2HWZH

Fab fragment of humanized anti-viral antibody medi-493 (synagis tm)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
227
structure length
227
Chain Sequence
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDDKKDYNPSLKSRLTISKDTSANQVVLKVTNMDPADTATYYCARSMITNWYFDVWGAGTTVTVSSASTKGPSVFPLAPSSAAAAGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a single tryptophan residue as critical for binding activity in a humanized monoclonal antibody against respiratory syncytial virus
rcsb
source organism Homo sapiens, mus musculus
molecule tags Immune system
molecule keywords Immunoglobulin Fab light chain
total genus 39
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2006-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hwzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hwzH01
2COQA 2O5XH 1RU9L 1XGRB 3DHJA 3MNWB 1D3CA 1N0XH 4MD5B 5DQDL 3PUCA 1XGYL 2IMNA 4HGMA 1T80A 3BQUC 5DJ2A 3VXSE 3X13A 4G8EA 5E8DL 1JMZA 2WMPA 3P9MB 3PGFH 4ORGB 1IBGH 5C0AA 4Z77A 2VDKL 1G0YR 4JKKA 2VERN 3EYQD 2FX8L 3JUYA 4KZEH 1WBYB 2FJGB 1LP9E 3BPLB 2Z8RA 4ELME 5KTEH 4N9GA 5GRVK 1U8JA 1KCUL 2VZUA 1AGDA 5EUOB 4NDMA 3M45A 3TBVA 1V8HA 2AV7B 2JJUA 3CSGA 3A67L 3LKPB 3OZ9H 5DRWB 3RL2B 3TT3L 3SE9H 1T21B 2GJ6D 2N56A 5LQBH 2D7MA 5IKCB 2W0KA 3HNVL 1RVFH 3FFCD 1KV3A 4EN3A 3U4BH 4JZNA 1FO0H 1XEDA 3MV7E 3SE3A 1S7WB 2P8MB 3DVGA 1R3LA 3LB6D 4FFWD 4NM4H 5HYQA 1LGVA 3CLFH 4FNLH 4GRLD 2ZUYA 5JLZB 1S5IL 1A6TA 2BP3A 1K8IA 1TTFA 1KLUA 3C6LD 3SKUD 5IJVB 2R9HD 2UYLA 5FDWA 4QT5B 3GIZH 1GGIL 3GJEB 2BNQD 2F5AL 3IB4A 3QI9B 5FHBH 1F6AA 3VWKC 5JPNA 3KYAA 2IAMD 2PTUA 3VXOB 1BLNB 2AJSL 4DW2H 3O9WD 3OKOA 1A7OH 2EDOA 2ENSA 3IFNH 2FHBA 3CFEB 4MGXA 3RIAK 3C5SA 3INUH 1VPOH 5J12C 3HRZA 2Q76B 4LCWD 2A6DA 4P2QB 5CBEA 5ITFB 3QHZL 2D9CA 2J6EL 3FB6A 4HC1A 4JRYD 4I5BA 3QUYA 1J87A 4R97C 3QO0B 1TQBC 2UVEA 3AGVA 4JY4A 1R5IA 1BZ7B 4M6MH 1RI8A 3T65B 2D7NA 3TO2A 4MX7B 4YUEL 2EYTB 3NAAH 4KKBD 1JNJA 1H3WM 4N9GB 4JM2C 4O00A 2VYRE 2K1MA 3OTTA 5IMOA 3FN0L 4JQVC 5J1TC 1G7LB 3B2VL 5FUCE 4XVTH 5F7DA 2EIZA 1PYWA 1RURH 4HFWA 2V2WA 4U1NB 3MXWL 3UPRA 4YC2B 1XCQA 3K8MA 4GW1B 3WE6A 4PV9B 2ZUSA 3DMMB 4ODWB 4OFKA 4PJFA 3TA3D 2ZG3A 4D0CB 3FQUA 2MPAH 1NGXA 3QI9C 3S4SG 5BZWB 2FEEL 3F7YA 1QSZA 5DURB 1JWSA 1LK3H 3QJHB 4H25A 1ND0B 4DQOL 1EIBA 4O9HH 4XRCB 1DEEA 2KZWA 2EDYA 1I7UB 5I1IH 3LSOA 5CMAB 1F4AA 4YPJA 4ZSOE 1OSPH 2UYLB 1ITCA 3PV6A 4YEEA 4GSDH 1M7DA 3CU7A 3OX8A 4EOWH 4H5SB 4HCRH 15C8H 1CD9B 1Z2KA 1T1WA 4K7PH 4B5EA 5IBTH 4PV8A 2GTZB 4LDOB 2NXYB 1A6ZA 1S5HB 1IGCH 2B5IB 2W0FB 4RMQA 3ABZA 1RPQA 4GXUM 4WFFD 1FSKC 1UVQA 3ARTA 3MACL 4LVEA 4MJ4A 5D7JA 4PJ7A 2AJUH 4M61A 5HGHB 4N1EA 1UACH 3NZ8A 4OIBA 2P46B 5DGRA 1LE5A 3PL6C 3QIWB 2V17H 3PHOB 3WE6B 4UNTA 3IKKA 3JWDL 4Z5RB 4H20H 1U2CA 3BPNB 4NZJA 1EHAA 1YEEL 3OGOE 1YMMB 4JO4H 4HLZH 4ENED 1NPUA 1C1EL 3QHFL 4MDJA 4GBXB 4J6RL 4XPFH 2Q8AL 2VIRA 4Y5VC 4MQ7B 1T7WA 1A3RH 1CFTA 4JFED 1MIEH 4L8DA 4V1DD 2HJFB 1A0QL 4RDQG 1EZVX 3BRGC 2BSRB 2I9LB 4MYWB 3WN5B 2DQFA 5L8LB 5CD5D 1HHGB 2ICWI 4I2XA 4TPRL 2YRZA 4R6UA 3BEVB 1ZT7A 3S3PA 1H3UA 4TVPD 4IRJA 3QWOA 3CLEL 1LHZA 4XPTH 1NH6A 3ISWA 4L8SC 1FVDB 5EG6C 2OZ4L 1LEKA 4UT7L 5ITBH 3CU1A 4ZUUA 2LTQB 4X5LA 3VD7A 5J13B 2QBWA 5CKAA 5C3TA 1PLGH 4YXHL 5IB2B 2EKJA 2OBGA 4MB4A 3MGTB 4HX1B 4Q2ZA 2QV2A 1ETZB 3BP4B 4IRJC 5I1AB 4JREC 2BOCA 4JFQA 5FO7A 1FGNL 5DMKB 5C9JB 4MNGB 4HUVB 2XFXB 5TDNB 4L29B 2CRYA 1JWSB 2OSLB 1T04A 4X7TB 3JTTA 4Y16D 1A02N 1GZPA 2IALA 4XCYA 1DBKH 1S78C 1U58B 3TBSB 5A3IC 3VFNB 5I8EB 2A1WL 4AIZB 4F7PB 2VDQH 4XT1C 4NBZB 2J5LB 4PJFE 1ZHNB 2YD4A 4ZO7A 1V7ML 4FP8L 5T1MB 1X5JA 2HJFA 3RVWC 1JRHI 4RGNE 4RQQB 2APXA 5F7HA 5IHLB 4TUOA 3BX7C 3SDXA 2DDQH 3SKJH 3UEZA 4NQDD 3L3OA 1D6VH 3GKWL 5EN2A 1UQSB 2A74A 1TCRA 4M48L 5FGBC 3GJFA 4K71C 1MHHB 3S88L 3WNLA 4JQXA 4I3SL 4FQHB 1YEJH 3OG6B 5C0BA 1CGUA 3IXAB 1RK0A 4UILL 4Y5XB 5HVGB 5HGBA 2ZG2A 3RBGA 2Y06L 4LKCA 4Z7NF 4RFOH 1Q9KB 1A7BA 1CF8L 1VEOA 3KXFB 2N7AA 3P30L 2V6HA 2OP4L 4Q97A 2EC9T 3SOBL 2VABB 3L5IA 3S4SA 3D18A 5D6CB 3NVQA 2H9GB 3QUXC 3U9PL 5ESAB 2A83B 5BJTA 5F7EL 5ESVA 3IDUA 3S5LB 2BRRH 3OKNA 5C1MB 3O9WB 3MJ7A 1AKJB 1FLRL 3U6RB 4LNRB 3EOBB 4HWUA 1HQRB 1OW0C 2AXFB 4G6ML 3BESR 1SYVB 2WV3A 5DFWH 2CIIB 2FGWL 2Z35A 5T3XL 4H1LG 2X1PA 5F93C 1EUUA 3UTOA 3CZFA 1J1XL 4JRXE 4M93B 1FQ9C 2YUVA 32C2A 4JN2B 5F1KC 8CGTA 5GS2H 5MERA 1LEKB 2X6MA 2HFFB 1VDGA 3OL2A 3V5DA 5IEHB 3FZUC 4OZIF 4JFDD 1OWRM 5E5MA 3D39E 3TH2T 5DJZB 2NW2A 1A3QA 3VFRB 3G04B 1JGLH 4A2LA 1JPFB 4BZ1H 2GCYB 2AQ3A 5DHVA 3RVXD 2ICES 1MELA 3NMEA 3SDDC 3ROLB 3UDWC 1U3ZA 2FO4B 5FYKH 3LHPH 2XXCB 3AY4C 4HFUH 3AB0B 1MCSA 5JQHC 4Q9QL 5CEZE 2H32H 4PJGE 4R4ND 1EX0A 1FL6A 1EJ6A 1IGMH 1TJHL 4OZGE 4FMFA 2FJGA 5F96H 5KSBF 4M3KB 4FABH 1A6AB 3MCKA 2EE9A 4JKLA 4TPRH 4I9WE 2HN7B 3O9WC 1WC7A 2G60L 1EEUA 2IFGA 3MMEA 4XNUH 4UNVA 2PN5A 3HI1A 5C0AD 1FZMA 2FO4A 4LHUB 3RVTD 1ZWIB 4ISVB 5ENWB 1YPZF 1P69B 3K8LA 4PJ9A 3LZFH 4Y19A 4LSTL 2YD6A 4MJID 4WUKH 5IT2H 3FCTA 1VFBB 2PR4H 4M7LT 3GSNA 3M8OL 1TNNA 3KS0H 5HYSG 3GIVA 2FSEA 2XTJE 1B4RA 4LP5A 1KTDA 5DMGC 4W81A 1UJ3B 5CJQL 4PRIA 1G7JB 2VL5B 4X4XA 4W6YB 5TE6L 2H3NB 1PW3A 4KI5E 2QHLA 4GT7A 1XR8B 3HMXH 5DEGB 3C09B 4U1SA 4JCLA 3MACH 4M5YH 4GW5B 4OCWL 1NCUA 2ADFL 3L3DB 4U6TA 3WNPA 5T3ZD 3B3IA 2VZTA 3PWLA 2HMID 2ATPA 3AS3A 4CVXB 1JFQH 1E4JA 4ZAKC 5A16B 1CLOH 3VDCA 4J4PD 2JJVA 4HIHA 1F4YH 1BPVA 5HGAB 3UDWA 2VISA 3MLWL 4K3JH 4YGVB 2P7TA 3KLAB 4LLWA 4ZFFB 3NTCH 2X4OA 4PR5B 1J0JA 1P4BL 5F71A 4F57L 3V6BR 4HV8B 3S9DB 4GSDL 2NY0D 4ZUWA 1HKLH 4PJXE 2JB6B 5FYJH 3T3MF 5DD6B 4YHKL 5H35B 1IFHL 4MA3A 2OJZH 1QFOA 4QCIA 3MYJA 3O6FD 1J11A 4J3WA 3LEYH 3FQNA 3EO9L 4MS8C 1FFNA 2YHGA 1CK0L 1R5WA 1RULH 1LD9A 4E9LA 3BISA 5BXFA 3I84A 2F53A 5IW6B 4MD5A 3EO0A 3C5ZD 1NANH 4L8DB 3QWQB 1INEH 3BE1H 3EUUA 1R0AH 2UVFA 1ZLUK 5ISZD 2WWKO 5TFSL 1TQCB 3BE1L 1JHTA 5EC2B 5K33A 3KPRE 2GEEA 1B90A 3IF1A 4HWEH 2WZPD 4E0RA 1B0WA 2XWBB 4I3SH 4JANA 5L88H 3WHXB 1BEYH 5GS0C 3V6ZA 4PBWD 4PJCE 5HPMA 5GGUA 2PYFB 4EXKA 3RIAF 1U93A 1WWAX 1BQHG 3VXSA 1S9WA 3DX6A 1GCFA 5EORH 3LSOB 3V9FA 4CKVX 4JRWA 3QHZH 1DN0B 5ACLA 4U6XA 5E0QA 4G6AD 1UH3A 4L3AA 1EFXA 2DLHA 1FFRA 4H1LB 3GI8H 2F54E 3P73B 1I8LC 3O0RH 4FP8H 5EU4B 4U2YA 1P4BH 4WUUA 3OPZL 4Q9CA 1IAIM 4KC3B 3KLHC 2R39A 3MLWH 4K3JL 1X5KA 5CEXA 2R4SL 3N1PC 2CRMA 1WCBB 3OGCB 3CK0L 3QEQD 1U58A 3TBSA 1CLOL 4KK6C 4KQ4L 4UI2A 3KNBA 4MVBD 1A14H 3O2DL 1LILA 1J0KA 1MJJB 4QHKJ 1I75A 1QSEA 5BO1H 4MJIA 5I2IA 4F37K 3MA9L 4U7KA 3PQYD 4ZAKD 1A6WH 3IKCB 3G5VA 1RUQL 1IM3A 4NKMA 4RNRB 3PWNB 4OF3A 4Y5YC 1IQDA 1KIPB 2R0KL 4YHIB 1RIHL 1VHPA 1UM5H 5DEZA 4GBXA 5MP6H 1SM3H 5F1OB 2ZUWA 1FH5L 5JHDB 4OZ4B 1NUFA 1O7VA 1C12B 1MJ8H 5IBLD 3GO1H 3KXFA 3VWJD 5C09E 5ADOL 5TE4H 2DBLL 4MLIA 3H9SB 1CN4A 4E41D 1IAOA 4RGND 1HIMH 4PJBE 5T1LD 2V5MA 3U4EB 5FM8A 4YWGH 1MIEL 4HIIA 1PQZA 3TJEH 3QUZB 4HJGA 2DQGH 3ZKNC 5DD1H 1WZLA 3ARGD 3I75B 1B0RA 4JN1H 1CE1L 4MNGE 4CJ1A 1T89C 2FX8H 4HT1H 3QXDB 5E2VH 1QA9A 2FIRT 3FB5B 4D9RE 2YA2A 3GB7B 3JWDH 3SDAB 1TTUA 4CN4A 2DIAA 1UB5A 1NKRA 1IMHC 4F2MB 2A0LC 3KGRA 3JV4B 1ZTXL 4JJ5A 4OF6A 1I8IA 5EOTB 5KSAA 4UQ2B 1JGLL 1E4KA 2AAVA 4GG6B 1G7HB 3VXUB 5KJRH 4FQ2L 2GKIA 1PX3A 2E6JA 5DWUL 3REWB 1O0VA 1UCBL 4DUVA 4KJQC 1T7ZA 4XB7A 5F9JB 4YZFE 5EU7E 1BBDL 1NL0L 2VSCA 2PTTB 5KBNC 4LP4A 5T3XH 4Z7OF 1E6OL 4FTVA 1NAKL 1KB5L 4U1NA 1ES0A 2GT9A 4L8CA 2ARWA 2FJFA 4PRDB 1UKSA 3SDCD 4RISH 1QR4A 3T0EE 4TNVK 2NPLX 4ZUSA 4QRQB 5IB1B 4DQOH 3TLRA 2ZPKH 1H3GA 2C5DC 3GSWB 5MEQB 1UZ8A 2VXQL 1P6FA 2YPLE 2JE8A 4QTHB 1P6AB 4QWWC 2GFBA 5IVNA 1E4KC 3WNOA 2GCYA 3SKOA 4EVNB 3MRJB 1BFOA 4GAYA 4U3HA 4Y4KA 3OB0K 5DJDB 3DIFB 4I1NB 2V7NA 4KRMB 4DK6A 4GOSA 5FUOL 4BZ2H 3P30H 4L1HA 4DKAA 3S34H 3K2UL 5KSAB 3O11A 5I19H 3R0MA 3TCXA 3WJJA 1FORH 2P8LA 5FYLE 1IT9H 3QNXA 3HAEH 2NZIA 4OFIA 4PP2B 4GG6F 2M1KA 4LARL 5CEZD 1OD7A 4GBXC 3P0YH 4OM0L 3CH1B 1QYGH 3C2AL 2JJSA 1MREH 3PWJA 1QSEB 3RWFA 5J1SC 4HIIB 2ZUVA 3HC3L 3BIBX 5JHLL 5B3JE 4GG6A 2HH0H 1RZFL 1ORQA 5JLZA 2G2RA 2DYPD 4JDVA 1I9JH 3EOTL 4OLVH 4XHJC 3QDGB 2X89D 5DJ0B 3CVHA 3GSXB 1J0ZA 1P4IL 5AYUH 4Z95H 4LASH 4U0RB 2IH1A 4HAGA 1OGAA 1OGAE 3HC4L 2NW2B 3RKPA 1OP5K 1ZLSL 3LQAC 4K9EH 3L3IB 1MQKL 1CZ8L 4AG4H 2YZ8A 4NM8L 3OV6A 1YN7B 2WM0A 5TQ0L 1NBVH 4CMHB 3B9EA 2RJMA 3O4LD 1AC6A 1G6RA 3VFNA 4PY7A 1B6UA 1XGPB 2IH1B 2R56L 5HBBA 5C0BE 4EUPB 2CO7B 5F9WB 5KVGL 1JJUA 1FP5A 5EPMA 4WGWB 4IHOA 1BQLH 1L7TL 5DK0A 5EBLA 3JTSB 3PWJB 1DQJB 4HD9A 2P4AB 2Y72A 4XCCL 3O3DB 3GMQB 1FNEA 1URLA 2R2BA 3N50A 4S2SB 3QAZB 1KCUH 5GGSY 4L9DA 1QD0A 3IJSB 4JO1H 4ERSL 1PFCA 1LD9B 1IAKA 2O26U 4Y2OA 2CR3A 5B3NA 4XWOC 3W2DL 1YC7A 1BP3B 5DA0B 1X3DA 5E5RB 1TXKA 4WHDA 4H20L 4UIMA 3DIFA 4OCYL 4PP1C 4PJEF 2AJXH 3V6FB 4RAVB 2MQ0A 3ARRA 3V0WH 4WHYH 1CD1B 1UACL 1MOEA 1AGCB 1Q9WA 3GBML 5C0IB 1XR9B 4PJ5B 2HRPH 4KKLD 2V9QA 3AMLA 3HUJB 4HMEA 1NCNA 1W0VB 5ICZA 2R2HB 4XNQA 4NQEA 4D9QD 4O4YH 4JFXA 3UZQA 4MNQD 1R3IH 2VISB 4UDTA 3V4PL 5EIIA 3IU3A 2I9TB 4H88L 3TVMC 1ZOXA 1FCCA 1RZJC 3MLTB 3NCMA 4P4RA 2CLVA 1D9KD 3FQXB 4ONHB 4S1SL 1EZVY 5DMGD 2Y9RT 1A21A 5D72L 3P9LB 3QEQE 1QNZL 2LFGA 3DMMD 5D6CA 5D7LD 3NFPA 3V52L 1PKQE 2OM5A 5JOPE 3MRHB 4XVJL 4NRYB 1TLKA 4XBPA 3MZGB 5LGKA 4NUJA 3B9KB 3RL2A 2AQ1A 2IQ9H 4MVBC 4QLRA 3GJFK 1F4XH 3EDEA 5IKCA 3LKQB 3PWUA 3BP5A 5GGSB 3SPVB 2VB5A 4H0HB 4ZFOL 1N5AB 3V5HA 1EEQA 3KJ6H 1NC2B 5DD3H 4DN3H 3U7YL 3ZSTA 4ZD3H 4NZRH 1F02I 2R2HA 1DVFD 5CP3H 5JDSA 3BKJH 1A6AA 5IBUG 3BW9A 3RWGA 4HF5H 1HILA 3UPCA 1WAAE 1ED3B 1CVSC 1FZJB 2IANE 4FFZH 5DO2C 3D85D 5I74C 4RAVA 4H26B 4PJDB 4L9LA 4QRPD 4N8VA 1SBBA 5I1EL 2HKFL 3G08B 3ROLA 2VKWA 4V2BA 5C0CE 3DRTB 3HE6A 4PJ7E 3VXUE 3W11C 2CGRL 4PJHA 1F45A 4PRPB 1PQZB 1FO0B 4I48A 4ODSL 5FYLD 1F13A 4R2GD 4X6CB 5IHBA 4QNPF 2XN9A 3QJFB 2AJSH 3V6FA 2ZCLL 5IVXF 1AQKH 3VI4F 1LE9A 3LKSB 2DI7A 1CWVA 4G80A 2FJFB 1F4WH 3EYQC 4PJ7F 5BRZB 2YD1A 1FNAA 1IRAY 2GTWA 4AH2A 5TE7H 1KIRB 1NC2A 2YSSA 4X99A 4WTWA 4ZUTA 3MV7A 3C09C 3FCTB 4GKNA 5IVXE 3HPJB 4YO0A 3QDJA 3SCMA 1P7QA 2Y6SC 4Q9RH 3HNVH 1OTUC 2B4CC 5CLTA 5D7JD 2C3GA 2Z92B 5EO0A 5AUMB 1F11A 4UNUA 3WKML 4ZG1A 1BMGA 3L3OB 2IBZY 2BJMH 4L3EB 5IESL 1MJ7H 3MUHL 3U30C 1GC1H 2XOTA 1K4CA 4FXKA 4LQFL 5JW5B 3NACH 2OX5A 3OZ9L 1IC7L 4IRSA 4N8CH 1IC4H 3C5SB 3W9DA 3THML 1VB9A 4K9EC 1Q9KA 5K9KA 3B43A 4R0LA 4XC1H 4PJXA 3V0WL 4H0GA 4KK5D 4PJFF 4EEEA 4EIGB 3NFSL 1YMME 4MD4B 1A3LL 2XWTB 4HH8A 1IEHA 4NNXB 4BELD 4FXKB 4POUB 4O58L 1SMAA 3CH1A 3MLXL 1S78D 2GJ6B 3S5LA 4MA1C 1XGYH 4JRYE 2K7QA 3B2UD 1N3NA 4FXGA 3WIHA 5DJ6B 1JPTH 1X4YA 4J1UB 3UC0H 1X6NA 4XCFH 5GRZA 1OGTB 2ITCB 3C87A 3BYYA 2DYPA 5LBSH 1R5WB 5CMAA 2A6DB 4P2QA 2L4OA 5AD0A 1U3HD 5DVKA 5I8OH 4PJDA 1WZ1H 4CBPA 2X4PA 3BN9D 3KXFD 3BGAA 2EKSA 4IRZL 4LGRB 4IOIA 4PLJD 2AJYH 4HF5L 1AXSA 3UTSA 4YAQA 1BLNA 3QQ9C 1A7QH 4JPWL 5J7CC 4GXUN 3QCVH 3VFTB 4HHAA 4F7CA 5EUOE 4P57B 5IFAH 3ARFC 4ZXBD 4DN3L 4KUZH 1AD0A 2LU3A 3I9GH 3QUML 5I17B 3TFKD 5DFVD 1Q94B 2ZUXA 3DXAE 3DXAA 4DKFL 2CUHA 4M6AA 3IU4H 1QO3B 4FG6C 1DBMH 4NCDA 1I3GH 5B22A 4HS8L 4OLVL 1DN0A 3MV7B 5GS2D 3T8XB 3CH8A 2UUDK 3I02B 3BP7B 2AP2A 3HC3H 4IM8A 3SDYH 3HPLB 3PP3K 4KPHL 1YECL 2I60H 4LLMA 2HT3C 4Q2ZB 2DQDL 3RY5A 4EBQL 4P49A 5F88B 3MC0A 1DVFB 4HIXL 1LK2B 2WANA 1W8NA 1WCBA 1II4E 4OZFH 5E94B 4QRUA 4QXGL 5I75C 3N9GH 5DJYA 3PV6B 2WBJD 4S1SH 3OB8A 5JW5A 5E6IA 2RB8A 2IPKA 5HHQB 1OM3H 2P5WA 3ARGA 1MNUL 1N7MH 3LEVH 5LWYH 1JUFB 4YXLL 4APQA 1G6RL 3FAXA 4PUBH 3SE4A 3ZHDA 3UCRA 3VGAB 4RWHA 1HHHA 4POZC 4BZ2L 1W0VA 4M62L 3RNQA 4Y5VA 43CAB 3WFHB 5IJVA 5MENA 2JK5A 4DN4H 5MEND 2FL5A 3IDIB 3GBMH 4A6YH 1MFDH 2B5IC 2VAAA 3SDAA 2CLZA 4M9PA 1CFSB 2D4DA 1FFOB 4AEFA 1V3LA 5J6HB 4F9LA 3JWOL 3OX8B 4WTZA 1AR1D 4M6NL 1V5JA 1W0WB 3SY0B 1F3RB 1RUKH 4R3SA 1KEMH 1LWRA 2Q3AA 4Q0XL 4OKVB 3ZMRA 1UFUA 5EO1A 4G7VH 4XNZC 1NFDE 4CDGC 2Y6SD 1DE4B 1E6OH 3BH8B 4NN5B 1I8KA 4LEXH 4OFVA 1QBML 4I0PD 1C08A 3DGGA 1G1CA 3QCTH 4L4TB 1FPTH 3Q6FB 2SEBA 4Z76B 4ZMAT 1N8ZB 4KK9D 2FLBT 3PWLB 4YE4L 4FQ2H 4NO5B 1MCKA 2MOVA 3N06B 1AXTL 4U49A 2VQ1B 5IF0A 4LNRA 5DJXB 5KN5B 4YC2C 2L7JA 2EYRB 3MRDB 3IVKA 4KUCD 3C60B 4JDZA 4TVPE 2X4NB 4I18C 1HHIA 3LS4H 4LCWB 5F88A 3TVMD 5TQ0H 3KPLB 1ZT1B 1MFBL 3JBG7 4HWBA 4FTVE 4Y8DC 5J06A 1VFAA 4MNHB 4QRRB 5AG8A 4K9EL 1BZ7A 2UWEA 3MNZB 3HMXA 4JFEE 5EZLA 5DHYB 4CMMA 3H6JA 1T0NB 1F6LL 1BF2A 3TJEL 5DURD 3QZWB 4LL9A 5C0IA 2DOCA 3PDOB 1MFEL 3AREC 5T3ZL 2NY1B 3GSOA 5JHLH 4GAFB 4OLXH 4WO4B 4Y5YA 5B39G 1PYWB 1JGUL 4ZOCA 1U8NA 1JZ6A 1ACYH 4N1HB 3BPOC 3G6JF 35C8L 3SGJC 5MP6L 4XXDB 1F42A 1MAJA 4OIIH 1FV1B 3T0WA 4NQDB 1IL1B 2XWBA 5E8PA 3EJZC 1E28A 2V2TA 4KK6D 4UT6L 2Y25A 3UBXI 3T2PA 3VRLF 1YNTB 1CGXA 5CINH 5ITFA 3ZYOA 3HFMH 4W6WB 4X6DA 5CSZA 2DTML 1KLGA 1F11B 1TETL 4X9GA 3QIUB 4NN6B 4UTBL 3MNZA 5EO9A 4R4BB 4G6AC 1NDMB 3BKML 3L95B 2DLTA 5EU4A 4R7DA 1JCKA 4PY7B 5DUMH 1KF9B 3WN5C 1D9KC 3HMWH 4OD3H 4EQ2A 1UYWH 5FGCB 5KVDL 4PRNA 2EXYD 3GI8L 4JPVL 2VE6A 3T0EC 1C16B 1JPFA 1MH5A 3EAKA 3TVMB 3MLPA 4JO2L 4E41B 4U6VH 3BKYL 1U8NB 3L3DA 3DETD 4NZUL 1ZA6B 1KPUB 3FO1B 3IRZA 5T33L 1HINL 3MLVH 3QUZC 3GMQA 5BOPA 4FQIL 5MERB 1DLHB 2VNCA 1NEZA 4LAJH 4OGXL 4PJGA 3VXMA 3C9NA 3NIDF 3IDYB 4YHZL 5JXED 1KG0A 3DV6B 4OFPA 3DYOA 2NY1D 1YNLL 5ETUB 3QBTB 4Z6AT 4LLDA 4JM4H 4AEIH 1BZ9B 3Q6GL 3Q6GH 2OI9C 3GGWB 1JN6A 1R3KA 4F7MA 3HE6D 4OI9A 4PLJC 5BZDB 1R3HB 5CHNA 3QDGE 3FO0L 1WBYA 5E2VL 1S9YB 5C0BD 5H2BB 3M17A 1ACZA 1J0YA 1RK1B 3T4YB 2AJZA 5HHMB 2ICEB 1J1PL 1MCBA 2F54D 3LDBB 1TMCB 5CILH 1G7QA 2YRPA 1U3HA 2GY7B 2H45A 1J8HE 4KHXL 3OXSB 4PJBA 1U3JA 1TVBA 3LDBC 2X4QB 5DRWA 3T3PE 4XTRC 2EDWA 5DF0A 2NY4C 1ITBB 2OXHA 3HI1B 5SV4A 5F3BA 5TE4L 1MAML 5ADPH 5SV3A 2WNGA 5C0AE 3N0PB 1M7DB 5LXGL 3GFUA 4G6JL 1SEQL 3H9SD 3LVEA 3SN6N 1KUMA 2E8ZA 3FQNB 1KC5L 1N59A 2B2XL 3LCYA 2DMKA 4NQEE 1SY6A 1T1XA 2W9EH 1F4HA 1YEDB 1JZ8A 4FQJH 1KIUA 4AM0A 1RZ7H 5C0CD 2FIKB 2GQHA 2HWZH 4RBPH 2R2EA 1G7JA 2VL5A 3QUKA 3D1MC 4YR6A 2JB5L 5JIKA 4YBLB 3QRFM 3L3JB 2FX9H 2HFTA 1BWWA 3H0TA 2XPGA 4G9FB 1NGQL 2XA8H 4Z0BL 2P5WB 1AKJA 1DQDH 5LXGH 3FT3B 1VFOA 2FRGP 3MODH 1FGVH 3MNVB 1ZHKB 5HHXH 4K3HA 4W4NA 5D2LF 3MGTA 4PJBB 3K46A 2JCCB 2FH6A 5ISZB 1WBZB 1P7QD 4NWTH 4XBPB 4ZPVA 3VRIA 3T2NL 3O4OB 3T4AB 5B39B 1A22B 2CJUL 1P9MA 8FABA 5CILL 1BVKB 3ZYJA 2OTUA 3H42L 1P9MC 2F9BT 5C0NC 1FN4B 1FZKB 2AI0H 4JVPA 4F7TA 4IOIB 3GMMA 1SQ2N 5I9QC 1MCPH 4HFUL 3HNSL 4JRYB 3EFDL 1A1MA 1U36A 4NQSB 1JWUA 3MV01 2X44D 4NO0D 3QIBD 2EZ0C 3MRBB 4YFDB 3VI3F 3GRWH 3N1FC 4NHUA 4TUJA 4BZ1L 1T1YB 3CSYB 4K94L 4KKBC 3GMRA 1FVEB 1CT8B 3Q1SH 2O93L 2ZKHL 3EZJB 3KPOB 4DEPB 1AP2A 4ZNEA 4JN2A 1CIDA 4PY8J 2X42A 3QXAA 1FL6B 4M00A 5D7LB 3RA7H 2B0SH 3KYKL 4LSSL 3GSNL 5I0ZA 1HH9B 2WBKA 1LP9F 4LDLB 4NQUA 4J23A 1DEEB 4HUMB 3C5ZC 4TUKH 2IQAA 4P9HC 2X2YA 4NZUH 2IH3B 2OMNA 2RFXB 3QEGH 4RQQA 4YHKH 3QCUL 2IAMC 4JPVH 1JYNA 4K07A 4KKNA 1AFVH 2MTPA 2ZUQC 5CP7B 4YFEA 4WUUB 3ARYA 2ARJQ 3MGOB 1LNUA 2VLJA 1NEUA 3X11B 5H37G 2DTMH 3HRPA 4NNXA 1S7SB 4N8VG 2D31A 1CDGA 1A8JH 2CDEB 4JM2B 3MXVL 4LHUD 4ORGA 2VZSA 5E6YA 5FO8B 4ZTPL 1T83C 3WLWD 5DLML 4PGBA 2IFFH 4KI5C 4DKEH 5I2IB 4NGHH 1MFDL 2Z0BA 3OHXB 2HMIC 2VAJA 4Y0GA 5DO2D 5CIPB 2FGZA 3R1GL 4M48H 5EBWB 1T1XB 1KTDB 5CJOH 4NQTA 3ZDZE 4TTDC 4WFED 4UQ3B 3TNMB 3TZVA 2Z9TA 3FQRB 3HI5L 4R8WH 4TSAL 1MNUH 4J3VA 3KPMB 4MD0B 5TDPB 3EOAA 1QZ1A 4KVNL 2FD6H 2E7BA 5L2KA 4XNYH 1R5VA 2PXYC 2VXTH 1CG9B 5ILTH 3ZKMC 1SJVA 4NQCE 3JXAA 4TTGA 3ILQC 4LCUA 3P0GB 3RPKA 2ADIB 1DCLA 2JF1A 5DRZB 3SDYL 1OLLA 1KLUB 3G5YA 5A2FA 1FGNH 2F74A 4PREA 1A6TB 4OGYH 2KQNA 2N1KA 2H2SC 3P4MA 4F3FA 3HZYB 2NY0C 3CFBA 1C16A 3NIGE 3PWPA 3RDTA 1HHKA 5KW9L 1F3JB 5BS0B 2BNQE 3AFLA 3HLAA 1N6UA 1VEPA 1VADA 3O6LH 4WFGD 3DPBA 3S96A 1RZGB 1FRGH 1KULA 1IC5L 4HUWA 4DOHB 2BNRA 2MWCA 4EN3D 2B4CH 4AEEA 5DA4A 2AK4B 3U79A 4JFFA 3K0WA 3ALXA 4R2GB 3VGEA 4NQDE 5JTWA 3RWJA 3WD5H 1FPTL 3HCVA 3NIFE 5D70H 1VADB 5ISZE 5I1GH 3UZEA 1UXSA 1EV2E 4LSPH 2APTA 4PJAF 4MDIB 4KDTA 5I8OL 4FQXD 2H6PB 3MRLA 3QFJD 4HG4J 1GGTA 5EWIH 2P8LB 4OCRL 1JHTB 5E99H 1RUKL 4LU5H 4JDTH 3L6FA 1TJIL 5IMOB 5KSVB 3TN0D 4DGVL 1ZK9A 3MRKA 4D8PA 3VA6A 1ADQL 3CD4A 3RZWA 5ETUA 4L8SB 3WFDH 1DQJA 4JZOB 2X4QA 3WCYA 4XBGB 4YQXH 1KPRB 1OLZA 2IG2H 5JW4M 3RKDD 5K9JH 5GPRA 3W81A 5ID0A 3VFPA 1RIUH 1KCSL 5D5MA 5CIPA 4K2UH 2C1PB 1Q72L 4JREB 4OZIA 5HI3D 5KSBB 3RY6C 2OR7A 1G0XA 2NY6D 3IJHB 1MHHA 3HR5A 3Q0HA 4EOWL 2NY1C 3ZDZF 2W0PA 1HSBA 1MLBB 3PGDB 3RGHA 3BD5A 3S3SA 2X4OB 1GPOL 3UYPA 4HIXH 4KV5F 3KAAA 5C0GA 4JM2A 3EJZD 5KANI 3NABL 5ICYB 1FAIL 4HGWA 3BHBB 3S98A 1Y6MR 5HHME 2YWZA 5D4QA 1JGVH 1GVIA 2Q8BL 1LK3L 3LRHA 4N90D 1CR9L 1CVRA 4ZPTA 4QY8A 3S8WA 4D9QE 2GK0A 4UV4H 2IGFH 3JV6B 2VDOL 3DLQR 3FT3A 2J1KA 3ULUE 2ZSVB 4RMWA 5EZOH 2D7PA 3DX9B 3KYNB 1BM3L 1VFAB 4MNHA 2LE9A 4WWKA 5CZXC 5IR1B 4K3EH 1HQ4B 4RMTA 4W6XB 2R1XA 2BSTB 4GUPB 2EDFA 5DR5H 8FABB 2V5SA 1MCHA 1F90L 1JZ4A 1S7TB 4XAKD 4I9WD 3AY4A 4KROD 3MRCA 3T0VA 3SKMA 4FQQA 1DL7L 3M1BA 4ODUA 5B8CA 5SX4I 1FNSL 3EJYC 3DX9A 3CLEH 4U1IB 3BPCB 5DJAA 1SJEB 4HXAL 4WO4A 1U92A 1YQVL 4P9ML 5I1EH 3SO3B 2J6EH 2JELL 3HTLX 4P23C 3VWKA 1VACB 5EU7C 3S3JA 3RTQA 2EDLA 4ODUB 2RR3A 1WITA 3E2HB 3HUJF 4IIQC 4BFGA 1RV6X 2CKBL 1A4KA 3VG0H 2HKHL 3SDCA 3O2WL 5C92A 5DJ8A 1BIIB 5IB2A 4ODBD 4KY1H 3MLXH 5GSVA 3KJ6L 5J8OA 2EDRA 2F5AH 4I0PC 3VFRA 4PJ8B 5C86A 1GGIH 2Y4SA 2X9XA 2DAVA 5FK9A 1UXSB 2A6JB 3DYPA 3WIFB 3T8XA 1NMBL 3MBXH 2XNAA 3FJTA 3JTSA 1S7UA 4LRIC 4MJ5A 5D5MB 2YD5A 1GGUA 3QXTA 4R9HA 1CLZL 3DURA 3FOLA 3PABB 5E2WH 2CKBA 3FOMA 4JHWL 1T1ZA 1OAXL 2HLFD 3AM8A 1PG7H 3GSWA 3UJJL 3T0EB 2P8PB 4XP1L 3MGOA 1TVDA 4KROC 2I27N 4JGMA 4MQTB 2WIMA 4KK8C 3ARBA 4MA8H 3O41B 1EO8H 4BQBA 3F7VA 4MMXC 3KR3H 1KN4L 4HC1L 1UQSA 4M7KH 4MCZA 3VJ6B 4GG8A 2ZOLA 5F7KC 2PO6A 5IUSA 3KDMB 3RFZC 4G3YL 3RNKA 3O11B 4O9HL 5MENB 4Q6IB 4KKAC 4GQ9L 5F6IB 2OJEA 3VE0A 2C4XA 4WFHD 3DV6A 4XAKE 4D9LL 2YPVH 4X6FA 2HRPL 5C09D 5GS1A 4KJYA 4I13B 5GGTH 2DWDA 4YEFA 2F8VA 5T3XD 1OF2A 2HJKA 2AJXL 4G9DB 5IB5A 4FQXC 1RU9H 5EBMA 3G6AA 3WJLC 3DUUB 1TJIH 3DBXA 1CL7L 3BAEL 4KY1L 2XTJB 1KJ2B 1QSEE 1ZKAA 1A5FL 5JZ7D 4U31A 2NCMA 3WFBH 3OAYH 2CD0A 3ILPA 3IGAA 2HLAA 1X5ZA 1NKOA 3OXRB 3HZYA 1K2DA 3O45A 3IETA 1X5XA 4F33A 5FO9B 1YYMH 3ZE0F 3ARFD 4L3EE 4NJAL 5HHNA 1NCAH 5CEZL 4WW2A 4XBEH 4IIQA 2BDNL 3NPSC 3CDCA 4HPYH 3I6GA 3L5XH 1AHWC 3MJ9A 4LRNH 4U1HB 2DYPB 4P4KC 4HIJA 3OF6A 3QG7L 5IP4A 3O4LE 1HWHB 5EIVA 1A2YA 3FFCB 1C5DB 4JCMA 3Q2CA 4X7FC 1EXUA 2CO6B 5MEQA 1QLFA 1MVUB 1F90H 3NIDE 3D0LB 4IEFB 2HT2D 1AGBB 3B9DA 3E3QC 1BAFH 3WSQH 3VXSD 3RDTB 1CICA 4YHNB 3D85B 3TP4A 3S6CA 1A7NH 2GUOA 4QF1A 5C6TL 1SYSB 5D2NC 2EDKA 4YBLC 5HYJD 4NNYA 4AH2B 1AR1C 3U36B 1DBAL 4RGOH 2R9HC 1OQXA 3FOLB 4U7SA 5BZWA 2VDOH 4YNYB 5CUSH 1UVQB 5D7JB 1I9JL 2NX5A 1FO0L 2VH5L 5F9WC 1ZWIA 1DQQA 2XTJC 1YQ2A 2FZ3B 3CFKB 5C7XH 1FNFA 3NABH 5C0FB 1XF4A 4L4VB 2AJ3B 3SE9L 5JW4Q 4Z8FH 4M93C 1QHOA 1QTYT 5E6ID 4K7PX 2J8UF 4TQEH 5EBMB 3T08A 4PJ5A 4RGNB 4N0UE 2QHRH 4F58H 5HY9B 5EULV 3IDMA 3L3JA 3I2CH 1G6RB 4NO3A 5DVOA 1D5ZA 4AQOA 1Z9OA 5HVFB 2A73A 4QHUB 2R0LH 1UJTA 3MCLL 4ZTPH 1U8QA 1PY4A 2HLAB 4AENA 1LO3L 4JG1H 3BDBA 1Q9LA 1WEJH 4GRLB 5IK3B 1KNOB 1QOKA 2P5EB 3R06B 4EXPX 1OGAB 4IOSD 5C09A 4ZAKB 1IEBB 3UO1L 2W60B 2A9MH 1N0XL 3UTSE 2E7LA 5INCA 1DZBA 3O2VL 2P7TB 1CLYL 4BKLB 3MA7A 4P2RE 4HKXB 1J7VR 3TCLA 3MLZH 1U9KA 3GDBA 3HB3C 2D7TH 4DGYL 3BZDA 4GKZB 1RZ8A 5AAWA 2NR6D 2FZ3A 2ADJA 4MAUH 1NUNB 1YY8B 4OZFG 1A1MB 3OKDA 2QQNH 5DJYB 5B3JF 3W82A 5HYJB 2H2PC 4BYHA 2M8XA 3LV3A 2XV6B 3BKCL 5EU6E 2X7LA 3CC5B 1JWMA 2ADGA 1FLTX 4LLMB 2DRUA 3QNXB 3VXNA 3TBYA 4DOHE 3W0WE 2X09A 5A40E 3F58L 5ACMA 3LN9A 3TT1H 5ALCH 1RUMH 4YGVA 2NY0B 3ZSSA 2X4TA 1BVLB 3NPZB 2CK2A 5EC1B 4FZ8L 3WNMA 2YA1A 4JM2D 4WI4A 4X8JB 2XZAL 4XI5C 1WFOA 4QXWA 5SX5K 4L8SA 1UH4A 2VJXA 4BFIA 2BVQB 3P11H 1E4WL 3JV4A 2EDHA 1QQDB 1ROWA 2IPTH 4HT1L 1M6OA 2ZSWA 5JXAL 1Z9LA 2FLRT 1ODAA 3LQMA 3PQYB 3PNWB 2RQ8A 4R2GC 3C2AH 1A4JA 4V1DA 1H5BA 5JW4N 3KPRA 4OM0H 1BFSA 4I77H 2XG5A 1CFSA 4AEHH 4MXQD 4MCYB 4BQ9A 2BOBA 5BV7B 5B38G 4Z7QE 3EGSA 1DQMH 3SPVA 2CLVB 3RZCD 4I3RL 4LF3A 1CG9A 4M43H 5E6IC 3SO5A 4PJCA 1NCCH 1VACA 2Q1EA 4APQB 2GTZA 5GIRB 2CUIA 2OCFD 1SBSL 1DDHA 2BSSA 4U1MA 5CD5C 5HDQL 1H5BC 1X5IA 3RVVD 4ZO9A 4NUGL 2P24A 2O5YH 1RUQH 4OD2B 4KMLB 4EKXA 1EVTC 1NUGA 1TVBB 3H3BC 5CZKA 5IW1B 3QUMB 4Y1AB 3LB6C 4FFWC 5ALBH 4PJEB 3IRPX 4QHMA 3MXVH 3O3UN 1ZSDB 1FV1A 5FCUH 1FL5B 2W59A 2ZPKL 5C08A 4E42A 3MR9B 4RA3A 3RNKB 4YDIL 3D39B 4YHMH 4YX2H 4LPVA 1BHGA 3QJHA 3KYMB 1Q0XL 1NAKH 3T0ED 3UJIL 1MAMH 4P5TC 5CEXB 2B1AH 2YWYA 3OKYA 3GSOB 3OKEA 4P46D 3IDGA 5FKPA 1Z5LA 2F54B 1BBDH 3UPRB 2HTLC 4LVHC 4KMTH 1MCNA 4IHOB 2NNAB 4MSWB 4EJ1C 4NO5A 1ZV5A 1AGEB 2R29H 2IADB 3DI3B 4NKQB 3T2OA 5FM4A 2K9UA 1IARB 4NC1E 5J0BA 1WUNT 3RWFB 2D9QB 1J8KA 2ZZUT 4P99A 4XP4L 3G5VB 5GGRY 3QQ4A 3G9VA 3OKEB 5FKPB 3HPJA 4YO0B 1YN6B 5GHWL 1IZKA 5FOBA 5GXBB 4DFHA 1NSNL 3S35L 4ELMB 3X12A 3NOIA 3RVUD 5HGHA 3FT2B 1M05B 3ARPA 3GSQB 2X4PB 4UOW0 2ZKHH 4Q74A 5I76A 4ODVL 3TYFA 3GSVB 3VH8B 4OAWB 4FXLA 4RCAA 4K94H 1B4JH 2QADC 4NCC2 5KS9B 4X5WB 4WI2A 5DJCB 3MLUL 1C5DA 3IS0X 4NQED 5FCSH 1JK8A 3MBEC 1N6QL 4FQ1L 5DC9B 4POYA 4JRYA 2UZXB 3H9SE 4PTTB 4JPKH 1UM6L 1KIQA 4X6BB 4JRXD 4G8GD 5FM5O 4AYFA 2C3VB 3GO1L 3ARZA 5FO7B 4U6VL 4R7NA 4LCCB 1S9VB 5JPMA 1CD8A 4ZQKA 5BV7L 5DMYA 5DT1H 5ESQB 4NNYB 2IPKB 3NIFF 1OTTD 1N64H 2IADA 1DQTA 2EYTA 4F9LC 2CH8A 2A38A 4DVBB 3HZKB 1S8DA 2GK0B 4IRJD 2WSKA 1C5BL 5T1MA 1FGVL 4IRSB 4W4OC 4MNQA 1B0GB 1KPVA 5H94A 1CDJA 5D7KE 3IDIA 1NCDL 2F58H 3QDGD 4JHAH 4P46A 4PRHA 4G8FA 4A6YA 2ZSVA 1KLGB 4MA7H 1DQQB 1GXEA 5F3HA 1EJOH 4X6DB 1IGTA 1A14L 4WENB 2VDMH 4KQ4H 5J9PB 1IVLA 4ZDHA 4GW5A 2J7LA 5C07E 4LCWE 5DEGA 2OI9B 2YPKA 3CXDL 2DM4A 4NN6C 4LEOA 1OOAA 1CICC 5CJQH 3CSBA 5B21A 1OAQL 1K6QH 3OR6A 2NY3D 4OLEA 1ZXQA 1QFWI 3HE7C 2Q3ZA 2EXYC 2AJZB 4WCYH 4B0MM 5JORB 1D5XB 5C9KA 3H7LA 3T77A 2NY6B 2J8OA 4U7MA 1A7RH 35C8H 4AMKL 2OXGA 3TPUB 3S97C 5EORL 4HBCH 2EDDA 1NJ9B 5J6HA 1Q9OB 2P49B 5EOQL 3BZ4A 3EYUL 2CLZB 3S37X 2VQTA 5TQ2L 5FB8B 1I7ZA 3GK8H 1N6QH 3IF1B 2VXSH 2G60H 3O3BA 5HI4C 5FECA 1WQVT 1B2WL 3JTTB 4D2NA 4PJHB 2R23B 1UKTA 1PKQA 1Z3GH 5HYSB 3BQUA 1T5XA 3TZVC 4LLUA 1XIWC 4XP6H 5MI0C 2EH8L 2UZIL 4U1GB 2C4FT 4Q9QH 3UROR 3MOAL 3BH8A 2NTSP 2ORBH 1MRDH 4KVCH 2F53B 3LHPL 4ZS7H 2MCPH 4IMLB 1T22B 3STBA 3WIFA 1MVUA 1ORSA 1HILB 5FK9B 1N0LA 4Z7UA 1JNLL 3FO1A 1HZHH 4XAWL 1QFWH 2DI9A 5CBAA 2MSPA 4PJIB 5DQJB 3UYOD 1DBJH 3QEHB 2DB8A 2KH2B 1YPZE 4KHTL 1Z0MA 2ICCA 1AQDB 4HUUB 4XH2B 3MUGB 4BQCA 4MXVE 2R29L 2W0FA 1NCWL 4KXZI 5I15L 4L1DA 1KG0B 4L3CB 1TCMA 3I6KB 3E8UH 1W72L 3PXJA 1KJVB 3E0GA 4QTIH 3OR7A 4F57H 1J8HD 3Q3GA 43C9A 3STZA 3VXTB 1GH7A 3KDMA 1UWGH 4QRSB 1H8OA 3NPSB 4LRIA 1KEML 4YDIH 3LIZH 3PQYE 1VEMA 2V2TB 1X5YA 5C07D 4AT6A 5LVEA 2E6QA 2ADFH 2DS4A 3CMOH 3HMXL 1S9KC 3C6LA 3M07A 4PTTA 3DUSB 2OL3L 2XZCH 3T0EA 1I7RA 3PP3H 4YFLI 3L3GA 5E08H 1MJJA 3LH2H 1S9VA 5JPMB 4G80B 5DK0B 2C1OB 5EBLB 3QUXB 3QUZA 3VH8G 3RUGF 3LS5H 4NQEB 4YXLH 2JIXB 3MX0A 3TH4T 1G7IA 4KTYA 4OD1H 1B2WH 1FNLA 1HI6A 2NYYC 1KT2B 2WBJC 3ULVF 1XGQB 5GJSH 3S37L 1DQML 4MXWH 5EU6B 1E28B 2YK1H 4HS6B 1QFUH 5HJ3A 1T4KA 4UUJB 3MMEB 1NGPL 4P46C 5I17A 1OAZL 5F8RC 4HPOL 4GXVH 4EI6B 1Y6NR 5D1ZA 1TCRB 4PY8I 1I9RL 1XGUB 1NFIA 4ODTL 4D9RD 5IROA 4ZFGH 5JXAH 5IFHH 2OTUB 1UM4H 5EBWA 2UV3A 3H9ZA 5CJBA 3HAEB 2DLGA 1AGFB 2ICWA 2VDQL 4G7YH 2CMRL 1E4WH 2JB6A 3IU4L 1Z5LB 1G1YA 3JWDC 1KJ2A 3X11A 3CFIC 3HZMB 1NMAL 2D31B 3IAQA 4QOKD 2PW2A 3WO4B 1L6ZA 3V5HB 1RUML 5AAMA 5C2BH 5CZVL 4LCIL 4KRPD 1U8KA 1SEBA 5FFLA 1SYSA 4FQQB 5MENE 1QRNE 4LHJB 2H26B 3TWCL 4XPHL 3IFOB 1JVKA 1MCDA 3D39D 4B7LA 1IAII 1A7QL 4JPWH 4GBXD 3RJDA 5CD3B 4WDIA 1U8JB 5EUOA 3V6ZB 4UT7H 5HYJE 1U3HB 1MHCB 2J4WL 4GMSL 5E2TL 2P5ED 3RY4A 5IFHL 2IWGA 1MWAL 2PW1B 3PWVA 1RAMA 1J86A 1CGYA 3B5HA 1KJ3H 3ILQD 5AD0B 4DWHA 2EDEA 5EC2A 4PJDE 2XTLA 2VZOA 4AL8L 4G8IA 3CSYA 2WUBH 5L2KE 1T21A 5GGRA 1VGEL 3QCTL 2PTTA 3BGFB 1IGFH 1RHFA 1EAPB 4XCFL 1UGNA 5ESAA 5D9SA 1KEGH 2P44B 4HIEA 2YK1L 4IOFD 1GZPB 2IALB 3SKMB 1A3RL 3ESUF 4PTUA 4BH8B 2APBA 2Q6WB 1T04B 5GS1C 3QFDB 1C7TA 4KJWD 4XI5D 4NOFA 4GRWF 5BXFB 4RX4D 4J8RB 2AS5M 5BRZE 1UB6A 1YPZB 1GIGH 5HGDB 1G7QB 1JPGB 1RMFH 3FRPG 3LN4A 4Z7WF 4FFYH 1A3LH 2YBRA 3PG2A 1U8OA 1IGJA 3RGVA 1LO3H 2WIIA 3MRLB 1ETZA 3BP4A 1FZJA 4HJ0D 5F7UA 3DO7A 1Q8MA 4ZUTB 3BUYB 1KIRA 3MFFA 1QPXA 4E0RB 1IC4L 3TNNA 4N8CL 4BFBD 5E8OA 3EYOB 1GC1L 4PUBL 5EOCJ 3O81A 1CDYA 2DQJH 3QUYC 4WW2F 4LMQE 5I1DB 2B39A 1AD9A 2NW3B 15C8L 2VR4A 1RFDH 4Y19B 3LD8B 1B6DA 2B1HL 5HDLA 5INDA 1GGBH 4DKDC 3L3HA 4Q9RL 1MHPL 4NRZB 2B1AL 2ZCKL 2YUWA 2CDFB 2PO6D 4FN0A 1AXIB 4DGIH 3CFDB 4OZIB 5C0ND 1S3KH 3H0TB 3ME0A 2PXYB 2R1WB 5D2NE 2HTLD 2DQHL 4I4WB 3WIHL 3X3GH 4G9FE 1B0GA 2Z31C 4LVNB 5EA0H 2CXGA 4S1QL 2VZVA 2XT1B 1I3GL 4MJ2A 5I8KL 1LE5B 2ZCLH 3QT2A 4BH7B 4HAFA 4JFPB 1BECA 5BS0E 2YD2A 3NZ8B 3RTQD 3NCYP 2MCPL 3H9HA 4I3GA 4F7EB 4XXDA 2DQUL 5ANME 1OL0A 2EH8H 1RURL 4LRNL 4Z9KB 2CGRH 4PG2C 3T0DA 5IHZB 3RPIB 1U8HA 1A6VH 3DVNA 3IDNB 1L4IA 5IFJB 5F6HJ 3AREB 3L3KA 3VFOA 2PW1A 1BZQK 4RMVA 4F2MA 4XGZB 4M6ML 3GK8L 1M71B 1I85C 1LO5A 1OT1A 2EDXA 3LRSB 3CUPB 1OAUL 1ORSB 2AABL 5D1XB 3CDGA 3EYUH 3MJ6A 4RFNC 4HUXB 2GI7A 3BHBA 4R7NB 1OSZA 3CCHB 2H8PA 4QRRA 2E3VA 1IEAA 1SVZA 3DVNB 2GSGB 4NZRL 3MLRH 4KZDL 3QHFH 1C1EH 1I7TA 5EU5A 1RZGA 3ZKXC 4N0FA 5C0EB 3I75A 2DM3A 4TOYL 1VPOL 4M7LL 4L5FL 3DXAD 1A7OL 4Y1AE 1F4XL 2BX5A 5I30H 1QO3A 5EDXA 4KRPB 2WBJA 4FZ8H 4Y19D 2I07B 2VDML 4HG4K 1KPUA 5HXMA 1H5BB 1QSFE 1JHKH 1NAML 4OTXL 2P5EE 5ALCL 2D4FA 1IGCL 4L29A 1U91A 4XVJH 3DMMC 3EYFB 5I16A 1AGCA 1MAKA 3BP7A 2XN9E 2YD3A 3MRPB 5HD8D 1DVFC 2PYFA 4YH6A 2YKLH 4J2XA 1EH9A 3O3AA 5D96C 3L7EB 4J12A 3S7GA 1RVFL 2QQNL 4QHNB 1YYLL 1OSPL 5E2JA 3RWEA 2ZP0T 1T7YA 5MEPB 5E4EC 3AU1B 3UJJH 3WXVH 3MOBH 3T4AA 4UV7L 2OTWA 3V95A 5B39A 5ICYA 3P2TA 4RGMC 2X70A 3R0NA 1G9NH 4GG6E 5LCVH 4ZFFA 1P2CB 1P5VA 2FL5B 4R7DB 5ERWB 4Y5XA 5HGBB 3IDJB 5SWSA 5FOBB 2XKNB 3D39A 3DSNA 4QKXB 4DZ8A 3SKNB 1ZA3A 4URTB 2DTSA 4ZODA 2LU7A 4WWKB 5CSZB 5IB4A 1LEIB 4N8VB 4CW1A 3QFJA 5FYKD 1J88A 3B2VH 1YMHA 4U3CA 1AQKL 4BSVB 3K80A 3AUVA 3MA7B 2K3TA 3T04D 3T65A 3BDYH 3SE8H 1J9CT 3F7PC 2A74B 4ODHL 4PB0L 5HHOA 2DJSA 3H3PH 3V0VA 4WO4D 4QY8B 1YEDA 4UMGA 3TYGH 2Y07L 4F7PA 4XVSH 2DQIH 3G5XA 2F53D 4LLWB 1BQLL 1QRNA 4CW1B 4Y5VB 1Z9MA 43CAA 2G75A 1VERA 4LSVL 4OLZL 3HRZB 1IGIH 3ARGC 1D9KB 1PEWA 1K4DA 3MRJA 2R4RH 5D6DA 1M05A 5EOCH 4X6CF 3BOVA 4L8BA 4WHTA 5M95B 3HE6C 2R56H 3ECBB 1I4FA 4MZ2A 3QIBC 1HHIB 2XY1A 2PETA 5DMKA 2NTFA 3RU8H 5JOFB 3MCKB 3U0PB 1L9NA 4Q6IA 2QL1A 1T89A 3TNMA 3MSPA 4OCXH 2EE3A 4MJIE 4N0CD 3S36X 3WUWA 3BXNB 1I7UA 4HMCA 4JFFD 1J8HA 4S1DC 1G9NC 1NLBL 1MCLA 3EKCA 4Y8AA 5EZOL 3EFFB 4L4TA 4RAUB 5EFIB 4LASL 2IMMA 5GQBA 2VMFA 1MCJA 3CLFL 2V5YA 2VRAA 1C7SA 2BNUA 2IQ9L 5F3BB 1EBPA 3MRGA 3T0BA 3QDJD 3MRNA 1WJ3A 2EEDA 1P1ZA 4Z7VA 4K7FA 1T1ZB 3F7RA 5HDQH 4S10A 3B4NA 2GTWB 4V1DB 2Q8BH 3MV7D 4CN6A 4NQXA 4WFGE 3TZVD 4ZYKB 2VTFA 5IEHA 1MREL 1NMCB 1NCAL 3TT3H 3MV9E 5IBUB 3D85A 2IJ0C 3ZT7A 1DSFL 2QJDA 1YYML 5I8CA 1XR8A 5D72H 4KRNA 2DQEH 3SDXF 3NGBC 5E2UH 1NBQA 3KLHD 4LARH 3FO9A 2Z35B 2E7CA 1MWAA 4R4FL 3P77A 1YMHB 1QRKA 4QRQA 4HWZA 2Y23A 2W38A 1EEZA 1QLEH 1I1RA 3QSKB 5I19L 2PF6A 5JA9A 3FB8A 1RD6A 1T5XB 3GSNB 2HVKA 4HUWB 4QYOB 2XPGB 1MF2L 2FSEB 4FQCL 1RZKH 3MRQA 3NFNA 3SO3C 2VDKH 4AZ8A 1HOCA 4M7JH 4ESKA 3SKOB 4G8GB 5F9JA 4RBPK 4KV5E 5DUPH 4R4BA 5BOZG 1RUPL 2XZAH 1RZIB 3L9RA 5ID1B 4FZEL 1S7VA 4D9LH 3WYRA 4QYOA 3BWAB 4NC0B 3W2DH 2ZOLB 5CGMA 1NBZB 5D2NB 3UBXB 3TT1L 1OP3H 1QLEL 4IRSD 4NFCA 5HD8C 2FB4L 1R6VA 3PWNA 1YJDH 3STLA 4QT5A 3HKFA 3TESA 2QEJA 2BNRD 3OR7B 1EO8L 4LBEB 1K9TA 3OJDA 3BFOA 4GKSB 1I3UA 1J5OH 2XZZA 3GJFH 1CXLA 4D0DB 4MAUL 1JTPA 5H35A 4ZTOL 4WEBH 4W70A 4XWGH 4DGYH 4XX1G 5E2WL 3BSZL 1MJUH 1ZVHA 4PLOB 3MRNB 3H7BB 4YDKH 5ICZB 4UIKL 3UTTD 5DZLA 3FT2A 1ZTXH 1CD0A 4LKXB 3EO0B 3LN5B 2VN4A 3RUGA 3AAZA 4GLRH 1HSBB 1MLBA 4P5TD 2Y36L 3SDCC 5C08E 1EDQA 2LVEA 4P4RB 3FB5A 2PCPB 1KELL 3AB0C 2DBJA 2LAGB 3ULUD 1QPPA 4JR9H 3B3IB 1I1AB 4KXZH 4O02L 4CMHC 4JN1L 3VXNB 5HI4D 4XNXL 5HHVH 3VG0L 3G5ZA 2DIBA 1QFWM 5C0JA 3VFWA 3VXUD 3MFFB 3D25A 4M8QB 1BJMA 2GW5A 3SEPA 4R96A 1I85A 1KJMB 3BW9B 3KWWA 2C1PA 1NCBL 4PRAA 4YPGA 2AK4D 2MCG1 3LQZB 5H37H 5IFJA 4XPAH 4GW1A 1KB5A 2X05A 4OFYA 5T1KB 3EYSH 2ZJSH 3KLSA 4Y4HD 5D1XD 3GMPB 3VD5A 1KFAL 4OZFB 2RFXA 1W72A 2DQTL 1RUAL 4EVNA 1N26A 4PG2A 2ZJSL 5J11C 3HZKA 2V7HB 3TYGL 5F7YC 2VR5A 3DRQA 4N5ED 4QXUL 3MUJA 3O4LA 5E00B 1A6WL 1D5ZB 1FE8L 4U2ZA 4MX7A 2ZWLT 3RVTC 2FECI 4CNIB 1JGEA 1A4JB 5DTFB 4EI5B 4S0SD 5DEFA 5DR5L 5DLMH 2L7UA 4LOUC 2ICEA 1OTUD 5DHVH 3B9KC 3RWGB 3GM0A 2QSCH 1CGWA 1V3MA 4PFEA 1BOGA 1PDKA 4G9DA 5E9DB 5IB5B 2DF3A 1JMXA 4HWBH 4MCZB 3K2MC 4P5KB 5DD6A 4UTAH 1KTKE 4FG6D 3DOSA 3QXWA 3QIUC 2DL2A 4WDIB 3EO1B 5SWZE 3OPZH 5SWZA 5DFVC 3CVHB 3Q5OA 4GKNB 3HG1D 4TRPL 2F19H 3GSUB 3H2WA 4JDVB 4UAOB 3QFJE 1FYTE 3HAEA 3BSZH 1AI1H 4ZXBC 1MQ8A 3MOBL 1F8TH 2VUYA 5IJKA 3EDFA 4E41E 4PREB 3RZCB 3LKSA 3KS0J 4QXTB 3MTRA 2EDQA 4MNQE 2BHZA 4PJBF 5IVZA 1QKZH 4CADA 3QZWA 3ARXA 1CS6A 4K3GA 3CX2A 2X1WL 4KDTC 4JE4B 1OCWH 1XGRA 5K9QI 3LQAL 3D0VA 4JFEA 2X4TB 2VLRE 3QXVA 5GGVY 3F5WB 4EI5C 3QULB 3RVUC 5DJZA 4I2XB 1INEL 3KXFE 4MS8D 4XMPL 1WBZA 4U1KA 4ISVA 3OJVC 3DWTA 3GBNH 4ZOAA 3U7WH 2HG5A 3NCFB 5IVXA 5GGTL 4M7LH 5B4MD 4JLRA 3HNSH 2O5ZL 3MV8B 3WXWH 2Q7NA 4TSBH 1OWWA 1MIMH 4GH7B 1HCVA 2UY6A 2FATL 3VG9C 3LEYL 4JDTL 4LU5L 3I6GB 4FQCH 1YY9D 5EWIL 4FA8A 1XF2A 1DUZB 3TH3T 4G8EB 4NWTL 4NRZA 5CJ8A 2DBLH 4M1CD 4P4KB 3V7MA 5E2UL 1K4DB 5KVMC 4XXCC 5DVMA 3PE9A 5IGXL 2OTWB 1LQSR 3DBXB 4F15C 3FQWB 1NGQH 2XA8L 3N85L 2NQCA 2FX9L 1UWEH 3KPSA 1NGYA 2ZNXA 4QRUB 5IK3A 4R96B 3AS2A 2ZOKA 4YHIA 1UEMA 3C6SA 5C07B 4JFPA 1U41A 1KXQE 3ZDXF 3ES6B 4JHZA 3B9AA 5EA0L 1OGAD 4X9FA 4LQ1A 4PLKD 4IDJL 1WVZA 2QSVA 4G9FD 3SGJA 3TA3A 3WIHH 1X7QA 3BYTA 1JPST 3TV3L 1MCWM 2X89A 1PKOA 5TH2B 1M7XA 2UY7A 2CDFA 3CK0H 4PJHF 1I3RB 3O2WH 3B5TA 4P46B 2I5YH 3VFSB 4IJ3C 5ILTL 5TDPA 5SWQA 3WIIH 1FCGA 3IU3B 5C0CA 5E94A 3D18B 4R4NC 4NPYB 1CGTA 4KHXH 1QA9B 4JY6B 2CK0L 1MCOL 5K59E 5C0GB 2DQJL 2GJZA 4DK3A 2V7NB 3CC5A 5DRZA 5AG9A 2C7UB 1RJZB 4WW2C 3X17A 1PZ5B 4EI5D 2AEIT 5DQ9A 2Y07H 4C55A 4R97B 5I6XC 3ZTJG 3BDXA 1H15A 3O8XD 1NFDA 4QNPE 4X9BA 2D0GA 4OB5H 4UUJA 1MFAL 1BJ1H 2ID5A 3QQ9D 4R26H 2EXWD 1U8KB 3KPMA 4MD0A 3CJJA 2Z4QA 2FNBA 2HT4C 4OLWL 4BFEA 3Q48A 2IAMA 4U6HB 4OAWA 3PF2A 4Y4KC 4ZO8A 5BJTB 4D0DA 4DEPC 1MHEA 4OGXH 5F7WC 4S2SA 2H9GA 2VXVH 3ARDD 4JVUA 4LCYB 2X7LB 3NCJH 3RL1B 4M1CC 4P3DB 2Z31A 3RNQB 4BUGA 3EO9H 2R2EB 3MLVL 1HINH 1ZGLA 4WEUD 3D0VB 5D8JL 3HHRB 1JNHA 2R1YA 4FTVD 1Q9LB 4GRLA 4XWOD 3X3FH 1OPGL 1JZ7A 4UV7H 2APWA 2OJZL 3BKYH 1F3DJ 4JO2H 5E56A 5GRJH 4XHJD 5CBAB 4FQPA 4AY0A 5T5FH 3DX6B 1S9WB 1VFMA 5IQ9A 1FLRH 4GMSH 2J2ZA 4P3CL 3BUTA 2AXJA 1JBJA 4NHCH 3IFOA 4GW4B 4S1RL 5INCB 1VKXA 3RA7L 3VCLB 1HXYA 1EGJA 4PRPD 3KPSB 4YDVB 1ZE3C 1QACA 4XRCA 1TETH 3WLBB 1FSKB 3DVFA 1XIWA 5HVWA 3PIQA 1KJ2H 3QP3A 1NAMH 2C3VA 1CDIA 3HA0A 4Y7MA 2Y06H 4YHLH 4P4KA 2BOBB 4ELMF 5D2LB 2P45B 4QOKB 4J3XA 2ATKB 5KZCD 4KKCD 1ZHBA 4WI8A 2Y1VA 4OUUA 1O7SA 2XKUA 4N0YL 2X1OA 3TIEB 4XZUA 2F5BL 3MRDA 4NRYA 1UM4L 3GKWH 5GGVH 4YHYB 1A9EB 1KCKA 3H3KA 5JORA 4NCC1 5DEFB 4LLVA 1KCVL 1T66D 2DLIA 2P8PA 2BZDA 1W8OA 2AKRB 5T3XE 1A6PA 1ZT1A 5DJ2B 3X13B 4LSTH 2NNAA 3FHAA 4TSCH 2ED7A 4RWYL 1PSKH 1NEZG 4BZYA 4JZOA 4K55A 4DAGL 1V7MH 1QFUL 5I1GL 4UBDD 1CL7I 5KG9B 1G7IB 5EH1A 5HHXL 3QIUD 1DQDL 1FYHB 1IAOB 5I66B 2EDTA 3K1KC 5FXCH 1E0OB 2Q76A 1FC2D 3SJVA 3SJVE 3PNWA 4Q58C 4M4RA 4XVUD 3LH2L 3OMZA 1KENH 4IDJH 1ZANH 2J8HA 4OGAD 1FL3A 4Z7UB 4M5ZL 1T22A 4YXHH 4KI1A 1P4LB 4S1QH 2BVTA 4NWUL 1ZANL 4RRPG 3RVWD 3DX7A 5BCAA 3X3GL 3SJVB 4ZUSB 1ZLVH 3U82B 4IRJB 5IM7A 1BFVH 5IGXH 4U6YA 4CVUA 5A3ID 4NO2B 3EYVA 1ZGLB 1AD0B 1WTLA 2GYSA 4OCSH 3MRIB 3LPGA 1SJEA 5J89A 3O8XA 5ACZA 5C8JA 1NMCC 1LVEA 1JPSL 2GK2A 3RAJH 4DGIL 3RGVD 1ED3A 2BVYA 4NUJB 4PRAB 2ZCKH 4YPGB 2VAAB 3UYRL 4XNYL 3OXRA 3SGKC 2B1HH 3TO4A 3VGBA 5C09B 5C0DA 2KPNA 5IIEB 4KVNH 4LSQH 5IMKA 4P9HL 4YDJB 2Q7YA 2VO5A 3OSKA 2Q8AH 3VH8A 4U6YB 2E27L 4HLJA 1T20B 4J6RH 4C56E 1N2RA 1FVCB 5DRXB 3NGBB 1CTNA 3HPLA 1BIIA 5F70A 3BT2H 2F5BH 1VGKA 3PDDA 5IW6A 3G6DL 2X4RA 4I0PA 5D5ME 1AGDB 4NJ9H 5D1QD 3JSSA 3U7WL 3SQOL 1XF2B 1M71A 2WINA 3QB7C 4XMPH 4WW1B 3RY6A 2ORBL 4KVCL 3MOAH 3MOQA 1SVCP 2VC2L 2QADB 4EDXA 1IEBA 5TPWL 1PGRB 1S7VB 1RMFL 2JIXA 4JFDE 2EDJA 1EHXA 3QUXA 2CPCA 4WIQA 3FQUB 5H2BA 5HYIA 2OZ4A 2QQKL 5GRWA 3DO3A 2N7BA 4P2OA 2R0ZH 4OKDA 5IV2A 3MJ9L 3QZWG 4YNYA 2ED9A 1IKNA 3MJ8A 4FQHA 5CEYB 3N9GL 5K9OA 3K74B 4NHCL 4OBRA 4NO3B 3ZZ1A 2FJHB 4KKLC 4AIOA 1D6VL 3KPQA 4WV1B 3UAJC 1NANI 5EC1A 2L0DA 1OT2A 2XQBH 2DDQL 3OKDB 3SKJL 5GS0H 5DI8A 3E2HC 4EI6A 2WLZA 4JQIH 2Z93B 3F6LA 2YPLD 4V1DE 3VDBA 4TUKL 1IQDB 1CU4H 1KIPA 4U1LB 3V5DB 1AGEA 3R8QA 3OR6B 1K6QL 1OAQH 1RHHA 3ZE0E 5DUML 4LEOB 4QHLB 2HFGL 3MV8E 3NCJL 3NCYS 1WV7T 3AVEA 3BKMH 1T6VN 1YA5A 3S36H 3QDGA 5JDSB 5JIPA 3KNBB 5AZEH 2VITB 3V5KB 2V2WB 4PGDB 3F5WA 5MEPA 1FZKA 5D7KD 4PJXF 1NCDH 5EBGA 4LF3B 3OJDB 4KKCC 3QEHA 1XF5B 5F21B 4NKDA 3IDXH 3PP4H 4BA8A 3GUTA 1U8MB 4YUEH 5DJ6A 4KROB 3QISA 4K23H 1H3XA 4LSRH 5E4IA 2NY6C 4ONOA 2J8UA 3MJGX 3C2SA 3GM8A 2GJJA 4JRXA 3WHE0 4ORZC 1WLHA 2AW2A 2DQTH 3RWCA 1INQA 2K7PA 1X4ZA 2MHAA 1KTRL 1U8OB 1ZLVK 5TDOA 1AE6H 2CK0H 3STZB 5ECJE 1YY9C 3DYMA 1QSFD 5DD5H 1S7RB 2OL3B 2JLLA 3ZE2F 1U0QA 2XRAH 2VQUA 5EUOF 5KSBE 2P5WE 3GHBH 4N5UA 3TN0B 2FEDD 4XPFL 1A6ZB 5KSVA 3MLSL 4MQ7A 3L6FB 4JFXB 5AEAA 1T7XA 4P2QD 3TPUA 2HN7A 4ODVH 1YEEH 1MEXH 5E1AA 1KELH 3SDXB 1IQWL 4NHUB 4G6FB 1EMTH 4PJEA 3BUYA 1AO7B 3JVGA 4RSVA 2EYSB 4X6EA 3V4VH 5K59F 3ECBA 2NR6C 4XHQA 4ZOEA 4EN3B 4WI3A 3V8OA 5ID0B 1UWEL 1MJUL 3FMGL 2DJUA 4O2FA 4XWGL 5HYSA 4C56B 1MJ7L 5D7IE 4G6JH 1E4XH 1KN2L 3MNWA 4NN7B 4U1SB 1AJ7L 1D7FA 4QTIL 4MQSB 1UZ6E 2J6EA 3MO1B 4O2CA 5T5NF 4XPBH 3HR6A 5A16A 2R69H 4CVXA 5D7LE 4PRDA 2AEQH 5BV7C 3UTTA 1HDMA 4QRTB 4Q9BA 3MR9A 4GRLC 5HI5D 4KHTH 5FA3B 5KSUB 5IMLA 4HW6A 1DBJL 4IMKA 1FNGA 2D0HA 3C5JB 4KK5C 3W11D 4PRHD 2JK5B 1PJ9A 1UA6L 4AEIL 3MV8A 1OD9A 2X4SA 1TQCC 4WFEE 3W9EA 4QRPA 1MCFA 4BSJA 4WNQB 4ODXA 4MA1B 1BFTA 4WHCA 2KZ1B 3NIGF 4XZUB 5B8CB 1I1CA 5DD0H 4X7DC 4KJPD 2HT4D 3B8YA 2VE6B 1JGDA 4G6KL 1CTOA 4G8GA 4FFZL 1DVFA 1V05A 1LDPH 1N4XH 3GGWA 4BSVA 1ZLWK 2AEWA 2AKRA 1EHNA 4P0DA 3BPLC 1FN4A 4ZQKB 4HBCL 4EBQH 4OZHF 1I1AD 2FHCA 5FUZL 3KHOA 4LSUL 1FFPA 4RFNB 2X9YA 4ZD3L 3E6HA 3TIDA 1NBZA 1TQBB 3OKKB 5D2NA 3UBXA 3WFEL 4Y16A 4YGAB 1T83A 5L8KB 2VLME 1FYTD 5J56B 3WO4C 4PJGB 5ERWA 3A6OA 1OTSD 3HN3A 5D5MF 5H94B 3UXFA 2X4NA 3BJLA 3OKLA 1BVLA 1UXWA 2OQJA 1UB5B 3O41A 5F1IA 1OP5H 4F15B 2QLVB 4UTAL 3ROOB 1JTTA 2ITDA 5DRNA 5BVJB 1PBYA 2VDLH 3QUMH 5EB9A 4NQVB 1ADQA 1AHWA 4U6XB 5TH2A 5KVEH 3LMJL 2QSCL 2JTDA 4KMQA 1G7PB 2MKWA 3VFVB 2H8PB 2CR6A 2AEPL 5I1CH 3FB7B 3QO1B 3F65A 3OKNB 3KPSE 4PJGF 1MI5B 1C5BH 2EIEA 3FN3A 2FBOJ 4NM4L 1CBVH 4HX1A 4PD4K 4CVZB 4B50A 5KSUA 3C6LC 4IJ3B 5CJXA 4GJTB 1IM9D 5E95B 4C83A 4LSVH 1NDGA 4WWID 1R3IL 2DLFH 3L5WA 3KLDA 1HYRC 4XVSL 1JHLL 4P2QE 2F8XC 3A67H 3HC0B 1EO5A 3U48A 3BGMA 5DXWA 2O61A 3IKCA 4PB0H 5E8PB 1NFDB 1H15B 2E5EA 3WLWC 3GSRA 2GSIB 2AV7A 2CLRA 1EUTA 1KJMA 3KWWB 4IMKC 4I8DA 3TGXA 4LAQL 4MAYA 3P4NB 3RIFF 5LKNA 5MI0B 4G6FD 4O02H 5F97E 3QDAA 1MFCL 4JR9L 4LLYA 5IR1A 5FGRA 1I9IL 2VLRB 4V2CB 2Z93A 4MMZC 2NYYD 1MFBH 4ERSH 2Q20A 3VD3A 5GJTH 1UWXK 2NTFB 4M3JA 4O2CB 5CP7A 4GRWH 2YPKB 3FFCE 3FFCA 3HI6H 4XCYB 5BVPH 3QXDA 3QQ3A 1EVUA 3IFLH 5EU3A 2DLFL 5HHOD 3KLAA 3RI5K 4X4ZA 1JNHB 3BO8A 4DZ8B 2NX5D 4EIZC 4PGDA 3FTGB 3LEXA 4TUOB 2G75B 5EZIH 1F2QA 2ITDB 1YYLH 1S7XB 1J5OL 3L3GB 5ENWA 4NYLA 5FO9A 5K93A 2NY2B 1CBVL 2NXYD 4JANB 3RGVC 4G7VL 4H8WL 3SDDD 4U1LA 4Q0XH 5DHYA 4HUNB 4JFZL 4NM8H 3DJ9A 1NC4B 2Z91B 4WGVB 4KTEL 1CZ8H 1MQKH 3RBSA 4U0RC 4ZUWB 1D6EB 2VLLB 2Y5EA 2JJTA 5TF1H 5TJWK 5DJDA 1AGBA 1ZHLB 2MKLC 5D1QA 1QLFB 3L3HB 2A6KA 1X5HA 4L5FH 3O6KL 5EO9B 2YC1B 3NCEB 3QO0A 4BK5A 1QFHA 2AVGA 4X6CE 5I16B 1D5MB 2YXFA 2F15A 3DROA 4TVSa 5L0QC 1RZKL 1EGJL 4PJ9C 1A9BB 3L5XL 4K3DH 3MLRL 4KZDH 5BMFL 3HS0B 4HUUA 3DX8B 6CGTA 5AZ2H 5FUZH 5SWSD 3TNNB 4X0KA 5M7QA 4HEPG 3AXLB 4JQVA 4RFEB 1KNOA 5ICXA 4NJAH 5E5UB 4QHKI 1A6UL 3G6JE 3OKLB 4M43L 4O51A 1XZ0A 1OAUH 5KOVC 2ESVD 2GFBB 5IMMA 1BREA 2NY7H 4KU1A 2HFEA 4UBDC 4OLUL 1NBYA 4WU5A 4P5MB 4HLZG 1QSED 5IHUH 5DI8B 3E6FB 3QG6B 4B7IA 1FORL 4OF8A 1QR1A 4R3SB 3VFVA 3U7YH 3EYFA 4KPHH 3CZJA 5ICXB 4YLQT 3C9NB 3O9WA 5FUOH 4NQXB 4QRRE 3VU2A 1FZMB 1KACB 3VXRB 2UWEF 1U8PB 4HS8H 1TNMA 2DWDB 4LPUA 4YDLB 4Y4FA 2DKUA 5JO5B 2YPLB 4G8IB 5JW3H 5IROC 5SX4H 3AU1A 4MJIB 5AWNH 1T1WB 4JY5H 3Q5TA 1J18A 3PHQB 1F6AB 5JPNB 3QA3B 4G3YH 1D5XA 5JUEH 2ADIA 3PGDA 3ULVL 3RU8L 3K4DA 4HSQA 3VXMD 1NC4A 3V79C 3B9VA 5GGUB 5GS3A 1GGBL 4J3UA 1P7KB 1PG7W 4N5EC 2ARJB 2BRQA 4M4PA 4L3EA 5KSAD 4GKOA 1IGTB 3UZVB 3V4PH 5FV1L 1EFXB 5DWUH 1OAXH 2Q7YB 4MJ6A 4YFLF 5DGQA 5D7IB 3ETBF 5D1QC 3IYLW 2D03H 1EFXD 2D7TL 1N5YH 3SJVD 3FN9A 1EHLH 2NY3B 1DUYA 2APVA 3V0VB 3H3PL 1PEZA 3MREB 2ZUTA 3IETB 2BERA 1NMBH 3O6ML 5GJTL 3WHXA 1AD9B 1HQRA 4U05A 2BVOB 1GL4B 2VL4A 3DTXA 2GUOB 4QF1B 5A2JH 4JQXC 3VXQA 1GOHA 1NGWB 4DVRL 2H6PA 1AP2B 2EH7H 3BPNC 3MLSH 1K3ZA 3O3EA 3W9EB 1U42A 1QHPA 3ALPA 4JGUA 2R0LL 2CKBH 1I4FB 1SY6L 1CFQB 3K3QA 1P2CA 3VFWB 4OD2A 3O8XC 4XCCH 4FHBD 1EHLL 3DVIA 3ARED 3U83A 3OJ2C 5ANMA 1N5YL 4LLUB 3QHTC 1JHLH 3MRKB 4D8PB 1CICD 1YNTA 2WP3T 5DUBA 2CDEA 3WXVL 3B8SA 2XIDA 5I1KH 3SE4C 4HXAH 1M7IA 3VGAC 1SM3L 2A9NL 1UM5L 3EO1A 4JKPH 3BZEA 3ZYZA 3F12A 3IAPA 4C57C 5HHOB 6FABH 2YKLL 2JJSC 2QTEA 1CIUA 3D3VE 5CUSL 4QO1A 3WNNA 2EC8A 3IDXL 3PP4L 5JUEL 4CVZA 1NBVL 4HH9A 3MLYH 2HLFC 1CYGA 2VDRH 4RGOL 3AM8C 5HTSA 5FDWB 5CFHA 5KVEL 5KAQG 1K8IB 1UADC 5GGTA 4PJIE 1OB1B 2D3VA 2HRLA 3GJEA 5FHAL 2BVOA 4I18A 3UTZB 1FVEA 1JHKL 2V5TA 3A6CH 4FTVB 1MRFL 3WS3B 1YJDC 3D69A 3WJJC 3F12B 5AYUL 1P4IH 3GUTB 4ZPTB 1J0IA 2AV1B 3D3VB 4NKDB 3I3DA 2FYYA 3T0XA 3F6IA 1H3PL 4XPGL 4TOYH 5ABDE 3VFMB 3MBED 4ZFGL 1QBAA 4RX4A 5D7IF 4ZNCD 1I9RH 3L7FA 2J3SA 1GOFA 2BDNH 4UAOC 3LY6A 2XQBL 5TDOB 3P0YL 4GKSA 3SDAD 3L1OH 4DUXA 3BWUC 1G9EA 4F8TA 3BP5B 5GGSA 2HA1A 3CFCH 3PJSA 1TZIA 1Z0NA 4X80H 4XMKL 1Q72H 4ZFZB 4HWEL 3BMWA 3KPNB 4I48B 2CXKA 5AZ2L 4BQ8A 1A6VL 2AXHA 3WS6C 1CL7H 4K3DL 1NGYB 1C12A 1U92B 2CLRB 4JFDA 1BF8A 2P43B 3TZVB 4U1IA 1LE9B 4HS6A 5HJ3B 4PGEA 3ARBD 2Y7QB 4XB8A 2NY5C 1BQUA 1WISA 4PV9A 4APQC 1F3JA 5BS0A 3U2SA 5I8KH 5IG7B 1CGSL 2Z8WC 3S4SB 3IVKB 3SY0A 3TYFB 1JRHH 2YPVL 3G5ZB 1WF5A 3TFKC 2VLKB 1ES0B 2GT9B 4L8CB 5E99L 4RMSA 3BPOB 1V7NH 4APQD 5E6ZA 2J5LC 1IFHH 1J12A 1QNZH 1KB5H 2MFNA 3O3AB 1I8MB 2R69L 3MREA 5EUKB 1HK6A 3C5ZA 3SKNA 3ES6A 1RY7B 1RJLA 2DN7A 1FIGH 3WL9A 1BGXH 1QBLH 1FL3B 1NL0H 3HCVB 1KCLA 3ULUH 5L2KB 2ED8A 3G9AB 3MO1A 1ZHLA 1AIFB 3GHEL 1YEGH 5DRXA 2HG5B 2GJZB 2IPUG 3D2UD 4OCSL 5IVXB 3ULVC 1WSST 3O6FA 1A9BA 4JHWH 3DGCR 3S96B 2NZ9C 4LGSB 3HUJE 4PLKC 1P7QB 1YNKH 2KUTA 5J3HC 1S8DB 1BBJB 3GRWA 4HKZB 3V7AE 4KGLA 5A2LH 3IXAA 3UJTH 1K2DB 4ZS7L 1S9XA 5KS9E 5AYQA 1MRDL 4NBXB 4OCNC 1QLRB 4LPTA 3ARSA 3KYOB 1RJZA 2G5BB 1MFCH 4H0IA 2CSPA 1V3JA 1U91B 4P59H 4OCLC 1G7HA 3ZHLA 4CRPA 2DQGL 4LNVA 5DTFA 3HG1B 4EI5A 4WY7H 3NA9H 3GHBL 5KS9F 2Q6WA 1XF3B 2R0WH 3EBAA 3VXRA 4Y4FC 5DK2B 2VXTL 2BFVL 2XRAL 5INDB 4RFEA 4PRID 1JL8A 4Z78B 5DD5L 1VGEH 3MRMB 3ZKND 3BO8B 1TVHA 3LAFA 1KJ3L 1SYVA 1A7RL 4X4MA 1MCWW 4XCNA 1MWAH 3RQ3A 3WFZA 3U36A 4RGNC 3L3IA 4GLRI 4WCYL 1HYSC 2YR3A 1IGML 2HTKD 1VKXB 3LKOB 1DBBH 4Z7VF 1AR2A 1HCFX 2MQ3A 3BQUD 4OJFH 1FHGA 2EO1A 4M8QA 4C58B 3D48R 4M03A 3ILPB 3KG5A 2IFFL 4DKEL 4HQQL 2YUZA 3JV6A 4JB9L 4YHLL 2KBGA 4PR5A 1Q94A 3MQIA 5DMIH 2HTKC 3REVB 4MNGA 5J6GB 5LGHH 1I1FB 4JFQB 3DRTA 3PWUB 1RSFA 1JZ5A 4BKLA 4F7CB 4L8BB 2QQLH 3UX9B 1VENA 1A1OB 4G7YL 1J05B 2H32B 3JWOC 1DUYB 5HGAA 1RZFH 4PRPE 4N0UB 2W9DH 3MUGA 5DT1L 2FBJH 1U3HC 2HT2C 1SJXA 1K3IA 5C6WH 4XCEA 3BXNA 5C0RH 5C6PB 4WI6A 1CICB 4IBLT 1WICA 4L4TE 3ROOA 3TN0A 2BXYA 4I0CC 1A4KB 4M7ZC 1U95A 4MXWL 1R3JA 4LPXA 4OI7A 2OR9H 5I75B 3MJ9H 2R0ZL 3DRQB 3MLUH 1IT9L 1G7PA 2OSLA 2GJ6E 3BIKA 1T2XA 5TFSH 5L6YL 4QRPE 4JKMA 4PGJA 3PIQB 2PYEE 5F6HI 5ANMB 1UZ6F 1HE7A 1QSVA 2IAND 5IMKB 5K9JL 3LPFA 4GAGL 4R26L 3VXSB 5T1KD 4H26A 4YQXL 1OARL 1O5DT 3FZUD 3I50L 5D1XA 2XNAB 4NBYB 3ULVD 5I73B 5MEOA 3RUGE 2PO6B 1E4XI 3EOYG 5DJCA 1BJ1J 1RULL 3RRQA 1ZHBB 3S88H 4DGVH 4GW4A 1BOYA 2X4RB 4GRWB 4HDIA 4PJIF 2WQRA 3RWEB 1CDUA 1YZZA 1U6AL 4QHNA 4BJLA 4RISL 2YZ1A 2CJUH 3X12B 1BD2D 5F1SA 1XGTB 2EO9A 3BMVA 1LO0H 3T2NH 4OQTL 5DUBB 2Z92A 5EO0B 5AUMA 3RDTD 3FT4B 4LHUG 4HULB 1AJ7H 5B38B 4Z18A 3UJIH 3WD5L 1MI5E 4LVOB 4JG0H 4LFHG 1E4XL 1KN2H 1XMWA 2DL9A 4X99B 1NCWH 12E8H 5FA3A 4OUOA 4QGTA 1LP9B 4PIRF 3IFPA 5C70A 5E5MB 5KJRL 3GMNB 2A2QT 4X4YA 3W39B 5FCUL 4OCWH 1QFWL 4OSUH 1U8QB 1WGOA 5B38A 1NCTA 1OP9A 4YJZL 4OV5A 1EMTL 4Z7UE 1H0DA 2JCCF 1PLGL 4BSWA 1W0YT 1I1AA 1RZ7L 5F89B 3H9SA 5ITBL 2UZIH 3O3DA 1HSAB 1EA9C 1JV5A 2H26A 3VWKB 4ZSOA 1SEBB 3A6BL 3BEWB 5HGGS 3AXLA 5JZ7C 1JF6A 4HZAA 4UDUB 1EXUB 3MJ8B 3GSXA 4DTGH 5F9OL 1BWMA 1WWWX 4Z7QF 1WAAA 3IXTA 4DAGH 3WDJA 3GI9H 1XCTB 3BN3B 3BZ4B 4XNUL 4OFYD 3PHSA 1I7ZB 4IIQB 1BJ8A 2I26N 4ZSOB 2NXZB 2UWEB 1J1PH 2NY2D 4AMKH 3CSPA 3VXUA 3UAJD 4JAMB 2VN7A 3IJSA 1RIHH 2BY0A 3WUWB 5CBEB 4I0PB 4PJ8C 2O5ZH 4C4KT 4BH8A 3IJHA 3P11L 4ALAL 3VW3L 4LLDB 1JZ3A