2HWZH

Fab fragment of humanized anti-viral antibody medi-493 (synagis tm)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
227
structure length
227
Chain Sequence
b'QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDDKKDYNPSLKSRLTISKDTSANQVVLKVTNMDPADTATYYCARSMITNWYFDVWGAGTTVTVSSASTKGPSVFPLAPSSAAAAGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin Fab light chain
publication title Identification of a single tryptophan residue as critical for binding activity in a humanized monoclonal antibody against respiratory syncytial virus
rcsb
source organism Homo sapiens, mus musculus
molecule tags Immune system
total genus 39
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2006-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hwzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hwzH01
2C4FT 1YJDC 2J1KA 5D9SA 1B0WA 5CWSB 4RFEB 3T4YA 4EI5C 1J12A 1XGYH 4O2CA 4I2XA 4APQC 1EJ6A 3FQTB 2HRPL 4LPVA 3PWNA 3F7RA 3UYRH 2VLME 3L95B 1OT1A 1B3JA 4BFBD 4U05A 1IZJA 3BPCA 2P4AB 1HH9B 2XZQH 4KHXH 4PP1C 5CINL 2NPLX 2Y25A 3TYFA 5I30H 4GG6E 2VXUH 4QRPA 4OGXH 3ZSSA 3GSNA 5GGSY 1EFXD 2I07B 4AG4L 1DQDL 4O2FA 1NGYB 4RMRA 1J8KA 3PJSA 1G9EA 2IANB 5DJYB 4FFWC 3TZVB 1LO2L 5I1AA 1WICA 3KLDA 3CCHB 5DURD 2X1PA 1ITBB 1ITCA 6FABH 1EIBA 5DC0A 1JGVL 2P7TB 2W60B 4IMLB 1CICB 3G5XB 5EU3B 3TP4A 3WN5B 3MSPA 4Z7UF 1T80A 3T0AA 3MR9A 4QF1A 1UCBL 1KIQA 5DRWA 3B9KD 2ADGB 1SMAA 3GZKA 1UQSA 1B2WH 2NX5A 2OYPA 1MJ7L 4D94A 3HI1B 1B6UA 1X3DA 1VSCA 1P4LA 4ODHH 1LEGB 3PWVA 1W0WB 2OLDA 4JM4H 1DBML 1NUNB 3D2UA 2BFVL 5FYKL 5C0NC 4LQFL 3E6FB 4PJCB 1G7PB 1E27B 3NAAH 5H8DA 5FF6A 3OXSB 5EBLA 4EUPA 2JIXD 4EOWL 5C0ND 3BW9A 5I19H 1PYWB 3UTZB 3RZCA 1Y18B 1CFVL 1M05A 5GSVA 4K23L 4Z0XA 3TT1L 3DX8A 1KNOB 3VFMB 5GISL 4YIQA 3JWOL 3MLRH 1JP5A 3KHQA 5DEZA 4Y4FD 4RIRA 3C8DA 1YEDB 3S3JA 1TETL 3GKZA 1PVHA 4DKFL 2Z92B 3D3VE 1NBVL 4PRIA 5CEZH 3UPRA 4UIMB 1RUQL 1YYLH 1YUHA 2VTFA 1QBLL 4M5YH 4JFFE 4NO5B 3DURB 4J3OC 3VXTB 5IIEB 1GGIL 3FTGA 1LD9B 3O6LH 3P0YH 3QRFM 4MXVF 3T2PA 4U6YA 5JLZA 5DZLA 2BK8A 3BKJL 1N4XL 1L6XA 5D96B 1FL5A 3EO0B 5EB9A 3W2DH 4I3RH 5I1KL 2LABA 1S7WB 4DOHE 1S9XB 4HIIA 1DQJA 2JCCE 2NY3B 4OCXH 4LVNB 1MFBH 4L8CA 4MA8L 1QSFA 2MCPH 2NXZC 3D69A 4AJ0A 4U1MB 1NMCB 3LN4A 1KG0A 5ICYA 2H26A 4XPGL 4OGAC 2AV7A 5TPWL 4PJ9A 2NXZD 1G7HA 5CIPA 5HYJD 3WXWL 1FCGA 2H1PL 1BF8A 1ZT1B 4OGAD 5BZWA 4LVHB 2OQJB 2PXYA 4JKPL 1C5CH 3V0VA 5JW3H 3S34H 1AO7D 2CH8A 3KYNB 3MV01 2ADFL 3W39A 5AD0B 2V7NB 4F80A 1JPFA 3MFFB 2DAVA 2P5EB 1BQLL 1OARL 1UM6H 3MOBL 2LAGB 3EAKA 3FRPG 4ETQA 3V7AE 3WJLA 1LP9F 3ZKXC 1VDGA 3IETA 1CDIA 4G8GB 5KS9B 4WW1A 3PWPA 4YQXH 1ZGLM 4HBCH 4H26A 2AJXL 1RZGB 3GUTB 3C60D 4O4YH 3CFKB 3MTRA 1ZKAA 2B4CL 2W0PA 5IFJB 5MEOA 1J05B 1A7OL 3SO3C 4JFQB 5I1LA 4FZ8H 3HMXH 3EFFA 2X4TB 3OF6A 2AJYH 4JO1L 2WIIB 4FFZH 3P0VH 3LZFH 1FLRL 4GRWE 2WUCH 2FSEA 4X6BA 1PLGL 4TNWF 4JO3H 4IRSC 3D39E 4DGYH 5T1LA 1ZWIB 2IAMA 1SEQL 1ONQA 4JKLA 4XMKL 1DQLH 1OB1A 2QBWA 4PGBB 3IXAA 4GAYB 4ZFGL 5GS0L 2K7PA 4JCLA 3N9GH 35C8L 5AZ2L 2QADD 4RMSA 3T2OA 4OCRL 3T4AB 1H3XA 4QRRA 1I1AB 2UWEE 4BSWB 1IEHA 4D9LL 4X6DE 5T3XH 1OAYH 5FKPB 4NT6A 4Q9RL 2YS4A 3D85A 4E5XA 1J0YA 4OBRA 4C83B 3CFBB 2BP3A 4PJ5A 5B39A 5GGRA 3O41A 4NNXB 1ZHNA 2MOVA 2EXYC 1FL3B 4NKIL 1FNSH 1G9NL 1XF4A 1CGVA 1E6OL 2R0KH 4HPOH 5K59E 1EJOL 1MCSA 2D3VA 2EXYD 1X5AA 4MVBC 5FUOH 5GS1A 4O02H 1M7DA 2OI9B 5T1DL 1Z0NA 1HHGB 4IRZL 4Z9KB 3SKNB 3QR2A 2HWZL 1DSFL 3BT2H 4FFYH 4LFHD 1ZLWK 1GVIA 3SBWA 3X3FL 2VJXA 1J0KA 2J5LC 2NNAB 3BMWA 4LPTA 5E95B 3HLAA 4JHAL 4NQXA 3C8KA 2DTMH 2XN9B 4NC1C 1FH5H 2EE9A 3FQRA 1JPST 2F53A 2LU3A 5ESAA 4Z78A 3B8YA 2RAMA 2NZIA 2R1WA 3GI9L 5DEGA 2E7MA 5IHUH 5I1JL 1J0IA 4GW1A 3JBG7 1XGPA 2VDOH 3G5YB 4U6HA 1KULA 3MV7E 1R3KB 2EDLA 2ZUUA 4UV4L 4KVNH 5EFIA 2M8XA 2ESVD 4J8RB 4V1DB 4KQ3H 1S5HA 4OGYL 4YAQB 3CD4A 5I1DA 1OSPL 3EDFA 3FN0L 1MCFA 5EU5B 2EC8A 2OP4H 4AH2B 1SMOA 3NZHH 3WXVL 5IEKB 4K3HA 4P2OC 5E08H 5LGHH 1F4YL 4KQ4L 3SKJL 3VCLB 4AL8L 3O2WH 4Z7QF 4O9HH 3PP3H 4P2OD 4PJ8B 2WP3T 5SWSA 2BNQD 3ILQC 3O45B 4F7PB 5IMOA 1FYTB 1HKFA 3RNQB 4D0DA 1J1XH 3ULSA 2VC2H 3ILQD 4HSQA 5IW6A 1FG2B 1E4JA 4DZBA 2HLAA 5D2LA 3DXAE 5I1IL 4PJGF 4HKBA 1RUKH 4ESKA 3HPJA 1T2QL 3HNSH 4L8SC 5D7SH 1XIWB 1T89A 4JFOA 2R2BA 4ZO6A 4ZUSA 3H9HB 1X44A 4EIZC 4OLVH 2BVQB 1Z5LA 4U6XA 5J13C 1JGDB 5DQDL 3KHOA 1OAZL 3GMLB 3L7EB 1UB5A 1J8HE 2DLEA 4MS8D 2EEBA 4Y2DC 1U6AL 2VXTH 3M8OH 4I0PD 3Q3GB 2NY1D 3ZE0E 2OX5A 1MCQA 2YZ8A 1NGQH 5AZEL 2O5ZH 4HIEA 4S1SH 4M4RA 4TPRH 4I8DA 1T5XA 5F70A 3GHBL 1YEEH 4UOW0 2R2CA 3GJEA 3KPRE 5EUOE 3U0WL 4WO4C 2R69H 1U3HC 3BGFC 43C9B 2X4NA 4JQIH 2PW1B 4YXLL 2B2XL 1AQKL 4WO4D 4JGUA 4DGIL 3DYPA 4JN2A 4YUEL 2PR4L 4PGZA 2PYFB 2YZ1A 1BHGA 3DUSA 3RDTD 3EOTH 1TVHB 2W9DH 4XXDB 2CK0H 2EO1A 4NJAL 5D93B 2EDXA 4PTUB 4UDUA 4JR9H 3KPQA 4PJFF 4ODVL 1WIOA 3BIBX 4MLSA 3G6AA 3SDXF 4JO2H 1IEAB 3PHSA 5E6YA 4PJ7B 3C08H 3L5XL 1YEHH 2X9WA 5IV2A 2GITA 1UM5L 4NQCD 4MQXC 2HRPH 3ARQA 1RJZA 4ELMB 3BQUA 2ENSA 2FHBA 1GOFA 4POZC 3F5WB 1BZ9B 3H0TB 4MQXD 4E41E 3SE3A 4L3EA 1BD2A 5CINH 3TNNB 5I0ZA 2VOTA 4POZD 5GHWL 4Z18A 4HKXA 4F9PA 2QHRL 3V4UL 3G6JA 1A6ZA 2DWEA 3DX9B 3RWIA 4AG4H 4YR6A 1FPTL 3RTQB 2AJUL 4PRNA 3LKNA 1LO2H 3MUGB 3HE7D 1CDJA 3BAEL 4PLOB 1I7UA 4UB0L 2UZIL 1W2KT 4QRQA 3RA7L 1JGVH 1CFTA 5CEYB 1BJ1H 1V3LA 3MBEB 1G7LB 3V0WL 4OZIB 4IS6A 4K7PX 4N9OB 1UCBH 4M7JL 1MCWM 2DICA 1ZSDB 1NGXA 1RJYA 1MJ7H 4L1DA 3UTSB 4ZUWB 1R3LA 1CDYA 1R3JB 3WEXB 3EGSA 4NQVA 1WT5A 1DBMH 3L5HA 4UDTB 4K7FB 2BFVH 3WBDA 5FYKH 1D9KA 1WBZA 4LQFH 4BH7B 3CK0L 2YPLA 3GSRB 4PRBA 3GSXA 4JZJC 5DF0A 5HPMA 4HC1L 2OBGA 4NN6B 4EOWH 2GI7A 3VGAB 4QY8B 1ZHBB 3S5LA 1CFVH 1HHIA 4YHNA 2X4RA 4K23H 3TT1H 2WINA 5L8LB 5GISH 1X7QA 3JWOH 4OZHA 3KPSD 4R0LC 4DJMA 3KPNA 4GRWH 4OT1L 4MXQC 3BWAB 1TETH 3FQWA 5HTSA 5BJTB 4NO0B 5C0AB 1HIML 1NBVH 5MERB 2W91A 2VQTA 1RUQH 4P46D 4MXQD 4YHYB 3LOWA 4JY4A 4DAGL 1T0PB 1U8PB 4WUUD 3WL9B 3O2DL 1GGIH 2JTDA 1WBXB 3MRKA 2XT1B 1UACL 4F7EB 4PRDB 1U8JA 2HJKB 3BKJH 1N4XH 1BJ1J 4JFEE 2CLZB 5I1KH 4Y4HC 1B0RA 1PW3A 3MJ9L 1MCRA 3RHWF 4Y4HD 3NIGF 4MA8H 4PTTB 5E8PB 3QJFB 2HT4C 3MUY1 4ZO9A 3R8QA 4XPGH 1FGNL 5F9WC 5TPWH 4WU5A 3GRWA 3OXRB 3WXWH 3BUTA 2H1PH 2HT4D 2UVFA 2R1XA 3G5ZA 4WFHE 1JV5A 2GJ6A 4JKPH 1IGYA 4N1CA 5FM5M 1ACYL 3VFOA 2ADFH 2W65B 2EDOA 2CR6A 1BQLH 1OARH 5FDYA 3QIBD 1T0NA 1BFOB 3LKRA 5C07E 1I85C 3MOBH 3BP6B 3HMWL 2VLRD 4Y2OA 4JDVA 3FQXB 2IADB 2A6KB 2YN3A 1F11A 3VFRB 4FQQA 2OR8A 5BO1L 4E42B 1F4WL 2OTWA 4LGSB 3LKSA 3WLBB 3EO1A 4QRUB 4OUUB 3BGMA 4UT7L 4G6JL 4XBGA 2HFEB 3CSBA 1H5BC 4ODSL 3UTTE 3OKMB 2FLRT 3PL6D 3SGEH 4LHUB 3LEYL 4RWYL 3I6GA 2FX8H 2B4CH 1EHLL 2HG5B 2ADJB 1A7OH 1K4CB 3SHSA 2BVYA 3GIVA 4R9HA 4NKMA 4ODUA 4KROC 3MV8D 4JO1H 1UVQB 3U2SA 4G7YL 3ZMRA 1FLRH 4UI2A 4R7NA 5DJAB 4PJXB 3F65A 5DMIL 1SJEB 1J7VR 4KROD 1PLGH 3WDIA 5IVNA 2WSKA 1SEQH 4XMKH 5SV4A 4HDIB 5GS0H 4ZFGH 1NEUA 3O11A 5I66A 35C8H 3QHZL 5AZ2H 5IF0A 5I8CA 2EYRB 4OCRH 2VLLB 5IVZA 3SGEI 4Y5VB 1TZIA 4D9LH 1A64A 3QG6B 3MGTB 4C4KO 2JLLA 4WI6A 4Q9RH 4MGXA 4WW2B 3R8BB 4IRJB 3VWKB 5DSCB 4AIXA 3CH1A 4ZUVB 2VLKB 2XWBA 2M2DA 4NKIH 1G9NH 4PJAB 2Z8RA 1E6OH 1QUNA 1WZ1L 3T09A 1BWMA 4H1LG 1EJOH 4LDOB 3FT4B 3F6LA 3PWLB 1BOGA 2W07A 3MRQA 4KKCD 3GMMB 5T1DH 5L2JA 1OLLA 1DLHB 3ME0A 4Q9BA 4MNHA 4IRZH 2XTJD 3K4AA 4XGZB 2HWZH 1DSFH 5JHDD 5MEPA 3L3OA 3P4NA 4Y4KA 3X3FH 3HPLB 5KG9B 5DJZA 3T0BA 1YNTA 5GJTL 4JHAH 4Q2ZB 4Z7WA 1T22B 3I3EA 1AP2B 3RUGA 3DO7A 5D1QA 5FYJD 2YA2A 3GI9H 1EEYA 4URTB 4JVPA 5I1JH 2B8OT 5DVOA 1JHKL 2A6DA 1EO8L 4NQSB 5K9QG 5TFSL 2OSLB 4MJ2A 1Q9OA 4RAUB 4UV4H 32C2B 5F1IA 5T3ZD 4Z7VF 4IJ3B 2AW2A 4LCUA 1WWAX 3GMOB 5C0FB 4J4PC 4MWFB 1DQQB 4OGYH 4P99A 5HHQB 1OSPH 5D6CB 3FN0H 4I18C 5CD3B 4FTVA 1A1MA 2GSIB 3WXVH 3T0XA 3QNYB 4KRPC 2NX5D 4UZGA 1F4YH 4KQ4H 4OCYL 3RWHB 5INCB 1NFDB 3SKJH 1IGCL 4AL8H 3BH9A 4N1HB 5IBUG 2VLJA 3STBA 1LO4L 1QACA 2K3TA 3WFEL 2XRAL 3U4EB 4ZMAT 3C5SA 2F54A 2Z35A 5I8EB 2DQFB 3VXME 4P2QA 2D9QB 5F7HA 3PDOB 3FB7B 4N9GB 4U2ZA 5I1IH 3K2MC 3NA4A 3GJFH 1A4JA 4NYLA 5C09E 4A2LA 2RJMA 1T2QH 4ZSOA 2I9TB 1HHJA 3PWUB 2ZSVA 3KLAB 3IDJA 1HEZA 4M43L 1BZ7A 3IDUA 5CJOL 5IQ7L 3VW3L 4HMDA 3QI9B 1YEFL 3Q6FA 5DQDH 4G8FB 2PKDA 1OAZH 2E7LA 4KRLB 3DETC 3QDJA 1T1WB 4CJ1A 1JVKA 2OR9H 2P44B 3QIUC 4HCRL 4YE4L 1U6AH 1KACB 5E8EA 3VD3A 4PREB 4Y8AA 3DETD 2CDGB 5MEQB 3VXQA 4JRXE 5JHLL 2IALB 1UWEL 3P9MB 4NZUL 5AZEH 4F3FB 2EYSA 3H3BC 5B38B 3FN9A 4H88L 1FZMB 3FHAA 4R2GD 3JV6B 1RD6A 1WEJL 4RGNE 4ZXBB 5JA9A 1MH5B 3GHBH 5EU4A 3U0WH 4M6NL 1XCQB 3ZTNH 2D7QA 2YSSA 3O3AA 4ZYKA 3HI5L 4YXLH 3U0PB 1QA9A 1NUDA 1AQKH 2B2XH 1NCBL 1N26A 4DGIH 2A83B 4HZAA 1P1ZA 1FC1A 5EUKA 1VADA 4YUEH 2PR4H 3W9DA 1HHHA 3NZ8B 1FNEA 3EOAA 4PJ9D 4Y8DC 3V5HA 1CK0L 3O0RL 1U8LB 3AXLA 3U7YL 1JN6A 3LH2L 1U41A 4U1LA 1H8OA 3IDIB 2FIKA 4NJAH 4YGVA 3BXNB 3S3SA 5JDSB 2B4CC 3PWJA 1B88A 4BFIA 3MMEB 4ODVH 3MQIA 2YD7A 2FJHA 1WLHA 2VDLL 4P2RD 3L5XH 3P0GB 1HINL 3T0VA 1BLNB 1MLBA 5D7IF 1PKQE 5IG7B 5DC9B 4GLRH 2APFA 3LS4L 3QJHB 5HSFA 1RZFL 2EICA 3MLPA 3M17B 1UM5H 3FONB 5F1NA 3LRGA 1RZ7L 1FNLA 1HSAA 2F9BT 4YC2B 3VFSA 3SE8H 1XZ0B 4LDEB 3QXDB 2HP4A 2H45A 1N6QH 3CUPB 3QDMB 1UWGL 1U8OA 3TA3B 3NCCB 2L4OA 5GHWH 2Q6WA 5C08D 2QHRH 1QPPA 3V4UH 1ZVYA 4PJDE 5DYOA 1FPTH 2C3VB 3MXWL 5I1EL 2AJUH 5ICXB 2VABB 3HR5A 4JZNB 2J6EA 3BKML 5J89A 2V7HB 3BAEH 3WD5L 1OLZA 2UZIH 4YHOL 2R23A 3W5MA 2BSTB 5CFHA 4GLRI 3V0WH 3A67L 5IB4B 3CFDB 1AGCB 4IHOB 4M7JH 1XCTA 5EOCL 3D0LB 2AS5M 2VZSA 4LF3A 5F44A 4U1IB 1EFXB 5JORA 4JFZL 2CR3A 3OG6B 4QRRD 3BP5B 1CDGA 1SYSA 3DGGA 4MJIA 3CK0H 8CGTA 3RKDC 2YD1A 1ODAA 4WWID 5DURB 3MUHL 3D85D 4HC1H 3LQZA 3SDAA 1NGWA 1YEJL 1BECA 4Y19D 2CIIB 1S7QA 4PJ5D 2QKIB 1IMHC 2Z4QA 4DN3L 5CAYB 1UXSA 5SWZA 5E1AB 1KJ2L 4X4YA 4QXTB 1R3HB 3B9KB 3OMZA 1MJJA 1R6VA 3CJJA 5FGSA 4WENB 2BSSA 4OT1H 3SKMA 3ZT6A 2FJGA 2N7AA 5KSAA 4HIHA 1HIMH 2O93L 2MKLC 1CFNA 2F15A 4BH8B 4M6OH 1QKZL 4YHLL 4W68A 1TZGL 4DAGH 4OI7A 2JIXB 3O2DH 1QO3A 3IKKA 5EU6A 3UTQB 1F2XK 1UACH 5F3BB 2VDRL 2HAZA 4GG6F 3NCBB 5IEHB 4YBLB 3K1DA 5EZLB 3L3GA 1BJ8A 1T1XB 3CVHL 1ZT7A 3MJ9H 4HWZA 4OFIA 3L5WB 2AQ1A 4JFPB 2PW2B 3S96A 4P57A 4Y4FB 1KB5A 3WFHB 5EIVA 4U31A 4HJJL 4X6CE 2DQHL 5ISZA 4E41D 1NQBA 4NRXB 4HFWB 1LNUB 2DI7A 3OKEB 1FGNH 4PJBB 3JVGC 4HW6A 1N8ZA 3C6SA 4PJIA 3NCFB 3OWEA 2GCYA 3N85L 3P4MB 1VA9A 4EJ1C 5DHYB 4S1QL 3WIHL 1PQZB 1A8JH 4BSVB 1ACYH 3VG9C 5HYIA 4U1GB 2QR0A 4ZFOA 4RMVA 5ACZA 5KANI 5DFVD 3DIFA 5SWSD 5DMKB 4Y5XA 4MA1C 3PQYA 1A9BB 1JI1A 3HMWH 5ERWA 1A6TB 2ERJC 4LAQH 1Z9MA 5L8JB 3WJJA 5BO1H 1F4WH 1T6VN 2NXZB 1GAFL 2Q3AA 4MZ3A 3MA9L 1GRWA 4WTZG 4AQ1B 4UT7H 4HHAB 3WE6B 3CNKA 4ODSH 4C55A 5J11C 5J0BA 5F3HB 1AO7B 5LXGL 3LEYH 1NEZG 3NIDE 2J8HA 4RWYH 2AXGB 1VFAB 2CDFB 1FJ1B 1NMAL 4HULB 1JTOA 4LGPB 3DBXA 4ELMF 4R4ND 2G2RA 4FG6D 1KV3A 4IOFC 1QEWB 2X4QA 4MDIA 4F33A 5CJQL 5JOPD 4G7YH 5E8OA 4IOFD 1XR8B 1S9VA 5DMIH 1GIGL 2VR9A 3NFNA 3OR7A 1FC2D 1DLFL 5IMLA 2XA3A 2EYTB 2NY2C 5INDA 4X98A 3RL2B 3RBSA 1L7TL 4XNMA 5TDNA 1F42A 1DEDA 2NXYD 3VXNB 3C9NA 1ZV5A 2XZAL 3C60B 2NY2D 3QHZH 4Y89A 1NJ9A 1MLCA 2DWDA 3RWCB 2VZVA 3EUUA 2DQDL 4QTIL 4CADA 2C3GA 1SJXA 4JFED 4Y16A 5CP3A 4ISVB 5MENE 3EDEA 1G0DA 5I1CL 3MRJA 1DP0A 3SO3B 1KTDA 1VGKA 4GS7C 1ZGLP 4GKSB 4QCIB 2AKRB 4PJHB 1EMTL 1WZ1H 4U7MA 4WU7B 2CLVA 2EC9T 4MQ7B 3C8HA 3EFDL 3EOBB 3LB6C 2EZ0C 2QADB 3GGWA 5I73C 1TJGL 3P2TA 2GFBB 4WFHD 4GRLC 2Q1EA 2EZ0D 4G9DB 3L3KB 1YY8B 1D6VL 2VH5L 8FABB 3BQUD 4N0UA 5GJTH 1QFOA 3D25A 4UOJA 2VSDA 1TZHA 3FRUB 3KLSA 4JRYA 4FQHA 3BD4A 4L3ED 5F7WC 4BUGA 1JYNA 1MCBA 1XF3B 1ETZB 1JHKH 1VACA 2AJ3B 1EO8H 5TFSH 1HH6A 4AT6A 4HKZB 3MRGA 4C56E 3HNTL 2HRLA 5KAQG 3QQ3B 4GRWF 1I8LC 1F13A 1XH3B 3H7BB 5JPNA 3GSNL 3MRRA 3AFLA 3VFVA 3B6SB 5D1ZC 5FO9A 2R2EB 2P8PB 4LRNL 2ATPA 3V4PL 4JZOA 1NUGA 5FHAL 3EIFA 3D0VB 5FECB 4JANA 4OZGA 3U7WL 3SQBA 1FRGL 4OCYH 1H15A 1IGCH 1DANU 2UWEF 1U8MB 3HG1E 4X6DF 3VXRA 2XWJA 4CAGA 3P77B 3TBWB 3SJVB 3ZL4L 3CXHJ 1LO4H 5I17B 1D9KD 3MRHA 5D7LA 3WFEH 2XRAH 1RMFL 3CDFA 4XCNA 2YPLD 3CX5J 2ESVB 1DUZA 5F9OL 2P8LA 4V2CB 4N5EC 3BYYA 2DQUL 5FGBC 1KLGB 1N3NA 3Q6GL 1IARB 3VFPB 5GSRB 3ISWA 4N5ED 5K59F 1I8MA 2MJWA 3K7UA 3OKLA 3O3DA 3DSNA 3HZKB 2NQCA 1WZKA 1G7MA 5AG9A 2A6JB 1MCEA 1WVZA 4M43H 2CKNA 2DS4A 5CJOH 5IQ7H 3VW3H 1Q0YL 4RFEA 3ETBF 1YEFH 1KXTB 5BV7L 3FQTA 1VFOA 4P2OB 2BNQB 4HCRH 4YE4H 1EDQA 1GZPB 5DRNB 3L95A 5E00A 5GGUB 1T1ZB 3FOLA 1KYOK 3A6OA 1YC8A 3G5VB 1WK0A 4LCCC 3HKFA 2CPCA 3I85A 3REVA 5JHLH 1U8KA 4NP4L 1UWEH 2X4PA 5ENWB 5GGVY 5CGYC 1KXQE 4H88H 2EXWC 5TE7H 5BXFB 1A6VL 4ZFZB 5AWNL 1YNLH 1WEJH 2ZG1A 5DJYA 5I74B 1MY7A 3U83A 5CGYD 1MUJB 4M6NH 3VJ6B 5JO5A 4KC3B 5C0JA 5DJ6A 3SO5A 3V6FB 3BEVB 3HI5H 1UEMA 4KJPD 1SBSL 5C8JB 4LLMB 1NCBH 2IPUK 4JPWL 5I76A 4M3JA 4KMTL 5J13B 5IJVB 1NCWL 3ARTA 4I0PB 1L9MA 3K4ZA 1VFUA 2NY1B 2WQRA 3JWNC 2ADGA 1CK0H 4UQ2B 3UX9B 3U7YH 3HI1A 1JMZA 1DDHB 3LH2H 4NN7C 4XP1H 2XKNB 4HK0B 1EV2E 2GJ6D 4X7DC 4QRPE 4QHKJ 4JLRB 3FAWA 3E6FA 2QQKL 3QPXL 2VDLH 1U2HA 4Y5YA 3OXSA 5DWUL 1G9ML 5F7UA 1HINH 3B43A 3X13B 5A2FA 2VDNL 3W0WE 1R5WB 3DYOA 3LS4H 4WO4B 3X12A 1RZFH 4LBEB 4PGDA 1YDPB 2XNAA 1H3GA 5E6ZA 4AK1A 1RZ7H 4L1HA 2OMBA 3WUWB 3RDTB 5E5MB 1AH1A 1KNOA 1URLA 1UWGH 4Z76A 2CSPA 4RISL 3SKUD 4OTXL 3TNMB 4P9ML 2YOCA 2Z92A 4X5LA 2Y6SC 1E4KC 3WNNA 5HYSA 4HLZH 1MJUL 1W8OA 3MXWH 2CJUL 4NUJB 5I1EH 3DURA 1IC4L 1JNHA 3ZE0F 5C09D 3BKMH 3OGOE 5E8DL 3QXUA 3R0MA 4WHTA 3WD5H 2NR6C 4PJEA 4YHOH 1CTOA 4NQCB 3KLHC 3H2WA 4CGTA 3EO0A 1I9IL 1LO0H 4G8IB 5FM4A 2V5MA 1S9XA 3A67H 5JW4R 5EUOF 4ZD3L 1CYGA 5EOCH 3TO2A 4ENEC 2D0FA 4XZUB 5D71L 1QRKA 4NN5C 4PRIE 4RGNC 3RGVA 3QUXC 3HCVB 4OF8A 1OVZA 4ENED 3O9WA 1BBJB 3T0EA 3P9LB 3HE7B 3OBAA 3KXFA 4HS8L 1S8DA 2OQJA 3QWOA 1YEJH 3B3IB 3KYNA 5KVMC 3BFOA 5EIIB 2ADIB 2N1KA 1FE8L 3IJYA 5EH1A 5DJDB 5AD0A 4DN3H 2V7NA 4JVUA 4R6UA 2H2PC 1KJ2H 4BQ9A 4PIRF 3ROLB 4ZUUB 3OAZH 3JXAA 1LVEA 1JPGA 4LSQL 1QSFE 3NIFE 4H8WC 4K3GA 3U1SL 4N90D 3ARGC 4M00A 4MQTB 5E8NB 4EDWL 1QKZH 1Q0XL 1YA5A 2D0HA 3DX7B 4YHLH 1KJ2B 1TZGH 3ARGD 3ZYOA 1EO5A 2VIRB 3GUTA 4MAYC 2R4RL 3UDWA 2VDRH 4YDIL 5IFJA 1J05A 5L2KA 15C8L 1FFNA 5EOTB 5JOFA 2VZUA 4NSKB 1X6LA 3FB5A 3CVHH 5EZOL 1EA9C 2YMXL 5EOCJ 3HE6C 3HRZB 1NDGB 4X7FC 3MV11 3KPSB 2A77H 2COQA 3LIZL 4U1SA 2KQMA 3LKPA 1LK3L 4HJJH 1CGYA 4L5FL 4NHUA 3ESVF 2DQHH 3ESUF 5LWYL 4YO0B 3HE6D 3IJHA 4HJ0D 2ATKB 4R0LB 3V5DB 3TVMC 4MAUL 4P46B 3PWPE 3QDHA 4D9RD 4KRNA 2QSVA 2GK0B 4WUUB 4PGBA 2DI9A 3N85H 1XGQA 2Y36H 4S1QH 1OQOA 3DARA 3WIHH 4J6RL 5E24E 3ZE2E 5DI8B 3QUMA 2DJ4A 4TSCL 3M1BA 3MRBA 4WWKC 4YHPB 3UC0L 2FYYB 2QSTA 2BVUA 2VLJD 5TDPB 1TVBB 3DRQA 5DK0A 4F7MB 2JJUA 3CFBA 3FO2A 4Y4HB 4DN4L 3TBYB 1KIUA 3KJ6L 4NNXA 3CZFA 2F54D 2HTLC 2VQUA 5DJ2B 2I24N 2XYCA 4NNYB 2R0ZL 3QA3A 4CVXB 1WAAA 5C0GB 2BXYA 1CF8L 4ZQKB 1GAFH 1F3DH 2HTLD 4MB4A 3MA9H 3RVXC 5FYLD 5D2NA 4UV7L 4NQEA 1KC5L 2CUIA 3T3ME 5F9WB 3WLWD 2WQ8A 1K8DB 3I2CL 1HHGA 5LXGH 5D5MB 1ZHKA 2IH1A 3FB6A 3N1FC 1N5AB 4PV8B 1NMAH 1A6UL 4YH6A 4NFDA 1ZK9A 3QDJD 1LGVA 3QO0A 3QIBB 4NQUA 5CJQH 3TBVA 2H32H 2VLRB 4LK4A 5LJYH 2XN9A 5I71B 2H8PB 1MEXL 2WBKA 2AI0L 5TF0A 4X5WA 4YHZH 1GIGH 2Y9RT 4LLYA 3FMGL 3G5YA 1DLFH 4TSBH 4DQOL 1U91B 3SCMA 4OQ1A 1L7TH 2D03L 1HSBA 4WI7A 4LQ1A 4BM7A 3I02B 4DGVL 1U9KA 3PL6B 5BRZD 4KK6D 4HGWB 2XZAH 2H32B 4V1DA 3LEXA 3O4OC 3RNKB 3S9DB 2EIBA 5KSUB 3MCKB 2DQDH 2JJVA 4QTIH 5CS7A 2YD3A 2VO5A 2P47B 3L6FA 1TTGA 2MPAL 2FWOA 3MV8B 2UUDK 4WFFD 5I1CH 2IF7A 3ZDZE 3U36B 2Z8WC 2F53E 2NY7L 3MJ7B 4JG1H 4KROB 2CQVA 5ITFB 1EMTH 3QNZB 2WWKO 1TVDA 2ID5A 3HN3A 4PJ8A 3VGEA 2D7NA 4ACPA 1F3DJ 4HUWA 3O45A 4RBPK 4JGMA 4U3CA 1FZOA 1CLOL 3RNQA 3EFDH 2PTUA 3HAEG 1E6JL 5CLWA 1KYOJ 4QRTA 4KJQC 1TJGH 2DRUA 4YZFE 5IFHL 4H0GA 4ZAKC 4YX2L 3V79C 3CMOL 3OPZL 4FA8A 1XIWA 4RA0C 3H9HA 2VH5H 4ZAKD 1EGJA 1WWWX 3CDGA 1DQML 3AC0A 3AS3A 3TN0C 4W6WB 2ZUQC 4G80B 1BX2B 1JGDA 2EDRA 2Q7YB 4EI6B 1II4E 2JJSC 2MNUA 5C9KA 3TN0D 5T5NF 4WTZA 1RURL 5HD8D 3LQMA 1ZS8B 4XPFL 1AC6A 4LHJB 3IT8D 5F7EL 1X4YA 3PF2A 5D9SB 2E5EA 2XTJB 5IM7A 2IFFL 5JHDB 3GSNH 4K3JL 3T4YB 5EC1A 4O2CB 3UJIL 4I2XB 2ED8A 4MYWB 2ICWI 4LRNH 2W59A 3V4PH 3C5ZA 5FHAH 4UAOB 2LVEA 5EA0L 4UQ3A 3U7WH 1SBBA 1FRGH 4KJWC 3TYFB 4UU9A 4OJFL 1KF9B 3MRMA 2PYFA 1A6AA 3ZL4H 3ABZA 4O2FB 1WGOA 5EU7E 3PJSB 4Q9QL 1TVHA 4LASL 4MJID 1KFAL 4XXDA 1RMFH 4M93B 5F9OH 3SE9L 3IJSB 3RKPA 4QXGL 3ULUD 1MHHB 1T03L 2ICWJ 3SDAD 2DQUH 4K71C 4XBPA 1T66D 4PTUA 1ZEAL 5DO2C 3Q6GH 3KPLA 2PETA 2J8UA 2PF6A 1OWRM 1B4JH 3MR9B 3QFJA 4QF1B 3H9SD 4X80L 4EUPH 1IM3A 5DO2D 4G43A 1EUTA 1UQSB 4OZ4A 2NX5B 4TRPL 2ZWLT 3NVQA 1ES0B 4HT1L 3FN3A 1Q0YH 4I18B 1Z9LA 1KUMA 1OAQL 2EH7L 4EEEA 3PWVB 2IWGA 5EWIH 5BV7H 3WNKA 1NCCL 4KDTA 3JUYA 2JJTC 1F45A 4ZOCA 3H0TA 4GBXA 4GJTB 4NZRL 3KNBA 4EUPB 3IYLW 4NP4H 3BW9B 5EU6D 3WHE1 1A6VH 3DX9A 3CSGA 2Z91A 1M05B 3CDCA 5AWNH 5GSVB 5BV7B 5KSBA 5DS8A 3RY4A 5EZJA 4IOIB 1FNAA 2IPTL 3IF1A 4YIQB 3RVUC 2Y5TA 2EEAA 2ZUVA 4RIRB 1SBSH 2G5BA 3CFIC 4JPWH 3MBEA 5ISZD 2R0WL 4WDIB 4KMTH 3EYVB 3RVUD 1NCWH 3RL1A 2OTUB 1YUHB 1DVFA 5ITBL 2Z8VC 3FT2A 4M7LT 5HYQA 1KIPB 1ZXQA 1BD2E 3MRIA 5J56B 5JLZB 1D6EA 1L9NA 4P5TA 3DROA 4K8RL 2D4DA 4R2GB 4UDTA 3JZ7A 1IQWL 2NYYC 1AR1C 3GRWL 4ZNEA 3PHOA 5CIPH 3WNLA 3U46B 2QQKH 4HIIB 4U6TA 1DQJB 3WDHA 2E9WA 1IEBA 5DWUH 1G9MH 4KTDL 4XRCA 2VDNH 3GM8A 3WSQL 3PQYD 4L8CB 4NOFA 4QY8A 1ZHBA 3D69B 2IBGA 4BZYA 5F71A 5DD3L 2H26B 4PV9A 2AV7B 4PJ9B 1G7HB 3B8SA 3LCYA 4LP5A 1AQDB 3RIFF 3UXFA 5C0CE 3BWAA 4RISH 3V0VB 4OTXH 4P9MH 4NO0A 5MERA 3W39B 4HXAL 4XXCC 1T7XA 3U7AA 2Y23A 4Q7DA 3BSZL 1T7VA 4EN3C 4L4VA 1MJUH 4GXUM 2CJUH 4P2RB 3DRTA 5ALBL 1U8PA 1IC4H 3ZHKA 2DM2A 5E8DH 5GZOC 1WBXA 1PY9A 4EN3D 3P73B 1MIML 2HJKA 4ETQB 2MWCA 3IETB 5BS0A 3O6FC 1I9IH 1OGAD 4WW1B 5E4IA 3IXTA 2PYEE 4BYHA 4ZD3H 2X42A 1GH7A 5C2BL 4H26B 2EDYA 1E28B 2UUDH 5D71H 5C08B 1PDKA 2X1XR 1MRFH 3WO3B 3OXRA 4JQVA 3ZTJH 4O58L 4Y16D 1WFUA 4HS8H 1VB9A 4RBPH 3TGXA 4EDXA 4R96A 3DMMC 1FE8H 1BQHB 2EO9A 3TLRA 2FSEB 2VKWA 1RQ5A 3KJ4C 3UZEA 3C87A 2IAMB 4M1CD 4PLJD 1ONQB 4LSQH 3IXAB 4JFDE 2Y72A 3UYOD 4HAFA 3U1SH 3ARFA 4QRRB 5KVFL 5DHVH 5AEAA 2RB8A 3B5HA 4EDWH 4RNRB 4ALAL 5LVEA 3B83A 1JWUA 4KUCF 1W0YT 2HFEA 3DI3B 4NT6B 2ENYA 4GAFB 3D85B 4XNQA 3OKMA 4RFNC 1HNFA 3AY4C 2R4RH 4Y19B 4PJ5B 3O41B 4YDIH 4JRYD 4WFGD 3ARDC 1XF4B 3QIWA 2C3HA 4PJDF 1A7BA 3RX5A 3VH8A 3WFZA 5EZOH 2YMXH 3GBLA 2Q86B 3LIZH 4OF0A 2NY6C 1LK3H 3BD5A 3MYZA 4L5FH 5LWYH 4HXBH 1CD1B 1U3YA 1RJCA 1KGCE 2OS7A 1MAJA 4AYFA 4MAUH 2NY6D 2AQ3A 5T33L 3HLAB 3N0PB 2VL4A 3C8KB 5J1SC 2DN7A 1OWWA 3E0GA 3KPPA 4J6RH 5DJ0A 5ESAB 3VXUE 4Z78B 2R1WB 1UH4A 1LP9A 4TSCH 1QHPA 4GW1B 4NBXB 1XGPB 2LTQB 3MGTA 5HI3D 3TV3L 3NN8A 3RWJA 4U6HB 3VWKA 5D7LD 5GZNC 4DN4H 5EFIB 4JY5L 4AMKL 4PJAA 2R0ZH 5GZND 5BOZG 2EECA 1S5HB 3RX7A 4Z7UE 1CF8H 5I1DB 2KQNA 1W0VA 4S2SA 3TPKA 4RFOL 4UV7H 3ILPA 3GMMA 1X5XA 3IDYC 4PRHD 1DLHA 3MNZA 3I2CH 3KAAA 3UAJC 1C16A 4XGZA 5IJKA 1A6UH 2WBJA 5JQHC 1QBML 4M1DL 1V3JA 5DDHB 1OAKL 1T21A 4OFYA 3NABL 5SWSB 1WIPA 4WUKL 1T22A 5FGCB 2QHLA 4D0DB 1AP2A 3QFDA 1YN6A 4N5UA 1MEXH 3SGJA 5IW6B 2AI0H 3M45A 5D2LB 3QEQA 2CO7B 3TYGL 3FMGH 3M07A 1RHHA 4HKBB 4DQOH 2DJSA 4LRIC 4JFOB 1T3FA 2EIZA 2D03H 2R2BB 4ZUSB 4KTEL 32C2A 3FOMA 4DGVH 4X6CF 1VKXA 2YUVA 1Z5LB 2B5IC 4U6XB 5J7CC 2XTLA 4MWFA 5C71A 4U1JB 1DQQA 3JV5A 3V6OE 3VFGL 2YBRA 1UB5B 5D6CA 4L9LA 5CHNA 5CD3A 4I9WE 2ITCB 2MPAH 4KK9C 1CXLA 1NAKL 3S98A 4X9GA 3QWRA 4X4ME 1RK0A 2NY7H 4HIEB 4X7SL 5INCA 4KK9D 5F7MC 2CLRB 3C2SA 1DEEA 3GJEB 5HHMD 1CLOH 2GY5A 2FO1A 4TYUA 2NXYB 3V8OA 1E6JH 2H9GA 2NY2B 2X4NB 2YRZA 4F7CB 3IFOB 2GAZA 4LSSL 5IFHH 4N9GA 2NY4D 3SEPA 5CSZA 4MSWA 4QHMA 1HYSC 3QRGH 1GXEA 5KTEL 3OPZH 2I9TA 3D5OF 3RVTC 4R8WL 3DUSB 3KYOA 4U1KA 3X11A 1SVCP 2PCPA 4GMTL 4FTVE 1DQMH 2E7BA 2GTZB 5GGSA 2O26U 4DFIA 4ZTOH 3RVTD 3NIDF 4XX1E 4G8FA 2OTPA 1LEKA 5JW4M 3UBXA 1T1WA 4GW5A 4HK3N 4UDUB 4WGVB 1RURH 2C1OB 4QRSA 4HUXB 4XPFH 3G6AB 5C0DA 4PREA 5HHPA 5L88L 5MEQA 5F7EH 2CD0A 2ZP0T 4IBLT 1RZ8B 4P2QE 1A21A 4EQ3A 3I6KA 1HZHL 1KTKE 5B38A 2IFFH 4K3JH 4JVWA 2GITB 5DGRA 5IV2B 1J86A 3TO4C 1RZJC 3JV6A 3UJJL 3EZJB 1A4KA 3UJIH 5IW1A 3O3EA 1MH5A 5I75B 5ECJE 1RJZB 2J6EL 3BQUB 1XCQA 3RY6A 4X0KA 1F6FB 1A22B 3GSOB 2VKXA 5EA0H 4K07A 4L3EB 3STZA 3KYAA 2APTA 1RZKL 3CVIL 1U95A 4HKXB 4OJFH 5IR1A 3AVEA 5GRZA 3G6JB 5T1MA 2DWEB 3RWIB 3NZ8A 4PJGA 3G9VA 5DQJA 4YJZL 4K94C 2AK4D 5CMAA 4Q9QH 4FQCL 4LASH 3T0ED 1KFAH 4PRNB 3LKNB 4LCWD 5IGXL 3KXFD 1QSEE 2R0LL 3WDJA 3IDIA 2FATL 5GS3A 1I7UB 2YUXA 3SE9H 4QXGH 5JDSA 4KI5C 1T03H 4X6EA 3OAYH 4KGLA 1CFTB 3O4LD 1ZEAH 3FT3A 2H41A 4XMLL 4IS6B 4G9FE 3SPVA 4KI5D 3LQAL 4UILL 1C5BH 1GZQA 4X80H 5ID0A 1DN0B 1RJYB 1FVCA 5IG7A 4TRPH 3QJHA 4HT1H 4ZS7L 4MB3A 1R3LB 4TUOA 2EH7H 3H8NA 4CVWA 1NCCH 4ZDHB 1EAJA 4WHCA 5IVXE 1D9KB 1WBZB 4NOBA 2W1NA 2V5YA 1VHPA 1XZ0A 3LHPL 5B22A 1FV1A 3HAEA 1TNNA 2YPLB 2YHGA 3GSXB 4NZRH 3QUYC 4NBZB 2R1YA 3TA3A 5E7BA 4MNGB 2CRYA 3VE0B 3BDXA 3S5LB 1HHIB 1M1SA 4C59B 4YHNB 3X17A 5L2KD 2X4RB 5DR5H 1NH6A 5ICXA 4ONHB 5EPMA 4L8BB 2V7HA 2MFNA 2APXA 4ODBD 2WINB 1AR2A 2IPTH 1X7QB 4OZHB 1T0MA 2JKXA 3KPNB 1MFNA 1MOEA 4S0SD 1H3PL 3FQWB 4PRPA 2R0WH 5CD5C 4X7TB 4EI5A 3QXAB 2VZOA 1RZIB 2D7PA 2GKIA 4APQA 5ITBH 5AYQA 4JY4B 1KB5L 4B5EA 1JPTL 2YA0A 5CZVL 3EJJX 4A6YA 2FEEL 5J3HC 1X5GA 4U1IA 2W92A 4LCCB 3S36L 3EDDA 4K8RH 1IQWH 3RVWC 3GRWH 1B0RB 2DKSA 3TJEL 3H42L 3MRLA 2EE6A 1I3VA 2K7QA 4KTDH 5E9DA 3EHBD 3WSQH 2CIIA 2X09A 2QKIA 4YWGL 1IKFL 4PP2B 5H94A 4JDTL 2AJZA 5DD3H 1QRND 2HT3D 4NGHL 5I1HL 1AXSA 4NKDA 1N59A 4NJ9L 5B3JE 4W4OC 3CX2A 4NQED 3G5ZB 3P3YA 2GJ6B 4H20L 5TE6L 2VQ1A 3MNVA 5MHSD 3VFOB 4BH8A 4QHUB 2LQRA 3BSZH 4HV8A 2ORBL 1SHMA 2C1PA 5ALBH 2JIXA 1T0NB 3AB0C 3LKRB 5CUSL 2HN7A 3ZKMC 1HI6A 5F3BA 5IOPA 1MIMH 4JDVB 1F11B 2B0SL 3HUJE 4G6AC 2LE9A 5SWZE 3LKSB 1T1XA 3EO1B 3U82B 5M95B 3L5WA 1LMKA 3BGMB 5BW7C 4JFPA 4U0RC 4XBGB 5C2BH 3LDBC 1M6OB 1MY5A 3I9GL 4MJ4A 4JRWA 3MA7B 4L3CB 4UIKL 3I6GB 4P23C 4LSPL 4BK4A 5I6XC 4ZG1A 2EDEA 3MRNA 4PJBA 3BPNC 1IE5A 4O58H 3GIVB 4P23D 3LS5L 4ODUB 3U2SB 4R7NB 1IVLA 2MMXA 1YEGL 2FB4L 4WEUD 4XNXH 3IDMA 4WVRA 2ZUXA 2NW3A 2V2XA 4UT9L 4F2MA 4G42B 5IF0B 1KENL 5KVFH 5IVZB 4OGZA 5HYJA 1TZIB 4PUBL 4ALAH 1Q94B 4PJIE 1AHWC 2DYPA 1AO7A 5JPMB 1W72A 2AXGA 2AP2A 1FJ1A 1PD6A 2XWBB 4TVPD 5E94A 3QQ9C 1YQVL 2B1HL 2GY7B 2RCSL 3SDXE 2GTWB 4H25A 1JZ5A 3GO1L 4MA3B 1Y0LB 1BOGB 3MRQB 2BNRA 5HI4C 1WT5C 4IDJL 1V3MA 5L2JB 4JG0L 3E2HC 4JB9L 4MNHB 2FZ3B 2FHCA 1RI8A 5MEPB 4JE4B 3V7AG 4PG9A 1WZMA 4RDQF 5DJZB 2X6MA 3QWQB 3ARGB 5T33H 1YNTB 4XNZB 3VXNA 1AY1H 2E27L 3C5ZD 4Z7WB 5B8CC 3ULVC 3RUGB 5D1QB 2A0LD 1NLBH 1EEYB 2OMNA 2VRAA 2OZ4A 3ULVD 1CGUA 2A6DB 3TV3H 2CIKB 5ESVA 3BZEA 4WFEE 3HZMA 5F1IB 5BVJA 4OLUL 3LPWA 3HE6B 4JY5H 5D1XC 4R97C 4AMKH 5DGQA 1H3UA 2LU7A 3G08B 5D1XD 1TTUA 1T2JA 4RFOH 1J0JA 3C09C 4IRSA 4YBQC 1YEKL 3QFJD 2BY0A 3NIFF 2YC1A 3CPLA 4YBQD 2ZKHL 5HY9B 4RRPA 3ARBC 3BH9B 4G9DA 1QBMH 4M1DH 2Z9TA 1IC1A 2MTPA 5HHOA 1OAKH 2VLJB 1YPZE 3NABH 1A7QL 4WUKH 3ARBD 3FRUA 3VMNA 1YN7A 2F54B 4GBXD 4PB9L 1R5IB 1K3ZA 3MREA 1XF3A 3TYGH 1A4JB 4DEPC 3IFNL 4ZSOB 1MHEA 4HMCA 4KTEH 1U8HA 1HEZB 1BZ7B 5IBTH 1K2DA 1EAPB 3BPOC 1PG7L 3Q6FB 3B6SA 1X5YA 2V9RA 2R2EA 3QDJB 3VFGH 2P8PA 4JCMA 4XI5C 3V7MA 5C0BE 1NAKH 1DVFD 1OY3B 3FZUC 3VXQB 2KH2B 4X9IA 4X7SH 1U8MA 3FZUD 4P5TD 1CGWA 3IU3A 4BQ6A 3TBWA 1AIFA 2WLZA 5I17A 3S97C 4L4TD 1MF2H 5BRZB 2ESVA 2YSSB 3O3AB 4ZYKB 5D7JC 2IPKA 4F37K 3OKNA 1QA9B 5IROC 4LPUA 3UP1A 5J12C 3VFPA 3T2NL 5EUKB 4J23A 5D7JD 3W9DB 2BHYA 4R8WH 1JNLL 4OCSL 3EOAB 3K8LA 3V5HB 4K9EC 3T3MF 4R4FL 3DJ9A 4CBPA 5CEXA 5JXEC 3U6RB 2FIKB 4YGVB 2MKWA 5FHBL 1LDPL 1DN2A 3NBNA 4P2OA 3ZT7A 3VXRE 1AD9B 1GZPA 1TQCC 5GGUA 2DM7A 4L4VD 4LLQB 5L88H 1T1YA 5T1KD 5L8KB 5F7FA 1MLBB 1HZHH 5ENWA 4NRYB 4ZFZA 4G8EA 3UJJH 3BO8B 5F1NB 4ZAKB 1HSAB 1INEL 1IGTA 3VFSB 2J6EH 5HHVL 3ARVA 5SX5K 4HS3A 4YXHL 4L8SA 2DQGL 4LLMA 1U8OB 3IU4L 1NKOA 2LAAA 3TN0B 3QUZC 1RZKH 4M7ZC 3CVIH 1EZVX 5I8OL 3RI5K 5DYOB 4FQCH 3UTPD 3HR5B 4Y2DA 3P0YL 4P4RB 3ZDZF 1HK6A 4HK0A 5ANMA 3V6OC 4GG8A 4M62L 3DVNA 2R23B 4JLRA 4MHHI 4Z7OE 4PLKC 5I16A 4XMLH 2IANE 3LQAH 4X6FA 4U1HA 4OUOA 1XCTB 2BDNL 1UJ3C 4LF3B 4WO4A 3JV4B 1BPVA 4YZFF 4ZS7H 4D0BB 5HVHB 4MDJA 1A6WL 1U3HA 2HTKC 4LBEA 4F15C 3JSSA 1YDPA 2HFTA 1CE6A 4XCEB 2IEPA 1MNUH 3ARFD 5JORB 3WUWA 5IVOA 12E8L 3DGGB 3LHPH 4MJIB 2EDFA 2AXJA 3BZFB 3LQZB 1W8NA 3SDAB 1NGWB 4OD3L 2DKUA 3H9ZA 2CRIA 2Z4QB 4NCC2 4PJCE 1UXSB 3OB8A 2IMMA 5FOBA 4X4YB 3H9SB 1ZLUK 3SGKC 1CGSL 3GDBA 4Z7NE 1MJJB 3BUYA 3KG5A 1HQ4A 3S35L 3BP4B 3MBXL 2BSSB 3GSWB 4NQCA 4C57C 3SKMB 5D2LF 2FJGB 1H3PH 1EHNA 5KSAB 1UENA 2C3XA 4HIHB 3C6LC 4O5LL 2FEDC 4MX7A 1UB6B 2EDJA 2AEQL 1EVTC 4K55A 4UUJA 1KB5H 3ELAT 1JPTH 1ZMYA 5CZVH 1T7YA 2FEDD 5EU6B 4XZUA 1ZAGA 4O4YL 3S36H 1XF5A 1JF6A 2GEEA 1NC4D 4QHNB 1O5DT 3QDGA 3QEUA 3HMXL 1OTTC 3TJEH 3H42H 3PHQA 1ZT7B 4HWZB 3DV6A 1T7WA 3BP7B 3BDBA 3S96B 4Z5RB 4P57B 1KB5B 1HXYA 3B3IA 1OAUL 1P7KB 1YNKL 2ADIA 1BVZA 2WUCL 1XF2A 4YWGH 1IKFH 5ISZB 2DQIL 4JDTH 4JO3L 5CEZE 1SY6A 3NFPA 1P5UA 4NGHH 1QR1B 4TOYL 1Q9LB 5I1HH 1KEGL 4KKAD 1N8ZB 4NJ9H 5E6IC 3C6SB 1WIUA 2MSPA 3TM6A 2GCYB 1J10A 5EBMA 3E6HB 1MAKA 1EERB 4H20H 4QOKD 5TE6H 4R7DB 1OCWL 1NLDL 2FEEI 1QLFB 4RWHA 2WBJD 4JKMA 4ZFOB 2ORBH 2YR3A 1XMWA 5ACZB 2J7LA 5D72L 3DIFB 4G9FD 4XBEL 2A74B 3PQYB 5CUSH 4JZJA 3QQ4B 1B4RA 2WUBL 1S78D 1FNSL 2B0SH 2P5EE 1F3JB 1KPUA 2VN4A 4U33A 1UWXK 3WNOA 1NDGA 5FYKU 5I9QC 2R9HD 3GEWB 2V17H 3I9GH 4DTGL 3G04B 4YO0A 4G8GE 2BY1A 5KS9E 4FQPA 4GAGL 4FFYL 4R0LA 5DT1L 4PGJA 4N0FA 3DBXB 4LSPH 2G2RB 2GK0A 4WUUA 4MDIB 3THML 5DUML 4F33B 4OFVA 3LS5H 4EN3B 4WV1C 5E2VL 5TF1L 1S7TA 2Y07L 3QZWA 5E8OB 4YFLI 1BF2A 5DI8A 2XQYG 1S9VB 1H9VA 1R3IL 2X4OA 1OGAB 4YHPA 3JV0A 3L3DA 1HXMA 1YEGH 3NFNB 2VDOL 1I9JL 5CP3H 4OIIL 5TDPA 1TVBA 4X99A 3WYRA 4X98B 3UEZA 5INDB 2IMNA 4F7MA 1SJHB 4XNMB 4Y4HA 5TDNB 4G6FD 4UT9H 4LL9A 3C9NB 2X9YA 1Q1JH 4ZPVA 3PABA 3F12B 1MLCB 2DWDB 4P2YA 4CVXA 4GG6A 1INQA 4ZQKA 3MX0A 4PUBH 1WWCA 4Y16B 2OP4L 1JE6A 1KN2L 1N7ML 3EKCA 2XKSA 1RZKC 4CN4A 1N5AA 2A1WL 4U7KA 1YQVH 1EGJL 2B1HH 2DKMA 2RCSH 3JWDL 3GO1H 5KSVA 5FUCE 3KJ4B 1P4IL 3LD8C 4N8VA 4IDJH 3GGWB 4TVPL 3MLWL 3X14A 1I85A 5IBLC 4JB9H 5HGHA 3BIAX 1WCBA 3QDAA 2P5WD 5E2TL 3HNSL 5IBLD 3I02A 3KWWA 4N0UB 3D25B 2E27H 1TZHB 2A73A 1AC0A 2Z31C 4JRYB 4FQHB 3ZKND 1H5BA 1P4BL 4FQ2L 5KSUA 3L9RB 4RFNB 1LE9A 1FAKT 2Z31D 1VACB 2VXVL 5T5NG 3MV8A 4O2EB 4AT6B 3MRCA 2XN9E 3MRGB 3U36A 4OLUH 1CGXA 2IBZX 3MJ7A 4Q6IC 4GQ9L 5JPNB 2OK0L 3MRRB 1ZE3C 3VFVB 3D3VA 2NY6B 1YZZA 2GJJA 3D18A 4K7PY 1YEEL 2ATPB 2GT9B 3V0AC 2EKSB 4OCNC 4JZOB 3B2UC 3SQOL 1YEKH 5C86A 3MRPA 1C7TA 4JFFA 3ZHDA 5DMGC 3FQUA 4V1DE 4JANB 1MHCA 4OZGB 3MLTB 4BELD 3TC9A 3B2UD 2PN5A 2ZKHH 1BOYA 5I0DA 1H15B 5KANG 1A7QH 4PBWD 2JCCA 3MRHB 5D7LB 4MD4A 3Q48A 1X5JA 1BX2A 1ZLUH 2Q7YA 4PB9H 4EI6A 2P8LB 5IB2A 5LGKA 1Z9SA 5C6PB 2P8MA 4XCCL 4D9QE 1ND0B 1N3NB 1BFTA 3DV4A 1ZS8A 4ELKA 1CDBA 1FYTE 5KAQF 1FZKA 3OKLB 3O3DB 4PRHB 1NL0L 5A3ID 2FR4B 1F90L 5JHDA 5CJ5A 2RR3A 1CFQA 1PG7H 4M6ML 2YD2A 4MJ6A 4PRPD 4JM2C 2BHUA 4EI5D 5E00B 3FOLB 4APQD 4WY7L 3REVB 3ZLQC 3NMEA 1U8KB 4QTHA 1YMMD 4M61B 4TSAL 2X4PB 1DFBL 5DRXA 4LLWA 1J0HA 3MJ6A 4PP1D 4I77L 5JO5B 4I3GA 2FBOJ 1MHPL 3IJSA 3P4LA 5C0JB 5DJ6B 1MHHA 5E9DD 2BCKA 3PGDB 4FFWD 3T2NH 5I76B 5EBGA 2B5IB 3U9UA 3E8UL 3QEHA 4J4PA 1JNLH 4OCSH 4R4FH 5MI0B 1AJ7L 3UCRA 1ES0A 4I18A 2FL5A 4P49A 5FHBH 1LDPH 1JPSL 3RIAK 3SDCC 4JFHD 1OW0C 3D39A 5HHMB 4OSUH 2ZJSL 4Y5YB 3OKKB 5DVMA 3I6LE 1ZGLA 4BSJA 3EW3B 1UWXH 3CAFA 2NY4B 4P9HL 3X12B 4LVOB 4PGDB 1BM3L 4JAMA 2XNAB 4PJ7E 3GMNA 1INEH 5HHVH 4IOIA 4WI5A 1JZ7A 4YXHH 4TNVF 3AREC 1VERA 2DQGH 4XAKD 1MRCL 5J1AA 5ETUA 4Z76B 3IU4H 4WDIA 1T4KA 3EYVA 4ELME 2GJZB 2OTUA 5I8OH 4J3VA 5HYSB 2VYRE 3BMVA 1KCRL 1JNHB 5HHNA 3QIUA 2RBLA 1KIPA 2QSQA 4WHTB 3T65A 1I7TB 5FXCH 4PJEB 5JW5A 4YEFA 4M62H 1BWWA 5IFAH 3BX7C 3U46A 2R39A 5HGAB 1CS6A 1E4XL 5A2LH 4LSDA 1B90A 3UZVB 4XH2B 1QLEH 4M48H 2BDNH 3TO2B 4YK4C 4OM1L 5TQ0L 2YK1L 1TPXC 2Z93A 4KK5C 1A6WH 2IC2A 3GB7A 4HS6A 1AI1L 1G6VK 3WHE0 4OZIE 3RGVB 5DVKA 3INUL 4PY8J 4HJGA 1CU4L 2AK4B 2JB6A 12E8H 3O9WB 3T0EB 2F8OA 2OL3B 4LCWB 3KXFB 3UTSE 1AQDA 1UCTA 1S8DB 3QWOB 2YUZA 2NTSP 2DYPD 4OD3H 3FFCD 1VEPA 3O4LB 3IJYB 3U48A 5CGTA 2AV1A 5F9AC 1WZLA 3DGCR 4P2RA 1CGSH 1JPGB 3S35H 2SEBA 3P73A 3MLZL 3MBXH 2BNRD 4IIQC 2BRQA 3BVNA 4LSVL 3AMKA 4O5LH 1B0GA 5FYKE 1Q8MA 2AEQH 2NLJA 4AZ8A 5FFLA 4U6VL 4J7RA 3KS0H 3VD9A 1FQ9C 2BERA 4JFXA 1E28A 2ZCLL 5L0QB 4NO2A 5C08A 4ODTL 5C0AE 1KBGH 2FX8L 4JDZA 4P4KC 1LDSA 1IL1A 2FBJL 5L2KB 1MPAL 3DXAA 1FFNB 5JOFB 4X9BA 1SM3L 4BJLA 3FB5B 5F21B 3CC5B 5GGQL 4AM0B 2HKFL 4M8QA 4DUWA 3ZKSD 4UTBL 1KT2A 4U1SB 1OAUH 3LKPB 2B39A 1YNKH 3QUMH 4NHUB 1BQHA 4DVRL 2DQIH 3IJHB 4EIGB 1RJLB 4N0YL 1J8HA 4TOYH 1KEGH 2ZCKL 3N06B 1CI5A 4IRSD 1GGYA 5C0RL 1XGQB 4XMPH 1OCWH 1P6FA 1NLDH 3QUMB 1I4FA 1G1CA 4YBHA 3M1BB 3TZVC 3MRBB 5IVXF 4RNRA 4NQDD 1FVEA 5HHOD 4MNQD 3BZDA 5D72H 3KPRA 2P49B 3DRQB 4XWOC 5DK0B 1WISA 3QAZC 5EUOA 1EBAA 4XBEH 3FO2B 4Y19A 1CICC 3WN5C 3CZFB 2H2SC 4LLUA 1JZ6A 1LO3L 1LWRA 2WUBH 4QKXB 4XWOD 4CU6A 5LKNA 3PXJA 3QA3B 5LQBL 1QRNB 5JZ7C 1B9ZA 4F9LC 2FD6L 5D2NB 4NQEB 2Q86A 1X5ZA 3KS0J 3MRFA 1OD9A 4DTGH 3MGOA 4S11A 4MVBD 1CD1A 4LU5L 1F6LL 1IAIL 1S9YA 4GAGH 1ZHKB 2IH1B 3FB6B 5DT1H 3CFCL 5KZCD 1NPUA 3O3UN 4BKLB 1Q9WB 3VWJC 3QO0B 3HHRB 1JI2A 3THMH 4U3HA 5DUMH 3DVGB 3P11L 3TBVB 5E2VH 5TF1H 3MOQA 1BZQK 2Y07H 2RFXB 3VWJD 2BVEA 4MCZA 4NO3A 1R3IH 2DL2A 4X5WB 4X9FA 5IHBA 4FQIL 1I9JH 4LLYB 4KWUA 4OIIH 1WJ3A 3SCMB 1HSBB 3Q5TA 2NY5L 1S9KC 3DUUB 3FO9A 4E41A 4PJXE 2WNGA 4LVEA 4KV5E 5E1HB 4GW4A 2MCG1 3LEXB 3LDBB 4BFGA 1LEIA 4OLYL 4EQ2A 1EPFA 1JWSA 1YMHA 1CXFA 3GJFA 1IGML 4CRPA 1TNMA 5B3JF 3L6FB 4M02A 2FWOB 1KN2H 1N7MH 4HF5L 3JVGA 2A1WH 2NY3C 4W4NA 1EXUA 4LVNC 5DDHA 3QCUL 4YDLB 1EGJH 4HUWB 1KPVA 3JWDH 5DFWH 1FZOB 4TTDC 1FVDA 1P4IH 1NMCC 2VLKE 4TVPH 4N68A 1IAIM 3MLWH 4QRTB 1C12A 4PJAE 4OQTA 3HUJF 5E2TH 3BH8B 4I5BB 5DA0B 3CDGB 5BOPA 5CJXC 5HVFB 3VXSD 1EVUA 2NMSA 4U1JA 1P4BH 4FQ2H 5JMRA 2JE8A 2OR9L 5I18L 2PTTA 1BP3B 3ARRA 2VXVH 3RQ3A 2ITCA 1FZJA 1CE1L 2KDGA 1Z6JT 1Z2KA 5T5FL 3TH4T 4Y2DD 1JIBA 1FP5A 1GOHA 2Y1VA 4BQCA 4GMSL 5IM7B 4GQ9H 1XGRB 2OK0H 1WCQA 1DUYA 1MIEL 1JNJA 5EC1B 2CLRA 2X4SA 2XKUA 5F6IB 1XR9A 3E2HB 1A1NA 3SQOH 5F1OB 3ZTNL 3C5ZB 3E3QE 2A9ML 4F7CA 3IFOA 1KJ3L 5DD5L 4UQ3B 2DM3A 1NANH 1U3HD 4JFEA 4UU9B 4Y1AD 3MRMB 1N64L 3GNML 2DQEL 4NBYB 1A6AB 4PJIF 2GTZA 2C5DC 4NRZB 1I7ZB 4X9HA 1NFDE 4XCCH 3U30B 4XBPB 2XWTA 2VISA 5L9DL 2BRRL 3KPLB 2C1OA 4KFZC 4HUXA 1OHQA 1U0QA 2J8UB 5JW4N 4LEOA 4JM2F 3QFJB 1IM3B 1KCSL 4G43B 1RZ8A 1I1AC 3REWB 4OZ4B 1NL0H 1ZVSA 5IMKB 1F90H 4TNWK 3C09B 2E9BA 1RAMA 4M6MH 5C7XL 5D7KD 4N0CC 4PY7A 4GRLA 5FUCC 3SE8L 4FRWA 3S37H 1BIHA 3ARBB 4YFLF 1N6QL 4GBXB 3GSOA 2Y7QA 5C07A 1HDMA 3KNBB 4WY7H 4TSAH 1YJDL 1DFBH 5HJ3A 4QXUL 2Z91B 2OI9C 5KSBB 2VR5A 4I77H 3QDGD 5DS8B 2AK1L 5EZJB 4X8JA 4A6YL 3T04D 5T3XD 1MHPH 4QYOA 3UTTA 3IF1B 2Y5TB 1AD0B 2RGSA 5GPRA 2W9EL 2G5BB 4C58B 3FO1A 1MI5D 4DUVA 5K9KB 1I8LA 3E8UH 5EO0A 5AUMB 3RL1B 4ONOA 3IDXL 1DVFB 4UTAL 1DN0A 4XVUC 3FT2B 1AJ7H 5HYQB 4UNUA 4X83A 3MRIB 3EJZC 4LPYA 1JZ3A 1D6EB 1JPSH 4P5TB 3DROB 4XVUD 4ZDHA 1J9CT 3HC0B 4YPGB 3PHOB 5KN5A 4F37F 1YPZF 4L4TB 5CP7A 2ZJSH 3WIFA 1IEBB 3T2QA 2IPUG 1BQSA 1A7RL 4XRCB 5L6YL 3TPUB 5CBEA 5JNYB 3DOSA 4MNGA 4P9HH 3VE0A 1A02N 5C3TA 4ZO7A 3MV9D 1BM3H 4LLAA 5DK2A 5D7JB 5FGBA 1ZLWH 4B7LA 4ONHA 4PV9B 3WHXA 5FK9B 4L8BA 25C8L 5LAXA 3AU1A 5HGGS 1JGLL 3EYFA 4J3WA 5GS2D 4I48B 3GSQB 1MRCH 1Y6MR 3PXHA 4OIBA 1MQ8A 5C3LD 1A1OB 4X7TA 2IJ0C 3QXAA 1RZIA 4M6OL 5SWQA 4LSTH 3VDBA 4L4VB 2VERN 4G6KL 2V2TA 1KCRH 3DRTB 5T1KB 3QDME 1D7FA 3S4SG 1IKNC 2DQJL 3B9DA 3GBML 3MLVH 4LCCA 5GRYA 1T5WA 2GUOA 2G9HB 4IOSD 5BS0B 1P69B 4Z95L 3W9EA 2BY2A 1E4XH 5EO1A 1NAMB 3IXTB 4GUPA 3SDDC 2VLMD 1O7SA 1JUFB 3ORJA 4OM1H 5TQ0H 2YK1H 4PP2A 4X4XB 3PE9A 5JIKA 1AI1H 1J1OH 5H37H 3SDDD 4ERSL 1UZ8A 3INUH 5DJCA 4O51A 2CKBB 1CU4H 4PRAA 5BZDA 1GGBL 5DEFA 4EDXB 4R96B 4KVCH 5K9OA 2YRPA 3WNMA 4HKJA 4QHUA 3ROOB 4KMQA 2E6QA 3FL7A 1JHTA 3MFGB 4KZEL 1E4XI 1FSKB 3DX6A 4MD0A 3MLZH 4LAQL 5IMMA 4MQSB 4ETYA 1GJIA 2HKHL 1PGRB 3ARFB 4LSVH 2HJFA 1JBJA 1MVUA 3QT2A 5TH2A 1JWUB 4U6VH 1M6OA 5D93C 5E99H 4XNQB 5FO8B 1K3IA 2ZCLH 3MA7A 3VXMA 1A3RL 4ODTH 4L3CA 2I27N 3N1GC 3RP1A 1MCHA 5DFTA 1TIUA 2FBJH 4AY0A 1MPAH 3QIWB 4OBSA 1SM3H 3VH8B 4M6AA 5C09A 1UT9A 1UA6L 5GGQH 1E4KA 2MHAA 2HKFH 3QUKA 3DSFH 4GH7B 4UTBH 1OM3L 3BHBA 3QULB 5FKAB 3TFKC 2OZ4L 3MRDA 4DVRH 2VZTA 3IFLL 4Z7OF 1DZBA 1VCAA 3D3VD 1AGBA 4N0YH 2ZCKH 3S36X 4RDQG 5C0RH 4JRXA 4JFFD 4PFEA 4G42A 3KPPB 3I75A 1NC4B 4M5ZL 5DJ0B 3RTQC 1LP9B 5J6GA 1CR9L 4PJBE 1Q94A 3TJHC 1RHFA 3BPLC 1F6AA 3NN8B 3QH3A 3QUXA 3RWJB 3O81A 4M9OA 3FAXA 1QLRB 4AIZA 3EJYC 5JPMA 4FXGB 3VG0L 1MCJA 1S7XA 1ZA3A 1LO3H 4OF6A 2WK2A 3VFUB 5LQBH 5JR1L 4PJCF 4Y88A 1S9WB 2GTWA 2VMFA 4MA3A 3VA2C 1W0VB 4S2SB 4DKEL 1VFBB 4Z7NF 3IS1X 2FD6H 1Y0LA 4KZDL 4HPYL 3ILPB 4QOKB 3MNZB 1S7VB 3UTSD 5HDQL 1C16B 4LU5H 1IAIH 2FZ3A 3QG7H 3ZT5A 1C5DB 3CFCH 2WBJB 2BOBB 1T21B 3ARGA 3BJLA 2G60L 2YD8A 4NN6C 4N1EA 3FRPA 1N6UA 3CZJA 3U4AA 3VGAC 3P11H 3ES6B 1AO7E 3MCLL 5HI5C 1PKQA 3QFDB 1YN6B 3IAQA 5AG8A 4MAYA 1ZLVK 3QEQB 4FQIH 3GSVA 2CIKA 2I5YH 1P9MC 1RHHB 1EK3A 1T3FB 2EIZB 1FO0A 1IM9A 2NY5H 3FOMB 2V9QA 3KPMB 5D70L 3O6KL 3HE6A 4P9HC 4V2BA 1VKXB 5I9QB 4OLYH 1LO5B 2FH6A 4DK6A 4YHYC 4AEIH 1O0VA 4R3SB 3D48R 2XY1A 3MXVL 3HR6A 4HUNB 3G08A 2AJSH 5BVPL 2YBRB 1IAII 4L9LB 4PJDA 1IGMH 1BFVL 5CHNB 3TVMA 4J4PD 3JWOC 3SKOA 4HF5H 5ID1B 3JTSA 1RK0B 1FNGA 5HY9A 2ZZUT 4WV1B 2P46B 2NTFA 4KRPD 3V8CA 3QCUH 5DMJB 3D39D 4WWKA 4G6FB 1DEEB 4KY1L 5E5UB 4JGJA 2H9GB 1R5IA 1WUNT 3T8XA 2GAZB 3GBNH 4PJHE 1MCLA 4K2UL 5CSZB 4MSWB 4QHMB 3FB8A 3KYOB 4U1KB 3X11B 5A40E 2PCPB 5GGSB 4FZEL 4LAJH 4HUKB 3ZTJG 1EAPA 4POYA 4XVJL 5KS9F 2DLHA 5AAMA 1LEKB 3UBXB 5I18H 4GW5B 2D2OA 5C0EB 2ICEB 4QRSB 2X70A 5C0DB 3LAFA 1CE1H 5HHPB 1MFEL 5L7XL 5T5FH 3QIUD 2GSGB 4BZ1H 3I6KB 1YECL 4GMSH 2J4WL 3WCYA 1KTRL 5B39G 1MIEH 2P5WB 3LD8B 5TE7L 4XP6H 2Q8AH 1A4KB 1YNLL 5IW1B 3UBXI 3O3EB 4RMWA 1ADQA 2PTVA 3F7PC 5BRZA 4NNPL 4X0KB 4GO6B 2PO6C 2QTEA 2A9MH 1KJ3H 1KTLA 3RVVC 5FM5O 5DD5H 3STZB 2ICES 4YFDB 1IBGL 1QBBA 1U95B 2PO6D 2Z31B 3RY5A 5IR1B 1U8IB 5T1MB 1N64H 3GNMH 5CILL 2DQEH 4PJGB 3VGHA 5DQJB 5CMAB 3LRSB 3MV7D 4XP1L 3U6RA 4TN9A 3TCLA 3GI8L 4MJ5B 4X6CA 1F2QA 4X6EB 5L9DH 1AD9A 2BRRH 2B1AH 3FT3B 3SJVE 4Q6IB 3HAEH 3SPVB 1OTSC 4LLQA 1GZQB 5ID0B 2ESVE 2FIRT 1KCSH 5H2BB 1FVCB 2BY3A 1PSKL 1OTSD 4Y5VC 1I8IA 5DZNA 4NRYA 4TUOB 5C7XH 3BO8A 4ZAKA 4BZ2L 3I50L 4WW2C 4IRJC 2EE2A 1FV1B 3HAEB 5GS0C 1PY4A 4Z77A 3KGRA 2R1YB 3NCJL 3TN0A 1YJDH 2I25N 1QOKA 3CMGA 5GS0D 4D0CA 2J3SA 2A2QT 2BNQE 2JJSA 4ZPTA 4QXUH 3DXAD 5HVWA 2D0GA 1J0ZA 1MJ8L 1U8NA 5EPMB 2AK1H 4P4RA 1PG7X 4A6YH 4Q9CA 1KJMA 1NGZB 2AAVA 3UPAA 2YUWA 4LOUC 2XPGA 1N2RB 4P5KA 3VDAA 1T0MB 1FYHB 1G9NC 2W9EH 1LO0L 4PRPB 1BQUA 1D5ZA 2QSCL 4EI5B 4PJFB 1JZ4A 3IDXH 4NFBA 1J8HD 4APQB 1QNZL 4UTAH 1RVFL 3T08A 3AS0A 3JV4A 2EIDA 4D0BA 1YMMB 2ZOKA 4A6YB 4LSUL 3VRIA 5FYJU 4XCEA 1SY6L 3V9FA 5I2IB 4ZODA 3WO4C 1JZ8A 3E3QC 1CLCA 4IJ3C 3UROR 3MRLB 4Y0GA 4CUCA 3VFTA 3KPRD 3BZFA 1A7RH 5E03A 4KPHL 5E9DB 5L6YH 5EC2B 5FCSH 1OPGL 3DTXA 3WFBL 3RKDD 5H94B 5IB1B 1T6WA 4GSDL 1OSZA 2AJZB 5GJSL 3H9SA 2V9TA 4KK8C 4J1UA 1QVOA 1A5FL 1AXSB 25C8H 4NKDB 1N59B 2NY5C 3TEUA 5MENA 2JB5L 3CVHA 1JGLH 3BP4A 5DJ8A 3GSWA 4KK8D 5HBBA 3EYUL 4CKVX 2VQ1B 3MNVB 3CSYA 4EVNA 4LLVA 1UB6A 2HT2C 3BZ4B 3OSKA 4G6KH 4HV8B 1ZLVH 2C1PB 1RIHL 4Z8FL 2HT2D 2JJTA 3MROB 4Z6AT 5CBAA 1TJHL 2DQJH 3GBMH 1HI6B 2HN7B 3OG4B 5IOPB 3B2VL 4QHNA 1F8TL 4Z95H 2OJEA 2RQ8A 5F1SA 3BP7A 3QI9C 3JTTA 3MUJA 4Z5RA 2A77L 3Q5OA 5DXWA 4ZFFB 1I8KB 1P7KA 1PZ5B 4NQCE 1DBBL 4NWUL 4ERSH 2G5RA 1G6RB 1QR1A 1Q9LA 3CXDL 3MRNB 4TTGA 1Y6NR 1GGBH 3RU8L 2G75B 1I3GL 4JFYA 2Q3ZA 3IFPB 2IG2L 3E6HA 4C56A 2WLYA 2Y36L 4R7DA 6CGTA 1OP9A 4ZXBC 1XT5A 1QLFA 2QLVB 4KHTL 3ZE1E 2BZDA 1E4WH 2P24A 2QQNL 4HUVA 4J3XA 4ZXBD 2V5RA 3IDMB 3NPZB 2NW3B 5B4MC 5ICZA 4KZEH 2A74A 2V2XB 5HYEA 3S6CA 3OKDA 3QQ4A 1I1CA 4F2MB 1HKLL 2HKHH 5F7YC 3ZYIA 1F3JA 5HYJB 4PJ7F 3VXOA 2EH8L 4OCWL 1MSPA 1OF2A 1AFVL 5FDWB 3G04A 2DYPB 2X7LA 3FFCB 3NFSL 1A3RH 5A1AA 1W72B 2X40A 1G7JA 2Z8SA 2DMKA 3U0TA 5E94B 1GHFL 1KB9K 3S35X 4YDVA 4MLIA 4XXCA 1ZLSL 1UA6H 4H25B 1J11A 4EN3A 4G6MH 2BNRB 1A7PL 1ZOXA 1OM3H 3QXWA 4LKCA 4HEME 4U4BA 4YC2C 1HOCA 1OGAA 2OZ4H 3IFLH 4YHZL 2A6IA 2ARJQ 3PIQA 4TSBL 4DWHA 4PG9B 3S5LG 3ZKXB 2CXGA 1BIIA 3O6FA 1SJHA 3S4SA 2DQTL 5D6DC 3KPSE 1BJMA 4YXKL 4K3EL 1JYVA 1QFPA 4RCAA 1C7SA 3F12A 3OKYA 4M5ZH 3J8F7 4OZIF 4XVTL 2WIMA 2OCFD 2NW2A 1CR9H 3V6ZA 1U8QA 4WUUE 1RULL 1N0LA 5ESVB 1RUPL 3ZYZA 3BZEB 4WEBL 2AEWA 3HZMB 5BVJB 3VG0H 4QGYA 4JG1L 4WI4A 5EOQL 4OAWB 1PAMA 5DD0L 1GC1L 5JR1H 3BYTA 3DMMA 5DD1L 2W0FA 2E9IA 3UTOA 4M4PA 4DKEH 4KZDH 4IRSB 2ZPKL 4HPYH 1R5VA 1UH2A 5FIEA 4B7IA 1DJSA 1HCVA 5J9PA 2YC1B 5HDQH 3CPLB 3LB6D 1NSNL 4NQDB 2Q76A 4BQ8A 4CU7A 5HHOB 4MNQB 3TIEB 2G60H 4OFKA 4GRLD 4XPHL 1J18A 1NBZA 5D5ME 1YN7B 3MCLH 5FO7A 5C07D 3W0WA 3QAZB 3D87B 3MREB 3L9RA 1M4KA 2HJLA 3AY4A 3B9KC 3ARUA 3ARDA 1T04A 4O2EA 1MHEB 2VLRE 2DDQL 4UINL 5FYJL 4FHBD 3CU7A 5D70H 1U8HB 3O6KH 1K2DB 3QCTL 3UTTD 1INDL 1RU9L 1WWBX 3BEWA 2E3VA 4I1NB 3S7GA 3H3PL 5KZCB 1S7RA 2X1QA 5GXBB 4DKAA 3MXVH 2GT9A 5FA4A 5BVPH 2EIEA 2CK2A 2EKSA 1BFVH 5T3ZL 3O8XC 5D1ZD 2J5LB 1CZ8L 3VWJB 5IB5B 4DK3A 4YBLC 4MD5A 3MLTA 2Y06L 3O8XD 3PP3K 3GKWL 3KYMB 4KUZL 3LSOA 3IU3B 1IZKA 4QLRA 4Y4FC 1AIFB 3O2VL 5J8OA 4YNYA 3MV8E 4KY1H 5DD6A 5ELIA 4IM8A 2AABL 2Q8BL 4KKBC 5IWLC 4X4ZA 4DUXA 2IPKB 1ND0A 4KDWA 3OKNB 4KAQL 3K3QA 3QHFL 4K2UH 4KKBD 3B9EA 4HIJB 1B4JL 5BQ7A 1FL6A 2DBJA 4PRHA 1GYAA 5CEXB 4U1GC 4OLZL 4FZEH 2FR4A 3LVEA 2QV2A 4XVJH 1G0YR 4Z7VB 4H1LA 4NKOA 5EWIL 3N1QC 5TQ2L 1M7IA 2F8XC 1MFEH 3VD7A 1T1YB 5L7XH 4M61A 4ODWA 1YECH 2J4WH 3MZGB 5J06A 7FABH 4IDLA 2KZWA 5C9JB 3L3HB 4G8EB 3P4OA 4I0CC 4QHKI 4QXWA 1IGTB 3A0OA 2EXWD 1H3VA 1XGUA 4RZCA 3VXSB 4NNPH 3RWEA 4HS3B 4L8SB 4LRIA 4QO1A 2XTJE 4PJXF 5JHDE 4NZTL 4KV5F 3PGDA 2FHFA 3VXPB 4HWUA 4BA8A 4I2XE 1IBGH 4CN6A 1ED3A 5CILH 1F00I 1I1YB 5TGBA 2GK2A 2AJVL 3QNXA 5I1GL 3MJ8A 4Y2DB 2BJMH 4OF5A 5FYJE 3HZVB 5JXAL 3GI8H 5ANMB 1X5IA 4GG8B 1GGTA 3DVNB 4MMXC 5JIIA 4OKDA 5I16B 4LNRA 4AEHL 4X6FB 3OKKA 3OR6A 3C60C 4WW2F 5E2WL 3ARYA 4U1HB 5T3ZE 3D6GA 1I7RA 1JWMA 3TBTA 5D4QA 1PSKH 3BI9X 1NC2D 3LV3A 4MDJB 4PJAF 1U3HB 3PV7A 5F89A 3BGFB 2Q87A 1OOAA 4Y1AB 1CE6B 4WCYL 1B6DA 4BZ2H 3I50H 1ROWA 4JJ5B 1AGEB 5K9JL 4PGCB 2NX5E 1U2CA 3ARXA 1KPRB 3IGAB 3NCJH 1JTTA 1HWGB 2UZYB 3VXMD 4HX1A 2H6PA 4XX1G 2GJZA 2R2HB 3EDJA 2QADC 5FOBB 2NY0C 1MJ8H 3IKCA 2Y6SD 3BUYB 1HQ4B 2L7UA 3QISA 4QHLA 1I7TA 3VFWA 2NY0D 3S37X 4XCYB 1NCAL 2ED9A 4LIQL 5HGAA 2B20A 2NR6D 1OAXL 2QSCH 3MLYL 4MX7B 3TO4A 4XH2A 3KLHD 1U3JA 1QNZH 1RVFH 4UUJB 4AENA 2GQHA 3LN5A 3IS0X 1V7NL 4HMEA 4YLQT 2EDQA 4LSUH 4XHJC 4JRXD 5D7IB 1H8NA 1XF5B 2XG4A 4U2YA 1SY6H 4E0RA 3F7VA 1MRFL 5KVGL 2AK4A 1MAML 3AM8C 2QQLL 5DHVA 3QDGB 3QEUB 4XHJD 5AYUL 4F58L 2OL3A 4LCWA 4RGND 3PHQB 1TCRA 3QUXD 3DV6B 4KPHH 1HXYB 2CGRL 3O4LA 4HWBA 1NFDF 1OPGH 3WFBH 1XF2B 1MI5B 3LN9A 3OKOA 3VGFA 1QR4A 4X7EC 4RSVA 4GSDH 3NFPB 5GJSH 3VU2A 5IK3A 1A5FH 1NBYA 2JB5H 1JL8A 1KB9J 2H2PD 5EBMB 4CVZA 2OXGA 4FABH 1CDHA 3EYUH 3ECBA 4XHQA 1T83C 5GS2H 3SJVD 2EDBA 3T0DA 1RIHH 4Z8FH 4CMMA 1KCKA 1CGTA 3GMRA 3OX8A 1TJHH 4JZJB 3B2VH 2DMBA 3QUYA 3MV9B 3SY0A 1F8TH 4JKKA 4H5SA 4MAYD 4WTXA 2LU4A 4HWEL 4EXKA 4P2RE 5C1MB 3CC5A 5F7LB 2WMPA 3ARSA 4AM0A 1KPUB 4TUKL 1RY7B 1JF5A 5DK3A 5ACMA 1IM9D 4KUCD 3DYMA 2IQAB 1DBBH 4HXBL 1NCTA 1Q38A 4NWUH 1HQRB 3MLSL 3PV6A 1RJLA 4N0FB 1P5VA 3CXDH 5ADPL 1PJ9A 1G0XA 1V3KA 1OD7A 1X4ZA 3Q0HA 3RU8H 1I3GH 3TVMD 2IG2H 3KYKL 1S7TB 5C08E 3AS1A 3QZWB 4FXKA 5A2KH 3FCTB 3TWCL 1OT2A 1I1FA 5I74C 4MHHG 2X4OB 3FFDB 3L3DB 1FN4A 1HXMB 4KHTH 3IDGA 4LIQE 3VFNA 2QQNH 1MCNA 4X99B 4WWKD 4JHZA 1JCKA 1MWAA 4MS8C 2X1WL 4ZPVB 3PABB 4OLXL 3SDDB 2VXSL 1HKLH 4I0PC 1QFHA 1QRNA 2NY1C 4GG6B 3OL2A 3S88L 1INQB 1IAKA 2EH8H 4JQXC 4OCWH 3B9AA 2X4UA 4DVBA 4OB5L 1UKSA 1AFVH 1EO7A 3E1F1 3GIZL 4M7LL 4IMKC 4W4OA 1FHGA 3NFSH 3RVXD 3W82A 1X5HA 2BC4B 1GSMA 4OQTL 3BD3A 4QRRE 3WS6C 4MXWH 1LILA 2DLIA 2F5BL 4BKLA 1GHFH 1Q9WA 5DJXA 1ZLSH 4I4WA 3DVGA 5KSVB 4Y19E 3OHXA 3OTTA 2XFXA 4PJ5E 1A7PH 2RFXA 4WNQA 4G5ZL 4WIQA 4N8VB 3X14B 3RDTC 1TLKA 4ZNCD 4CW1B 5HGHB 4YDJB 4DCQA 1WCBB 5J1TC 2VUOA 2YWYA 1V5JA 2QL1A 5JTWA 1F58L 2FX9H 1CG9A 1SYVB 4LPCA 2DQTH 2J2ZA 4FS0A 4YXKH 3DUUA 2HFFA 3KWWB 5C6WH 4K3EH 5I8KL 5BW7A 2A73B 4EBQL 1EBPA 1AKJA 2ZCHL 1H5BB 4XVTH 3TIDB 5EBWB 3UZQA 3MNWA 1LE9B 1K85A 1JF1A 1CCZA 1P2CB 4P23A 1RULH 3V52L 1GGCL 3LPGA 2VZ1A 3Q5YA 1RUPH 3MRCB 4WEBH 4FMFA 1FGVL 2AEPL 5EOQH 2JJWA 5DD0H 1GC1H 4DZ8A 2CDEA 3D3VB 5DUBB 5DD1H 5GGVL 5TDOA 3D18B 1FLTX 2W38A 1EEQA 4HUUB 3RBGA 4R26L 4OZFG 2ZPKH 3MRPB 4JFFB 3UPCA 3FQUB 4WHYH 3RWGA 1MHCB 3A6BL 4WI9A 3HE7C 1NSNH 3QRGL 4G3YL 3BH8A 4I5BA 4U1NA 1DQDH 4KJQD 5CJBA 4DOHB 4LSRL 2JCCB 4XPHH 2C7UA 4MD4B 4ZTOL 2X5PA 3BPLB 5IB2B 4B50A 4QEGA 1AHWA 2P8MB 4U3XA 3DV4B 4LEXL 4WI3A 2EDDA 5SWSE 1U92B 5IQ9A 2F74B 4ELKB 5FM8A 4BFEA 2DDQH 5FGCE 1FZKB 4UINH 5FYJH 1NEZA 1FIEA 3MODL 3QSKB 2XI9A 1TQBC 1XGRA 3QCTH 5C0CA 5C70A 1INDH 1RU9H 1CFQB 5D2LE 3H3PH 2BNUA 3QO1A 4MJ6B 1IAOB 5T3ZH 1ORSB 4HFUL 2I60L 1FAIL 3LEVL 1CZ8H 4LKXA 3VGBA 1A7NL 2Y06H 4QTHB 3GKWH 4KUZH 5B8CA 4P3WA