2HWZH

Fab fragment of humanized anti-viral antibody medi-493 (synagis tm)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
227
structure length
227
Chain Sequence
b'QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDDKKDYNPSLKSRLTISKDTSANQVVLKVTNMDPADTATYYCARSMITNWYFDVWGAGTTVTVSSASTKGPSVFPLAPSSAAAAGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin Fab light chain
molecule tags Immune system
source organism Homo sapiens, mus musculus
publication title Identification of a single tryptophan residue as critical for binding activity in a humanized monoclonal antibody against respiratory syncytial virus
rcsb
total genus 39
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2006-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hwzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hwzH01
2C3VB 5ALBL 5ERWB 3BZFA 3SE3A 3DETD 1HXYB 1LO4L 1C12B 4LSSH 3N1PC 4LLVA 4FTVB 2BDNL 2Z93A 4U7SA 5AUMA 5CZVH 4KKCD 2A83A 3VFGH 3TBTB 5ETUB 3KYMA 1FYTD 1YECL 1CFVH 3VXUE 5ESVB 4XNXH 2D2OA 1WT5C 3FB7A 4D3CH 2NTFB 3KLHD 1ZWIA 3LN9A 4XBEL 1R3IL 4WVRA 4CMHB 1TLKA 4GMTH 3DXAB 2X44D 5ENWB 4Z7OE 1YEGH 3IXTB 5EU7C 3CZFB 3I9GL 1YPZB 3QDMB 4N0RA 3PXHA 4OCWL 1DSFH 3P0YL 5ANMB 4LKCB 5EORH 4X9FA 4MZ2A 2NYYD 5I8CA 1B6DA 2DIAA 3FCTB 1RULH 5KW9H 2NXYB 3VGDA 1MAJA 5E1AA 4IJ3C 4YDLC 3LKRA 4NWUL 4XWGH 4N8CH 5D1ZD 3MLSH 2VZVA 1O0VA 3TJHD 3OKKA 2X09A 4Z5RB 4OUUB 1C08A 3T0XA 4HS6A 3U1SL 2IAMB 1MAKA 1A6AB 1WZKA 2VQTA 3ALWA 5D2LE 1V3KA 4ETYA 5IESH 5I1EH 1JFQH 5JZ7C 1S9VB 3S35X 3BWAB 5F7FA 2F5BH 3RTQB 1CXIA 2XZAH 4FQ2L 4RAVB 1MCLA 1H15B 5E2UL 4KJWD 1BGXH 3IU3B 1K6QH 5DLML 4R8WL 2X6MA 4PGZA 4XC3L 3CFKB 3S7GA 5DJZA 3MA9H 3G08B 4Z9KB 2YPLB 4AH2A 4YHLL 3FT3B 3O2VH 1ZWIB 5AD0A 5GGUA 2ICWJ 4YUEH 3QPQD 5K9OB 3OX8A 4MVBD 2C5DC 4FFYL 3ARBB 4N9GB 3TVMB 2FIKB 2FSEA 5TFSH 2OJZH 2FD6L 4M93B 2R69H 1JYNA 5AYUH 1G0DA 5DD6B 3HNTL 5D8JL 2DQDH 2WIMA 4PJFB 3K0WA 1T1YB 5CMAB 4YHIB 4TSAL 4NQED 2A74B 2D7MA 3R0NA 4MAUL 4G8GB 2ZCHL 1H8OA 4ODBD 5GJSH 1T3FB 4BK4A 5FYJL 5FYKD 2AKRA 4PY8J 5IQ9A 3KYKH 4OCXL 1H3PL 1JE6A 1QSEA 1GGCL 3VFSB 2EC9T 5E1HB 3T2OA 2ZCKH 2HVJA 2ITCA 2WBWB 4GKSA 2JIXD 5CUSH 5IVXB 3R06A 2AJVL 1MHHB 5GS0D 4R96B 2VMFA 4G3YH 5I75C 1TQBB 1NFIA 4JQXA 4TQEL 3IU3A 5B8CC 1YY8A 3UYRH 4OLUL 3MYZA 3WL9B 1WBXA 5FEBA 1I8LC 5AUMB 5EO1A 4R7NB 3FO9B 3O9WB 5CJOH 3IFOA 1GCFA 4JQIH 2O26U 2GSGA 3BSZL 4I1NB 4HG4K 2BK8A 3ZKXC 4PG9B 3L6FB 1D6EB 3VFWA 2AQ2A 4IRJA 4BK5A 4JO3L 2EEDA 1PQZA 4HWZA 2YA1A 5J0BA 1TVBA 5A2FA 3VXRB 4PJIB 5E08H 3PHOA 4KTEL 4QHLB 5BO1H 5FA3B 4RQQB 4OB5H 2W38A 1R5VA 4YPGB 4DN3H 1RZFL 2AJYL 5TDNB 3FTGB 4PJFF 3BGFB 4JY6A 3NVQA 4EBQH 1MI5D 3VXUD 4N0UA 1O5DT 5L7XL 1GAFH 3BZ4B 2FLBT 3BDXA 1HIMH 4XCNB 2R8SL 2I5YH 1JYXA 3H9SA 4DGYH 2CLZA 3DGGA 3QEQA 3V8CA 2OMBA 5L0QC 3BJ91 4M48H 4EDWL 4Y5YA 1NFIB 2ZCLH 1T2QL 5BZDA 2CLRB 4KI1A 4BKLB 1BQSA 3QUXB 3TPUA 4IRSC 1KJ3H 1R0AH 4HWBH 2AJVH 5JHDD 5F89B 1JUFA 3WFDL 5CLWA 4DWHA 3MV8A 3O2DL 4DQOL 3RHWF 1MRCH 1CGXA 3F7QA 4WI8A 3OF6A 4ZO7A 3V5HA 4Z7UF 5KSBA 4OCWH 2VZTA 4DVBA 4I8DA 5H2BA 1UZ8A 3BISA 3IAGC 4APQD 5IMLA 1BQHG 4EI5A 1SEBB 3RWHA 3SN6N 5FA3A 5MHSD 1RV6X 4K7PL 5CMAA 5LAXA 5DVKA 3IFNH 1XGQB 2R29H 4XNXL 4EVNB 4J1UA 4PRID 4ZTOH 1X5LA 4HS3A 3GSUA 3V95A 2WLZA 1QLRB 3Q6GL 1H3VA 1FC1A 5CZVL 5I8OL 1HKLL 4CU7A 3QQ4A 3WNOA 2ZJSL 1IGTB 2BSSA 1J1OH 3MV9A 3EYUH 1FL5A 2CDEB 1I3GH 2IJ0C 5A3IC 4L8DB 4R4ND 4CVXB 5IBUB 1TFHA 5HHPB 4MWFB 5K9KB 4OAWA 5EO9A 5KSVA 5HYJD 1F58H 4XC1H 5FKPA 5A16B 4JZNA 1CBVL 5E00A 2EO9A 3M1BA 3MLTB 1MFEH 1EBAA 1H0DB 1KJMA 4P4KC 1BM3L 2XA8H 1PJ9A 4LCUB 4MS8D 4R7DB 2DICA 5IFJB 2D0GA 4IHOB 2W0KA 3SGJC 1EEUA 3ULVH 3MJGX 4GXUM 3RJDA 5JW4N 4TNWK 2PYED 4LPUA 1EH9A 4CADB 1LP9E 4B41A 5DEFA 2QR0A 5EO0A 4U1HB 4KTEH 5B8CA 3EOBA 4J12A 1K9TA 1T03H 1AJ7L 5I1IH 1JV5A 4JRYD 4ODSL 1ZVSB 4LLMB 2EDFA 3KHQA 4EUPA 5IB1A 1EK3A 3G6AB 3HE6C 4MX7B 1G7HB 4EIGB 5KAQG 1B4JH 5KOVC 3EDEA 3KNBA 1SY6L 5IFAH 3GIVB 1BX2B 3WUWB 3TYFB 3VXUA 2NY0D 2A6DB 4K94C 4ENED 3STLA 5BS0A 4MXWH 3FT2A 2H9GA 3P4LA 2ERJC 3NIFE 3W0WB 3ISWA 5F96H 2N4IA 4MWFA 1RZFH 2AJYH 2K1MA 3I6GA 3A67L 2OZ4H 3KPSB 3RU8H 1XGTB 2VDLH 4LSVL 3INUH 3BHBB 3IJHB 5ACLA 4G6FD 4Y5XB 3M1BB 3TO2B 3EIFA 4HUWA 3SY0B 4PY7A 1KJMB 1D6VL 3GIZH 2X4TA 3HC0A 3QPXL 4G8IB 4HKBA 3HPJA 3O2WH 1I9IH 5HVFB 1XGYH 5LBSH 4JM4H 5KBNC 1MVUB 4PD4K 4M48L 2QKIB 4OCSL 1LD9A 2IALA 2YS4A 1FN4A 4PJGE 1OWWA 2DB8A 4IIQC 4U6VH 1LO0H 4FFZL 3MROB 4JN1H 4XVUD 1JHKL 4RDQG 1CIDA 1FL6A 3U30B 1ZLWK 2R39A 5IK3A 1H5BB 1W0YT 3HHRB 3SDYH 2C1PA 1KXVC 3PV6B 5C07E 3X14A 1OGAB 1YPZE 1SY6A 3QDME 2BNQD 4BSVB 5IT2L 1OT2A 4OGAC 1MQKH 3QO1A 1IGTA 3VD5A 5DK0B 2BNQB 5DRWB 2FEEL 2A73B 3OJVC 3FQWA 2H32H 3LKNB 4M6NH 5F6IC 5IJKC 3S37H 2F58L 1JJUA 5T1MA 1DVFC 5AZ2L 3GM8A 1ORQA 4C56E 3EOTL 2NY6D 5DQDL 3WIFA 1ZVHA 3ELAT 1OF2B 4PRNA 2FR4A 1QFWI 1UH2A 5IKCB 3FFDA 4PIRF 1NJ9A 2X4TB 4HIIA 4W81A 1XR9B 5A40E 5INCB 4ZQKA 4Y19E 3AMLA 1I7RA 1T0NB 1A6ZB 4IJ3B 4N0FA 4V2CB 3RWDB 2W9LA 2DJSA 32C2A 4YBLC 4P5TA 3BD4A 4PB0L 5F7EL 1L6XA 1ACYL 5SV3A 2ESVB 4KMLB 4I3RH 2O5YH 1N2RB 2P5WE 2H45A 4L9DA 2OS7A 2YMXH 1MCIA 4AQOA 2MKLC 2PO6C 4G9FE 4Y5VB 4U1MA 3ZDZF 4Y88A 2IH1A 4M62L 1I9IL 2AK4E 3QQNA 1UWGH 4HXBH 2DDQH 3QEUB 4WI3A 5ID1A 2EXWC 1D5IL 1T03L 4P3CL 1P2CA 2CRMA 2OL3L 4ZUUB 3TYFA 4NWTL 3UYPA 3QO1B 4YHNB 2A6DA 2OZ4L 3GMPA 3ALXA 1Q1JL 1TNNA 1BZ7B 4FFVC 3EUUA 3T3MF 4EKXA 4TNVK 1JNNH 5GS1B 4WI2A 5INDB 4ZDHA 3MRQB 5BOZG 4LDEB 1BFOB 2DYPA 1M05B 3QUKB 2G9HB 4MJIB 2DTML 2HH0L 3IDYC 3WJLC 1N8ZB 2V2XA 2BY2A 1JPSH 2D03L 2HP4A 1T7XA 2VISB 4LKXB 1W8OA 3O3AB 1NCCL 2VTFA 1AO7A 1EHLH 1NDGB 2VR5A 3BMWA 4WUUA 5F21B 3HZVA 4JJHA 2FO4B 1BAFH 5DQJB 3MO1B 2IANE 4RMWA 3OKOB 5I1EL 1FN4B 4H25B 2H8PB 1T83A 1FFOA 1P84J 5EU4B 2AV1B 2NY5L 4RISL 4J6RL 1N0XL 5EU3B 3T09A 2HRLA 1ORSA 5FIEA 3MCKB 3GBLA 5C0RL 2HMIC 1MHEA 4HIHB 5CKGA 4QXUH 3A6OA 3CPLB 1MLCA 4IS6B 3OHXA 2R1YA 2VDNH 5H94A 4OZFH 2ERJB 5T3XD 1UM4H 5EB9A 4ZYKA 3T08A 3WS3B 4UIKL 5FHBH 5D7IF 4IBLT 5KW9L 2F53A 4DEPB 1QTYT 3VMPA 2VLJD 4B53A 4YHNA 4I13B 4N1CA 3ZLQC 2BVYA 1KJ2H 2J12B 2FX7H 5GRVL 4WHTA 1XFPA 2ZSVB 3HE6B 3MPCA 4JFEE 5DVMA 2BHZA 3DO3A 4KHXH 4MQ7B 3ULVE 1DUYA 3UTZA 3P11H 1QFWL 1HHGA 3B9KB 5T1KA 5I8OH 1Q1JH 5D5ME 1KENH 1S7QA 1KCLA 4LVNC 2ZCLL 4TTDC 4JFOB 1TJIL 4JY5L 4ELMF 1P4BH 3IKCB 4UINL 1FRGL 1UACL 5IW1B 1M6OB 2W91A 2X5PA 3KPLA 3QIUD 4Z8FH 1A7BA 1H3TA 5TQ0L 2VC2L 2AV1A 4J23A 1TETL 3UTSE 1T4KB 3RAJL 1FFPB 3GBML 4BH7A 1P5VA 1R3KB 3BWUC 2CH8A 4DAGL 2IF7A 1IGIL 4FXGA 4HK0A 3PGDB 4F7PB 1RUAH 1JZ4A 4JFDA 5E9DD 3MLRL 4YHPB 5FGBA 1BECA 4HH9A 4Z7QF 4JFEB 2EIDA 2HFGH 1YPZA 3QDMA 5J1AA 4QRUB 3QEUA 2VNCA 3KLHC 4X98B 4EIZC 1AGEB 1P2CB 2VH5L 3C8KB 4D8PB 4Y5YC 5IMOB 4YIQA 2BNUB 3MLXL 2FJGA 2C4FT 5C8JB 3VDCA 3PP4L 1F4AA 3MLYH 5FUOH 1CT8A 1A2YB 3AXLB 1UYWH 1G9NL 2XWTA 1GGIL 1GAFL 5KSAB 1I1AA 2BNRD 2OL3A 5HGBB 3WBDA 1NGYA 4KK9D 1F00I 2H26A 1A7PL 4Z78A 3OMZA 5EC2A 5DJ6B 4QRRE 4I9WD 3IVKB 3DV4B 2VUOA 2O5XL 4WWKA 4KMTL 1RUQL 5E2WL 1J1PL 4WUUB 2OR9L 4LF3B 3QUZA 3VE0B 1RZKH 1UEYA 1R3LA 4ZPTB 4UDUB 4P2QE 3MV7E 5CINL 5F3HB 3WDHA 3SQOH 1D7FA 4X5WA 3RDTD 3BVNB 3RWJA 2NY1C 4MCZA 4TOYH 1ONQA 2GAZB 4OT1H 4YHPA 3GGWA 4NBXB 1MSPA 5MHSE 1I1YA 1I75A 5C0JB 4M61B 3RGVD 3MYJA 1MLCB 4IS6A 3OXRA 3AS0A 4WI9A 5DK2A 4ZAKC 4QRUA 3MV9E 4YDIL 5I76A 3VD3A 4LPXA 1J0HA 4HMCA 5IBLC 3MRHB 4G3YL 4M7ZC 2F54D 4PREB 5D6DA 1KLGA 5I19L 2YZ8A 1REIA 2X4QB 4Q2ZB 4JHBA 1DLFH 1HHIB 3OKDB 2JJVA 4R97C 5DFVD 3HG1E 4OQTA 4OLWH 2LABA 4IRZL 1HOCB 1YMMA 1QPXA 3BKCH 4OCYL 5J57B 2HVJB 1T20A 3MJ7B 1NAKH 5T3XE 3KYKL 1UA6H 3FB5A 4UT9H 1FZOA 4LSDA 4TVPL 5F93C 4BH8B 1TJGL 2VZUA 1L0XA 5D1XA 3BI9X 2BMKB 1U36A 3TT3H 1HYSC 2ATPB 4Y4HB 2YPLD 3JV4A 2Q8BL 1NGWB 3VXQA 4NQEB 1KCRL 1F4HA 4AEIH 1GZPA 3STBA 3O9WA 1AI1H 3N1QC 1J1OL 3WD5L 1NCTA 4UV4H 2HFFB 2NXYD 3GGWB 3RKDD 3FB8B 1IILE 4OFPA 2AABH 5GZNC 2JB6B 3HS0B 4RFOH 1T89A 5I76B 4HGMA 3QDMD 4PRIE 2O61B 1CGSH 1WZMA 3L5XH 2GW5A 3WJLA 4HC1H 5JW5B 1QOKA 1JPFB 1JTOA 3W39B 3V4PL 3MRFB 4X4YA 1RJLA 4BUHA 4KK8D 1E4KC 3CH1A 4PGCB 1F5WA 3GMQB 4DKAA 1PYWB 3HR5B 4N0UB 3PWNA 3BYTA 4RISH 1NKOA 4ZG1A 3MOQA 1A5FH 1CN4A 2ZZUT 4U1IB 4U6YB 2XFXA 4Q9RH 3UTTA 1JPGB 2R15A 3C6SB 4E0RA 3GSQA 5FYLE 4I18C 4Z7WE 1LK3H 4XPAH 4FZEH 1MEXH 3LD8C 5L2JB 3UPAA 1RJCA 1P7QD 3P0YH 4F2MA 2DI8A 5KSUA 1B0RB 3IDIA 3LMJL 1FYTB 2OP4L 3GO1L 2HT2C 2VDOH 1MRDL 1IZKA 3QHZH 2VDRL 1FORL 2XACC 3BEVA 3UPRA 2X40A 4LCWD 1NKRA 4OCNC 3BE1L 2EC8A 1ONQB 4RZCA 5D6CB 1IAOB 3RGHA 2VLLA 3HUJE 5C0JA 3NABH 1FAKT 2GSIB 4P4KB 4CVWA 1BBDH 2K9UA 4KI5C 3WEXA 4F58L 4YXLH 4G9FB 3LH2L 4JFFB 3C60B 5GGSY 3MBED 3BP7B 3D0VA 4P5KB 1J7VR 3FQXA 5IIEB 4OQ1A 5CD5D 1RJZA 4X5LA 1NCCH 3UTPD 1RIVH 5E6ID 4G6AC 2J2ZA 4JB9L 3QXDA 5T1LA 4KDVA 3QUMH 3C6LC 1HWHB 1I9EA 4GJTB 2APVA 1GC1H 4U1IA 4U6YA 4L8SB 2Q6WA 4WW2F 3ULVD 3MLXH 1ZSDA 1HOCA 4YC2C 3T2NH 1AFVL 4FQIL 4XMPH 2ICCA 5TE6L 1SYVA 1L7TL 1VGEL 3O8XC 1OTSD 4ZMAT 4F7EB 1XR8A 2J8UF 4WI7A 4OZFA 4Z76A 1F4YL 2EDTA 1CDYA 3QCUL 3SOBH 1QUNA 4ZFOB 4PGEB 4C58B 5E24E 3HI6H 1AGFA 5B4MD 5SX5K 4Y16A 3BKMH 4MLSA 2BOCB 5HHVH 3BEVB 1FGVH 5FA4A 3D2UB 4NJAH 4ZO6A 2A83B 2MCPH 1YEJL 1BOYA 1T89C 3KJ6H 5ETUA 3EDFA 2HFFA 5E2TL 4S1DC 1P69B 1P4LA 2BRQA 3FZUC 3K8LA 1NAMA 3V0WH 5KSBF 4G6FB 1K4DB 4G80B 2C3HA 1CGUA 3VXME 5K9JH 1HEZA 4JFYB 1BZQK 1WC7A 4B50A 2VO5A 4G7YL 1KYOK 3IDMA 2CXKA 5FYKU 4P9HH 1RJZB 1FZKB 4AIZA 4HKJB 1RJYB 5C0AE 4RGND 5DT1L 5DR5H 3QIUC 4PGCA 4L8SA 2Q6WB 3QDHA 3BIBX 3DHJA 4MYWB 3HPLA 1G7JB 3QI9C 3WJJC 1DN2A 4NT6A 3IJYB 3VFPB 1JHLL 3L3DA 3O6LH 3WKNA 3FONB 3SDDD 3W0WA 3DROA 4X6BB 2KQNA 1RAMA 1E6OH 4YHZH 2I9LA 1BLNB 5FUOL 1NPUA 1XGTA 3BKYH 5ABDE 4X80L 1SQ2N 4JDVB 3U0WH 5K33A 3QPXH 3OKEA 3SO5A 5DS8A 3ULVF 1AH1A 3KXFA 5FA4B 3SDCA 3V6OC 2IGFH 3AREC 1JNJA 5TGBA 3U7WL 4ZUTA 3ZKXB 4MA7L 3CFKA 3MUY1 1RZKC 3G08A 5GZOD 3HAEB 3SE3C 3SDXA 5DFTA 1FAIH 2ITDA 1S7UA 4ZUWB 5C0CA 4GAFB 1UM6L 3OG6B 4GLRI 5ADOH 5JXED 1D3CA 1XIWA 3L3GA 4X7SL 2QQNH 5C0BB 5D2LF 1KXTB 1AO7D 2WIIA 3BP6B 2NY0B 1ZHKA 2G5BB 3TH4T 1TQBC 2HJLB 4LLMA 4OZ4B 1U8MA 2FRGP 4Z0BL 3H3KA 1U93B 3G6AA 1FO0H 3TBWA 4XBEH 4Y4FB 3QXDB 1AJ7H 4XRCA 1I3RA 3H9SE 3GSRA 4YXLL 5IUSA 1RSFA 2H32A 5IQ9B 4XNMB 3VXRE 2WAHA 3PWVA 2XZZA 1IKFL 3L5WB 1MCWW 2ZUVA 1F6LL 2AV7B 2MQCA 1JGUL 4I48A 1IM3A 1X7QA 2J1KA 5GS0C 3RDTC 4J4PD 2YPVL 1M71B 3VW3H 5C0EA 3PQYA 1PW3A 1LEKB 4R97B 2A9NH 4P59H 2R23A 1MHHA 1XR8B 3RNQB 1S7TB 2C1OA 4YDVA 1SJEA 3GJFH 4C83A 3ZTNH 4FABL 1YEFH 3MRNB 1T2JA 4W68A 3C2SA 4X4ME 1D5BB 3MXWH 1KCUL 1TVHB 3V79C 2GI7A 1INQA 5BJTB 3IETB 2KL6A 2FATL 5SWZD 2Q86A 3TN0C 1NUNB 2J4WL 5IVXE 3ULUF 5LGHL 5DD5L 1T5XB 5E0QA 4UQ2A 2NY7L 4X9HA 3UJJL 1HQ4B 3RBSA 2BDNH 3RTQC 3IDMB 1NEUA 4NZRL 1DZBA 3MFGB 2B4CL 3PWLB 2F54B 4XH2A 3RQ3A 3ORJA 3PV6A 4KPHL 2D4FA 9CGTA 1A7OH 2EYSA 4M62H 3QXTA 1A1MA 5TDNA 2EC9U 4MQTB 3UYOD 3H9HA 2EDQA 1FFQA 3E8UH 1QSEE 1N26A 5ESAB 5HJ3B 1EO8L 4BFGA 1UXSB 2E27H 3CUPB 1MRCL 5GS1A 5CJXA 1TTFA 3BEWA 4RCAA 5IR1A 3I3EA 2BNRB 3RWGA 5LCVH 4CL7A 1I7TA 1N0LA 4EUPH 2XY2A 1YDPA 5F7MC 3ARED 4PTTB 4KROB 5D7LA 1EERB 2C4FU 3DRTA 4MD0B 4PJXB 1WF5A 2Q8AL 1K2DB 3TT3L 2CLRA 4K7FA 1S7WA 2R4RL 3T3ME 1WWAX 1OT1A 1U8IA 4PGDB 3TM6A 5GSRA 3CJJA 3EOTH 1JNLL 1C12A 5J11B 2VWEE 3BO8B 3V0VB 1B90A 4H20L 1U8OB 1EGJL 3O3UN 4PJBB 5MEOB 3AB0C 4PPTA 2R8SH 4K8RL 1S7UB 3OAUH 4ZUWA 5C0CB 4MXQC 2Y9RT 1GC1C 1RZIB 4X6EA 3LDBC 5DHYA 4EBQL 2BHYA 2QQLH 4QKXB 1NC4D 3CMOL 2BSRB 1PKQE 3SKMA 3TJHC 5I6XB 1I1AC 3O2DH 3FN0H 4MNQB 3NPSC 4LQ1A 3HR6A 3QNXB 4Z95H 5FO7B 3U79A 3FO1B 1X5YA 4YQXL 2L7UA 5KVDL 5TE4H 4HUKB 4JFXB 3FJTA 1CICB 3ROOA 5FYLH 5I8CB 1U0QA 2RIKA 3FCTA 2W65B 4M4RA 5HHMD 4Z77B 3RKDC 5GJSL 3EFFB 4L5FH 5I1GH 3T2PA 1IAIL 3WS6C 1T1ZA 5INDA 1KN2L 3PWUB 4TUKL 3TVMD 3B9KA 3NZHL 1YDPB 5T1KB 3FRUB 4OJFH 4HK3N 4MD0A 5JUEH 2X4OB 2DLTA 1V3MA 2M8XA 4O02L 3TN0A 1MCPL 3HI5H 1J0KA 4PR5B 4QGYA 3AFLA 3G04B 1FFNA 1VKXB 3MRNA 2XN9A 1S5IH 4M5YL 1IQWH 2CD0A 4ODHH 2G2RA 4H1LB 2DQHL 4LHUD 4LSRL 3ROLB 1EMTH 1INQB 5HVHC 2XTJE 4HPYL 1MCFA 5H37H 5DQJA 1CLZL 1KIUA 3CFDB 2WP3O 3V5DA 3RTQD 1R3KA 5TF0A 1Z3GL 4HBCH 4HWBA 5DEFB 2WNGA 2P5WA 3KPQB 5F6HI 2E6JA 1T66D 1INEL 4XCFL 5T5FL 2DMKA 4LVOC 3N1MC 2OQJB 4X6DB 5JQ6H 4RAHA 5L9DL 1N6VA 4HZLA 1JWUA 4JVWA 1MOEA 5IMMB 5FKAA 5CILH 1S7RB 2B4CC 3D9AH 1RZ8A 1P4IL 1RMFL 4RFEA 4PJXE 4DGIH 2HT2D 5LVEA 1BQUA 1OAKH 5HHOE 1G1CA 2WK2A 4PJFA 3P11L 4G7VH 2B0SH 4WHDA 5GIRB 1QPPA 5IHUL 5JMRA 4PJHA 4N8PA 2EH8L 1FG2A 4X4MA 2X4SA 3FT2B 3T65A 3B5TA 4S1DD 3OKNB 1M7XA 2I60H 4MDIA 1YYMH 3HC4H 3SPVB 2BVPB 2DQUL 4CN1A 3DVIA 1HILB 2BSED 5IVXA 2WWMD 3PG2A 1U95A 4ELMA 3QNYA 3PABB 3R06B 4WUUE 3RIAF 3A6CL 1JGVL 3I2CH 4PY8I 3P0GB 4NIKB 4NJ9L 4G6AD 5D2NC 3EZJB 3RPIA 5AYUL 4JPKH 1RPQA 5F8QC 3PQYD 3ULVC 3VI3F 1JWSA 4NDMA 3QQ9C 4RGMC 2QADD 3VD4A 4GUPB 2FX8H 3PF2A 1S5HA 2OSLA 4LSSL 5SWSE 4KJQD 2VXSL 1K8IA 2DQFA 3JWNC 2HN7B 2ZSWB 3H7LA 4JLRB 5BRZD 1KB5L 4NFBA 3KWWA 5D2NA 2IBZY 2RBLA 3BPNC 1FPTL 4HFUH 5BMFH 5F7DA 3UJIL 1JGVH 1PQZB 3I2CL 4HWZB 4QF1A 4KDTA 4ESKA 5JQ6L 1C8PA 2BJMH 4LSUL 1KLGB 5EPMA 3OWEA 4ZUSB 3GBNL 5EC1A 1UA6L 1RZGB 1J88A 3KYNB 4LLWB 5FF6B 4KVNL 3JTSB 4YIQB 3MCG1 3ARPA 2HLFC 1FZMB 3LHPH 4QY8A 3VXTA 5F6IB 4LLQA 1JVKA 3EYUL 5HDQH 3H9SB 3RL1B 1ZHNB 4LIQL 2C3VA 2KBGA 1IGCL 1IM9A 1U8KA 3O45B 1LO4H 4NQXB 4OV5B 4ZQKB 3VFRA 5EC2B 1I7RB 4QRPE 3QJHA 4A6YH 3MLZL 4Y4HA 4NN7B 1H9VA 1YEEL 3ROLA 5EU7E 3PUCA 3S98A 4OT1L 2B5IC 2FH8A 4Y16C 5FYKL 3QZWG 1D5XB 3QI9D 3KPPB 5LGKA 3KLAA 5C71A 1JUFB 15C8H 1BQLH 2VUYA 1PKQA 1QO3A 1QYGH 3E2HB 3BRDA 1JGDB 2NW2A 5E2JA 4X7TB 3W9DB 3DV6A 3IRZA 1G7QA 3RX7A 3DTXB 3L9RB 4XMLH 1YMHA 4Q6IB 1JI1A 5IMMA 3W0WE 1OSPL 1DLFL 2QSTA 1P7QA 3QDGD 5C6PB 2VXUL 1KOAA 3TBYB 2AEPL 2P5WD 2NW3B 3V5KB 3DUSB 1UM5L 1NCWH 1PGRB 1DL7H 4GBXC 1S9XA 4PREA 2QQLL 5LAXB 1GOFA 4M1CC 3GSWB 4DUXA 4Y7MA 2VLRA 2VZOA 3LS5L 1JF1B 3TF7C 4I5BA 4U3HA 4D0DA 4LHQB 3VWJB 5GJTL 2FGWL 2WQRA 4Q6YA 5E8NB 2BSSB 4XP1L 3LSOA 4PB0H 5IT2H 4BFIB 1QVOA 1PG7X 5MI0C 1FDLH 4WRLA 5HSFA 4PJ9D 3UYRL 3U7WH 2AEIT 1WIUA 5L2JA 2WANA 1F13A 1FG9C 3NN8A 5KTEH 2QADB 2VDQH 4DK3A 4LDOB 3BPOB 3BZEB 3S4SG 3G6JF 2HLAA 2YSSB 2YN3A 3D0LB 4JO4L 1Y18A 1OP3H 1Q72H 4I0PC 4GSDH 1K3ZA 4X7EC 5CIPB 5I74C 4XMKH 1OB1A 2M2DA 4X99A 5E2VH 3DRQA 1KCVL 5HGDA 3S5LB 3MBXH 3QB7C 4NO0A 1UYWL 5TQ0H 5IB4A 5IVNA 5E2VL 2FJFA 4NN6C 3EO0B 2E7BA 2A9MH 5JXEA 4JLRA 1IEAB 4P4KA 1P7QB 3DPBA 2JTDA 1KPVA 3C9NB 4LCCB 4QXGL 1Q0YH 2CDGA 4U4BA 2HJFA 5IVXF 1JZ3A 3RWCB 5EPMB 5E9DE 3OKLA 4NN7C 1S9YB 2GY5A 1OM3H 1OAQH 4KK5C 5BV7H 1JF6A 1MY7A 3RVTC 2E7CA 3L5JA 2AKRB 4NUJA 5DFWH 5EOCL 4YHKL 4BM7A 4FQIH 3IGAB 4KV5F 3BDYH 1NGXA 2E3VA 2NZ9C 1U3HA 2F74B 1JGEA 4N8VG 4XBGB 1YEIH 4BFIA 4PRBB 4XPFL 5KSBE 4OLZH 1YEEH 1L0QA 3ZL4H 1A6AA 2ZG3A 3DVGA 4P2RE 1B0GB 2EDNA 3NPSB 1H3GA 5C7XH 1PZ5B 3DUHA 3I02A 3MRMA 4NZDA 4LSTL 4PY7B 4A6YB 5B39G 5IESL 5E99L 1G84A 4HKBB 1YECH 3QCUH 1AXIB 3RUGE 2Y36H 1GOGA 1UJTA 3FAWA 4JKKA 5DD5H 2OK0L 4OD2B 4MB4A 3E6FA 5EN2B 5HGAB 3LAFA 1YMMD 1WEJL 3DSFH 4TUOA 3QCVL 2YPLA 2NY3B 3ESUF 2NW2B 2QV2A 2FO1A 3EO0A 3OGOE 3G9AB 5JOEA 1AIFB 1VEMA 5L6YH 4PB9L 2A6JB 2NX5B 1X3DA 3DI3B 1BHGA 3P40A 3PIQB 3NMEA 3IDJB 4GAYB 4GW1A 1GIGH 1QG3A 4FABH 3BQUD 3I84A 5C07B 1LE9B 2BSTA 3CMGA 2ZUQB 3T1FA 5D1ZA 5I66A 3KS0H 5CEZE 3UDWC 1J11A 1VADA 7FABH 1A1NA 4UTBL 1KLUB 3QIWC 3QCTH 4QHKI 4WO4B 4PRBA 4ZAKA 4WI4A 4X4ZA 2VLKB 4ZNEA 5GSVA 5HI4C 1U8LB 4HUMB 1CL7I 2Y1VA 1XH3B 3ARWA 4P3CH 5LGJA 5EFIB 3WIIH 3TESA 3QUZD 3PL6B 1AR2A 1FNSL 3DLQR 1DQLH 3VFMA 1OF2A 4NZTH 4WWKB 2ADJA 1NJ9B 2BY3A 5IHBA 2CKBB 1YY8B 2PF6A 2EDXA 4XAKE 3T0EE 1LHZA 1WQVT 3LRGA 3LB6C 5CSGA 4UBDD 4YBQD 4IDLA 3VJ6A 1A4JA 3T1WA 5LQBL 4P2CG 1PSKL 1A47A 1BWMA 1KACB 1U3ZA 1RVFH 4XPGH 5E4IA 1J1XH 2H3NB 5HYSA 5KS9F 1AI1L 1MI5B 4E5XB 3MV7D 4HAGA 2BFVL 2ICWI 4LP5A 4OFVA 1KB9J 1A8JH 1U42A 1RMFH 4NO0D 1ZANL 4EDWH 4DZ8B 3ZE0E 2B2XL 3O3BB 1QSED 5K9JL 4HJ0C 4APQC 3GSUB 4FOMA 1A1NB 1RJYA 3BX7C 4I77L 1X5AA 5GGQL 4OIAA 4MMXC 4ZO9A 4OGYH 5I1KH 4LASL 1FL5B 2CDEA 2I60L 5DEZA 2NY5C 2WUCL 1FBIL 4DN3L 2DM4A 4UI2A 5D1XC 5E8OB 2AW2A 1Y0LA 2HRPL 3IYLW 4JFZL 2FX8L 3BKJL 3HI6L 4MCYB 4PP2A 3N06B 4O2EA 1Q0XH 1FZJA 1KTLA 4TRPH 3WFDH 5JLZB 3RNQA 1KCKA 4X6DF 4MA7H 1CLCA 5IJVA 1NANH 4KKNA 1IC4H 2EIEA 2GTZB 5E4EC 3REVA 1F6AA 1NGPH 3KXFB 3H7BA 4R0LB 3SDCB 1MIEL 4TVPH 1U8QA 3U0WL 3T0WA 2YD8A 3P9MA 5DZLA 1ND0B 3B6SB 4EN3D 5MP6H 1RIHH 2DQCL 1J8HB 1CLOL 5F7HA 3S88H 4K3GA 4RFNB 1S78D 4PJEB 4ZODA 2ZUUA 4GBXB 3BQUC 1R24B 1CDGA 1CS6A 4ZPVB 5EU3A 5FXCH 4GRWF 5B38G 5H8DA 3CVIL 1G6RH 5KVDH 1Q72L 2AJUH 3JVGA 1MWAL 3WHXA 4EUPB 5HI3C 1BBDL 4WJ5A 3ZYOA 1QR4A 1DANU 3N9GH 4ZFGL 4JPWL 3KNBB 1MWAH 4KXZI 1EZVY 3ULSA 2P49B 3LN4B 1JIBA 2R2HA 2IEPA 4A2MA 4JO3H 5CEZL 2F8VA 3RIFF 2FYYA 2H32B 4K9EL 3HB3D 4GW4B 5IB5B 1CQKA 3CX5K 4ONFL 4HS8H 1K4CB 2OYPA 1U6AH 1AGCB 5EDXA 4PRHB 2IADB 3V0WL 5A2LH 2NY3D 1MREH 1KB5A 1BIIB 4WFFE 1DUYB 1MNUH 4BZ1H 4ACPA 3GK8L 3MZGB 2KKQA 3HTLX 3IJHA 4PTTA 4IMLB 4G6MH 3O81A 4JZJA 3FB6A 2OJZL 2KUTA 1NCNA 3WFBL 5HPMA 2HTKC 2IQAA 3MRLA 3HC0B 4G8IA 4NO2B 1DQJA 3MLPA 4LIQE 1H0DA 2X9WA 5CZKA 5FOBB 4MSWB 3JTTB 2HA1A 5EU6A 3VFOA 3SGKC 4H8WH 3PHQB 1VENA 2A0LD 3QULB 2B1HH 4AMKH 3S97C 1CGWA 1T4KA 2W0FA 2AXHA 1GGCH 1QFPA 4OIIH 1JRHI 4LASH 3SKMB 1KN2H 1MHPH 2Q76A 2LQRA 4K8RH 4U1HA 1CFSB 1RU9L 1YN7A 5JXAL 1RIHL 2DQCH 4M8QB 2HKHL 3HZMA 1FE8H 1A6VL 2Y6SC 1CDJA 3UZEA 5BQ7A 1KPUB 2XOTA 2VLJA 4MJ4A 3ULSB 3L3KB 4GAJL 2YEZA 2NY7H 4G9DA 4JN2B 4ODSH 4F9PA 2CKBL 5AZEH 3UTSA 5F97E 3VWKA 3O8XD 4HX1B 5ITBL 1GRWA 4JEGB 4JREC 5C0FA 3OXSB 3BRGC 3ZKND 4K3EL 5FYJD 4QEGA 1I9JL 1WBZA 3STLB 5C0ND 1IL1A 4PV9B 2FZ3B 5T3XH 5BCAA 4JANA 3AXLA 5T1MB 4QRPA 4NQDE 3EKCA 1F11A 4TYUA 4WY7H 1UWEL 1DSFL 3I3BA 2FH6A 4ZFOA 5IJVB 4HIJA 4Y5XA 5CBEB 1RHFA 1ZS8A 3REVB 3GI9H 2AK4D 4YZFE 1HHJA 4KRPB 4PJCA 5EUKB 4R9HA 2UVFA 1OHQA 3R4DA 1P1ZA 4U33A 3CC5B 1FSKB 4RX4A 2EE9A 5E7BA 4CMMA 1TDQA 2NY0C 2NNAB 5F3HA 1FNAA 4HIEB 4YDKH 3SKOA 3PDOB 1I9JH 4PJ7A 5ICZB 5DJCB 4ENEC 1FHGA 1RZIA 4HUNB 1G9NC 5DYOA 1MHCA 4OZHA 4NQCE 3IU4H 1T22B 3PGFL 2E9JA 3T4AB 4HJJL 1YEFL 3GFUA 3D18A 3D3VE 1DEEB 4KVCH 1CLYH 4M3KB 1FP5A 1I1FA 2D4DA 3SDAB 4ERSL 4YHOL 3HMXH 3QISA 3W11C 2FX9L 4ZFZB 4HXAH 4Y1AB 3UTPE 3OV6A 1Q38A 5SX5H 1JZ6A 4JY4B 1GPOL 3U4EA 1BD2D 4PJXF 5E2WH 3C60D 1AD9A 5BS0D 2VLME 2Z35A 4IMLA 5E8EB 4LCIL 3FB6B 4LGPB 3VXNA 1I7ZA 4IIQA 2CR3A 2IQAB 3OKMB 1LEGA 4KQ3L 5HHOB 3MXWL 1QSFB 2NYYC 5GS2H 3ZHKA 3CSYA 1P9MA 3JV4B 3OKOA 5IVOA 1ZHBB 1ZHLA 3ARYA 1JHLH 4ZXBB 3PDOA 5AG8A 3MJ9H 4HEPG 3MRIB 1MJ8L 2ESVA 5C0DA 4JM2B 5HY9B 5DYOB 3LRSA 4NSKA 1N3NB 4HH8A 4M6ML 3GKZA 4OZHB 4OCRL 4NQCB 1NC2B 1PLGL 2XTJB 3CFBB 4NZUL 3VGBA 3N0PB 2IH1B 3T77B 4XP4H 4M00A 3CDFA 1TZHB 4LCWB 1U93A 4PTUA 2DIJA 5I19H 4N5ED 1W0WB 3BXNA 4PLJD 3MXVL 3CX5J 4H1LH 3IDNA 4YDIH 3QDAA 3AM8A 3OXSA 1ERNA 3Q5OA 2NY4C 3HE7A 4OFKA 3HE6A 1OAYH 4PJHB 3CH1B 4J3XA 4GG8A 3O8XB 3VRLE 1NC4A 3NFNB 1M71A 2E9WA 4Y5VC 4EXPX 3TBVA 1Z9LA 2HLFD 3UTTB 3I75A 2J8UA 1D5MA 1OAZH 2APBA 3NZ8B 1CE1H 4L8SC 4UV7L 1BWWA 1FVEB 4QT5A 2VN7A 4JQVA 1MCKA 1WFUA 3W5MA 5IEHA 4P3DA 1S9VA 5ERWA 4YQXH 3BWAA 1EVUA 3SDYL 1XGPB 5TPWL 3NGBC 5TE6H 2BY1A 2Y4SA 1IGJB 1QD0A 3O2VL 4LQFL 4JR9H 2H8PA 2FX7L 2VZ3A 5CP3H 4JM2A 3J8F7 5IGXH 5DRZA 3LRSB 3DX7A 4PJGB 2YD2A 5C08D 4RNRB 2X1PA 2Z92A 1OP3K 5GGUB 1KYOJ 1BZ9B 5DMJB 1T22A 3OZ9L 4NNYA 3A0OA 3TCLB 5I1JL 3BRFA 1UB5A 3F7VA 5ENWA 5DT1H 3B3IB 3VGAB 4D9RE 3CZFA 4TVSa 3EYSH 1HWGB 2QSCL 2D7NA 3UJJH 1OSPH 3RVXC 2FD6H 2PNDA 5ANMA 4ZUSA 5J4MA 4XP4L 4PRHD 5GGTL 4YHML 1IC7H 4G7YH 4KHXL 1NBYA 3VRJA 1E4XI 5EU6E 4Q74A 2QTEA 5HYQB 1JK8A 2FX9H 1LDPL 1U58B 4LSQL 4PJ5A 3E1F1 3OJMB 3OKKB 2H26B 1E4XL 2VC2H 3BT2H 1UVQA 4NRZA 3ZHDA 5JA8B 3FQNB 5EWIH 5DRNA 1WAAE 4P2RB 3BP5A 1CDBA 2XIDA 1SBSH 3BO8A 3NOIA 3RDTB 1EO5A 5T5NF 1Z9MA 1TJIH 3QUYD 4UDUA 2EE3A 4RGNC 4U1GB 3KPRB 4LPVA 3TC9A 1VA9A 3NCYP 3RY6A 3DVNB 4CDHA 5F6HJ 5JR1H 3V2AR 2CIIA 2OI9B 3FAXA 3RL2B 3WIHH 2YRPA 3FMGH 2AXFA 2EH7L 3FOMA 5D7JD 4XWGL 4MXWL 1P4LB 4OF7A 1RVFL 3EFDL 1IEAA 4WTZG 2DDQL 3IDGA 3MRJA 1A0QH 4XXCA 5GGVH 3SQBA 4CBPA 4R0LC 3KDMA 4NP4L 5EOCJ 4PG2A 1KJ2L 1M1SA 3PWPD 3ARBA 4O58L 1J10A 4S1QL 2FIKA 3ECBB 5EORL 3V5KA 5HYEA 2W0LA 5BW7C 3PGFH 5L8JB 5JPMB 3JWOH 1S9XB 1J8HE 2I26N 4W4OC 3IDNB 3HE7D 3X11B 2P45B 5F9JA 1UWXK 3ARFB 2BNUA 3ETBF 5DHVH 4Z77A 4C56A 5C8JA 3VW3L 4LIQH 4JFPB 4U1JB 4XCYA 4ZS7H 1NC4B 1WEJH 1U3HB 3SE4A 1X4XA 3QDJE 4KK5D 5DC0A 4M03A 4G6JH 3BD5A 3WLWC 4LNRB 5C0CD 2VLKE 4ZTPH 4X7DC 1B0WA 1YY9C 1E4KA 2X42A 3DMMB 2A1WL 3DVGB 2VYRE 3JUYA 5DSCA 2Y6SD 2CKNA 2E6PA 4OQTL 4X8JB 4YAQA 4H1LA 2BJML 4GXVL 4M7LH 4P46A 3C2AL 2DN7A 3QUZB 3ARFD 3LQAH 4KROD 3U9UB 2R2EA 1KFAH 1ZTXL 4K94H 2EIBA 2V7HA 3C5ZC 3DJ9A 3QIUB 2GITA 2XZCH 5ICXB 5F9OL 2BXZA 2YUXA 3FB8A 4DK6A 2ITDB 4POZC 2CGRL 4WEUD 1NDMA 4E41D 1PY9A 5J6HB 3U36B 1C1EH 2ADIB 4Z0XB 1SJVA 3ZYJA 4C4KO 4M61A 3O11B 5GRUL 3MFFB 2AI0H 3ZHLA 1RZ8B 3MJ9A 4NNYB 3TCLA 3Q2CA 3U7YH 4P9HL 4NBYB 1JN6A 4P99A 1SVZA 2YKLL 2BCKB 2AEQH 3F7PC 3LEXA 4JZOB 2MMXA 2X4QA 4QXGH 5HDOA 5I73C 3QDGA 4UILH 3QUYB 1X5JA 4G42B 4U6VL 2C26A 4LEXH 4JO2L 2ARJB 43C9A 2UYLA 3ARDB 1A3QA 2WINB 4YFLF 4JRXE 3TGXA 2P8MA 4OM0L 2V9RA 3W9EA 1YMMB 4LVHC 2W9EH 3QIWB 5J89A 4F57H 5SWZB 4X9GA 4BQBA 4E41E 3R0MA 4E0RB 1KC5H 3JV6A 3GM0A 3K4ZA 1H3UA 1JRHL 2ZUTA 3I6KA 3HE6D 4P2RA 1SJEB 5IBLD 3E0GA 3RDTA 2PO6B 4IRSB 2Z8WC 3QUXC 4PFEA 5CJBA 3T4YA 4NQSA 4DUVA 2DIBA 5F1NA 5EU6D 5IFJA 4KUZL 2DM3A 5DFVC 1G9MC 2ZPKH 3E6FB 3IETA 4MB3A 2F9BT 4RZCB 5D6CA 1NDMB 3I50L 1EEZB 5DMGC 2GEEA 2JB6A 4I2XB 4KTYA 2NTSP 5MEQA 3S35H 1LP9F 2B1HL 1JZ2A 3DXAE 4TN9A 4WEMB 2QJDA 4KMTH 3FO2B 5IB1B 3CK0H 2XWJB 4ZOCA 3KYNA 5FF6A 1W0VA 2EYSB 5CFHA 2AJXH 3D6GA 2D9QB 4NZJA 4IMKA 5F3BB 4U2ZA 1JI2A 3DUUB 1GOHA 4WO4A 3IJSA 1LE5A 1NH6A 3MX0A 1U3HC 4Z5RA 4FTVD 1J05B 4L5FL 4YFLI 3WNMA 1ODAA 5I1GL 3GMMB 5I0DA 4KZEL 4NQXA 3P9WB 3B9EA 1R5WA 3VDAA 1U8NA 4XNYL 1KTDB 3GEWB 1B4RA 2DLGA 4HULB 2DWEB 4LRIA 1CD1A 1K2DA 2R2CA 3DURA 5A16A 3W11D 3DGCR 4PS4L 5DUBB 1UCBH 3NFPA 3SKUD 2P5EE 2FBJH 4F9LA 1U8IB 3TEUA 3CVHB 3ILQC 3P9MB 5I75B 3CDCA 4LSVH 3VXSE 3F6LA 4D2NA 5DUMH 2NY4D 2YPLE 5A2JH 5KS9A 1HH9A 3BH9B 4P5MB 4KWUA 1T6VN 1MFCL 3S37X 1OSZB 1MAMH 1QP1A 1X6LA 2YA2A 1EO8H 3VXSA 2W0PA 5J8OA 3U36A 1EAPB 3RAJH 4KKLC 5DC9B 1KCSH 5T1LD 2XZQL 4I0PB 4XPTL 3MFFA 4ZSOB 3TVMA 2VE6A 5JOFB 3BH8A 4GG6F 4PD4J 5AG9A 1IAKA 3DUSA 4RA3A 1A3RL 3M07A 1Q9LB 3QNXA 3K2UH 5FO7A 1P4BL 4UINH 2BC4A 3O6KH 2MJWA 4Y1AE 4X0KA 5T3XL 4KKBD 1EHAA 1B3JA 4F3FA 4OGXH 1EFXD 4U3CA 2Y06L 2EDKA 4CRPA 4LNVA 1XCQB 5M95B 2P1YA 2UWEA 3SKNA 5L2KB 3OR7B 4HJGB 5T3ZH 3TO4D 4UT7H 5CSZB 3QAZB 2BZDA 5F1OB 1DQDH 1N64L 1DDHA 3U46A 2VQ1A 4PLJC 3VGAC 3H0TB 4ERSH 3DYMA 4Q7DA 3RZCA 2GFBA 1CGYA 1CFTA 4JY5H 4P5MA 2H2PC 5EBGA 3TNMA 1QBMH 1AHWC 1ZAGA 2Q87A 1PD6A 4OI9A 3ZKQD 4DQOH 2BRRL 3OB0K 2IAMC 4YLQT 4WCYH 5GGRA 2EYRB 4HWBL 4LCWE 2YD7A 2PW1B 5TH2B 1FL6B 4Y5VA 1YN6B 4Y4KD 2HJLA 5B3JF 2Q3ZA 3T0BA 1U8MB 1MH5B 3TZVD 3SDDA 3W0WD 4OGAD 4BFEA 1T7WA 4XVSL 5C9KA 4CU8A 1SYSA 3B2UC 3LN4A 4NUJB 2DQIH 1MREL 3QFJB 3UJTL 5MENE 4F37F 1MCDA 3ES6A 4NHCH 2XZQH 1WISA 1XCQA 4NRXA 3RUGF 1A02N 3FFCD 1MAML 1FC2D 2NY4B 3WO3B 5TE7L 3X3GH 4L9LC 4J3UA 3WMSA 3MOBL 2Q7YA 1U95B 5C2BH 2XKSA 1AD0B 5C0AD 1HHJB 4NO2A 5KSAC 4DGIL 4C55A 2EICA 1FYTE 3VGGA 1A6ZA 5EU6B 1GL4B 2NR6D 1EUTA 1EPFA 1KJVB 3N1GC 1FJ1B 4TUOB 5KS9B 2HH0H 3QWOA 3PJSA 5FOJA 1OGTB 1TITA 1QBLL 5ADPL 1DQQA 4G6KL 3HUJF 4V1DD 4ODWB 1H8NA 3LZFL 1S7SB 5D8JH 3CDYA 3DO7A 4MA1C 1EA9C 4OZIA 2XKNA 4PG2C 3CPLA 4U1LA 4JQXC 1VACA 3IAPA 3GI8L 1NFDB 3NIDF 4AEFA 4YHYC 4KHTH 4PRHE 2FDBP 4OZ4A 3ZSSA 3WE6A 5BVPL 2HKFL 1X5HA 4YO0B 3WFEL 4NCDA 2HT3D 5KANI 1A1MB 3ZMRA 1RIUH 2HT4D 3U0PB 5HI4D 1A7QH 3Q6FB 2UY7A 3V0AC 1NSNL 3VA2C 3KPNA 3MA9L 1MFAL 1MVFA 2I9TA 1PX3A 3AS2A 4GRLA 1FZMA 5GISH 5D7KD 3EBAA 4U0QB 4GMSH 3M8OL 4NQTA 5FCUH 2V5MA 3WKML 1AD9B 2JB5H 3KXFD 3T0DA 3TBSB 1D5ZB 1MCEA 2R23B 3BKML 1KLFA 4PJXA 1M05A 3QUKA 4WEBH 1KTKE 1JF5A 5IHZB 1U8KB 1NGPL 5E00B 1HNGA 3B9KC 3FQRB 3QHFL 4FHBD 4UT6H 4O00A 5JQHC 3LKSA 2PXYB 4LCUA 3GKWH 2IBBA 3FKUS 4OCRH 2P48B 4JE4B 4F8QA 2GFBB 3JWDL 1FFRA 4LMQE 4RAVA 2DQEH 2BHUA 5JDSA 2GJZA 4U1KA 2MKWA 3BUYA 4QXTA 1PKQB 2X4PA 3SJVE 5HHMB 1U2CA 5A3ID 1JGDA 5D96C 3KYOB 4HEME 4TVPE 5I1DA 1MFBL 1IEBB 1CQYA 4ONGL 1NC2A 1VACB 2DL9A 4Z8FL 2W92A 3CFCL 3S8WA 4GSDL 1A7OL 1MH5A 3SE8L 4DW2L 2F54A 1FNSH 3W81A 3U0PA 3NIDE 3VWKC 2R4RH 1BX2A 2DJ4A 1NFDF 3C8KA 4D8PA 1HYRC 4MS8C 4GS7C 2ICES 4HZAA 5EULV 5F96L 1FNEA 4N8VA 4X6CA 1IQDB 3TIEB 3LEVL 2EEAA 4NN5C 1E4WH 2APWA 2IPKB 3OL2A 2E8YA 1Y6NR 4PP2B 1F90L 3DIFB 1BM3H 3U4EB 1DTUA 3V6BR 1CYGA 4MA1B 3NZ8A 4XVJH 2K3TA 3V6FA 3S9DB 5I1HL 1CBVH 4UB0H 4CNIA 3FQRA 2V6HA 4YH6A 3ARVA 1GJIA 1CDIA 1A14L 2JK5B 4K55A 5DJ6A 4MNQD 3NCJL 5T3ZL 2EDDA 5IMKB 5D7LE 3H7BB 1ZGLP 2AJ3B 2MSPA 4R4FL 5GS1C 1U8QB 1YNLH 2FJHA 4LLDA 3R8BB 2F54E 3O9WD 4RSVA 4YPJA 5I1IL 4P9ML 5I1CL 3AM8C 3IFPB 4WCYL 4Q9RL 4MGXA 3FFCE 3MLUH 3UCRA 6FABH 2LTQC 5DRZB 4JZJC 1S3KL 3RY6C 4PJGA 4L9LB 5B22A 1CTNA 2DJUA 2VLRD 4PJAA 1U3HD 4WWKD 2HT3C 4OZIB 2A6IA 4H88L 4NFCA 1S7RA 2WBJC 1YEHL 4PGJA 1T7YA 1B6UA 5EWIL 1WFNA 4CW1B 1UJ3C 3NCJH 1QLFA 5BMFL 1S7VB 4U31A 2WUBH 2VL5A 2NX5D 3VFUA 3PWPB 2GIYA 4MA8H 1DBJH 4X6CB 4YDLB 4NYLA 2FJGB 2A73A 4XPHH 3NGBB 2PTVA 3EFFA 4D3CL 3WIIL 1MF2L 3NFNA 1JNNL 5D7JB 1S8DB 1GGTA 1QRKA 4QRQB 4QHNA 4KC3B 4F33B 3PE9A 4PUBL 2FL5B 2FR4B 3HUJA 1MFNA 4Z7UE 1UJ3B 2FB4H 3DGGB 3MRLB 4PP1C 3EZ8A 3ET9F 5CILL 1N7MH 1IRAY 3TWCH 1BVKA 4XZUA 1FO0L 2DL2A 2VABB 2JB5L 4HFWA 3VXQB 1VHPA 4JM2F 4YE4L 2DWDB 2F8XC 2P8PA 2X9XA 5HYSG 2C3WA 3VH8A 1N2RA 2VXTL 3MRRA 3QAZC 3R1GL 4NUGH 1DE4A 5H35B 3ULUE 4ZAKD 4UV4L 1WAAF 5C0AA 1E4WL 1AIFA 1AHWA 4FQQB 4QCIB 2B0SL 5E8PA 4QRTA 3GRWA 2ZWLT 4URTB 4XNZB 2OXGA 1RY7B 1RK1A 3LKPA 1OAKL 4X6FA 5GRVK 5BV7B 1FIGL 5IG7B 2DRUA 1MI5E 1LE9A 1RZGA 5GRZA 4LPWA 3HA0A 4XP1H 4XI5D 1A3RH 3IXAA 3PGCB 3WKMH 3H42H 2H2PD 3ARUA 1XT5A 4DTGH 1A7RH 4MJ5B 3MGTB 2FL5A 2DYPB 4Y5XC 2R1WA 4OKVB 3MUZ1 5EFIA 4EOWL 4OBSA 4JPIB 4JHZA 4P2OA 3O3AA 4BH8A 2HKFH 5GXBB 3U6RB 1AO7B 4Z7WF 3RTQA 4ODUB 4XP6H 5HYJE 4OTXH 2CKBA 2KH2B 1YNKH 4ZXBD 4B7LA 3CLEL 3AS3A 1UC6A 4FTVA 4H25A 2V7HB 1AXSA 4LP4A 3QIUA 3VH8B 5DJCA 2IQ9H 4NO5A 5EU5B 2XXMB 3HKFA 5FYJH 4Y16D 5TQ2H 5AWNH 3QYCA 4QOKE 1J0JA 3SGDI 4QO1A 2D31A 4E5XA 1I9RL 1U3JA 2DKUA 3OX8B 2QR0B 2EZ0D 4JM2D 4ZS6D 3TBYA 3B2VL 4AM0B 3SCMA 4OLVH 4NO3B 4NFDA 1C16A 1CFNA 5HYIA 4DZ8A 3EOAA 3WUZA 4EDXB 4LKCA 2R9HD 3PQYE 3MLRH 2R0WH 5B3JE 4OD1H 1A6TA 1F42A 5B3NA 3HRZA 5CUSL 2AJUL 3ARDA 4UNUA 1MLBB 2JKXA 4RWYL 4NC1C 4MQ7A 3GMLA 4RA0C 3QI9B 5K9QI 2ESVD 3LN5A 4NPYB 5JZ7D 3ALPA 4WO4C 3WJJA 5BS0B 1A9EB 3HC3H 5E8EA 3BSZH 1F2QA 3JV6B 1IGML 2IAMA 1XF3A 4M02A 1SBBA 5DRXA 3F6IA 4JFOA 4KVCL 4Z7OF 2MCG1 4BQCA 5CGMA 1DUZB 3HLAB 1QSFD 1I8IA 5F88A 1FIGH 1VESA 4UQ3A 1EDQA 2RB8A 5DTFA 1Y18B 4X9IA 3MLVH 3ZT7A 1QQDA 5C2BL 1D5XA 5HHQA 4KY1L 3JBG7 3SJVD 4KJPC 1ND0A 3B6SA 2Z91B 2DMCA 2YK1L 3KVQA 5C3LD 5DF0A 4DOHB 3O6FB 3EGSA 3DYOA 4S2SB 1KCUH 1A6WL 2DD8L 1I3UA 1G7QB 3LQZA 1DN0A 1HEZB 4JFYA 4NC2B 5FYLD 4Z0XA 5FUCC 4Y1AD 3MMEA 4J8RA 4LEXL 4GFTB 4GXVH 3F58H 3GNML 4DVRH 4X98A 4IOSD 1AGEA 1X9QA 4BSJA 1FO0B 2YPVH 4QTHB 4GXUN 5JW4M 5K9QG 4PYGA 4HT1H 4YR6B 5T1LB 1J5OL 1DLHB 3UO1H 3VGEA 4N90D 4OLEA 1F2XK 1QFWH 1W72H 4Q58C 3TBVB 4P48A 3GSVA 4NT6B 1AGCA 4K3EH 5JO5A 3VFSA 2BNQA 4TPRL 1TNMA 1FL3A 1PAMA 2FBJL 3K1KC 1H8SA 1TJHL 1JZ5A 3EYQC 4DUWA 3L1OH 2GY7B 1OY3B 4CJ1A 5CD3B 4WFHD 1KTDA 4AENB 3IFNL 4K94L 5J13C 2LU7A 5HTSA 2DWEA 1I8IB 4HWNA 4C57C 3K2UL 1IAII 1U8JA 5DTFB 3QT2A 4JG1L 4OF6A 4FQLH 4P2QD 4NNPH 1YEKH 1QQDB 4WUKH 2YSSA 1MCRA 1T6WA 5EA0L 1UM6H 1R3IH 3WN5C 5EO1B 4JRXB 4BQ8A 1AGBB 5CP7A 5D70L 5AAWA 4XP5H 4L4JA 1AP2A 3EHBD 2A6JA 1XIWB 3L3GB 1CK0L 3MLSL 3ZTJG 2DLFH 1U9KA 5JPNB 25C8H 1RUMH 5DK2B 2VE6B 5JOFA 1CL7L 2ZUWA 2FATH 4WNQA 1KN4H 5ICYB 3UZQA 3EJZC 4R26L 4KH2A 2IG2L 3TJEH 1BFTA 2V5YA 4RMQA 3QDGE 4D9QE 1NL0L 4TULL 3MRGB 2XQYK 3AGVA 1Q8MA 3O9WC 5C09D 4XNMA 2VAAA 3FQTA 1IKNC 4XP9L 3PWVB 2B1AL 5C0FB 2VLKA 1IAMA 1FVDB 4HKXB 3BOVA 3BGAA 1G7JA 1Z3GH 2P46B 5DR5L 1KSRA 1G7IA 2IBZX 4HCRL 1HSAA 1IGYA 1WBYA 5F1KC 4HJGA 4AENA 1V3JA 4W4NA 1FVCA 1C5CH 4WV1A 1WSST 2WBJD 5D1XB 1MCOH 3G5ZB 3EYOA 3G5VB 2BVEA 1G6RB 5D7IE 2P42B 2VISA 4K71B 3QUXA 3TPUB 1AO7E 4IHOA 3K1DA 4NGHH 4DGVH 5E2TH 1MFBH 5EN2A 5HGAA 2UZYB 5IWLA 1HH9B 1IARB 1CLOH 3QG7H 1OSZA 1MI5A 3E2HC 5JPNA 1G0XA 3HS0A 5GGRB 5F7EH 1MELA 3WXWH 4MAYA 4N0CC 4RIRA 2HG5A 2O61A 4J8RB 2XQYG 4XNUL 3RWIA 5J9PB 5JHLL 4H1LG 3AS1A 1SEBA 3RWHB 1TZIB 3CFJB 1N6QL 4PBWD 5BXFB 3BGMA 3RWFB 4YXKL 2EDBA 2EYTB 1A7NL 2NY2D 5GPRA 3HZKA 3H9HB 3HNVH 1IAIM 4X0KB 3O41A 4KTDL 4KKCC 4JN1L 4HJ0D 4LLYA 4E41B 4ZUVA 3QQ4B 1RURL 2J6EH 1LMKA 2V2TA 3QRGH 4LNRA 5GSVB 4WWKC 4XAWH 4U1SB 1T0MA 3S36X 1V5JA 5EBWA 4U1NA 4MB5A 3H42L 5KVEL 1MQKL 2AGJH 4RBPH 2Y7QA 5ECJE 4GQ9L 5D7LB 4JO4H 1GH7A 3MC0A 1JFQL 4LBEB 2VH5H 2YKLH 4P5TD 1X5GA 5HHOA 3SOBL 4P4RA 5D1QC 3X3GL 3OSKA 3DARA 2BFVH 1MVUA 3QBTB 4MJ6A 3HG1B 5C86A 3VXRD 3TN0D 1J9CT 4U0RB 4JHWH 4GRLD 1DCLA 1CFTB 4QLRA 3QWOB 2A77H 3MLWH 5AAMA 2E7LA 4P2QA 2VLLB 2H3NA 4D94A 5HYSB 5I1AA 4EN3C 2J88H 4EQ3A 2JF1A 1E27A 4FQ1L 4OCSH 1ZVYA 4F7MA 3S4SA 1TMCB 2AVGA 3G5XB 3CFBA 2OR7A 4CMHC 4M7LL 4FZEL 3X14B 3FO1A 3V52L 2QLVB 2R2HB 1CVRA 3PWPE 4JFED 1NFKA 3UBXB 3HG1D 1NMBH 1SYSB 1CL7H 3UTQA 3EO1A 1QACA 1DQTA 3KHOA 4ZOBA 2J7LA 1WZLA 2VRAA 5EBWB 4NRXB 1MPAL 3QWQB 5CCKH 5CJXC 1G7IB 4HDIA 3QEQD 1X5XA 5KOMC 5I73B 4BQ9A 4YX2H 5I2IB 4WWID 2ZOKA 4PGBA 1KULA 4NNPL 3NFSL 3TT1L 3EYOB 3S34L 3BT2L 3MZTA 3RNKB 5C6TH 1CK0H 5FCUL 1TPXB 3D2UA 2YRZA 4I9WE 5L88H 1Z2KA 2VXSH 3B9KD 3ZSTA 2VLRE 4EJ1C 2LAGB 1XAUA 1V3LA 4NZRH 2AJSH 3GUTB 1ZA6B 1EEZA 5CZXD 1I1AD 1KIRA 3NABL 4GBXA 1IFHL 3MUGA 4U6HB 1SM3L 5IK3B 4MNQA 2VLJB 1A9BA 2YEZB 1DP0A 4YDJB 1OTTD 2VDKH 3DMMC 5CJQL 4OZFG 4FQLL 3UTQB 1DBAH 4QWWD 4JHAH 2PUQT 4MAYD 5I74B 4XAWL 5SWSA 4AEHH 1T83C 5FGSA 4V1DB 4GRMB 2VDML 4RWYH 1YEIL 1HHIA 3OKDA 1OOAA 4WHYH 4AMKL 5C08B 2XG5A 3DHMA 2QADC 2CRYA 3FQWB 4M6OH 2EH8H 4OD1L 3KS0J 3ZKNC 4OGXL 3CXDL 1OAUH 4L4TE 2BVPA 1E6JL 4LVEA 1AKJB 2B8OT 1QFHA 3THMH 3WIFB 3H6JA 2Q8BH 1N8ZA 2NPLX 2ZP0T 1ZEAL 5DMIL 3QUMA 4HIIB 1L7IL 3SCMC 2D9CA 5HI3D 1KUMA 1VKXA 4IM8A 4DFIA 3KR3L 3VXSD 2FJHB 3LS4L 5T3ZE 2CK0L 1ZK9A 4FZ8L 4AG4L 5IV2A 4P2QB 4PBXA 3ZTJH 4NDMB 4PV8A 1Q9OB 1ETZB 4JQVC 2PW2B 3NTCL 1EFXA 1U8PA 3IDXL 3ZE2F 3DYPA 1MHEB 3FB7B 1GGYA 2CRZA 4YXKH 2JELH 3T4AA 5BQ7B 1A7PH 2KZWA 3D18B 4CW1A 1LK2A 2YR3A 3JUZA 4UNVA 2P8LB 5TF1H 3IDYB 4LPCA 1RZ7L 1EO7A 4KROC 2XTJD 4Z7NF 4P46D 5F9JB 1MNUL 4BZ1L 4HF5H 5I30H 2A0LC 3E3QE 4G5ZL 5TQ2L 3VCLB 5CJOL 5DO2C 3VXTB 4JJ5B 4AL8H 2X4SB 1JPTH 3V6ZB 1SJHA 3NA9H 1S8DA 4HBCL 5AEAA 2H2SC 2ADGA 2Z35B 4KKAC 1KELH 3TZVB 3GSNL 4YDVB 5HHVL 5CGTA 3QXAA 4OTXL 1E0OB 1HILA 5ID0A 2VQ1B 2SEBA 1ZS8B 1EAJA 2JK5A 4F58H 1JRHH 5CS7A 1BD2E 4OF0A 2VDLL 1LDSA 1TVHA 4GW5A 4S10A 2VXVH 4J2XA 1MCPH 4U2YA 3CMOH 2GCYB 5HHNA 4PJ9B 3RGVA 2C4XA 1IM9D 2J3SA 3U9PH 5EU4A 3JSSA 3MRRB 3TZVC 1JPTL 5LXGH 2UZXB 2VL4A 3PGDA 4R4NC 4F7PA 4L4TA 4UQ2B 5TH2A 4YHOH 5E6IB 2VAJA 4PJAB 3T77A 2N56A 4P2OD 3ZDYE 4JB9H 4LCWA 4KDWA 4CDGC 1NMAH 3SDAD 2NY6B 4HWEL 4RGMB 1UQSB 5EZLB 3QJFA 4DKEL 1NBQA 4N90E 4UIMA 1YUHB 5HHXH 2ZG2A 1T1YA 1YQVH 4B0MM 4ORGA 4WV1C 5IMOA 5F1SA 5EC1B 5E6YA 3QDGB 4QGTA 1Y6KR 4XBPA 1T3FA 3CVHL 3G6JA 1L0YA 4D0DB 3O8XA 5LQBH 1PBYA 1U91A 4HT1L 1J5OH 3EYFB 5F9OH 4MJ5A 5DD0H 4HHAB 5F7WC 3UTZB 5I9QC 3RY5A 4ZOAA 1OVZA 1AKJA 4X5XA 3KAAA 4XHQA 3PP4H 1XZ0B 3ARGD 2V5RA 4WUKL 5CP3A 3F58L 3GNMH 1UJ3A 4UIKH 4OQTH 1JNLH 1T5WA 4Y4FC 5IFHH 4C59B 3MRPA 1MIEH 4R96A 1B4JL 4LF3A 1LO3H 4XB8A 5C2UB 3EJYD 5T1DL 4UU9A 4XPBH 2ILLA 5MERA 4OF5A 5E4EB 4V1DE 3MRIA 5LKNA 5IROC 3AU1A 1X5ZA 3D1MC 4ZXBC 5HY9A 1S7SA 4WTWA 3TA3B 1YC7A 2GUOA 1DE4B 2XN9D 2LE9A 4JPKL 8CGTA 5H35A 2IPTH 3AY4A 3L6FA 4OSUH 3WN5A 4WDIB 3V4VH 1DVFD 1R5IA 1YPZF 3GMOA 5DJYB 3VFWB 1T80A 3WSQH 4GOSA 5EZOH 1WC7B 4HQQH 4R90H 5IFHL 5DJ0B 2AERT 4O58H 4S1QH 2Z8RA 3TYGL 2F5BL 1YEKL 2DBJA 1FNFA 1R3JB 3HC3L 5D1QD 3G6DH 4HQQL 4MNGB 4R90L 4AIZB 5JNYB 1IE5A 1XGUA 4I2XE 3TWCL 3UBXI 4XPTH 1PX4A 3H8NA 1ZANH 4J3TA 1WITA 3VRJB 2XPGA 1P53A 3F65A 3GMLB 1NGZB 3BZ4A 3PWUA 1OPGL 4Q0XL 1T21A 2OL3H 3SEPA 2R0LL 1D5ZA 2GT9A 1QLEL 2J8UB 2QHRL 2ZJSH 5B21A 4PRAB 4AEEA 4XB7A 3D85A 5C7XL 1CDCA 2R1WB 3QXAB 1QZ1A 2PO6D 5FV2A 1N5AA 2I27N 2SEBB 3UBXG 3BN9C 5D93C 3OKEB 5EG6C 3U6RA 3KXFE 1CD1B 1SEQL 2FEDD 4MHHG 5DUBA 3BZEA 3MOAL 1GZPB 2QQNL 3K3QA 1A1OA 1INEH 5E56A 1AXSB 1CVSC 2P5ED 3BUYB 2VDNL 2CIIB 4GRWH 4QXTB 5E70A 5EIQA 3RL2A 2MFNA 4ONFH 4YWGL 3FOMB 4FQCL 2GUOB 5CINH 4NO5B 3MV8D 1CR9H 5FB8A 4IRSD 3IFOB 5J1TC 2GQHA 4OD3H 1RK0A 1YNKL 5TDOB 4DZBA 5E7FA 4WDIA 4O2FB 1BZ9A 3V5HB 4EI5C 2YK1H 4JFFE 4KRPC 1TENA 1HH6B 4NKDB 3C09C 4TUJB 1NCAH 4JCLA 5I6XC 3TPKA 1MFDL 2GTWB 2Z31C 3SDCD 5J3HC 5JPMA 1VPOL 3VXPA 3X11A 3J7HA 4FQPA 4GMSL 4QTHA 4YBQC 5EZIH 2A6KB 1XF4B 2BNQE 3VFTA 1NEZA 4FP8H 3G9VA 3MV8E 1KPRB 4I48B 1YNTA 4S1RL 4WI6A 1ROWA 3SO3C 8FABB 4L8DA 1MCWM 4P23C 1BFVL 3C6LB 3OR6B 5MENA 4WU5B 3PL6A 2V17L 4TQEH 2YD4A 1KV3A 3U7AA 1Y6MR 1JHTA 2FGZA 2BVOB 2DQHH 2OBGA 1BFVH 3T0EB 1PVHA 5E08L 1FDLL 4LGSB 1DDHB 1H15A 5FGRA 4OFYA 5IW6A 1KC5L 2R2EB 4KXZH 4NC1E 1VDGA 5MERB 3C09B 3GMNA 2GITB 4N1EA 3WFBH 4FXKB 3I85A 3FN3A 5FB8B 4BZ2H 4WW1B 1PEZA 1VEPA 5T33H 4G8FA 3O6LL 3D3VA 4OZIF 2IAND 3O11A 4HLZH 3RVWC 4OKDA 1JYVA 4LQFH 4L8CA 2NX5A 4ZNEE 4K3DL 2PW1A 1RIUL 5EOCH 2I24N 3D0VB 3L95A 1MCOL 4GAYA 4ZO8A 5FUZL 3LEXB 2F19L 3GI8H 3O3BA 4PJDE 1JPFA 3LD8B 2FNBA 4ZFFB 4G42A 2A6KA 3JTSA 4LFHD 1XCTB 4K7PY 1N5YL 2JJWA 2EDOA 4GKZA 2QSVA 3ULUL 2YRLA 3VXUB 5BZWB 3VU2A 1I8LA 3C5ZB 2YWZA 1KNOA 3ES6B 1WWBX 1F4WH 3C8DA 4MNHA 3REWB 5D1QA 2OXHA 5GRJH 3U2SA 3KGRA 3QG7L 2VN4A 4GG6B 1YEDB 1JPGA 3OAUL 1SEQH 4R2GD 3LQAL 3RWGB 4OLXL 4DTGL 2OJEA 3LS5H 4J3SA 4OCXH 3QWRD 5DD1H 5CD3A 5K9KA 2EKJA 4X8JA 1IT9H 2JJUA 3C08L 3ZDXF 1VFAB 3ZYIA 3T4YB 3CDGA 4KJYB 5KTEL 5EIIA 4FXKA 5D7LD 2AI0L 4D0BA 1BJMA 2ADFH 4QOKA 1NGQL 1A4JB 3ULUD 3RX8A 2EEBA 4KI5D 4PJIE 1WTGT 4NHCL 1NAMB 5A2KH 4IEFB 2R1XA 5AD0B 3CLFH 2YA0A 5EA0H 1DQQB 1CG9B 1IGIH 1MJJB 5MI0B 2GSIA 5F7KC 3QEGL 2XNAB 3UJIH 5IFAL 2FSEB 1JN6B 4WNQB 2GTWA 4N9OB 4Y8AA 4L3EE 3K4DA 3VWJC 1FLTX 5FECB 2BVQA 1NFDA 4O5LL 5LBSL 4NZTL 2NLJB 2W9DH 3MNZB 2ICWA 1BVZA 1CD9B 3UPCA 3GHBH 3VI4F 3ROOB 4X6CF 4BSVA 5HD8D 3VFTB 2R0LH 5D1XD 3FMGL 3WUWA 4LAQH 3K2MC 3NH7L 4XCNA 3IJYA 1EXUA 3Q0HA 3VFPA 3TV3H 1JGLH 4KI5E 5IEKB 5DRWA 2X4RB 1J05A 5SWZA 3TCXA 3GMMA 4NKOA 1KB5B 2RGSA 5IM7A 4UTBH 1R5WB 2YUZA 3VG0H 1FZJB 1KTLB 1VB9A 5JLZA 4GT7A 1CE6A 2EXYC 4Z7WB 5DGQA 3T0EA 2O93L 3CH8A 3G5VA 2VB5A 3SY0A 3TVMC 1A21A 5F89A 5TGBB 3R8QA 4E9LA 5JORB 2G2RB 3GMNB 4JAMA 1KEMH 4HV8A 3MV8B 5B38A 4U6TA 3RWDA 4DKDC 4G8GE 2AJZB 4KZDL 2F53D 3NAAL 1YZZA 5JDSB 3ULUH 3VGHA 2GSGB 5DMYA 2E8ZA 5JIKA 3DSFL 1KJ3L 1R0AL 4LK4A 4MJIE 1BVLA 2BRRH 2R9HC 5HHXL 5DDHB 1KPVB 3C9NA 4I2XA 4LCCA 4KK9C 4EQ2A 2EIZA 5E95B 5E8DL 4ZPVA 4NO3A 3IF1B 5FECA 3L95B 3GJEB 2P4AB 3RWIB 2NLJA 4HMEA 3MNZA 1RZJC 1ADQL 2C7UB 1KT2B 2EKSA 5IROA 2NCMA 3ZDYF 4JN2A 1F8TL 1GHFL 1HYSD 1QLRA 3MODL 4GKZB 5ACZA 4C54A 25C8L 2PR4H 3BJLA 5DJAA 2FYYB 1TTUA 3QIBA 4XTRC 4OF3A 5GIRA 4D0CB 5K93A 2VLMD 3IJSB 1LE5B 2V2TB 1IL1B 3VI3E 2PN5A 1YEDA 4HDIB 4L3CB 4FFVD 5GZND 4PLOB 5LJYH 1RI8A 5J1SC 4YC2B 3MRCB 4UV7H 5I15H 4CVUA 4HXBL 1UWGL 4LLDB 4GQ9H 2VZSA 1E4JA 3TNMB 3CC5A 4RBPK 4G5ZH 4N0FB 3CFCH 4XCFH 3DECA 3HAEA 5T5FH 3BH9A 4H0IA 1G9ML 2VR9A 2EDHA 5ISZA 4WW2B 3C60C 1EAPA 2MCPL 1CG9A 1MJJA 4XPFH 4Z7UB 3CLEH 1RURH 2J6EL 3ARGC 2W1NA 4U6HA 1K8IB 2AJXL 4YHKH 4PP1D 3OHXB 5H94B 1ZT4A 4KHTL 4NQVA 2IFGA 4Y8DC 5CHNB 4J1UB 3Q48A 3MCLH 5KJRH 4Y4FA 5FUZH 5SWSB 3CFIC 3LKOB 3S35L 4G9DB 3WNKA 3B2VH 2PCPB 4XX1E 4WTZA 1CE1L 4HX1A 4QWWC 1AFVH 2Q1EA 1EXUB 2Y25A 4F3FB 5GQBA 1QBLH 3RZWA 4K23L 1OCWH 3MREB 5FYKH 5IQ7L 1FNHA 1U8LA 5DK3A 1T2XA 5D93B 2IC2A 4QRRB 4W6XB 3G5YA 1BFOA 4NJAL 1S7QB 4Z7WA 2G9HA 3QNZB 4K7FB 3CCHB 4QYOB 3KPSD 1RQ5A 4BSWB 2VZ1A 3QJHB 3AY4C 1P6FA 1WT5A 3VJ6B 4HFWB 1RUAL 4QHUB 2Z8SA 3AC0A 1HQRB 3EO9L 3H2WA 1OGAD 5BJTA 3LHPL 4CGTA 3M17A 4HLZG 5C9JA 3ARGA 1OGTA 4JKPH 4CMMB 2D7QA 2E9IA 4UUJA 1HHHA 1KFAL 1ZTXH 1KIRB 1BGXL 4YE4H 4KFZC 3ZE1F 5CEXB 1ZA3B 5DC4B 1FH5L 4H0GA 1G7LA 4FQQA 3P77B 5F9WC 2ED7A 1Q9KA 1FRGH 1UACH 2AEQL 1RZJH 1HZHH 4ZYKB 3GRWL 4A6YL 3TA3C 1TPXC 3WS3A 2F5AH 4JFXA 3CIQA 5E8DH 3CX2A 5LGHH 1EV2E 1R3HB 5EOQH 5GGVY 2UUDH 1LWRA 3QIBB 2CIKB 4KDTC 2OLDA 5ILTL 4N68A 5CGYC 2HT4C 1LQSR 4HGKC 3MREA 3BKJH 4HBQA 3VCLA 1PSKH 2WBJA 2VXTH 4L3CA 3Q1SH 3MGTA 4PRNB 3VRLF 3QQ3A 2ZUXA 3LKQA 4ETQB 1VFUA 1S9KC 3CXHJ 1UGNA 3OJ2C 4WIQA 3TYGH 5IEHB 5HYJB 3K74B 3LKSB 5GHWH 3MRDA 2YD5A 4F15B 3HPJB 3RIAK 3VXOA 5CEYB 1ZEAH 1FJ1A 1UZ6F 1U8HB 3D85D 3CVHH 3VRIB 1KBGL 4X5WB 4KV5E 4KY1H 3SKJL 5F1IB 5CEXA 2CDFA 1CD8A 5HGDB 3S5LA 2FHCA 2GAZA 5LWYL 3BZDA 1JWUB 1XF5B 1FGNH 1H5BA 2D31B 4JFDB 1OL0A 2C1PB 3GHEH 3PNWA 5C1MB 5SWQB 2QBWA 4AM0A 3GDBA 4PTUB 4MNQE 2EYTA 5GHWL 2P8LA 2R0KL 3OB8A 1OP9A 1Z9SA 1CGSL 1N64H 1PY4A 4Y4HD 4BQ6A 5I1LA 5IB5A 5DVNA 1W72B 3HCVA 3MJ6A 3IRPX 3SGEH 1WJ3A 4IOIB 1H3WM 4JRWA 5DD0L 5F9DC 1QBBA 1EEQA 1NGQH 5CJ5A 1S78C 3IGAA 3EO9H 1MLBA 3WXVH 1UCTA 1JZ8A 1AE6H 1QHPA 1IKFH 4MJIA 5C70A 3V6FB 1C7TA 1D5MB 2X7LA 1CGVA 3H3BC 5I1JH 3MRDB 5INCA 1DQJB 3SE8H 4DW2H 3MRPB 1BP3B 4MXVE 4RWHA 2HFTA 5FOBA 3DX9A 4W6WB 3JTTA 3VFOB 2P24B 1T1WB 1X5KA 4FS0A 4A6YA 4QHUA 4Z7VE 1G9EA 1J8HD 4K7PX 1FFOB 4ZPTA 3VRIA 2OTPA 5C9JB 1RU9H 1YYLH 1Z0NA 3GSOA 3HRPA 4KTDH 1U6AL 1NAKL 3MA7A 4K8RC 4GUPA 3A6BH 3D69B 3TNNA 1FAIL 4R2GC 1E27B 5CCKL 3RKPA 1JMZA 4B7IA 4J4PC 4M7LT 3PNWB 1DN0B 3KWWB 5D2NB 5DUPL 1KPUA 4NWTH 3RVXD 3N9GL 1TVDA 4JO1L 4LDLB 1T04A 3QFDA 2D0HA 4G7VL 1QLFB 3ZKMC 4GS7B 1UG9A 3K8MA 2R4SL 3UBXA 1Q0YL 1LP9B 3QJFB 4H8WC 5I1LB 2DMBA 3VWKB 5C0IB 2IANA 4LAJH 1F4XL 1BZ7A 3EYVA 1VADB 5HBBA 5T33L 1KCVH 5FDYA 1F02I 5DVLA 3VH8G 1F4WL 3BDYL 3NA4A 2VDPH 3BFOA 3VD9A 4ETQA 4IMKC 2EDLA 1AQKH 2FHBA 4FXLA 4HIJB 4J7RA 4JHWL 5IOPB 2A38A 3PABA 5JHDE 2MHAA 4D9RD 5F9AC 1V8HA 1BEYL 4OB5L 3EDDA 5F9WB 3VWKD 2XN9E 1HXYA 1I3VA 4FQXA 3AREB 2ATPA 4WEBL 2X1WL 1BD2A 4EOWH 4HIXH 3KLAB 3VFNA 5DQDH 5FDWA 4BH7B 4KJQC 2WUCH 2WM0A 3W2DH 3RRQA 3HMWL 3DVNA 4QRPD 5CP7B 4HK0B 4NM4H 4P57A 4KJWC 2APXA 1K6QL 2N7BA 3AU1B 1G9NH 5DJDA 1S5HB 2OSLB 4H26A 3KJ6L 1IAIH 1NUFA 1YMHB 4Q6IA 5DGRA 4QRTB 2C9AA 4XMKL 3P2TA 4ZD3L 4KUZH 5SWZE 3MTRA 3WN5B 4NOBA 4N9GA 3LPFA 5D7IB 1HKFA 5C07D 5FO8A 1PDKA 4P5KA 4EI5D 5IIEA 1BJ1H 4JZOA 5C0BE 3ARQA 3IS0X 1QSVA 4GQPH 4LPTA 4PJCF 2PTUA 4XCCL 4ALAL 3HCVB 1K85A 2VSDA 2DTSA 1HNFA 3VWJA 1I1RA 4NQDA 2NQCA 5E8NA 1BREA 2GJ6B 2EECA 1DFBL 2NY2B 2B1AH 1A6UH 3C6LD 3RUGB 4DN4H 3QUML 3LMJH 1CICC 3QZWB 1N59B 4ODXA 1OAYL 3QUMB 1PZUB 4JFHD 3MUJA 4Z76B 3KPSE 3UMTA 4QHMB 1JNHA 43CAA 4P23D 5F8RC 3B9AA 1AGFB 1R3LB 3P73B 1LO5A 5JIIA 1B0RA 3IDIB 3WL9A 1F6AB 5HDQL 1AXTH 4XCEA 1CFVL 2QHLA 2CJUH 4EEEA 2DLHA 3TV3L 1J87A 4FFYH 1EUUA 1JTTA 4LHJB 3MV11 1WUNT 4JFDD 3MRKB 3NIGF 4ZS7L 4NSKB 2FJFB 2XKUA 4NRYA 1UXWB 2VR4A 1RK0B 5J11C 1HI6A 2UWEE 3FHQA 4M6OL 4O2FA 3V52H 3WDIA 3NCCB 4HC1L 4GKNB 3P3YA 4S0SD 5FYKE 1FV1A 4Q9QH 2VDMH 1CLYL 1NBVL 1EJ6A 1C5BH 3NACL 3ZTNL 5E2UH 4UB0L 4LARL 1TZIA 5BXFA 1A6TB 1NFDE 4ZFFA 3AVEA 1A22B 4KKAD 4E42A 3D39D 3IXAB 3PGCA 5J6GB 2A1WH 1XF4A 4JJ5A 1NGXB 4N0YH 2WZPD 1PG7W 4MHHI 1A2YA 1CT8B 2Z31B 3QI9A 1KBGH 5D1QB 3P9LB 2XWTB 5KSAA 2PYFA 2ZNXA 2YBRB 1D9KB 1AY1H 3U0TA 2CKBH 4HUXA 2X05A 3QZWA 3MLUL 2YD3A 4JKMA 4WHYG 1FVEA 4M5ZH 1IKNA 4NKIH 4U7MA 4PRDB 5IOPA 1DVFB 3EDKA 4TNVF 1F3DJ 1AC0A 1NCBH 2F8OA 4JDVA 2BMKA 4RGOH 2X41A 4F7EA 1MRDH 2CO6B 3QIBD 1PZ5A 3BAEH 5EIVA 2AGJL 1EZVX 5FFLA 3VE0A 4IOFC 2PO6A 5HHQB 1VCAA 4UT7L 1LO2H 4O51A 4IRZH 3HG1A 1I85C 4MJID 1A6WH 2DD8H 1WTLA 1WV7T 4HUUB 1S9WB 1VFBB 3GB7B 5EU5A 3QULA 3H3PH 4RNRA 5DJDB 1KIQB 1I3GL 1UB6A 4H26B 4WI5A 4I18B 4NQCD 4PRPA 3RVVC 3NIGE 3SGKA 5HI5D 5KSBB 3MGOB 2OK0H 3IDJA 4NKQB 5MEQB 4QRRD 4N1HB 5B39B 1YJDL 3HZMB 2F5AL 2WWMC 5EZLA 2BVQB 2R29L 5ESQB 1D5IH 3BYYA 2HFEB 3X13B 4ZD3H 5KG9B 5M7QA 3T0AA 4DGYL 5KVEH 3VWJD 5L8KB 1XCTA 4HWUA 5E9DA 1RUKL 2DQUH 2BOBA 5HHOD 2PYFB 1KF9B 3MBXL 4C56D 4XNQA 1D9KA 1IM3B 1X7QB 2DI7A 2EDRA 2YUWA 1WBZB 3MCLL 4PV9A 2FZ3A 4XP6L 2CLZB 2HMID 3JWDC 1FZOB 5C6WH 3WFEH 2ZOKB 1KCRH 1U8NB 3S3PA 1S7TA 2C1OB 1CXKA 3FFCA 1L9MA 4LSPL 4JFQA 3B2UD 3JVGC 2QSCH 1KELL 1BIHA 1NGWA 4O51B 3CDGB 1WICA 3TP4A 3LZFH 3KPRA 3TO4B 1UT9A 4Y4HC 2GK0A 5DMKB 2L4OA 1ZGLB 2XRAL 3CVHA 4XNZC 4D0BB 3MLYL 3X12A 5IQ7H 3LEYH 3S5LG 1IAOA 3SDXB 2X70A 1CDUA 5GRXG 3O4LD 4I4WB 5EBLA 3DXAA 2ZKHH 1T5XA 1ZV5A 2DKMA 3GJEA 5ESQA 4R6UA 1IAKB 3SCMD 4UDTB 2YPKA 1ED3B 1FO0A 5DJ8A 1B9ZA 1ADQA 3GIVA 1FLRL 3VDBA 2VAAB 3U4BH 1RFDL 5ACZB 4E42B 3QXUA 4YFEA 3BE1H 4XRCB 5DJAB 4XNUH 1NUDA 2HVKB 4U1JA 4O4YH 5KVFL 1NGZA 4M8VA 4L3EB 4M43L 1T21B 2B5IB 3TH3T 2ENYA 3MODH 2XFXB 4ODVH 4GLRH 2HYMA 4HS6B 3O0RH 1WIPA 1M4KA 5LGJB 3CGTA 1H3XA 1RUPL 4MQXC 2UWEB 3SKNB 5EOTA 5L2KA 4GH7B 4NHUB 2NY1B 4L3AA 2OTWB 4OM1L 4Y0GA 3QG6A 1S7WB 2X9YA 1QSFA 1RUML 4P46C 1OPGH 3T3PF 5DUPH 1S9WA 1VFBA 4TVPD 4XMLL 1PLGH 4FMKA 1EGJA 4CKVX 5KVGL 5D9SA 5DA0B 1HINH 1DBKL 4MDJA