMA 3IJSA 4NZUL 5IKCB 3IFOA 2Y5EA 1VSCA 4LPCA 5HYSA 4APQC 4Y4FA 3VXSA 1BEYH 3CXHK 3RDTC 1CK0L 4XCFL 2H26B 4UDTA 3TT3H 3MRJB 1HNFA 2EE9A 5EZIH 1PD6A 3EDJA 2PF6A 3IDXL 5KAQF 3UX9B 3TJHC 4PRBB 3C87A 1E6OL 2ZWLT 1YPZB 4N90D 1JYNA 3EO9L 1UCBL 5GISH 3MA9L 1NCCH 1S7TB 4LASH 3VWJB 3DPBA 4MCYB 3K7UA 4RGMC 4FQHB 4PJHE 5BJTA 5IGXH 3H9HB 4PRAA 1YEEH 3TCXA 5INCA 2ZUQB 3KPLA 1R3HB 5K9JL 1NCDH 5IBLC 1NAKL 4IRSA 4Z7QF 2DLEA 2KBGA 4Y2DB 5FGCB 1MWAL 1FVEB 1HKLL 4RMTA 4M62H 2PXYA 1BD2E 5FB8A 2DTMH 4HKXB 1ZHKA 4KROB 3GMLA 5GGRA 5E2WL 4Z7UF 1TZIB 2QHRL 1HYSC 1CFTA 1U8KB 5HGAA 3RIAF 5C0GA 3WFDH 3UAJD 2A9NL 4L8BA 1IGIL 5I66A 5EH1A 2PUQT 2FIRT 5ESVA 4N0YL