2HXAA

Crystal structure of cu(i) azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "csphqgagm", at ph3.5
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCSPHQGAGMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Engineering Copper Sites in Proteins: Loops Confer Native Structures and Properties to Chimeric Cupredoxins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 29
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hxaA00
1A8ZA 4KNTA 2OV0A 2XV0A 2PPFA 1IBZA 3FPYA 2LLNA 4AKPA 2PPCA 1PLAA 2VN3A 3H4HA 3FSZA 2OCCB 3T9WA 2IWEA 3SBPA 1JVLA 4YSCA 2BW4A 1GS6X 4A2DA 5D4JA 1NPNA 2HX9A 1AR1B 1KGYE 3QJVB 3UAAA 4E9TA 1NZRA 1AANA 1AIZA 1E65A 4HCIA 3DKHA 4HCGA 3NT0A 4A2GA 1ZIAA 2HLEB 2Y69B 4AKQA 4DP7X 1V55B 2NRDA 3T6XA 3QJUB 1JZIA 4Q89A 4ZK8A 3OQRA 4CSPA 1JZFA 2XXFA 2J5WA 1E5YA 1IUZA 1ETJA 2HXAA 3JTBA 3AG4B 2FT8A 2IH9A 3H56A 4UAHA 1XB6A 5B7FA 1KDJA 1CYXA 4G7RB 2QDVA 3NSDA 4GP5B 2FTAA 3EH5B 3C75A 4JKNA 3T6VA 3N55A 4WKXA 2PP9A 5D4HA 3X1NA 2WSDA 2P80A 4P5SA 2HZHA 2BHFA 1ADWA 3AG2B 1X9RA 3KW7A 3WNIA 2QPEB 2OJ1A 2XU9A 2DYSB 4KO9A 3JT2A 2PP8A 1JXFA 3NJGA 1GYCA 2MTAA 4DP8X 2X88A 1SDDB 3HEIB 3NJLA 1SDDA 3PXLA 1A3ZA 2XXGA 2W8CA 1AZRA 4WTQA 1AS6A 1CC3A 1GR7A 3NP3A 2UX6A 2ZWNA 1ET8A 1BQ5A 1A4BA 3OMNB 5B1KA 2BZCA 4L0PB 2FNWA 1ET7A 1AZCA 3FSWA 2Q9OA 1FA4A 3X1EA 1GS8A 2YAQA 1ID2A 3MBWB 2FQEA 4KOBA 2GSMB 1AZBA 3NJHA 4YSSA 3L45A 4CSZA 5B1AB 3KW8A 3OMAB 5F7BA 5I5IA 3GDCA 2VW7A 4YVNA 2GBAA 2GC4C 1L9SA 4BDVB 1NWPA 1RZPA 4QKTA 1N70A 2GI0A 2HRGA 2PPEA 6PCYA 2TSBA 4UF7C 4G72B 3DIVA 5AFAA 4A66A 2JFCA 2YAPA 1NPJA 4RH4A 6PAZA 3TA4D 2BW5A 1KCBA 1AZNA 3UGEA 1W6LA 1AQ8A 3AG1B 2I85A 1AS7A 1AZUA 2HX8A 3WIAA 3WI9A 2IAAC 3GXUB 1TEFA 3S8FB 1TEGA 1E67A 1J9QA 4HAKA 1M57B 1AG6A 2PCFA 2FT7A 2JXMA 1RCYA 4GXFA 2VW4A 1ZIBA 4YSDA 4BXSV 9PCYA 2VSKB 4A67A 3NJNA 1JZEA 1OE2A 3FS9A 2QT6A 1ILSA 2HX7A 1QNIA 3FYEB 4F7KA 4AZUA 1M9WA 2XVBA 2J56A 3FSVA 2XX1A 3UAEA 3NJMA 3AZUA 1KBWA 1SJMA 1V54B 3SBRA 4DP9X 5B7MA 1PAZA 4KOCA 4DPBX 3CVCA 1NIEA 1PLBA 3NJKA 3IBOA 3WNJA 2W88A 1L9QA 1UATA 3X2QB 1OOWA 2WO2B 1OF0A 3QQXA 1J9RA 2XX0A 3FQ2A 1MDAA 3N2JA 4HIPA 3V9CA 4YL4A 4E9XA 1GY2A 2ZOOA 1ET5A 1JERA 1T5KA 3AG3B 4F2FA 5A7EA 3TBCA 2MRYA 3FQYA 3NJFA 1VLXA 4K9JA 3UABA 1RKRA 1E30A 1SFHA 4BWWA 2Q5BA 3NP4A 4E9SA 4E9WA 7PCYA 2BP0A 4JHVA 4AX3A 1JVOA 1TU2A 2H47C 4DPCX 3PLYA 3D12B 1PMYA 4AI7A 4TXVB 1L9PA 1BQKA 2E86A 3NYKA 4HHWA 3G5WA 2VW6A 3QJTB 1R1CA 3ZIYA 3NSYA 1IC0A 2FQDA 1TKWA 2BWIA 2PPDA 5I6KA 3X1FA 4DPAX 4GP8B 1NWOA 2YAEA 3WKQA 2VM3A 3IN2A 5E9NA 2QDWA 4YVUA 1WAEA 3OD3A 1J9SA 3FT0A 2AFNA 2FQFA 1OV8A 2P80D 4HZ1A 5PAZA 4F2EA 1EHKB 2FJSA 4GY4A 1A4AA 1GSKA 3PAZA 2J57A 4E9YA 1SFDA 1AS8A 4NERA 1X9UA 4HHGA 3IN0A 5LDUA 2PP7A 3OMIB 3FU7B 1PZAA 5I6NA 5IY5B 2UXTA 3FU7A 3RYMA 1BXAA 1QHQA 2BP8B 1MG2C 2BP8A 3TU6A 4P5RA 4Q8BA 2B3IA 2CBPA 3CDZB 1WA1X 2PPAA 3CDZA 5F7AA 2AANA 5TK2A 3EH3B 2CALA 4MFHA 5AZUA 4JHUA 5B1JC 3CVDA 2XV2A 3PPSA 1HAUA 2H5UA 1WS7A 1AOZA 2H3XC 2IWKA 2CUAA 4YSQA 1NIAA 4YSRA 3DTUB 2GC7C 1FWXA 1N68A 2X87A 2HRHA 3ERXA 4DP5X 1GS7A 2FQGA 3MX0B 3ABMB 2ZONA 2JKWA 1ZDSA 1PF3A 2EILB 2XYBA 3AW5A 1MZZA 4KO6A 1HFUA 5I5MA 1SF3A 3SBQA 4E9RA 4BWTA 3PCYA 2DV6A 4DP6X 1SF5A 4W1TA 1ZDQA 1E5ZA 1AG0A 2GB2A 3T6ZA 3QJSB 1KBVA 1NIFA 4M4RB 3GYRA 1WA2X 1PLCA 5TK4A 4AKOA 4UANA 2UXVA 3S3DB 3IE9A 1SHWA 4YSAA 4A2HA 1HAWA 1J5CA 4A68A 7PAZA 3H4FA 3QPKA 2IDSA 1PNDA 1PZBA 2QPDB 4DP1X 4G71B 5D4IA 2UXFA 4HALA 4KO5A 4G7QB 2AVFA 3WKPA 1YLBB 1DZ0A 5ANHA 1OE3A 1WS8A 1SNRA 3UADA 2BO0A 1NDTA 3NJJA 5I6PA 2DY2A 5B1JA 2UX7A 1A65A 4A2EA 3HB3B 1L9TA 2I7SA 2VSMB 3AY2A 1J5DA 3T71A 1NTDA 4PCYA 1BEXA 4YSUA 2VM4A 1XB8A 1PZCA 2PCYA 3FSAA 2IDTA 3CZUB 1OCZB 4KNUA 2CCWA 1F56A 4G70B 1V10A 1XMEB 2BP0B 1L9OA 1BXUA 2N0MA 4FA7B 4ENZA 1NIDA 2AZUA 4N4YB 1ASQA 1ASOA 3V9EA 5I5JA 3ZBMA 3IEAA 5I6LA 3ABLB 1DYZA 1ZV2A 1PY0A 2BZ7A 2TSAA 3T6WA 1EZLA 4M3HA 5AKRA 4YSTA 1BQRA 4DP4X 3S3CB 1IKOP 1BXVA 1RZQA 1KYAA 1XB3A 1OE1A 2EIMB 4BXVA 2XUWA 1GW0A 5EHFA 4NAJA 1URIA 3CVBA 5B3SB 2GIMA 1M56B 1J9TA 1JZHA 2I7OA 2XV3A 1BAWA 1MG3C 2CAKA 2WO3B 8PAZA 1OCCB 3EHBB 2UXGA 2IWFA 3ABKB 3PAVA 4FAAB 1WA0X 2YAOA 1QLEB 4DP2X 1JXGA 2IDUA 2YXWA 2DWTA 1ILUA 1SHXA 1W8EA 4YSOA 1W6WA 1NIBA 2XLLA 1AACA 4A2FA 4GYBA 1PNCA 4G7SB 3S3BB 4E9VA 2CJ3A 4BK5C 3ABGA 5PCYA 3BVDB 3PAUA 1CURA 5I28A 1JZGA 3EF4A 4HCFA 2RACA 4N8UA 3FPXA 2EINB 2EIKB 1NICA 2AZAA 2FT6A 1JOIA 2Y1AA 5I26A 3TBBA 2XWZA 3NSFA 3S8GB 2EIJB 1PCSA 3UACA 1NINA 2BWDA 2YARA 1B3IA 4GP4B 2IDFA 1KDIA 5B1BB 5B7EA 4DP0X 1BYOA 2YQBA 1MZYA 1A4CA 4X4KA 3ZDWA 1GY1A 3QJQB 2YXVA 4W9ZA 4KNSA 1AAJA 3X1GA 1JXDA 2IH8A 4E9QA 2PLTA 3SQRA 4BWUA 2DWSA 3FYIB 3FQ1A 3CG8A 4KO7A 4BDVA 3ASNB 3NSCA 4YSEA 2IDQA 2J55A 1OCOB 3FU9A 5I6MA 2R7EB 1KV7A 1L9RA 3NJIA 5FC9A 2R7EA 2ZXWB 5I6OA 4EF3A 1ASPA 2GHZA 1FFTB 1JZJA 1I53A 3QJRB 4YSPA 2YAHA 2DYRB 1BYPA 2VMJA 3ASOB 3ZX1A 3BQVA 3WG7B 2YAFA 2FWLB 2A3TA 4NB7A 1ZPUA 3TASA 3FU8A 4PAZA 1CUOA 2YAMA 3U25A 1IBYA 3X1BA 4QLWA 1KCWA 1OCRB 3EH4B 2B08A 3OM3B 1CYWA
chains in the Genus database with same CATH superfamily
4NS0A 1KB5B 3L81A 3RZWA 1INEL 3RWGA 1BOGB 1DJHA 2EUXA 2NY1B 4UQAA 3H4HA 4LP8A 2VXTL 4TUJA 4YSCA 2DYPA 2FEDC 3Q6FA 4JO1L 4GAGL 4MCYB 2NNCA 4N90D 5EIIG 5DZOA 4JGUA 3UAAA 3P4OB 3D3VD 2W9DL 3F7PC 4HCIA 1PSKH 4KJPD 1J8HD 3EBHA 3R8BB 4XX1E 1ZSDB 4IKIA 1EZVY 3BEVB 5F89B 3T0EB 1Z9SB 4BFFA 2WLLB 1FYTD 3VE0A 3ILPB 1XGPA 4RMTA 4TRPH 3S36L 4Z76B 2HTLC 4OY9A 3SIKA 2P5EA 4NPJA 1XZ0A 2HLFC 2VR6A 4PJCB 1ZLVK 5CJXA 2DN7A 1UCTA 2JVUA 2JCWA 4N86A 1KCSL 5L6YL 5EU7C 1GMIA 1MCPL 3F7KA 3N0AA 4AGLA 3NSJA 2FL5A 2D3JA 4G7RB 5CGMA 3EFOA 1U8LA 1KLUB 4WU5B 5DDHB 1PU0A 4YC2B 1DUYA 3X1NA 1QO3A 3CQPA 3EH2A 4WK4B 4QCIA 1ADWA 2FATH 1LO3L 1J5IA 4BIKA 3MLYL 3O6KL 3WDIA 4PIBA 4FQPA 1GZHA 1O9WA 2XN9E 5GZND 3I6LD 1JXFA 3LVEA 4WO4D 1M7DB 1FJ1A 4RWYH 3W2DL 3RA7L 1SDDA 5AOJA 4KBPA 3HE7A 5EH1A 3W5MA 1A3ZA 4Q4EA 1Y7VA 4MA3A 5ESAB 1AS6A 4ZZKA 3EJSA 5C08D 4OCLC 4HAFA 3L2NA 3DURB 4GOSA 2F53D 2WXJA 1IQDB 1JDCA 4Y1SA 2OZ4L 3QWNA 3GXNA 1DEDA 2AKRA 5ETUA 2FYVA 2P4AB 4O02L 2WY3B 1EDHA 3P4NA 5I1EH 2V2XA 3PABA 4AMKH 4AE0A 3U30B 3QUMH 4FQIH 3MNMA 4TNFA 1MHPL 1RHFA 3MBWB 5DJ2A 5B1AB 1NMCB 4JPSA 5C1MB 5E2VL 3EJCA 5KW9H 5GZOD 1N70A 4XO9A 3VQLA 3EO0B 2MCMA 2FAUA 3UAJC 4XP5H 4NKIH 2O93L 4QRTA 1AE6L 1J0IA 2OTUB 3GZQA 4LOFA 5TQ0H 3ULSA 2P8LA 3SDAC 1NANH 1SXAA 2HG5A 4YK4B 1OPOA 12E8H 3H9SE 4FCHA 5FWRA 3GSUA 4F3FB 5F7EH 1HINL 3B9VA 1T6VN 4MRBA 1D9KB 4Q7DA 5D7LE 4OV5A 2NNAA 3D05A 4OI8A 1AS7A 2EP6A 3ELAT 1DQML 3VWKD 3L2MA 3LH2L 1S3RA 3V5DB 3GKZA 1HCZA 1YECL 1NKOA 3UZVB 3QYCA 3F6LA 1TZGH 4JO3H 5LCVA 2P5WA 3UO1H 3PGCB 4WFHE 4QXVA 2R1YA 4KWUA 2OL3A 2PTTB 5AAMC 4F58H 2V3EA 5D1QE 4XMPL 4YDMA 2WP3O 3B8SA 2APTA 1DJXA 4ZS7L 3RIAK 1TZ8A 4QEGA 5I1GL 1K8IB 2J3SA 3R19A 4DP9X 4QRRD 2XWTB 2ZYSA 2DQFA 2B59B 3TA3D 2BCMA 3A6BH 5BO0D 3SDYH 5J9PA 3L4UA 4TUJB 3UGUA 2G3NA 3RJOA 2G2PA 2D9QB 4Z7WE 5F9WB 5TH2A 5TDPA 1XL6A 1MDAA 5KSBF 2ZCKH 4Y8AA 2R9HD 5DJDB 4PLJC 4E41B 4AJYV 1FFPA 4H1LH 3V5KA 1UACL 5AQ0A 4RESB 3IGAA 4GAAA 4GNKB 1C5DB 1N12A 2DQJL 1MCOH 1NEZA 1YG9A 2IBZX 1UD5A 1B0RA 4RMRA 3I9AA 4DKFH 1XZ0B 1JFQH 1KPUB 4IKJA 3HUJB 4HEMA 1RZ7L 4QHPA 3UBHA 3VG9C 4P23B 4UMSA 3B7YA 3MRFB 4NZJA 3KPRB 4YBQD 1IQWH 2FL5B 2D2CC 1TQWA 3UBXG 4TMPA 4OF6A 1OO2A 2OS7A 5DRXA 4AX3A 2VT0A 3WJMA 5EF3A 1T89C 5ERWA 4DPCX 1QLEH 1S3KH 1DUYB 3J8F7 1SY6H 3A3YB 3GBNL 4CC1A 1JL8A 4FYRA 2BVUA 4K7FA 3GSQB 3TBVA 3WY3A 2YQ3A 4ABQA 2CGRH 5IB2A 2HP4A 5L2JA 2Y5QA 1MJUH 5HI5D 2DMCA 3MRJA 1IC7L 1R5VA 1U91A 1TKWB 4OTXL 4D3CL 4FE9A 2CRZA 1MREL 1FJ1B 3DYMA 3EUUA 5JUEL 3QJFA 3QUHA 3HNVH 1CIUA 4MA3B 4PW4A 3OHXC 4ANWA 4X9GA 2WSKA 4RRPA 2NNRA 4FLRA 3IN2A 4MVBD 4G6JL 4AJVA 2XKNA 3MBEB 1WAEA 4JHAH 5FLUA 2LTQC 5ETUB 3ZQWA 5HHNA 4XRCA 3OKMA 1PZUB 5KBLA 2VDRH 3PABB 2X4UA 1KYFA 4JCMA 1VFAA 2WBJD 5TJWK 4P2QA 3MRKB 4X7SL 2A2QT 5DJ2B 4G6AD 5H94A 5CGYC 1ZLSL 1Q0YH 4H8UA 4MAYA 2F19H 5FM4A 1KTKE 1JYXA 2MCPH 2H0FA 4JFVA 1FFQA 3LVTA 4C55A 4LO9A 1P5VA 2WAHA 4F8LA 4YE4L 2EDTA 1G4RA 1R46A 3GUTB 3ULSB 5A2BA 1W72H 4MFHA 5B1JC 2P8LB 2HG5B 4NI6A 4KDTC 4A7VA 4GSDL 4H4NA 4AGOA 3I2CH 1N10A 1RVFH 4OVUA 5ALCH 1E6JH 3FAWA 1EJFA 5ADOH 2R0LL 1JTTA 4OV5B 2NNAB 2R51A 2NYYC 5CLTA 1FWXA 4UILL 2D31A 4FNTA 5JW5A 3MDJA 1A7QH 3MZTA 3US0A 1CL7L 2G5RA 1IGFL 5D2LF 5JIKA 3T8VA 2YFNA 4FQJL 5E6UB 4PGEB 3CFBB 1SF3A 3SBQA 2BY1A 2J1KA 3GMQA 4C59B 1RIHL 4XI5D 1ZDQA 1C12B 4EZLA 4I3RL 1EAQA 1KGCE 4JPIA 4JZOB 1AIFB 1J9CT 1MXDA 3ROOA 1VZHA 5BQ7A 5J1SC 1ACCA 3QUZD 1P53A 1VFUA 1QASA 3CMOL 4Y5VA 3LMJH 4LNVA 2QQKL 3D09A 2J8OA 1YNTF 4HC1H 5IQ9B 3VG0L 5J9PB 1A6WL 4X5XA 4KV5E 1BQHG 2B9BA 3AREA 1SVCP 1GVIA 3MXWH 3P0GB 2WNKA 3OZLA 3W81A 4JW3A 5GGTH 1F4YH 1D7BA 1S7WB 5TH2B 4I0KA 5TDPB 1Q9WA 4IRSA 5DD5L 1G0DA 4KUCF 4OD1L 2LHAA 3WUZA 4BQ8A 1F90H 1GZPB 4YHKH 4XN1A 5LJYH 1OW0C 2DH2A 2Q3ZA 3CFJA 1A6VL 5LGHH 5JOEA 2NZ9D 1HEHC 3VB8A 4QNPF 2HCZX 3QDME 4Z0XA 2ZCZA 4JFFD 1OP4A 1B0RB 1JF1A 2QKIA 3RBGA 3ARBD 2QJDA 3HB3B 4KROB 4UTBL 1SDYA 4PJEA 2A9DA 2J8UA 4LCIL 4AXWB 1F56A 1UUNA 1FC1A 2A77L 3WTUA 3E1ZA 5I73B 2NT1A 1F1AA 2YZ1A 1ZJAA 2BSDA 3WJMB 1ASOA 1RSFA 1R33A 5I5JA 5BPPA 3H9ZA 4S1DC 3FT3B 5A1AA 1GXEA 1ZV2A 3LPWA 5LBSH 1LILA 2N01B 3QARA 2FYYB 1E5CA 4FJ6A 4NO0A 5CD5C 2GFBB 4R0LC 1NMCC 3P0VL 4ALAL 1U91B 1E8XA 3O2DH 3TBYA 4JDEB 1D5BA 2MMXA 3PWLB 2EIMB 3G3LA 4UOQA 4FL4C 2YMOA 1U42A 3ZMNA 3TWCL 4G3YL 1XAUA 4WW2F 5D96B 5DLLA 1KB3A 5D7JD 4IMKC 3Q48A 4P46A 5EIVA 3S48A 4DSYA 3VD1A 4ZXBD 3J27A 3RUGF 5D7EA 3SJVE 4X6DB 2IWFA 3K72A 3ECVA 1RZGA 1T1XA 3MV11 3PE9A 5AKSA 5JOPE 4FAAB 2NY2D 3OKMB 2X89D 1CDUA 2BFVL 2XVKA 3BKCL 3LKQB 4YHMH 1XEUA 4N2CA 3TBWA 3A5VA 1XGQA 4P2QB 1QBBA 3KMDA 4LLQA 4MTMA 3LRHA 2OSLB 4K7PY 2P46B 4ZO8A 3HC0B 5T5NG 4M1GH 4YHOL 3T3MB 1XR8B 2O30A 4NNPL 5SX4I 1HXKA 2ARJQ 3RIAF 2F54A 1OM3L 4LAQH 1HWGB 4MA7L 5DF0A 1IGCL 4X8XA 5TE4H 2HTKC 1G6RL 1F3DH 3CC1A 3LNGA 4URTB 2Q8BH 3ZRCC 3WTVA 4QRSB 4IBVA 5BS0D 4KK8D 4JRXB 2VWEC 4BFRA 2CRYA 2YARA 4DW2H 4PB9L 3SE9L 3BWSA 2D7OA 3FZUC 2WPGA 2ZCLH 5AAWA 2F5AH 3ELQA 2H0JA 3FQWB 2BVPA 4X4KA 4J3OH 5TF1H 3KPNA 1FCGA 1ZT7A 2D31B 1FZOB 5JW5B 3HG4A 2OJZH 4MMXA 3GIZH 4HISA 3LZRA 4PJFE 4XNXL 3QNYB 1A14L 5FGCB 1OSEA 4KO7A 3FB5B 5IOKA 3ASNB 3M46A 1S7RB 2YKKA 4LVNB 3VYOA 1DQQA 5ITFB 1ZKAA 1Z9LA 3GMQB 4IBQA 1KB5H 1OF2B 3CDFA 2X2HA 4M9OA 5LHDA 3TT1L 5IF0A 2YWZA 4L4VB 2GHZA 6FABH 2FBJH 3LPPA 4F8TA 5MHSE 5CJXC 2J25A 4JVPA 2HJLA 4HKBB 2LVCA 3M6DA 3TCXA 3APFA 3O6LH 4LGRB 4DOHB 2UYLA 4M1CD 1GGIL 2WWNA 4GT0A 5FOJA 1NSNL 4KK9C 2VC2L 3CBJB 1ETZB 1K4CB 5DZ9A 1AY1H 3BO8A 4QTIH 3PGDA 2VDNL 2X4NA 3SQOL 4PJDA 1L5GA 3E0GA 3DHPA 4MNGA 4Y9FA 2CR6A 4Z0XB 5I1IL 1F0LA 3DBXA 2VR9A 1AGFA 1VFBB 1WZKA 1JF1B 1OTSC 1UD4A 2QKIB 3HE7C 4I0PA 4OZFA 5ECGA 1BMZA 4NN5B 1XF4A 3ARFC 4PJEB 5HHME 3F04A 3I9GL 2K70A 2IWEA 3II3A 4IHBA 3DXAA 2J8UB 4R8WH 4P4RA 2BW4A 1HHHA 5BVPL 1T04A 2AJZB 4F15B 3ZSTA 1PLGL 4TTDC 1WV7T 2DZEA 3QWRD 1E9QB 2GSGA 4FFZL 3X14A 1MOEA 3D51A 4BSVB 5IUSA 5KZCD 3VXTA 5F3BB 4L0YA 3TVMB 4NO0B 1QUNA 2X6CA 1NBZA 4ZPTB 4LMQE 2Y06L 2MCAA 1TCRB 1TJIH 1A1NA 2APVA 4GB9A 1XH3B 2YJQA 3D7PA 2IH9A 3MUY1 3UXFA 3WEXA 3IGKA 1HKFA 2WUCH 5T1LD 2BCKB 2AXJA 4ZO6A 5HVHB 1NC4B 1LP9E 3C75A 1K6QL 4HP5A 4MHHG 1JCKA 1UGKA 2FLMA 3V6OE 5IHHA 4GRLC 1KGUA 3QR2A 1YUHA 4KPHH 1T1XB 1QOKA 3HE6A 3VB9A 5ICXA 2GITA 4BINA 2WNWA 3V7AE 3TBWB 3WY1A 3ZE2B 1NGPL 3QPXH 5EZOL 4YDKL 4MNQD 3ZR6A 4P04A 3MNZB 2CZNA 3K8LA 3S7GA 1BQSA 2X88A 5IHWA 4Y1AA 3HEIB 4GIPD 1J5OL 3BUQA 1EDQA 2CR3A 4L5FH 1D7FA 1IILE 3JWNH 3FO1A 3QS2A 4GAYB 3IMUA 3FH7A 1RPQA 5FHBL 5D7IA 3KWXA 3GDBA 4CU8A 4M7ZB 1CFSB 1ZGLA 5I8EB 3AU1A 2EO7A 3ARDA 3AVEA 2AV7A 4Q9BA 1KGIA 2N0KA 4MAZA 2J21A 5LGJB 1JPTL 3IETA 1ID2A 2FQEA 2FECL 3HRZB 5F9OH 1IBHA 1X5HA 1E4WH 1ZT7B 4HUUA 3O0RH 1HEJC 1L0YA 4MMXB 3M1CA 4PFEA 5EBLB 4NAQA 2BHYA 1DQQB 2ZE0A 1TQSA 1OEZW 3TONA 2D7TH 3DX8A 4K55A 4N85A 1QD0A 3GO1L 3GNML 3C6LD 2B8OT 1AZNA 4XHJC 3UGEA 3QG7L 4MYPA 5IBLD 2HJLB 3PWPD 4D0BA 2HJFB 1CK0L 3EO9H 1F86A 5I73C 2NZ1A 1AZUA 2FJFA 4OGQC 4QJ3B 3T77A 4CRPA 3QFGA 4YHIA 1RUPL 4OGXL 1IAKA 4PCTA 5KWYC 4IRZL 2WWKO 2C9SA 4ZUTA 1XBRA 2V5RA 4GPVA 3AXLA 2DLIA 2JXMA 2V17H 3BO8B 2WXPA 2DBLH 9PCYA 3PGDB 2VSKB 3FF8A 3UBXI 3NJNA 4Z7AA 4RAUB 3FYEB 2WVVB 2HPOA 3MV8B 4AZUA 4MNGB 5G4MA 2EUZA 2FCBA 1WEJH 1KGJA 3IT8D 1JK8B 2C7FA 2DMGA 3DBXB 2B1AL 2HVKB 5JW4M 3QDJB 1EHXA 4OZFB 2BHZA 3H3KA 2BJMH 4NM4H 4IS6B 5D96C 4FC3E 4NKDB 3B9EA 2XTJC 4RGMC 1HHHB 1A3LL 4V2CB 1T04B 2EIDA 2W88A 1UATA 4AC4A 4YDJA 1GJUA 4J3OD 2O5ZL 2GSGB 5E2UH 2JKRM 3SN6N 1FVDA 3OGCB 1AD0B 2JMRA 2XQBL 1BZQK 1I9IL 4L3EE 4P4KA 3FRUA 1EJ6A 1QUNB 1SM3L 2VISB 2X9YA 3I3EA 1NBZB 4MAYC 1H15B 3T8XB 1A8JH 3E38A 3LH9A 3WN6A 2XRAH 4J6IA 4HG4K 3HC2A 1UC6A 3U1SH 4IOIA 1E43A 4M7LH 1CGXA 1NMAH 1T21A 1Z1WA 2NY1D 4ANKA 1DJWA 4HIEB 3WEXB 2O6DA 4YX2H 3MFGB 3TYGH 4BZ1H 1BCIA 4WAFA 2A9BA 4L23A 4QO1A 4BQBA 2H1LM 2VRQA 1XCXA 2AEIT 2IQ9L 1J1XH 1DBJH 1QBLL 2ZT9C 4LLAA 3H6AA 4HUCA 5EIIA 4PN6A 1U21A 1EEYB 4FQXD 3MR9A 1FVCB 5IQNA 4FXLA 5I74B 2GITB 4I0CC 4MJJA 5K33A 3T0ED 2DQGL 5KYYA 2BWIA 4JFUA 3Q2LA 2GJJA 2PYEE 4HV8A 2X10A 1CD9B 4Q4IA 4XE5B 3JTTB 1YMHA 2FH8A 5CZVL 4WHTA 1XCQB 2ERJC 3QQNA 1U8KA 2JKTM 3FO1B 1F42A 5LXVA 3GBEA 1H8SA 3HI5H 3K2MC 4OZ4B 2DPKA 4YVUA 5D7IB 1V3KA 4TVPE 1KELH 3ARZA 4Y5VC 5IB3A 4GXUM 1MW1A 1ZGLB 4FXKB 4ZT1A 4F7TB 3AREC 5AVZB 3IETB 4M43H 4RDBA 1SFDA 1T7ZA 1TTRA 4D7PA 2DQCH 5DI8B 4R7XA 2WN3A 3R4RA 4IRSC 4NP4H 3FQRB 3FU7A 3L48A 3BAYA 4NQXA 4HUUB 4XN4A 3ETBJ 2G75B 1LE9B 3D69B 2X1QA 3TNMB 5I8OL 4HK3J 5JR1H 4P5MA 3HR5B 4XMLL 3ZO0A 4NHUA 4PGBA 5FYKE 5CF3A 5TTRA 4AYEC 1ZGLM 1WFTA 1JG9A 3C5JA 4OUUB 2P43B 2E27L 3GRGA 4C4UA 2QKIC 1HWHB 1P6AB 3RFRA 1I8AA 5FGRA 5IEKA 1AJ7L 2DJ4A 1GAFL 4XTRD 2K4WA 3JV6A 5KTEH 4YXHH 2CUAA 1MFVA 5IOPA 1UJ3A 3F2LA 2VQTA 5E23A 3CDGB 4NGHH 4Y9GA 1COBA 4YHIB 2BP5M 1WGVA 2FQGA 2R39A 1CGSL 5IKCA 3VJ6B 3BKML 3MJ9A 3AXLB 1A7PH 2JXMB 4E9RA 2D9CA 1JGLH 3S2AA 4G80B 4LHUB 5FDYA 2VZOA 4ZNEA 2QFPA 2VL4A 1A7OL 3SDCB 2DEXX 2VZVA 2X9XA 5IHBA 2VR8A 1T2QH 3RX8A 2BNRD 4UIKL 3QK0A 3UJJL 3QRFM 3HFFA 5CFHA 2L7JA 1D9KD 3IPFA 4P46C 7PAZA 2P5PA 3F7RA 4GLRH 3H4FA 3M45A 3QQDA 4Z18A 1JF5A 5KANG 1VGKA 4AQEA 4LPVA 1E50A 1N59B 5DHVH 1KFAH 4YDJB 5J12C 3TGXA 3Q9QA 4MDJA 1E8ZA 4WK2B 2D7NA 1OARH 5DD0H 1BECA 2OTWB 4DN4H 4OSUH 2AMUA 2DKUA 4JFZL 3NRPA 1ACZA 4XNMA 2K6WA 4P4KB 4M03A 2PO6A 3EYUH 2IGFL 5FWQA 4GG6B 4ENEC 1FH5L 5E2WL 4XAWL 2YGPA 4X6CB 2Z7YA 4OAWA 4R26H 1HQRA 1DBAL 4LRIA 2M83A 1T21B 4B7LA 3VNYA 3IU3B 5JW4N 2IDTA 2LE9A 1EH9A 1E5UI 2B77A 4QO1B 4M7ZC 4W4NA 1MCDA 3IDXL 2W81C 2A73A 4Z7UA 4UZSA 5FYJL 5EIIB 1XZWA 5AAWC 4AY0A 4NO3B 4E41D 1KB9J 4AYFA 5GS0H 4KK5C 4Z7VA 1X5FA 1MDTA 2YN3A 1FORL 4MASA 1M6UA 2BP3A 4GMTH 4DP4X 1HH6A 3CFCL 5KYYB 2DKMA 3HS9A 4D2NA 5FPIA 4Q97A 1IEBB 3NACL 3QEHA 1URIA 1TCMA 2ZOLB 3CVBA 3L2LA 4P23D 5IVXF 5IHUH 3KPRD 1UZ6E 2OCJA 4HJ1A 2I7OA 1J1OH 4PS4L 4QRPB 4ZOCA 1TVHA 3NPZB 4BUGA 4H26A 3VGBA 2VOTA 4BKLA 5CJ5A 1MAML 3UTOA 3ZL4L 3UBXA 1AD9B 2EADA 2W9EH 2FHCA 5GRVL 5B21A 2P7TA 3ABKB 3EJUA 3RNQB 3ORJA 3BQUB 3S37X 1FG2A 1SJHB 5C0BB 4G59C 2DWEB 2IAMA 5TDNB 4LB8A 3FTSA 3ULVL 1U2HA 1HHJB 1CDCA 5FA3B 4FLQA 2CJSA 1GTNA 4TSAH 4N2KA 4G8GD 2IO5A 1MXGA 2GUOB 3O3AB 3GTNA 15C8L 1XT5A 1W80A 2B3RA 4JHZA 4L8SC 3MV7B 1YY8A 3UTTA 4KJPC 1AHKA 2QPSA 2OCFD 1KPVA 4P5MB 4AEHH 1SEBA 3WBDA 4PJAE 3WO4B 1J10A 2CJTA 4GH7B 1NICA 3IXAA 1JOIA 3MBED 4G6KL 4LSTL 3TBBA 1UOWA 3VW3H 3GD1C 2L04A 1PCSA 3TJHC 3VFSA 4I0PC 1ZAGA 2YMTA 3KGRA 4F80A 1QEWA 5IQLA 2AXHA 4OCWL 1BAFH 3PREA 1U6AL 4GKLA 1F18A 4HKJB 1HXYA 1M53A 4HUWB 2K9FB 3JV6B 3CQFA 4D0CA 1PGRB 4GXUN 4OJDH 1SN5A 5IOPB 4YLQT 5CP3H 3QJQB 5HHOA 2BDNL 2CLZB 5I1KL 5J6SA 3H1ZA 2YKLL 1O9ZA 1TJGL 2IH1A 2ZOKA 3BVUA 3SQRA 4E9QA 5IKCB 3FYIB 1VESA 1ZVNA 1DDHA 5SWZE 3GMLB 5F0JB 3LV3B 3WXWL 2QSVA 1SLUA 1QI3A 5JNYA 3V4LA 5CCJA 2G0KA 3CGTA 3OKLA 4WEBL 5HI4D 1KN4H 1XF5A 5GZNC 1BIHA 2W0LA 3O81A 2CLVB 3IPBA 4H13C 5JIIA 4B53A 2ICWJ 1P4BH 2CDFB 2AJYL 1CGUA 1LO2H 4JDZA 1J1PH 1AXSB 2Y24A 3V5HA 1I3RA 2DYRB 2YSSA 3KPSD 1U9KA 4KKRA 4OQTA 2Z4QA 5CO1A 2OLDA 4IHOB 1EO8L 3K6FA 4JE0A 5HPMA 1VGKB 4AQEB 1JN6B 2P45B 3HE6C 4G9FE 1DSYA 2ENYA 1R34A 1WIUA 3QDGE 4G5AA 1LYQA 4OCXL 5E56A 3SODB 5IQ7H 1E5AA 4D9QE 1KMGA 1QABA 4XNMB 3GRWH 3RKDD 3AT8A 3MRMA 1BJ1J 1A8ZA 2PO6B 5LNEA 4MHHI 4GRMB 1IM3B 2PPCA 3E1F1 4P5KA 4OAWB 5GZOC 1QR4A 3DECA 4NWUL 2OI9B 3BSZH 4RFOL 1J87A 1FNGA 2IXQA 1OLZA 4OFYD 1ZXKA 5IWLA 3FO0L 4DETA 3QJVB 5I1CL 1ODAA 4HUVA 2DEWX 3ARDC 1ITCA 3MUJA 4MRCA 2A73B 2UUDK 4Z7UB 5L2KA 2A9ML 5GRJH 4BD4A 1QYGL 5ISZA 2ED6A 4Y4KA 3GPSA 4K94H 3IDJA 1LP9F 3T6XA 4CN1A 4AMWA 3O6MH 1ZK5A 3QCTL 4P3CL 4Q89A 4Z7VB 5GS1B 1QRNE 5I76A 3T08A 1HH6B 2IFFL 3JV5A 4FZ8L 3HG2A 1LM8V 4XH2B 5D6DA 4N0FA 1DBML 1DN0A 3HB3D 4KROD 4F2MA 4UAHA 5CLZA 5ACZA 3L9RA 5EEXA 4Y88A 3OG6B 4L4TE 1FNEA 1MIEL 4S1QL 3WFCL 2N1TE 1M7IA 1JNJA 4JKNA 3MCG1 3T6VA 3KLHD 5AW5B 4H26B 2YPVA 3DHUA 1CO1A 1D6EA 5T5FA 3UBXB 5DQ9A 3WFBH 2DOCA 5DS8B 3IFPA 2P7TB 2Z7UA 3CFUA 3ESVF 4UINL 4WWKB 4FNUA 4MKMA 2IAMB 3GJFK 3LN5A 3BAJA 1SHMA 3OAWA 1B6UA 4NKOA 1RUQH 1A2YA 3WU1A 4KO9A 3AGWA 3AXHA 3A6CH 2R1WA 1OCWL 4S0SD 2EDBA 2SODB 2FX8L 2F74A 2UZYB 2XXGA 5T3XH 4QMEA 1GR7A 2DLFH 1KPVB 4AYGA 3NOIA 1SEBB 3WCYA 2DWXA 1H6EA 3IXAB 2QL1A 3LZOA 4JY4A 5DFWH 2EC9T 3VFSB 1A9VA 3DVGA 4N87A 4FLHA 3K71A 4KVPA 3T3PB 1HSAA 4BRVA 2AHIA 1U8QB 5D71H 4IK7A 4S0TD 2YAQA 5GJTL 2EUVA 5EU4B 1FQ9C 1U8MB 1AZBA 5GS0D 3OMAB 3HLKA 4W9FC 4U0QB 3FUFA 1ZA6A 5HGDB 3KPPA 3FRPG 4YBLB 3TV3L 5C07B 4P4KC 3C2SA 2CKBB 3WFDH 3EG9A 3OPZH 1YQVH 2ITCA 4CNIA 1CDYA 4PB0L 1T7YA 3O2VH 5CU9A 3OKLB 2Z91A 1GYVA 5IROA 2OP4H 2Q7YA 3HMXH 3GSVA 3Q8FA 5D1XB 4JRXD 1A9EB 4OZFH 1EBPA 3ZE0B 5KBNC 5I23A 3UTSB 1RUKL 2YRBA 1NGYB 5FIEA 3VQMA 4U1IB 4NRXA 4NUGH 4NOFA 4PTUA 4OJCA 2YSSB 3LN4B 1YYMH 4Y2DA 1I9EA 4MVBC 3G7TA 2V9UA 2IC2A 4R84A 3WI9A 2P3YA 3NK4A 4ODXA 4AL8C 3LRLA 3H0TB 5EZIH 4N2EA 1CR9L 4OIIL 3WMQA 3I6GA 4Q6KA 2BRRH 2ADGA 2OMUA 2CMRH 1K5NB 5DGRA 1UWEL 1ILSA 1ZV9A 5JZ7D 4G6AC 4AV5A 5KAQF 4L4VD 5F6IB 4UYPA 4P5TB 4MNHA 1WHOA 4HSCX 4XBMA 3KYKH 4CJ1A 2NLJB 4P5KB 2CSPA 5DJYB 2NX5E 5D93C 2WK2A 1FNGB 2PWFA 1EAPB 3H7BA 4HHAA 3OB0K 3WL9A 1BQHB 1XH2A 2Q3XA 4FQHA 4HIPA 5E6RB 5JPMB 2D03H 1PEZA 4Y4KB 4IDJH 5IFHH 3IDJB 3OF6D 1JERA 3O9WB 3DSNA 5DJ8B 5I76B 4RWHA 4PD4K 3NH7L 3FQYA 4ABVA 4N0FB 1DN0B 1IBGL 2AI0L 3WO4C 3LD8C 3L9RB 4K71B 4U6VL 4KX8A 4LRNL 5ES4B 2PN5A 1TU2B 4D9LL 1C1EL 2A4EA 1XHHA 1M7IB 1JVOA 1I8UA 1EHNA 3L1OH 1Q9LB 3WSQH 2DQMA 2OMZA 4AI7A 4FKEA 4TXVB 2B9AA 5EFIA 1O6TA 1MQ8A 3VRLE 1CF8L 5DQ9B 1L9MA 3IMSA 4WNQA 4FULA 1YN7A 1UJ3C 1C08B 3TVMD 2NYKA 4WHDA 1MF2H 1QHPA 3RDTD 3GKWH 4NKOB 1V3MA 4AG4L 1A2YB 2BPBA 1T0OA 1OTTD 3GWJA 2Z1KA 3CFEB 3A23A 3N3EA 4BUQA 1FL3A 3QISA 1BZ7A 2Q0ZX 2R1WB 2F74B 1MQKH 2UZIL 4Z78A 1MLBA 2RHEA 1NAMA 1WISA 4LAJH 1PIGA 2NYZA 1GKEA 3G5VA 4GJTB 2Y3NA 3FU3A 3HTLX 2V7NB 2QDWA 5B38A 5JXAH 1NC4D 4I8DA 4M8UA 3H9SD 1P1VA 4NZRH 1SLWA 4JY4B 4TOYL 5E1GA 5J06A 1MLCA 4DUXA 1EHKB 4YS4A 2NY7L 3K71B 3EKCA 3QHFH 5D7LD 1HSAB 5TGBB 4M8QA 5CCKH 1IGIH 2J5LC 3D85A 3IN0A 4HGKC 5D8JL 3ULUE 4P9HC 3P73B 5F2FA 5IEHA 2XWBA 5EULV 3VMNA 1ZA6B 1ERNA 4WFHD 5I16B 2PPAA 1A3RL 1KIUB 3EG9B 4HJ0D 4JG0H 5INCA 4CNIB 5JPNA 2AJUL 4LOUC 3DDFA 5KANI 1WICA 4NZUL 2EDNA 2XV2A 2YEQA 1Q0EA 1EMTL 4LRIC 4ZMAT 5KVGH 1TPXC 5F1NB 4C58B 1L7TL 2IWKA 4M7KH 4YGVA 5KSBA 3TXAA 2HRLA 1MIML 1R9FA 2ESVB 5D7JC 4N2AA 1T83A 4Y2DB 1N6QL 5F9JA 3L9BA 3MOBH 4N2LA 4A37A 3B9KD 1TQTA 2ODHA 3ML8A 2H2SD 4ODXB 2O5YL 1CF1A 2XYBA 3HW7A 1HFUA 3GK8H 3DDGA 4KKAD 4BCYA 4DUVA 5T3XD 2OMUB 1E4XI 1I4FB 4JRYA 3ZYOA 3IMBA 3VGEA 1WITA 4JG5A 3QJSB 4Z5RA 4RQQB 1KBVA 3OB8A 2Z7ZA 3GYRA 1AP2A 1DCLA 4LFHD 4WHCA 3D06A 3ZKNC 2V2TA 2H45A 2WXKA 4Q6IB 4MX7A 1DQDH 2OMWB 5AUMA 3WHXA 3WXVH 5LNGA 1GGBH 2VDOL 4B41A 3H7BB 2K6YA 3ARGB 4HHAB 5DZNA 2FR4A 1AQMA 1RP8A 3BPCB 5D4IA 3ATFA 3CIAA 3L5XL 5T1DH 2IAMC 1SQ2N 4FFYA 2VJ0A 2X4TB 4FXGA 3MROB 1HIML 4XPBH 4ZMQA 4W6WB 2WZPD 3VWJB 1NDTA 3NJJA 3MV8D 1FO0A 1QSFE 2R2HA 5L8KB 4XPGL 1RUMH 4BFOA 4NC2B 2Y2TA 4WJG3 2GJPA 3C08H 3QDJD 3T71A 2BVTA 3S96A 1RJLB 4OI7A 5IJVA 4Y4HA 4PRHE 4RNRA 3FO2A 2ZX7A 3AAZB 1MI5B 1XMEB 1BXUA 4P05A 4OD3H 4PGZA 1LDPH 1F4WH 5EFIB 4WUUB 2UY7A 4KY1H 1DCEA 1JZ3A 4FJZA 4N2FA 4IQHA 1H3WM 1UZ6F 3FHAA 4WNQB 2YUZA 3MACL 2ZUYA 4LARH 4PY7A 1UM6H 3D87B 5C0GA 4QTFA 3PHOB 2DQTL 2VDMB 3L3GB 4QGYA 1K2DA 4K23L 2KI6A 3FBKA 3SPVA 4NQCE 3AM8A 1FL3B 1TNNA 2AK4A 3BP4A 4YBLC 3WNNA 3BN9C 1MLBB 1NAMB 1H3PL 2F7OA 3PF2A 4PP1D 1G7HA 3G5VB 4PU2A 1FSKB 4KQ0A 3WKYA 4LDCA 3FQNA 2QMJA 4QXTA 1YN6A 3HVNA 1Q9OA 3EHBB 2JQAA 2FSEB 3QG6A 5CSZA 1OLLA 2PWEA 1IBBA 3QXVA 1TFHA 1MLCB 1OSYA 1YY9D 2YAOA 4PJAF 5D2LA 2X6UA 3FOLB 4XCCH 1HZKA 1ZCRA 3D9AL 4M8QB 4F33B 1JS4A 1W6WA 1PKQA 2Y23A 2OL3L 2EXTA 3T2OA 3MJ9H 2AJ3A 4DK5A 5DZJA 3NN8B 3CN1A 4H40A 1IC1A 2H9GA 1YNTA 4J8QA 1FL5A 1ORQA 2R8SL 3HI1A 1DO6A 1KGCD 1G5GA 2EINB 2EIKB 2FT6A 4KZDH 5HY9B 5INCB 1UQSA 1BM3L 4JL1A 5A40E 4QXGH 5LAXA 3BE1H 2OX5A 1HESA 2B7DT 4EXPX 1YSOA 4JFYB 1VEPA 3SOTA 4YGVB 5I24A 4GMSH 4O5LH 5BMFL 1S9XB 5IWLC 3K2KA 1JV5A 2JCCB 1MCHA 2Q86B 2CIKB 5F9JB 1JXDA 4ZPVB 1MCWM 3D4YA 4M6NH 3NFPA 3W9DB 5L88L 3KR3H 3QNZA 1QUPA 2ZAIA 4XPTL 5DD1H 4PREA 3TEZA 3AXIA 3MJ6A 1OCOB 4JRYB 4Y16D 1HCVA 4KXZH 3H85A 3HCVA 2F5BH 4H7VA 4PJBE 1INQB 1AP2B 3MLWL 1N64L 2KPWA 2YHGA 4AV0A 4G8FA 1R19A 5ID0A 4AEIL 4YIQB 1EJOH 2DMKA 3QXAA 4XOCA 2Y2WA 2NY5C 1JI1A 4KU1A 2J1YA 3WHXB 4ANXA 5EEUA 1DSFH 4JAMB 2WLMA 4CA4A 4F9PC 1ZTMA 2L3BA 2BS8A 4JPWH 5DTFB 2QVKA 3HFMH 2A3TA 4NB7A 3N40P 1WJ3A 5CINL 5DFVC 3U25A 3B1UA 1NBCA 4M93B 4MAUL 2KDGA 4LHUD 2E59A 4A6YB 4WW2A 1VGEH 3GM8A 4KNTA 1Q9KB 4GEJA 3SDCD 3C5ZB 4UTAL 5EMYA 4QOKB 4ZJ9A 2RFXB 3RUGA 4GFTB 2DW5A 2F15A 1U95B 5EO9A 3U46A 2VLKE 4MSWB 3X3GL 4LF3B 4WRLA 1MH5B 3Q05A 1TXKA 2VXUH 5CMAA 1VSCA 1G7MA 1Q72L 1Y0LA 5HHPB 4EBQL 1BIIA 1F3JA 1NPNA 2HMID 5F3FA 4LSQL 5FM5M 3VGFA 5IBUG 1HEZA 3OWEA 1RURH 2IMMA 1NLDL 4F5CE 1GGCL 3RFZB 4A2GA 5BRZA 2W9LA 3NA9L 4DGUA 3CK0L 3IJEB 1M6OA 1NCDL 1A6TA 4M5ZH 4PY7B 2BVOA 1FFNA 5C9KA 3FW6A 1KBBA 1OPGH 4Y19B 5AZ2H 1OSPH 4U1SA 3SPVB 1HJCA 3LIZH 2GY5A 4UQ3A 1YA5A 1H3TA 1U3HA 1U4FA 3SOBH 2X6BA 4BYHA 5L7XL 4J39A 2FK9A 3NAAL 1CYXA 1G7HB 2C3VB 5IROC 4IM8A 2E3VA 3FQNB 1J0KA 4QGTA 4LT7A 4EQ2A 3L4YA 2A74A 3TM6A 1U8JB 2APXA 1CD1A 5BXFB 5CSZB 3V4VB 5GS3A 5JHAA 5CFAA 3UTPE 1X9RA 5D2LB 3L54A 4HFWA 5HP5A 1YPZF 3OMZA 4C8XA 1CIDA 4DGYH 4N5ED 3B2DC 3NJGA 2VSCA 5D7SL 4XVTH 1GYCA 2VDQL 2CJUH 5B3JE 1X5JA 1JHTA 1YMMA 4WTQA 2CKBH 1S7XB 5JW3H 4R4FH 1EV2E 1JPSL 3GS7A 4W9CC 2H9GB 5IHLB 5H37A 3VM5A 5MEPA 2OXHB 1ORQB 2KZ1B 4YPGA 4UBDC 4QRPD 1TETL 3QZPA 3P9MA 4G1MA 4NCC2 1JWMB 4OW6A 5MHSD 2O6PA 5HHXH 2QZ5A 1UQSB 3AABA 4L0PB 4FKKA 4M6OL 1WGOA 4HJGA 5F7LB 1FA4A 3BQUD 1UYWH 5C0BD 1P4LB 3KYNA 3OZ9H 4IEFB 3NIGE 2AJSL 4KOBA 3W56A 2KBGA 5I1AA 2FB4L 1SYSA 5GRVK 3EOAB 1JYNA 2GBAA 2GC4C 4KI5F 3MV7D 1N7ML 3BD4A 3NFPB 3SY0A 3BOVA 1ZLDA 3VXUE 2W07B 4FQXC 4DZ8A 3QIUA 1AI1H 4MB4A 4PREB 2TSBA 4WO0A 3GPEA 4DGIH 2HUEA 5G4NA 4P2YA 3MYJA 1QNZH 3W38A 3MC0A 3TBSA 2XIDA 4K5PA 2XA8H 3PJSA 4ZFOB 2GI7A 2DIAA 5DMIL 5ID0B 5A16B 3KWWA 4MZIA 1TMCB 1JPFA 4G7VL 3U0TA 2AXWA 2C7UA 3EJZD 4UQDA 4XN2A 1MCEA 2HX8A 4JFDA 2BOBA 3CFTA 1QA9A 4MJ6B 3WTYA 3LKRA 4POZC 4K8RH 5IUCA 4ODTL 1L7IH 4LVOB 1FZMB 4HOMA 4MA8H 3QFJE 4WLCA 3QO1B 3OAUH 3CX2A 4HSQA 4PJ8D 1BJ8A 4N2GA 4XBPA 2Z35A 2EUWA 5I8CB 4LLMA 1A7NL 2XN9A 5F93C 3S35L 1XCTB 3F64A 2DQEL 5HGHA 3SBRA 2CUIA 2EDMA 3MODL 4KOCA 4K3JH 3LJ3A 5CZXD 5EO9B 3UJTL 4TVUA 2V9TA 4LU5L 5CMAB 2VLLA 4HS8H 3FMGL 2G9HA 1Y0LB 1QW9A 3LKNA 2VXVH 2WO2B 4OIAA 1NMBL 2OQJA 4CUCA 2FO1A 3S34H 5BOZG 4LPCA 35C8L 3N2JA 5JIHA 4KMTH 1SVBA 2J20A 2O26U 3ZHNA 1F58H 1Z0MA 2YPKA 2BVOB 1FFNB 2GTQA 3HAEA 1A02N 4PIRF 5H8DA 4OLYH 3VRLF 4M6MH 4MBRA 4ODHH 3ECBA 2IBZY 4U1SB 4IBZA 2HFEA 5GGQH 1IM3D 1VLXA 4K9JA 4JPKH 1ZMYA 1SFHA 4HEPG 1YAZA 4BWWA 1NAKH 1MCIA 1YO4A 2UUDH 5E1IA 4APQA 4EO5A 2CNZA 5JPNC 5FO8B 4M62L 3KLDA 2YSTA 1SVZA 1VHPA 3GMPA 1TVDA 1EXHA 2I69A 3OKDB 3MOAL 4JQXA 2VKWA 1TT6A 1BQKA 5HYSA 2O1AA 4N2HA 3SE6A 1KN2H 1R1CA 3ZDXF 1T83C 3V0IA 5EF1A 4ZUWA 3IWUA 4FEIA 5ICYA 3RIKA 3RWIB 1R3KB 4OM1L 3PNWA 2FD6H 3PGFH 1MFAL 2NOYA 4OU3A 2R29A 4R7LA 4OCRH 4M1DH 4X8JA 2CRIA 2QVTA 3LZPA 4XOAA 3KM2A 3AACA 3CZFA 4DAGH 2C4FU 4U7KA 4JCLA 1BHGA 5F72S 1KF9B 5D9SA 4YPGB 3R1GH 4TUUA 3RILA 3ULUF 2EDQA 1FV1B 2FJGA 4G1MB 4PR5B 1BBJA 5D1QA 4KMLB 4WDIA 3ZPDA 2I07B 4JLRA 4HJGB 4HMDA 1XGYH 3MNVA 4WWKD 1EZUA 4U49A 1MEXL 4ZW6A 4E9YA 4R5VA 4P9MH 2GHWB 3OMIB 4HWBA 5FUZH 5HYQA 2MSPA 5L4FA 2BP8B 2VH5H 4WTWA 1C7TA 1ZGLP 3GHBL 4F57H 1WG3A 1UB5A 3SY0B 3R06B 4FXGC 4LEXH 1X7TA 5HTSA 2G4EA 5T8IA 1NGQL 4JO2L 5TQ2H 3ECWA 2A9CA 4ZS6D 4A7SA 3B1TA 2GT9A 1F4XH 3F7QA 4LSVL 4P2AA 3VXRE 1IC5L 1J18A 3MYJB 4HS3A 2L4OA 3NTCH 1Q1JH 5EC1A 2VDLL 1HILA 1ACYH 4NT6B 2MNJB 2VDPB 2WB7A 3VCLB 3SDDB 3KL0A 4I7ZC 5EUKB 3QULB 4JDVB 1Y1UA 4PRHB 4Y4HC 1T7WA 4EXKA 2AK1H 1KBGL 4ETQA 3BVVA 2BY2A 5IB1A 2C7UB 5CHNA 3SY6A 1SYVA 2HRHA 3MJ7A 4JFDB 1OD9A 5TE6H 1QA9B 1UA6L 2YQGA 5J89A 1JPST 3MX0B 4LSRH 4WQOA 4EI5B 1MJ8L 2WTRA 5E5MB 3UJIH 1ZDSA 1A6AB 5DK0A 1NCUA 2L7QA 3G6AA 4L3ED 4NRZA 1DQLL 5C07D 1V05A 1Q90A 2JJTC 2BLFA 3NGBB 4H20L 1MFBH 4W1TA 3RWEA 3W11D 5ACMA 3BGMB 4O58L 2QSCH 1BD2A 2Z35B 3IMRA 2NUPA 4JR9H 5AOKA 4LLMB 5KVDL 1WRFA 1BFOB 1L0XA 4J3TA 5D1XD 5HGHB 2ZYHA 1BLNA 2HB0A 2UXVA 1YEGH 3EGDA 4ERSH 1SXSA 3U36A 4HVBA 1WFIA 4D7BA 5JO5B 4G9DA 4HJTA 1PYWA 1FRGL 3CSTA 1V27A 4L1DA 3LKNB 3T65A 1IIKA 2ZYIA 4KZ0A 4Y2NA 4IOSA 4HH9B 3RVXD 3MCLH 1YEJH 3T5WA 3VFGH 2A6JB 2A99A 4ONOA 3DGGA 5G55A 5ICUA 3SE3A 1KC5H 2AVFA 4IW4C 1KJ2B 2XCMC 2VDMH 2XIBA 3QC6X 2D2OA 3NCJL 3DTXB 4E0RA 5C09B 3J7HA 2PYED 1WVZA 3DSFH 3J2PA 3RBSA 3HAEB 5C70A 1R6VA 1U8IB 3DX6A 1A65A 2WVSA 5DD3L 4P5TD 1NBVH 1T3FB 2HFEB 1J5DA 1N9PA 2JELH 3GI8H 3HHRB 4FQ1L 2K0RA 5SX5K 1XB8A 4MQXC 3LX9A 3CZUB 4XNYH 4ABWA 3L17A 4JQVA 1UUSA 3W9EA 4NN7B 4JRFA 2OBGA 2FGWH 5BUGA 1A9BB 4HXAH 4XPAH 4AM0Q 1BGXL 3STZA 4NQEE 4K8RD 3GGWB 5KBPA 1AGEB 2WXMA 3INOA 4EZJA 5E1AA 5MI0B 2CDGA 2YC1A 3O9WD 5ICYB 3ULVF 4PJHB 1F6LL 4WI8A 1H3VA 3FFCE 4YQXH 2CH8A 4JM0A 4P2RE 5IQOA 5DRWB 4OLUL 1UB6A 4B97A 1NL0L 4LSPH 2OXGA 2XDHA 3FXIC 3SGEI 2G2RA 2Y3AA 1NJ9A 3F7LA 3CLEH 2FJGB 4WI7A 3WY2A 3U6RA 1BBJB 1UTDA 1S9WB 4OLXH 1MSPA 4TV3A 4P2CG 1T66D 1G1OA 4LLVB 3SPHA 3ZE1B 4JLRB 1CG9A 1WA0X 4D9RD 5CD3A 2AW2A 3QAZB 5C7XH 4B9ZA 5GGSA 3D4CA 2VLJB 4UQCA 4WCYL 4OFVA 3K6IA 4QXUH 1CE1L 2ATKB 4KK6C 1OAZH 4FQ2H 1G7PB 3E3QE 1YEEH 1ZS8B 3S3BB 2CJ3A 5FFOA 2H2PD 3NCYS 3QIWD 4MLIA 4PRPA 2HKHH 1UZ8B 5L0QC 4HCFA 4WW2C 2VABA 4YO0B 1FCCA 2GT9B 2IF7A 2X4OA 1TOXA 4YFDB 1EO5A 3QDMA 1JMZA 1DJYA 3AC0A 3APCA 5EC1B 4LEEA 1HILB 1FAIL 4FNLL 4GRWE 1KDIA 4KC3B 5ILTL 2MTPA 4X6FB 4ZTOL 4ETQB 4PV9B 4N8PA 5AG8A 4R3SB 5H4ZA 1GC1L 4UOZA 3BCDA 4HT1L 2BM3A 4LESA 2C34A 3AMKA 1TO4A 4HWUA 2OULB 4F8NA 3AS3A 3DX7A 3CG8A 3FQ1A 1I3GL 2JK5B 5DK0B 3QQ3A 3PFQA 3HZKA 4MXQC 4A6YH 3QJXA 5EZJA 1KEGL 2R7EB 3NJIA 3RWEB 4OLWL 2WV3A 3FRPB 3SPIA 1INDL 3NQIA 5AZEL 1BD2B 5J6HA 2NUPB 5EOTB 3QUKA 1C5BH 1U3HC 3DJSA 1RL1A 1Z3RA 2CGZA 2NY6B 4X0KA 5E0FA 1I53A 2BNQA 3BW9B 3P54A 3F7YB 4AL8L 4TSCL 4DNLA 1N3NA 4EOWL 2AEPH 2ESVD 3DO4A 1PYWB 4UCFA 1Z5LB 2A74C 2XT1B 4YWGH 1TDQA 1PSKL 2NT0A 2YD8A 2ZKXA 4BSJA 2Z93A 2NZIA 3SJVA 1NFDB 2ADFL 1E6OH 2WLJA 2IQAA 1RV6X 1JPGB 4R4BB 3BWUF 3NIFE 3JVFC 5CZKA 2E9JA 1OCRB 5IVXA 3CZGA 1OWWA 5IBTH 5F7YC 2R69H 3T6ZA 3ZYJA 2IPUG 2FEJA 2X53A 3L7EA 3ARRA 4S10A 3D0LB 2PWDA 3QHZH 1PLAA 1BDYA 4PS7A 2GBTA 2XNAB 2XZZA 4WFFE 4D0DA 4H0IA 5GISH 4BK4A 1IL1A 1ZLWK 4HPOL 2NY4B 2VGLM 3P3SA 4E42A 3I6SA 3IKCB 3AB0C 2E8YA 2YD7A 1HL8A 2FATL 3ARGD 2WBXA 3SQBB 3V4VH 4CDGC 5IB4B 3VXMA 1P6FA 1DR9A 2E0PA 3STZB 4CN6A 2Y69B 4K3GA 4W4OA 4IJ3B 4LBAA 1HHGA 3IDMA 4QHLA 2WHVA 4K4KA 1JZIA 2ZJSH 5E1AB 2YC1B 3QRGL 5C0DA 3VGHA 3VWJD 2JIXB 3BAWA 1EHLH 2CPCA 5FO9A 5AWNL 4JREB 3QIUC 3UPRA 4LZKA 4GKNB 2N3JA 4PJIB 2OXGB 1MCSA 2I9LB 4UAOC 2G2RB 2QDVA 5D72H 1DO5A 3IWVA 1NJ9B 1MI5D 5I1EL 3N55A 5B3JF 3HS0A 1RZFH 2VQ4A 1WWCA 1QBMH 1LDSA 2ZSVA 4FP8H 4WUUD 4AQ1A 4FQCL 1YNKH 5CD3B 5D2NE 1KY6A 3HZYA 3KW7A 1ZEAH 1MCKA 5E99L 2ROXA 5H2BA 1IAOB 2X2YA 2X28A 1A4JA 3RJDA 5JA9A 2X70A 3VFOA 2GBVA 2YGNA 5EBWB 3WHE1 2EACA 7FABH 5TQ0L 4PRIB 4UV7L 4PRPB 3MN8A 1N8ZA 2MEJB 3NIGF 1RJCA 3PHQA 2ZUQB 5CM1A 3RGVA 3CH1B 2X4OB 3BVTA 3BPLB 2AJXL 5F7EL 4L18A 3EHBD 3FTWA 3JZYA 1CZ8L 4PS3A 3EJYD 4L29A 2FZ3A 1MHHA 3DX2A 3PQYA 5DGQA 2HAZA 1GS8A 3OSKA 4P9HL 4XXDA 2Q87A 2UY6A 3BH8A 3LS4H 5FAAA 5ANME 3L45A 4EJ1C 5HHQB 1TZGL 4ODUA 2HA1A 4LP4A 4G9FD 2GJZA 4QHMB 5DC4B 5I9QB 3UO1L 3HJEA 3QJOA 4H0HB 4LEBA 3NCCB 4BQ6A 2EKJA 4M5YH 4CMMB 5FOBA 3QQ3B 1IM9A 1ADQA 1I7ZA 1T7XA 4UF7C 5EZJB 1Q4NX 1G9MH 1HVXA 2B4CC 3FQUA 5A2KH 3T4YB 2EDYA 4OUOA 2NY3C 4KHTH 3LZFH 3A6BL 3Q0HA 3SDYL 1TF4A 3QUKB 1G9NC 3RWDA 1CL7I 3TFKC 3FSOA 1LD9A 4X0KB 4APQC 2JJUA 1AQ8A 5T3ZL 1ZT4B 1R17A 5FYJU 3ZDZE 1I1YA 2EC9U 4NJAH 4Z7NF 1CI5A 4RETB 3SE8L 2F2HA 1UFGA 5K39B 3GSNH 3I6KA 2ZCKL 4JQXC 4UIMA 4X7CC 4IU3B 5A7BA 3V6OA 5E2JA 3NZHH 1Q1PA 5J7CC 2RTTA 2PCFA 2ARJA 5MEOA 2MOQA 2TAAA 3AUWB 2BY0A 4H8QA 5MI0C 2P9RA 3S88H 4JQIA 5C2BH 1QRND 2OFQA 5IVXB 4YFLF 2HX7A 4P57B 4F7KA 2BVYA 2XVBA 3OR6A 3L7EB 1JHLH 2FGZA 4MGXA 4DCQA 1QFPA 1KBWA 1KJVA 4ZFZA 4F7MA 1Z3GH 3CVCA 1RUAH 2AVGA 3CFDA 1PLBA 2OSYA 2WWMD 1NCHA 4ZD3L 1I7UB 1JSYA 1DJGA 4HZLA 1HNYA 1QLEL 1S3KL 4K3EL 1LO0H 5D1QC 3RX7A 1E4XH 1M7UA 4E42B 3DK0A 3F7VA 3T2NH 4KITB 2CGRL 3GLZA 3VXMB 1RZJH 3QAZC 4MZRA 5MENB 1CE6A 3OJDB 4KKBD 2MQ0A 43CAA 3VUAA 1HHGB 2C9UA 4QHLB 3WFZA 5DT1H 1T5KA 2JWYA 2ZWZA 2EXSA 4G7YH 2ZF9A 5C0DB 1QX1A 3APMA 3BWAA 3B9KC 3C5ZD 3O6FB 2WXQA 2H2SC 2YOCA 4QOKD 3U82B 3UABA 3DJTA 3L5HA 5HDBB 3Q1SL 3CDYA 4KKAC 4YPJA 4LIQH 3KDMA 5IMMB 4I89A 3KH4A 2KC0A 4Z7QE 4LCWB 1P7BA 4GKSB 5GGVH 4A2LA 5I15L 1HH9A 2ZSVB 4DH2A 3EO1A 5BV7B 4MD4B 4YNYA 4ADGA 1VJSA 5CBEA 3BPNB 3HZYB 1TJHH 5IIEA 2HWZH 2IH3A 2MH4A 4K5MA 1SMDA 2MCPL 2EYSA 2PPDA 3B6SB 5C0IA 4EDWH 4Y19D 4DQOL 1HCFX 3WUWG 2X70B 4GP8B 1S78D 2X42A 2Z6FA 4IOFD 2A6IB 4O4YH 3VFPB 3FT4B 3WKQA 3CBKB 1NCBH 5DMKB 3H42H 4PGDA 1GGUA 3CUPB 4N90E 3QZNA 1RIVL 4C56E 1RVFL 2X3CA 4WNJA 2VDPH 4NBYB 3SE4A 1VACA 4L29B 1XIWD 3PQYB 4L3CA 2WVTA 4HXBL 5A2FA 3CPUA 4L3AA 3C60D 2XKUA 3PAZA 1FYTE 3C09C 3B9AA 4KJWD 4X5RA 1TTGA 4K7PX 1PY9A 2J57A 3LIUA 1L4IA 5IW1A 4JNXA 3RU8H 3US1A 2IG2L 3QWOB 3RJQB 4CU6A 2UXTA 2OR9H 3U4AA 3CN4A 1EZSA 5AOMA 2GJZB 3SE3C 4G83A 4LCVA 5FV2A 5MERA 1VEMA 5EU6B 2IBGA 4JY6A 5AG9A 4H88H 5LKNA 3EH3B 3VSVA 3LMJL 5AZUA 3TCLB 3MQIA 2QTEA 3FQUB 3BP5B 4QWWD 3QPQC 2VTFA 1QPXA 4HC1L 3PPSA 1DEEA 3PUCA 4K9EH 1XH1A 3RWDB 2XZAL 3MXWL 4S2SB 2EABA 5EO1A 3IAPA 4JQVC 3STLB 2H3NA 5EEVA 3PY9A 2LAGB 1I1YB 4KKZA 4ZQTA 3PP3H 1F90L 1GS7A 1XR9B 3I6KB 3X3FH 1KB9K 3QVAA 2XQYG 4UNVA 4UIMB 2ZONA 3DVFA 4B9PA 3DX9A 3OV6A 1SXNA 4JZNB 4IU2A 4NZTH 5DWUH 1CLZL 2EILB 1KJ2H 1PF3A 1Q0XH 1YY9C 1ZSHA 2ARJB 2PCFB 5C08E 5T1KD 2NXYC 4DEPC 5KVDE 5MEOB 2F53E 2KYIA 4V11A 1ZHBA 3ESNA 3EUDA 1AG0A 3QXDB 3BAKA 3QQ4B 3LQAC 5HD8D 3P3RA 1JZ8A 3CVIH 2X0VA 4RGNB 5KVFH 5AW8B 4AKOA 5AB9A 4MXVE 4YSAA 3RWJA 4CVZA 1XD0A 3CFDB 5JIMA 1ED3B 3WLWC 1QSEE 3GJEA 4O02B 3ZY7A 2V5MA 4J8RA 2LVEA 4GUPA 1PZBA 4QF1B 3ROLA 2QPDB 3FQXA 4NKMA 4F93B 2MKWA 4F91B 5IT2H 2UV3A 3EYVA 5ADPH 4HALA 1RLWA 2BVQB 3D50A 4G7QB 4HWZA 2EVIA 2OMTA 4OFIA 1CE6B 3B5GA 5K9QG 3KD4A 5I8KL 1OGAB 5ANHA 3VFWA 2PWGA 4YXLH 3LXUX 3BEWA 3W82A 5D1ZD 2J1WA 3NVQA 2XZQH 4CSSA 1E4KA 3BWAB 2EAEA 3QCUH 4XP1L 5D70L 1KXVA 1F6AA 3G5YA 1ZLEA 1MCRA 2R0ZH 2XG4B 3VX0A 4N8VG 2BC4A 3DRTA 2LAAA 5DEFB 3KDMB 3FT1A 2F7RA 4Y16C 5HDOA 2CCWA 1F41A 4XCNA 8CGTA 1KCVL 3BMVA 1QVOA 2Q8AH 3SKJH 4AEEA 1DUZB 4PV8A 1YEIH 1RU9L 3IEAA 4RX4D 4OZIE 4A7TA 2XYCA 1SJVA 2YGVA 3NEXA 4YNYB 4FADA 1RHHA 5IBUB 3E8VA 3WELA 3UROR 5C0FA 5IIEB 2IH3B 4M1GL 5I9QC 3K6SA 4BXVA 1H3GA 1CDIA 5FK9A 2WIIB 2AERT 4XBGB 4UU9A 5TE4L 2APBA 2NSXA 2Q8BL 1J9TA 1ZXQA 4DIXA 5KS9F 2O5NA 2EVJA 2XFGB 5E70A 1KCLA 3AY4A 2ZCLL 4HS6A 2F5AL 4LLUA 2XSKA 1DJIA 4L3CB 5TF1L 3MJGX 2OJZL 5I75B 3UGXA 5HYJA 5TE7H 1KCRL 1X9QA 1LXMA 4GYBA 1FNAA 4UV4L 1D5XA 4GRWF 3AMLA 4UI2A 2MOGA 4G7SB 3U4BH 2FJHB 3Q2NA 4XNZB 4KZCA 3ZTEA 4EUPG 4ETYA 1UM5H 1KB5L 3UG4A 1CQYA 3PAUA 1CURA 1KLFA 5MERB 5I28A 2NY0B 4N8UA 2H6PA 3BPOB 1J8RA 2AZAA 3FN9A 3L95B 1THAA 5AW6B 3NABH 2FECI 2XWZA 3ARXA 2GEQA 3VVVA 1QRKA 2C9XA 4ZZFA 2A83A 4ZO9A 3GJFA 5B1BB 4UOW0 2BSTA 4V2BA 5EOCJ 4IBWA 5B4MC 5EO1B 4FABH 4PLNC 1S7TA 1A4CA 2H3NB 2YXVA 3SDXF 1BBDH 3H6JA 5C97A 1JIBA 1AY1L 1QAWA 5DJZA 3QA3A 1AHWA 3ETBF 2PLTA 4J6RH 4OZGB 4QTIL 5FO7A 1OVZA 3Q6GL 5JLZB 4UT9H 4C57C 3NSCA 4W4OC 4YSEA 2D73A 2F1EA 5I6MA 1ZHBB 1O5PA 2ZXWB 4JM4L 4EN3B 1OZUA 2J88H 1AGCA 4XCYA 1BREA 2X6VA 4R8WL 1IC4H 4NUJA 3NIFF 4XP9L 5JHDB 4YAQB 3QGVA 3SDDD 4N0UA 3RWJB 2YAHA 4PRHD 4I9WD 2Z8RA 3MRBB 3JWDC 3GJEB 2XXCB 1FLRL 3HS0C 3H9HB 1D5ZB 2G5BA 1EK3A 4NKMB 5ICZA 2M8XA 1IZJA 1MFDL 1OSZA 5AW4B 3WG7B 4AQ1C 5I5RA 3O4LE 4EI5D 3EDDA 3MLVL 3R7QA 5EPMA 4HWZB 3IGUA 1FI8C 3MV9A 4U3CA 1CUOA 1IBYA 3P69A 3EH4B 2OW6A 1S9YA 3OJMB 3VFMB 4NQCD 2VCOA 5C0RH 1IBZA 3RDJA 4AKPA 2JJWA 2WUCL 1F6AB 1SXBA 1AXTL 2WQUA 4YHLH 1TVBA 1G6RA 1CBJA 3D4GA 3DYPA 3C8HA 4ZSOB 3DRTB 4PJAA 4ODSH 3HNSH 3RGVC 3LRSA 4UUJA 3QBTB 2HX9A 3SO5A 2ZKMX 1QVOB 4CADA 5I2IA 3DBSA 4PV8B 4BM7A 2QKSA 4LPYA 4TNGA 3NT0A 1L6XA 5I18H 3VRJA 3QPXL 1RHHB 4AGNA 3CC5A 3EJZC 4RSYA 4WY7L 1WE5A 5C09D 4W70A 1HI6A 1NCJA 2XXFA 4PCSA 1WZMA 5DZPA 1U0QA 4OJFL 1KOAA 1DFBL 3AG4B 1ZV5A 2A6DA 4XR8C 1EGJA 4UU9B 5SWZA 1XB6A 1BQLH 2WYTA 3P77B 3I74A 5IP4A 3BD3A 4PJ8C 1B4JH 3KEDA 1ZRUA 3VTAA 5IMKA 4QRAA 3MREA 1KJMB 4PGCA 4C83A 5FHAL 5I66A 5D7HA 4NQTA 1NCAL 3WIHH 5F9OL 1MAKA 3BAEH 4R97B 4QIRA 2Y5EA 1E4WL 1L3WA 2F58H 1NC2D 3O0RL 4AIXA 2WCSA 1M2OA 1F1DA 1T03L 4JFFE 5HYJB 1C5CH 4GEIA 3CXDL 2KS0A 1JF6A 1KY7A 3V6OC 4DP8X 1M05B 4PQXA 5ID1A 3Q7JA 1LEGA 4OCYH 2CRMA 4KQ4H 1CC3A 3QDGA 3KYOB 4RMUA 3OLGA 3Q5OA 2ZWNA 3IXTA 1KLFB 4KH9A 3B3IA 4RGNC 2X4PB 4IRJA 2R15A 3TN0B 3LNFA 4IDLA 5I19H 3ZL2A 4RMVA 2WJ5A 1ET7A 3EO9L 5EORL 4OVVA 3EJQA 3VXSA 4KJYB 2EECA 1ZANH 2VLJD 1VPOH 2AMGA 4FFYL 1F97A 4FFZA 1S7TB 4JKLA 1WH0A 4NQDE 4S1SL 4HD5A 3ZUNC 1BVKA 1JDAA 5DJZB 4J4PD 3ZKXB 3ZTJG 3V0WH 4ZMOA 1I1RA 5FO7B 3WMPA 1RZPA 4X7TA 2GI0A 4HG4J 5EEWA 4FHJA 1N5YH 6PCYA 1HL4A 4L9LB 1WEJL 2F7IA 1MRCH 4E68A 3RVVD 2ZX5A 3ISRA 3GXPA 1TR7A 2YAPA 2C1PA 2L0DA 2ZG1A 2EXWD 2NMSA 3QFDA 3B7RL 3N44F 1KCBA 4BE6A 1AC6A 1AGCB 4XCYB 3UEZA 3U7WL 1E3ZA 1YEKH 4NUJB 3W39B 2X4QA 3B8YA 3GHEH 4RISL 4N0UB 4J12A 4L4TA 4XWGH 4GUOA 3DUUA 1PCXA 1WHPA 2FO8A 2P42B 2Z1PA 3AITA 4DGVH 5E2UL 2G5BB 4JHWL 5ICZB 3CFNA 3MRHB 3K74B 2R2BA 1OSZB 4HLZH 2VW4A 3QNFA 4NO2B 5EPMB 3H2QA 4YSDA 3FO9A 3MV9B 5GGVY 3EW3B 5EC2B 3DJ9A 2C3WA 2LU5A 5GRUL 4WWPA 1JZDC 3C5SA 1CTNA 5BS0E 3HNTH 3U1SL 2XIIA 4M7LL 1NMAL 3RWCA 3S5ZA 4IMLA 4ZAKA 3U0WH 4DKEL 4YX2L 3MRQB 1Z6JT 4NENB 4BZ1L 2NY6D 5K9JH 4F7PA 4FTVE 3IM1A 1USZA 3LSOB 4RA0C 2EDFA 2WZAA 1J1XL 1DBJL 1YPZA 3LRSB 3PDGA 3VFNA 2Y1YA 5EF0A 5J11B 4ZW5A 1R47A 2PYFB 5BV7H 1FFRA 2GUYA 3HN8A 5CCHE 1VFOA 2DMBA 1AHMA 1I9RH 3O41B 2XI9A 5EU7E 2ZOOA 3FUJA 4ODWB 1MCBA 3CC5B 4Z7QF 2E76C 4NJ9H 5KSAD 1DFXA 4QKXB 1HI6B 3QORB 5A7EA 2X2IA 3VI3E 5IVOA 2YA1A 3BPOC 4X5WA 1INEH 2DRUA 1RK1A 1T1WB 2CG9X 2NY4D 2XA3A 5CGTA 3VAEA 2VL5A 4XBEH 3MFFA 3GXDA 1EFXA 2VXTH 4R90L 5HVFB 5HJ3A 3QB7C 3CLWA 4GAGH 3UTZA 3MRRA 4C83B 4HHWA 4M43L 3VD4A 5EEZA 2EEBA 1KTLB 1AGDA 2QZQA 3QSKB 4BHUA 2DQCL 4IRZA 1QWUA 3I02A 3NSYA 2VC2B 1ORSB 1T2XA 4UMGA 1GKOA 2WXLA 1MELA 2Q76B 3CDCA 4TVSa 2J72A 2JIXD 1ZTXE 3LB6D 2HH0L 2VDNB 4OZHB 5IFJA 4XPFL 1LEGB 1JJUA 1J0ZA 5HGAB 3PL6A 4ZX4A 3VFRA 1KCSH 1VADA 2QADB 4WW1B 1MCPH 4GS7C 3SGJA 1KTDA 2D0FA 2FQFA 2ZSWA 2P80D 1A5FL 4YXHL 4U3SA 5A6LA 1XMWA 3O2WL 3HHMA 1TTBA 3L4VA 4J5VA 3FH5A 4B6ZA 3TO4A 4Y4FD 3REVA 4I1PA 3VXSB 2NX5A 4NGHL 3VI4F 2QPUA 5F7DB 3L3DA 3RX5A 4BQ9A 3T04D 5I6NA 1JGEA 3O6KH 5D5ME 3WGUB 1BVKB 4U1MB 2Y9RT 3TU6A 4PJ9A 1H19A 1JGLL 5AW0B 5JA8B 4G5ZH 2HPTA 2CBPA 4PRID 1T5WA 2P24A 2CHNA 3CDZA 5CWSB 5DZVA 5TK2A 3RA7H 4IK6A 2IEPA 4PI2A 5DUMH 2ADJB 2CO6A 1E4KC 2YBGA 1T2QL 2C1PB 1KXVC 5MEQA 1HAUA 2H5UA 1CICB 4ADIA 1WS7A 2OZ4H 2Y36L 3NK3A 4WV1A 5K9QI 4IKLA 4O02H 1KNOA 1MFEL 5E00B 4I9XA 5I1DA 1KFAL 1OM9A 1H5BA 4DESA 1OP9A 4AQOA 4DN4L 3L3OA 5ABDE 4OSUL 3TZVB 1MHPH 4ODVH 2Y6TE 2ED9A 1UFUA 2R2BB 3D30A 4QLRA 5EUOB 3ZRFC 1MHCA 1U4EA 3TH2T 4V1DA 1JGVH 3PCYA 4P06A 4YHNB 4PG9B 1CTMA 4XO5A 4ZFQA 3VFVB 4PJ5B 4DHLA 5TK4A 3R8QA 5F8RC 3MGTA 4IMLB 5F88A 5AW9B 3G6JB 3S3DB 4U1GB 1QWNA 2H2PC 2CUMA 4F7PB 2QPFA 3QIWC 4WSGA 4N25A 3MRNB 3COOA 1CTOA 3E8UH 2GBUA 1P69B 4IIQA 5IVNA 1YPZB 1YRKA 2QMKA 1SN0A 5JTWA 4LASH 2UXFA 2Y25A 4J1UA 1NEZG 1ONQB 4R97C 5GS0L 4ZDHA 3MAWA 3LH2H 4GMTL 5DS1A 2AJVH 2X05A 4U7MA 1WPCA 1WFOA 2BO0A 3B7TA 3VYPA 4I48A 3ZTCC 2XQ0A 1JNLH 4AE1A 3A24A 1IMHC 3BZ4A 3PWPE 5IHUL 3AY2A 3W0WE 2NR6A 4XMPH 2KQNA 1J1OL 4ZS7H 1SEQH 5I1GH 3FSAA 1A6UL 1DQVA 1RK1B 2ZPKH 3BH9A 2W9EL 4ENZA 2ATPB 1EFXB 4Y5XA 3DGDA 4GBXA 1KJ3L 1DE4A 4N26A 5MEND 3MRRB 2H8PB 1UA7A 4OJYA 3IMWA 1X3DA 1U8OA 1LK2B 4QRFA 3NIDE 4TSAL 5DK3A 5JHLA 4NN6B 1CT8B 3I02B 5ALBL 4RDQF 4ORZC 3P9LB 4BGDA 1AHWC 1UACH 4RRPG 4AQ8A 3O6FD 4AEHL 1UD6A 4PM1A 3RZCA 4LQFH 4L48A 2YRZA 4CILA 2DQJH 5FX3A 2GCYB 3ZTNH 2VN5A 3WEMA 1IAIL 1SLXA 5BW7A 4QT5A 3QUYB 3VW3L 2XY2A 3PL6B 1RZ7H 2Z9TA 2D3LA 3VXRD 2C4XA 1WZAA 3KAAA 3CFKA 4LCWD 4XPHL 2ZSWB 1IJ9A 2ENSA 3N41F 4NDMA 1RZ8A 3TIDA 3PAVA 3L1FA 5BJTB 4X83A 2Z8WC 2VE6A 2NTFA 3REVB 3V9FA 4AQAA 4MQ7B 3VGDA 4K3DL 4KKLD 3L3DB 1AGBA 3DMMA 2WLKA 4R83A 1VAHA 4LKCA 3L4TA 1JGEB 3UZEA 3LZLA 1VENA 4UM8A 1IC7H 1T7VA 4X9BA 4OTXH 2R27A 4D3CH 5F9AC 5CJOH 1MREH 1Y1DA 4MJHA 5JUEH 3MLXH 4X98A 1KTCA 5HVGB 3KJ6H 1P4BL 4M3KB 4YJZL 1QSFA 4QXWA 1VKXB 4G6JH 1JAEA 2APFA 4YXKL 3IFLL 4PJ7B 2X3AA 5JIPA 1R3LB 1WD8A 3BYTA 4DP0X 4WV1B 4I5BA 2OM5A 4I3GA 3T0EE 3VSUA 2BVEA 1KNOB 5FYLE 2Z8VC 2DTSA 1H5BB 1SRDA 1WYJA 4OGAD 3RWHB 2IH8A 4ADJA 4AENA 3FOMA 3QQ9C 2C3HA 5IQ7L 3DRQB 2B4CL 4X7SH 4B9JA 5ABZA 3L3IA 1ZLSH 1P7QB 5EU6D 4V1DB 4YEFA 1YYLL 1IVLA 2WD0A 1OTUD 2Q6WB 3QS3A 4EF3A 5JIDA 4HK0A 2LW3A 1TMQA 1RXLA 1KYDA 3D2UB 3MGTB 4ZTPL 4KTGA 4WU7A 5EEYA 4HU8A 3FTVA 4KX9A 5GGRB 3DC0A 5HGBA 4FX5A 2N56A 3Q43A 3SPGA 2NXZB 3A4AA 4ZFFB 5DA0B 5FM5O 4BA8A 1K3IA 3EJYC 1DL7L 3NPSB 4UILH 5FUOH 2FWLB 4J1UB 3GZOA 3WFHB 3O6ML 3O3DA 4NCC1 2XQYA 4W9IC 4ZDHB 2R29L 3OVUB 2YAMA 1CL7H 3TV8A 2Z31A 4QLWA 1IGFH 2WINB 1BMWA 3RTQB 2V2WA 4FNQA 4FQJH 3QIBB 2KH2B 3U0PB 3S2CA 1DLHA 2XV0A 1N5AB 1HZHH 4U1HA 1GYWA 5TPWL 3QNXB 1IEAB 1MFMA 2GG1A 3T9WA 4YFLI 2XTSA 3MRPA 4A2DA 4KMQA 2ALWA 4IRJC 1B6DA 4OFDA 4XP6L 2BSED 3LDBB 5E4EB 1A6WH 4O2FA 3LKPB 4WI2A 3KWUA 2TRHA 1AIZA 4HWBL 4QY8B 1E65A 4M61A 1DE4B 3QZWA 4G8EA 3HKFA 4NFDA 4L5FE 5DXWA 1U8OB 4GW1A 3JWNE 3O3BA 1OGAD 2KZKA 3DLQR 4GG8A 4OD1H 3A6CL 1NM9A 4ZQKB 4AVJA 2WMPA 1MW0A 5JYLA 4PLKD 1E5YA 5B39A 3CU1A 3DVNA 4LKXB 3LPGA 1I1AB 3P3UA 3ZQXA 1WAAF 1EPFA 3MCYA 2VMFA 1CD0A 2Y72A 4PJXB 3B4NA 3U6XA 3L6FA 4U6TA 5LBGA 4QT5B 5CEYA 4LPWA 4UTBH 1PZ3A 3MUUA 1U92B 1AR1D 1MJJA 2HLAA 4LCIH 5AD0A 4M3JA 2C9AA 3F58L 2QGBA 5D71L 1WC7A 2YPLA 3TIDB 2P48B 1MCQA 2P8PA 2GK0A 1CLOH 4MJIA 4RBPH 3ARSA 5AAMA 2LV4A 1OQXA 2CDEA 3DMMB 5MP6H 4L8DB 4LKCB 2MTAA 4PWJA 4ELDA 2RAMA 5IESL 2HJKA 3QAQA 2WCPA 4UM8B 5A6MA 1EXGA 1WAPA 4ALAH 1AR2A 5LGHL 4IBUA 1YQVL 3JWOC 4ODBD 3CPLA 5ENWA 3O2VL 2HKAA 3FUNA 3WUWB 1BEYH 1OD7A 1BQ5A 3HMXL 3NFSH 3EOBB 3TWCH 4G3YH 4AUYA 2EYRA 1SJEA 4X7DC 4ZX5A 4ZAKC 3KZ8A 2VRKA 4HIIA 3HZMB 2GJ6B 1OGTB 3VXNB 1BVLA 4E41E 4PW9A 2VLKA 4I5BB 1VCAA 1RJZB 5DVOA 2CD0A 4U1NB 4CSZA 2A38A 5DO2D 1KLGA 3BKCH 3P11L 3GEWB 1HDMA 3FOMB 5H35A 2J6EH 3HUJE 1L9SA 1OGSA 2DTMH 2CMRL 3F65A 4PHXA 4ACPA 4F5CA 3KPRE 4PRNA 4R7NA 2NY0D 3DIVA 3EDEA 1RY7B 2JFCA 4EUPA 2IPKB 2DEYX 5EF2A 1YJDC 2H32H 2FLBT 3KYKL 4LLYA 6PAZA 3TA4D 4HK0B 1OM3H 1LNUB 4MA7H 1TQBC 5CILL 1IGCH 1E5BA 2VR4A 5A3IC 1W6LA 4WU7B 2DWDB 4JFWA 3HI6L 1M42A 3CZJA 3A21A 3SE9H 4LDEB 2I26N 2QQNH 5HGBB 2EEFA 4IBLT 5CR1A 4RCAA 3DOHA 1TEGA 3OKNB 3H55A 3RPIA 1QFHA 4KI5C 1UXLA 4K5OA 2W38A 5IFHL 4MQTB 4PG2A 3MJ8B 3HOGA 3WLBB 5SWQA 1O7DE 4QD2E 4XNXH 4OLVL 4OCNC 1JP5A 4KJWC 4A67A 3DOIA 4XN8A 4MWFB 3WIIH 1NKGA 1DLHB 3L7FA 4EN3D 1VEOA 5EOCL 3HMWH 4J3SA 1HXMB 3OXRB 3TO2A 5LNDA 2G3ZA 1DVFD 1JV2B 5JHDD 1PG7X 1BP3B 3PL6C 1P9MA 3BUDA 4IJTA 4JFEA 4PJGF 4AH2A 4ELMF 3HC4L 4QRUA 1U93B 5SWSA 3SGJC 2NW3B 3VI3F 5FB8B 4HKXB 1FAKT 1KXTA 5HHVH 3VRIA 1AH1A 4HCRA 2X4RB 3LNIA 4BZYA 2FE0A 2FHBA 3QI9A 5DFAA 2W65A 3TO4C 3V9CA 1WZ1L 1MF2L 3GMNB 2W60B 3KVDD 2W80C 2H4EA 1U2CA 2MHAB 1IE5A 4FFVD 2A0LD 1DVTA 2VDNH 1GZQB 3L8QA 4PJ9C 2OSWA 1CQKA 3CQQA 1RKRA 4I13B 1XD1A 1CMOA 4BGLA 2FIKA 2EZ0C 5JXAL 2WZ5A 5I1IH 2VAAB 3VXUA 1GH7A 3RVUC 2VLRB 5HYIA 5CEYB 3ZKMD 3PDOB 3VM7A 1YNLH