2HXKA

Crystal structure of s-nitroso thioredoxin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
105
structure length
103
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDQDVASEEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Buried s-nitrosocysteine revealed in crystal structures of human thioredoxin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 36
structure length 103
sequence length 105
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hxkA00
1XW5A 1C72A 3IOSA 1YQ1A 4GQFA 1O85A 4TR1B 1K3YA 4ULXA 1VGLA 1KTEA 4PQ1A 3WT2A 5ECNB 2DMLA 3F0IA 1YF1A 1BEDA 3TKQA 5IMDA 2V6OA 3LWAA 3RPPA 2NVLA 1M9BA 2C3TA 1K0DA 1N8JA 2VL2C 1PGTA 1A8LA 4PQHA 2HRNA 1K0AA 4TXOA 2OE1A 2IMEA 1FB6A 1YKCA 4OFTA 3KCMA 3BD2A 4LL4B 4GLTA 2H0IA 1XOAA 1QUWA 2MMZA 3CSJA 3L78A 1BG5A 4LMWA 3KP8A 1ML6A 4CW9A 5FWGA 4ZBBA 1R5PA 1OC9B 2H01A 17GSA 1JLVA 3H1NA 1M99A 1XPVA 4ECIA 1JHBA 2H71A 1ZZYA 3UBLA 2NDOA 2FD3A 3TOUA 2VLVA 4PURA 4ZB6A 5IMAA 10GSA 4GWRA 4TRXA 2TRXA 4QQ7A 2LRCA 2F8FA 2C3NA 2KP1A 4X43A 4YH2A 3ZIVA 5LCZA 5GSTA 6GSTA 2P31A 1GTIA 3Q19A 4D73B 1URMA 5ECIB 2GSQA 3HZ8A 1TK5B 2LJAA 2BTOT 2ZCTA 2REMA 3FZ5A 3H4KA 4L5OA 2O8VB 4IJIA 2OACA 1DE1A 4LL1B 2DJ3A 1YDKA 2HSHA 5IPGA 2GGTA 3HJOA 2CVDA 3HXSA 16GSA 5CO3A 1PX7A 1LU4A 4K0NA 5DALA 3DKSA 2V41A 3KTBA 1T4YA 1GSDA 2GDRA 5JCGA 2VO4A 3IRAA 1VF3A 4XS1A 4X0XA 1PKZA 2FWGA 4K7OA 1GP1A 3KMOA 5COHA 1K0NA 5DCHA 4RQXA 2AV4A 3IC4A 20GSA 3PGTA 1O8WA 4ZB8A 1VF4A 1ERUA 1GTBA 3F4SA 4V2MA 3IDVA 3F9UA 4HJ2A 1MDKA 2CX3A 1A0RP 1O7UA 4XTSA 3QFBC 2DJ1A 3CBUA 3GRXA 1TTZA 1YJ6A 5JCWA 2MBTA 2YNXA 3PR8A 1TKDB 1O8XA 1AXDA 2JL4A 3TCOA 2E2GA 4JZQA 2GZPA 2QC7A 4RI7A 4EDZA 1Q98A 4Q5FA 4ZXGA 3F3QA 2PBJA 5DQSA 3N9JA 3GSTA 4ISDA 5D96A 3GH6A 1YY7A 1ZCPA 5DJLA 3QFAC 1AQVA 2F3MA 4TR1A 1SU9A 5B7CA 4CDOA 2IL3A 2VCTA 3I6AA 2VAFA 2X99A 4GF0A 1X5EA 4HZ4A 5EL8A 4HEA2 4OWYA 3M8NA 2PUKC 4ZBAA 2XHFA 2TIRA 5IIZA 1PKWA 2FCHA 3IBHA 2JACA 1M9AA 3RAZA 2CAQA 5KN1A 4FO5A 2K8SA 2GS3A 2VM1A 2HT9A 4KX4A 1OC9A 3RBTA 1V57A 3IE3A 3PINA 5ECMB 3FR3A 2J9HA 4E8EA 3GKKA 1SD9A 3GKNA 3M9JA 4O92A 5JWRB 4HQZA 5CYYA 4JE1A 1XWBA 3IA1A 2H8LA 4TR4A 3KD0A 2AYTA 4FH8A 3GFKA 3GMFA 1B9YC 1SK2A 2C0EA 4TXOB 3NOFA 4XIHA 5A4VA 2J23A 3WYWA 1YEXA 3IHQA 3O3TA 4MP4A 3GKXA 2EC4A 3GURA 2L5OA 3FR6A 4RUVA 3GIXA 4OD7A 2RM5A 1VF1A 4GXZA 2C0DA 4ECCA 1W89A 3O76A 2FNOA 1A0FA 4AF2A 1M2AA 4WF4A 3L0HA 2VCXA 3HA9A 4OO4A 2G0FA 3GTUB 1MD3A 1FVJA 4KNDA 4GRFA 3LQ7A 2N5BA 4K1FA 1QK8A 3IK9A 3F3RA 4MA9A 3TKSE 4RQRA 2L6CA 5A4UA 2RIIA 4QL9A 3G7IA 2L59A 2D2ZA 2FWEA 1NHOA 1DSBA 4TN8A 1IYHA 1GNWA 3UIWA 2IPAA 4WBJA 3UJ1A 2DIYA 1Z7RA 2YN1A 4KDUA 2FA8A 1TK0B 4YAPA 2GSRA 3TJBA 3FW2A 1MD4A 2HE3A 1Q4JA 4BVXA 2H6YA 1SL1B 4DSSA 1G7OA 1J08A 2GLRA 2CAIA 3D5JA 1EEMA 2MZCA 1BX9A 3UBKA 2GZYA 4MZBA 3G7JA 1SYXA 2B5YA 1J0FA 5ECLB 3ED3A 5CRHA 3J7Yk 4Q5NA 2GQKA 3UVTA 2K18A 1BYEA 3ME7A 1O81A 1GRXA 3WD6A 3VLNA 4ZIJA 3QD9A 1XWKA 2KP2A 2HYXA 3DYRA 3A2WA 3IAS2 4KAEA 5DALB 4L8EA 2DSAA 1G0TA 1WJKA 6GSVA 5HR3A 3W6GA 3L4NA 4O32A 4V1Ap 2KUCA 1SYRA 1GLPA 2DC5A 1PN9A 2PERA 1EWXA 4N30A 2H6XA 2QSIA 3VWUA 3VFIA 2B1KA 4XHMA 3IK7A 3R2QA 4F0BA 2B6MA 2C1YA 5AN1A 1U3IA 3L9SA 5KEJA 4OCFA 3LG6A 2L4QA 4HS1A 1V40A 2F9SA 3IAM2 3ZL5A 3TJJA 3DWVA 4EXJA 4N0VA 5DQYA 4Q5QA 4LMVA 3KGKA 3VPTA 2PVQA 3M0FA 2M80A 4TKYA 1SJZA 4IN0A 1QFNA 4XRAA 2L6DA 1A24A 3VI7A 2O87A 2WCIA 2NPBA 4NHWA 3TKRA 3Q6OA 2F51A 5F06A 14GSA 4IBPA 4OFMA 1YKAA 3ZREA 1V2AA 4PNFA 4G19A 2MYGA 3QPMA 4PGTA 1F9MA 1MDIA 3E0UA 1ERVA 1H4OA 2X8HA 4OO5A 3LGCA 1TXXA 3GL3A 2P0GA 5IMZA 3DRNA 1XOBA 5IM9A 2M72A 3D21A 1QQ2A 1V9WA 4EKZA 4MJAA 2FY6A 2VCVA 3J7Yb 1LJRA 6GSSA 3KH7A 3E9JB 3ZFLA 1HD2A 2C0FA 4WKWA 4KDYA 4POMA 2LEGA 1DBYA 4IS0A 4IVFA 3FHKA 2DLXA 1R5AA 2R2JA 1M2DA 4FYBA 1Z6MA 2I1UA 1CQGA 2JSYA 2LQQA 2LQOA 4EL1A 4GSTA 4K6XA 3GTUA 3OR5A 2PPTA 2AUVA 3QDNA 3FRCA 3EU4A 4KGIA 4OFNA 3EWLA 2VM2A 3CYNA 5IOWA 2OA7A 1XCCA 3HVXA 5D9XA 1K3OA 4MF5A 1PMTA 3ZFBA 3H93A 1EGOA 1J9BA 2ZUPA 1XVQA 1Y6EA 2M46A 2CVBA 3D0ZA 4G9HA 5D9TA 5HFIA 1GSEA 1QGVA 3M9KA 2VL2A 3IPZA 3MNGA 2VL9A 3A2XA 3M3MA 5B6NA 4NMUA 5ID2A 2JZRA 4F82A 1YEPA 2O89A 1USBA 1XBSA 2EIRA 4XCSA 4YQUA 2B7KA 5KN3A 2A2SA 4MJEA 4DVCA 3QAWA 11GSA 1OE7A 5IMVA 5IMFA 5AIVA 3TJGA 2C8UA 4E8HA 4JU5A 4TW5A 4JRRA 4EO3A 5ECHB 2XBIA 3LXZA 4IP1A 4ZL8A 3QMXA 1QXHA 2ALBA 3K8NA 4KDXA 2DIZA 2LS5A 3NZNA 4F03A 1EV9A 1B48A 1XWGA 2E7PA 2TRCP 2HZEB 3MDKA 1WE0A 2XPEA 3D4TA 3UARA 1EEJA 2IFQA 5EPFA 1XVWA 2B5XA 3M1GA 3C71A 8GSSA 2I9HA 3EE2A 1SK1A 1HNBA 2E2MA 4DSSB 5D9VA 5G1KA 3CTGA 4O7HA 2VD1A 2YWMA 1S3AA 5CNWA 1XZOA 1U88A 2NTOA 3DGQA 3HY2A 4GSSA 3QOUA 4EC0A 4BL7A 3EVIA 2X64A 3QCPA 2A2RA 2C80A 4MK3A 4EF0A 3KP9A 2P5QA 2CX4A 4Q5RA 1GTAA 1E6BA 2H6ZA 2CQ9A 1DE2A 3P7XA 4BWQA 4IQAA 1K0BA 5G1LA 3LSZA 1I5GA 2MMAA 2AJQB 4IP6A 2YWNA 1T00A 1SK0A 3Q18A 3BOAA 4LLRA 1F6MC 1WPIA 2PN8A 3FY7A 2HSYA 1TRWA 3ERFA 1XW6A 3ERGA 1PD21 3G9BA 3VK9A 2OADA 4KA0A 4J56E 4F9ZA 1ZYQB 1U6TA 4DSRA 1SL0B 2AAWA 2HFDA 5DBQA 2YV9A 1Z9HA 2GTUA 1WIKA 1X9WB 4LA1A 5G5EA 1MDJA 5AGYA 3QR6A 2B3SA 1SKRB 2H70A 3FZ4A 3ZRDA 3VWXA 4MPFA 1X5CA 3CSHA 2MMOA 1SJIA 5C00A 1Y25A 1R26A 4FYCA 1RQMA 2ES7A 3GNJA 3LJRA 2VUPA 3GUSA 9GSSA 4I8BA 2I81A 3QAGA 2B5EA 3DXBA 3ME8A 4K0GA 3P2AA 22GSA 2K8VA 2WJUA 4HUAA 1XFLA 1B4PA 3UL3A 4NPBA 1SL2B 3F4TA 1BQ7A 3ERWA 4XS6A 2ON7A 2QGVA 5CRDA 4PNGA 1KEBA 2LRTA 4N10A 1PQNA 1K0MA 3C73A 4TVEA 1GSSA 2JZTA 1GSQA 1EV4A 1K0CA 2BMXA 4IGJA 1XWAA 1T4ZA 1SKWB 5DAKB 5J4UA 3AY8A 1OAZA 4K7IA 1PX6A 3GYKA 4N0ZA 1SENA 5DCGA 4ECBA 2VLTA 3KH9A 3GHAA 3CSIA 5EVOA 4L0WA 3DVWA 2K9FA 2LUSA 3APQA 3DMLA 4IJ3A 1JZWA 5JCUA 4I2UA 2OJLA 3TGZA 5HR0A 3DVXA 2YOIA 1OC8A 4F0CA 5ECRB 4J2FA 3LFLA 3U6VA 5GZZB 2X8CA 4RI6A 5ELAA 2FWHA 1AQXA 1RK4A 3LORA 2WGRA 1E2YA 1GWCA 5J9CA 3FR9A 4KCEA 2HZEA 4GSNA 3RHBA 5GSSA 1T8EB 5ID2B 5INYA 1GSUA 3KXOA 1OC3A 1TRVA 3QAVA 1U3AA 1AQWA 1XW9A 3UAPA 3C1SA 3GSSA 4AJ7A 4QL7A 5IO2A 1Z7PA 2IMIA 4TR0A 1R4WA 3JCML 1N2AA 5CRWA 2CV4A 2EIQA 3GV1A 3PH9A 1YZXA 5G2ZA 2ON5A 1XWCA 2VL3A 4EE0A 3F4RA 5G5FA 2PGTA 1FAAA 3ZLPA 4MLYA 5LD0A 3D6IA 1T3BA 1W4VA 1A2LA 2YZUA 2VIMA 4IW9A 1FHEA 2OE0A 4JR4A 1NM3A 3BBYA 4ID0A 1GNEA 2H1AA 2LTKA 2IFQB 2KLXA 5IMCA 3DIEA 3ZYWA 2LNSA 4I97A 4BWSA 1H75A 2VD0A 4NHZA 1F3BA 5D73A 2WZ9A 2IMDA 5A4WA 1K3LA 1F37A 4JEDA 6GSYA 3KTLA 4OMVA 1R7HA 5JWOB 3SWLA 3ZMKA 4L0UA 1GTUA 1HYUA 4J57E 4V2LA 2H1DA 2G2QA 1DUGA 3BJ5A 5ABRA 4AJ6A 2YANA 5D9WA 1TK8B 2BJXA 3RDWA 4KSOA 1TDIA 5D93A 2A4VA 2JSZA 2CZ2A 2L5LA 4O5RA 5B8AA 3IXRA 3L9VA 2RM6A 5DJMA 3TJFA 3KMNA 4KH7A 1X9SB 3RHCA 5CAXA 1A23A 3LEFA 2JZSA 1M2BA 5IPHA 2K6VA 3LXTA 5KN2A 1SD8A 4EVMA 3TDGA 5C04A 3ZITA 3BCKA 2YZHA 3UMAA 3Q74A 2YWIA 1HQOA 5G31A 2OBIA 1AW9A 1RW1A 2XPDA 2H75A 2OKAA 3GKMA 4ML1A 3EURA 3IV4A 5CREA 1A8YA 1UVZA 4PUFC 1UC7A 1THOA 2LJKA 1PA3A 3VWWA 1BJXA 2DJKA 4DEJA 2KOKA 2IJYA 1T7PB 2H0HA 4HI7A 2CT6A 12GSA 2LJRA 3WGXA 2O85A 1S3DA 1TJDA 4AGSA 4NAXA 4K2DA 5DAKA 3D22A 3LYPA 2H66A 1S3CA 2IN3A 2LV3A 1PRXA 1EZKA 1JZRA 1ZYEA 3KM6A 3VURA 4MJCA 3CRUA 1OE8A 2O7KA 4X1UA 1GUMA 5IQYA 3RPNA 1FB0A 3ZMLA 3FZ9A 4IKHA 1TRSA 2LKUA 1EP7A 3GX8A 2GT5A 5GAPD 4WF5A 2LRNA 4KB3A 1WWJA 4G2EA 4KCAA 5B6MA 2B1LA 1U87A 2HI7A 1EGRA 4YQMA 3LYKA 5EY6A 3P8WA 1HNAA 3ZZXA 1B4QA 3TKSC 1UN2A 2LNTA 2VLUA 2VCQA 4HZ2A 2VCZA 4MZWA 3F6FA 5ELGA 3TJKA 2OBKA 1JZOA 3F8UA 1G6WA 5J9BA 2C3QA 1GUHA 2FWFA 4NWYA 3I69A 1IYIA 3FK8A 3W8JA 4I2TA 2IMKA 1AIUA 3VI5A 2IIYA 2C4JA 1KBNA 3HJMA 3A3TA 1ZOFA 3HDCA 4GQCA 3FKFA 5F05A 4NXIA 2CA8A 2N5FA 5CRGA 4EDYA 4F2IA 4N11A 5F07A 4FYUA 4PXOA 2PVOC 1X0RA 1B8XA 1TW9A 3GH9A 6GSUA 1JFUA 1B9XC 4WXTA 2V1MA 3ZVJD 4WR4A 1TU7A 4MZCA 3C8EA 2JU5A 2CZ3A 2E0QA 3MSZA 2GSTA 1FW1A 1I9DA 3H79A 1O6JA 1ERWA 4MH3A 4H86A 6GSXA 1PL2A 3TKSA 5HQPA 4IELA 1TI3A 3HCZA 1ST9A 4MPGA 3TRXA 3F63A 4MCUA 3E3EA 4PX1A 2AB6A 5AISA 1FG4A 5IOXA 3HKRA 2XC2A 5FHIA 5HFKA 3TRPA 5ECQB 1ON4A 3US3A 2FHEA 4BVYA 4NV5A 1G7EA 1NW2A 1GSYA 3I9V2 1CQHA 1Z6NA 3F6DA 4TR3A 3FZAA 5HFGA 2GSSA 3GN3A 2OE3A 1AC1A 3HJPA 2R3XA 4V1Ag 3TKPA 1QMVA 3TRQA 1M0UA 3H8QA 4KSMA 2XBQA 2ZNMA 4MF7A 5F8BA 4ZL7A 3HHVA 1ZGNA 2YCDA 3UEMA 1EOHA 2GVPA 4MDCA 2HZFA 4ZB9A 4NV2A 1TI1A 1THXA 3I43A 4G10A 3EINA 1KNGA 2PU9C 3SBCA 2GQLA 4XS4B 6GSWA 2WRTA 3L9UA 2H1BA 2H0GA 2P5RA 2WB9A 5KN0A 2EIOA 2VOCA 4EUYA 1WRYA 4MH2A 1GUKA 1TOFA 1ERTA 4HQSA 3HYPA 4JR6A 5GAND 4WR5A 4ZILA 3EMPA 3TOTA 2X8GA 4HJMA 2WS2A 3P90A 1M7TA 5ECKB 2YPMA 4WEYA 3WGEA 4FIWA 2R6KA 3WGDA 2NBSA 4HOJA 1ABAA 1A2MA 2IMFA 4TOPA 2PMTA 4BA7A 1SJ6A 1FVKA 4HDEA 3UOMA 2MMNA 1K0OA 1OVNA 3EU3A 5HR1A 3NIVA 2H19A 5H5QA 1GH2A 3MAKA 1OYJA 4I5QA 3W8SA 2R37A 4KE3A 3CTFA 1Z5YE 3CXGA 3A2VA 3S9FA 4P3YB 1VRSD 3MWHA 3D4MA 4ILFA 4TXVA 4V2NA 2HLSA 3KJYA 3APOA 4AJ8A 4K9ZA 1ZL9A 2VCWA 2HRFA 1PL1A 2MBSA 2WFCA 1UA5A 3O6TA 2H1GA 1V98A 1LBKA 1VF2A 2H76A 2H74A 2I3YA 2YP6A 4Z7XA 5G30A 5A5KA 4KUNA 2KHPA 2CVKA 2V32A 3KZQA 2AHEA 5ECSA 3GL5A 3GA4A 5B8BA 3UVHA 19GSA 4ZL9A 3VWVA 1YF0A 5DDLA 1GLQA 3ZVJA 4PQIA 4ML6A 1HNCA 1FO5A 4CHSA 1WMJA 1V58A 5J3RA 3C1RA 4HU7A 2QKEA 1JZDA 3KEBA 2GT6A 2Z9SA 1ZMAA 5ENUA 4D73A 1MTCA 2F8AA 5IO0A 1X9MB 3GX0A 5HR2A 2HNLA 2DJ0A 3HVSA 3N5OA 4ACSA 5FT3A 2YJHA 2IWTA 3TUEA 4OCEA 3WT1A 2WULA 1ACVA 2I4AA 3A5WA 1O73A 1TU8A 5ECPB 1EP8A 2FGXA 4IQ1A 1Z3EA 3HVVA 5ECOB 5H5RA 1TP9A 4MMMA 2GZZA 1GL8A 2RUEA 4GCIA 3C7MA 4POBA 1F3AA 4HU9A 2L4CA 5E59A 4YAVA 4K7NA 1WP0A 5LNKe 2B7JA 3IR4A 4I6XA 5DVBA 2JADA 1XIYA 1TRUA 4DSQA 1SKSB 3HD5A 1BAYA 7GSSA 5D8IA 2C0GA 5E4WA 1AUCA 4MABA 3TB2A 1OKDA 2FA4A 4L5LA 2YWOA 4ECJA 4K8MA 3ISOA 1JLWA 2HXKA 3EC3A 2N5AA 4JBBA 1ILOA 2L57A 4KW6A 4PUAA 3APSA 1FOVA 4WBRD 1PSQA 2DJJA 5AIXA 1NHYA 1T1VA 13GSA 3DD3A 3HZ4A 1XXUA 1MEKA 1X5DA 5J5NA 3V1WA 4XS4A 3ZTLA 3EYTA 1GULA 2YV7A 2H73A 2RLIA 18GSA 4BPYA 3CRTA 1GSFA 1NSWA 3FEUA 2R5GA 5JWQB 5H5SA 4IHUA 2RUFA 5CP1A 3VPQA 1OKTA 2DJ2A 2H30A 3U5RE 2PWJA 1F2EA 2LSTA 2GQMA 2V2GA 4WETA 2WDUA 5J41A 2V6KA 3ZIJA 5L71A 2DMMA 4YQVA 2H72A 3KIJA 2YJ7A 3CMIA 1EOGA 3BCIA 4ZBDA 4GTUA 4POLA 4MF6A 4MJBA 1AAZA 4XRDA 1WOUA 2R4VA 3FYGA 3DEXA 3G7YA 4POKA 1G6YA 2FUG2 1A2JA 3EMXA 2DBCA 2FLSA 5F0GA
chains in the Genus database with same CATH superfamily
1XW5A 1C72A 3IOSA 1YQ1A 4GQFA 1O85A 4TR1B 1K3YA 4ULXA 1VGLA 1KTEA 4PQ1A 3WT2A 5ECNB 2DMLA 3F0IA 1YF1A 1BEDA 3TKQA 5IMDA 2V6OA 3LWAA 3RPPA 2NVLA 1M9BA 2C3TA 1K0DA 1N8JA 2VL2C 1PGTA 1A8LA 4PQHA 2HRNA 4Z2RA 1K0AA 4TXOA 2OE1A 2IMEA 1FB6A 1YKCA 4OFTA 3KCMA 3BD2A 4LL4B 4GLTA 2H0IA 1XOAA 1QUWA 2MMZA 3CSJA 3L78A 1BG5A 4LMWA 3KP8A 1ML6A 4CW9A 5FWGA 4ZBBA 1R5PA 1OC9B 2H01A 17GSA 1JLVA 3H1NA 1M99A 1XPVA 4ECIA 1JHBA 2DKIA 2H71A 1ZZYA 3UBLA 2NDOA 2FD3A 3TOUA 2VLVA 4PURA 4ZB6A 5IMAA 10GSA 4O5UA 4GWRA 4TRXA 2TRXA 4QQ7A 2LRCA 2F8FA 2C3NA 2KP1A 2HRKA 4X43A 4YH2A 3ZIVA 5LCZA 5GSTA 6GSTA 2P31A 1GTIA 3Q19A 4D73B 1URMA 5ECIB 2GSQA 3HZ8A 1TK5B 2LJAA 2BTOT 2ZCTA 2REMA 3FZ5A 3H4KA 4L5OA 2O8VB 4IJIA 2OACA 1DE1A 4LL1B 2DJ3A 1YDKA 2HSHA 5IPGA 2GGTA 3HJOA 2CVDA 3HXSA 16GSA 5CO3A 1PX7A 1LU4A 4K0NA 5DALA 3DKSA 4K5SA 2V41A 3KTBA 1T4YA 1GSDA 2GDRA 5JCGA 2VO4A 3IRAA 1VF3A 4XS1A 4X0XA 1PKZA 2FWGA 4K7OA 1GP1A 3KMOA 5COHA 1K0NA 5DCHA 4RQXA 2AV4A 3IC4A 20GSA 3PGTA 1O8WA 4ZB8A 1VF4A 1ERUA 1GTBA 3F4SA 4V2MA 3IDVA 3F9UA 4HJ2A 1MDKA 2CX3A 1A0RP 1O7UA 4XTSA 3QFBC 4USSA 2DJ1A 3CBUA 3GRXA 1TTZA 1YJ6A 5JCWA 2MBTA 2YNXA 3PR8A 1TKDB 1O8XA 1AXDA 2JL4A 3TCOA 2E2GA 4JZQA 2GZPA 2QC7A 4RI7A 4EDZA 4Q5FA 1Q98A 4ZXGA 3F3QA 2PBJA 5DQSA 3N9JA 3GSTA 4ISDA 5D96A 3GH6A 1YY7A 1ZCPA 5DJLA 3QFAC 1AQVA 2F3MA 4TR1A 1SU9A 5B7CA 4X4JA 4CDOA 2IL3A 2VCTA 3I6AA 2VAFA 2X99A 4GF0A 1X5EA 4HZ4A 5EL8A 4HEA2 4OWYA 3M8NA 2PUKC 4ZBAA 2XHFA 2TIRA 5IIZA 1PKWA 2FCHA 3IBHA 3CQFA 2JACA 1M9AA 3RAZA 2CAQA 5KN1A 4FO5A 2K8SA 2GS3A 2VM1A 2HT9A 4KX4A 1OC9A 3RBTA 1V57A 3IE3A 3PINA 5ECMB 3FR3A 2J9HA 4E8EA 3GKKA 1SD9A 3GKNA 3M9JA 4O92A 5JWRB 4HQZA 2DKHA 5CYYA 4JE1A 1XWBA 3IA1A 2H8LA 4TR4A 3KD0A 2AYTA 4FH8A 3GFKA 3GMFA 1B9YC 1SK2A 4A5PA 1M3JA 2X49A 2C0EA 4TXOB 3NOFA 4XIHA 5A4VA 2J23A 3WYWA 4O5QA 1YEXA 3IHQA 3O3TA 4MP4A 3GKXA 2EC4A 3GURA 2L5OA 3FR6A 4RUVA 3GIXA 4OD7A 2RM5A 1VF1A 4GXZA 2C0DA 4ECCA 1W89A 3O76A 2FNOA 1A0FA 4AF2A 1M2AA 4WF4A 3L0HA 2VCXA 3HA9A 4OO4A 2G0FA 3GTUB 1MD3A 1FVJA 4KNDA 4GRFA 3LQ7A 2N5BA 4K1FA 1QK8A 3IK9A 3F3RA 4MA9A 3TKSE 4RQRA 2L6CA 5A4UA 2RIIA 4QL9A 3G7IA 2L59A 2D2ZA 2FWEA 1NHOA 1DSBA 4TN8A 1IYHA 1GNWA 3UIWA 2IPAA 4WBJA 3UJ1A 2DIYA 1Z7RA 2YN1A 4KDUA 2FA8A 1TK0B 4YAPA 2GSRA 3TJBA 4K5RA 3FW2A 1MD4A 2HE3A 1Q4JA 4BVXA 2H6YA 1SL1B 2R0PA 4DSSA 1G7OA 1J08A 2GLRA 2CAIA 3D5JA 1EEMA 2MZCA 1BX9A 3UBKA 2GZYA 4MZBA 3G7JA 1SYXA 3EPTA 2B5YA 1J0FA 5ECLB 3ED3A 5CRHA 3J7Yk 4Q5NA 2GQKA 3UVTA 2K18A 1BYEA 3ME7A 1O81A 1GRXA 3WD6A 3VLNA 4ZIJA 3QD9A 1XWKA 2KP2A 2HYXA 3DYRA 3A2WA 3IAS2 4KAEA 5DALB 4L8EA 2DSAA 1G0TA 1WJKA 6GSVA 5HR3A 3W6GA 3L4NA 2HRAA 4O32A 4V1Ap 2KUCA 1SYRA 1GLPA 2DC5A 1PN9A 2PERA 1EWXA 4N30A 2H6XA 2QSIA 3VWUA 3VFIA 2B1KA 4XHMA 3IK7A 3R2QA 4F0BA 2B6MA 2C1YA 5AN1A 1U3IA 3L9SA 5KEJA 2UZ8A 4OCFA 3LG6A 1S3RA 2L4QA 4HS1A 1V40A 2F9SA 3IAM2 3ZL5A 3TJJA 3DWVA 4EXJA 4N0VA 4G0IA 5DQYA 4Q5QA 4LMVA 3KGKA 3VPTA 2PVQA 3M0FA 2M80A 4TKYA 1SJZA 4IN0A 1QFNA 4XRAA 2L6DA 1A24A 3VI7A 2O87A 2WCIA 2NPBA 4NHWA 3TKRA 3Q6OA 2F51A 5F06A 14GSA 4IBPA 4OFMA 1YKAA 3ZREA 1V2AA 4PNFA 4G19A 2MYGA 3QPMA 4PGTA 1F9MA 1MDIA 3E0UA 1ERVA 1H4OA 2X8HA 4OO5A 3LGCA 1TXXA 3GL3A 2P0GA 5IMZA 3DRNA 1XOBA 5IM9A 2M72A 3D21A 1QQ2A 1V9WA 4EKZA 4MJAA 2FY6A 4CY8A 2VCVA 3J7Yb 1LJRA 6GSSA 3KH7A 3E9JB 3ZFLA 1HD2A 2C0FA 4WKWA 4KDYA 4POMA 2LEGA 1DBYA 4IS0A 4IVFA 3FHKA 2DLXA 1R5AA 2R2JA 1M2DA 4FYBA 1Z6MA 2I1UA 1CQGA 2JSYA 2LQQA 2LQOA 4EL1A 4GSTA 4K6XA 3GTUA 3OR5A 2PPTA 2AUVA 3QDNA 3FRCA 3EU4A 4KGIA 4OFNA 3EWLA 2VM2A 3CYNA 5IOWA 2OA7A 1XCCA 3HVXA 5D9XA 1K3OA 4MF5A 1PMTA 3ZFBA 3H93A 1EGOA 1J9BA 2ZUPA 1XVQA 1Y6EA 2M46A 2CVBA 3D0ZA 4G9HA 5D9TA 5HFIA 1GSEA 1QGVA 3M9KA 2VL2A 3IPZA 3MNGA 2VL9A 3A2XA 3M3MA 5B6NA 4NMUA 5ID2A 2JZRA 4F82A 1YEPA 2QA2A 2O89A 1USBA 1XBSA 2EIRA 4XCSA 4YQUA 2B7KA 5KN3A 2A2SA 4MJEA 4DVCA 3QAWA 11GSA 1OE7A 5IMVA 5IMFA 5AIVA 3TJGA 2C8UA 4YKGA 4E8HA 4JU5A 4TW5A 4JRRA 4EO3A 5ECHB 2XBIA 3LXZA 4IP1A 4ZL8A 3QMXA 1QXHA 2ALBA 3K8NA 4KDXA 2DIZA 2LS5A 3NZNA 4F03A 1EV9A 1B48A 1XWGA 2E7PA 2TRCP 2HZEB 3MDKA 1WE0A 2XPEA 3D4TA 3UARA 1EEJA 2IFQA 5EPFA 1XVWA 2B5XA 3M1GA 3C71A 8GSSA 2I9HA 3EE2A 1SK1A 1HNBA 2E2MA 4BVXB 4DSSB 5D9VA 5G1KA 3CTGA 4O7HA 2VD1A 2YWMA 1S3AA 5CNWA 1XZOA 1U88A 2NTOA 3DGQA 3HY2A 4GSSA 3QOUA 4EC0A 4BL7A 3EVIA 2X64A 3QCPA 2A2RA 2C80A 4MK3A 4EF0A 3KP9A 2P5QA 2CX4A 3PPUA 4Q5RA 1GTAA 1E6BA 2H6ZA 2CQ9A 1DE2A 3P7XA 4BWQA 5BMUA 4IQAA 1K0BA 5G1LA 3LSZA 1I5GA 2MMAA 2AJQB 4IP6A 2YWNA 1T00A 1SK0A 4CY6A 3Q18A 3BOAA 4LLRA 1F6MC 1WPIA 2PN8A 3FY7A 2HSYA 1TRWA 3ERFA 1XW6A 3ERGA 1PD21 3G9BA 3VK9A 2OADA 4KA0A 4J56E 4F9ZA 1ZYQB 1U6TA 4DSRA 1SL0B 2AAWA 2HFDA 5DBQA 2YV9A 1Z9HA 2GTUA 1WIKA 1X9WB 4LA1A 5G5EA 1MDJA 5AGYA 3QR6A 2B3SA 1SKRB 2H70A 3FZ4A 3ZRDA 4ICYA 3VWXA 4MPFA 1X5CA 3CSHA 2MMOA 1SJIA 5C00A 1Y25A 1R26A 4FYCA 1RQMA 2ES7A 3GNJA 3LJRA 2VUPA 3GUSA 9GSSA 4I8BA 2I81A 3QAGA 2B5EA 3DXBA 3ME8A 4K0GA 3P2AA 22GSA 2K8VA 2WJUA 4HUAA 1XFLA 1B4PA 3UL3A 4NPBA 5BRTA 1SL2B 3F4TA 1BQ7A 3ERWA 4XS6A 2ON7A 2QGVA 5CRDA 4PNGA 1KEBA 2LRTA 4N10A 1PQNA 1K0MA 3C73A 4TVEA 1GSSA 2JZTA 1GSQA 1EV4A 1K0CA 2BMXA 4IGJA 1XWAA 1T4ZA 1SKWB 5DAKB 5J4UA 3AY8A 1OAZA 4K7IA 1PX6A 3GYKA 4N0ZA 1SENA 5DCGA 4ECBA 2VLTA 3KH9A 3GHAA 3CSIA 5EVOA 4L0WA 3DVWA 2K9FA 2LUSA 3APQA 3DMLA 4IJ3A 1JZWA 5JCUA 4I2UA 2OJLA 3TGZA 5HR0A 3DVXA 2YOIA 1OC8A 4F0CA 5ECRB 4J2FA 3LFLA 3U6VA 1PFOA 5GZZB 2X8CA 4RI6A 5ELAA 1FOHA 2FWHA 1AQXA 1RK4A 3LORA 2WGRA 1E2YA 1GWCA 5J9CA 3FR9A 4KCEA 2HZEA 4GSNA 3RHBA 5GSSA 1T8EB 5ID2B 5INYA 1GSUA 3KXOA 1OC3A 1TRVA 3QAVA 1U3AA 1AQWA 1XW9A 3UAPA 3C1SA 3GSSA 4AJ7A 4QL7A 5IO2A 1Z7PA 2IMIA 4TR0A 1R4WA 3JCML 1N2AA 5CRWA 2CV4A 2QA1A 2EIQA 3GV1A 3PH9A 1YZXA 5G2ZA 2ON5A 1XWCA 2VL3A 4EE0A 3F4RA 2HSMA 5G5FA 2PGTA 1FAAA 3ZLPA 4MLYA 5LD0A 3D6IA 1T3BA 1W4VA 1A2LA 2YZUA 2VIMA 4IW9A 1FHEA 2OE0A 4G0KA 4JR4A 1NM3A 3BBYA 4ID0A 1GNEA 2H1AA 2LTKA 2IFQB 2KLXA 5IMCA 3DIEA 3ZYWA 2LNSA 4I97A 4BWSA 4K2XA 1H75A 2VD0A 4NHZA 1F3BA 5D73A 2WZ9A 2IMDA 5A4WA 2A4HA 1K3LA 1F37A 4JEDA 6GSYA 3KTLA 4OMVA 1R7HA 3R3EA 5JWOB 3SWLA 3ZMKA 4L0UA 1GTUA 1HYUA 4J57E 4V2LA 2H1DA 2G2QA 1DUGA 3BJ5A 5ABRA 4BL7B 4AJ6A 2YANA 5D9WA 1TK8B 2BJXA 3MYDA 3RDWA 4KSOA 1TDIA 5D93A 2A4VA 2JSZA 4BVYB 2CZ2A 2L5LA 4O5RA 2R0CA 5B8AA 3IXRA 3L9VA 2RM6A 5DJMA 3TJFA 3KMNA 4KH7A 1X9SB 3RHCA 5CAXA 1A23A 3LEFA 2JZSA 1M2BA 5IPHA 5KOXA 2K6VA 3LXTA 5KN2A 1SD8A 4EVMA 3TDGA 5C04A 3ZITA 3BCKA 2YZHA 3UMAA 3Q74A 2YWIA 1HQOA 5G31A 2OBIA 3FMWA 1AW9A 1RW1A 2XPDA 2H75A 2OKAA 3GKMA 4ML1A 3EURA 3IV4A 5CREA 4FQUA 1A8YA 1UVZA 4PUFC 1UC7A 1THOA 2LJKA 1PA3A 3VWWA 1BJXA 2DJKA 4DEJA 2KOKA 2IJYA 1T7PB 2H0HA 4HI7A 2CT6A 12GSA 2LJRA 3WGXA 4BIKA 3A5IA 2O85A 1S3DA 1TJDA 4AGSA 2R0GA 4NAXA 4K2DA 5DAKA 3D22A 3LYPA 2H66A 1S3CA 2IN3A 2LV3A 1PRXA 1EZKA 1JZRA 1ZYEA 3KM6A 3VURA 4MJCA 3CRUA 1OE8A 2O7KA 4X1UA 1GUMA 5IQYA 4G0LA 3RPNA 1FB0A 3ZMLA 3FZ9A 4IKHA 1TRSA 2LKUA 1EP7A 3GX8A 2GT5A 5GAPD 4WF5A 2LRNA 4KB3A 1WWJA 4G2EA 4KCAA 5B6MA 2B1LA 1U87A 2HI7A 1EGRA 4YQMA 3LYKA 5EY6A 3IC8A 3P8WA 1HNAA 3ZZXA 1B4QA 3TKSC 1UN2A 2LNTA 2VLUA 2VCQA 4HZ2A 2VCZA 4MZWA 3F6FA 5ELGA 3TJKA 4HSCX 2OBKA 1JZOA 3F8UA 1G6WA 5J9BA 2C3QA 1GUHA 2FWFA 4NWYA 3I69A 1IYIA 3FK8A 3W8JA 4I2TA 2IMKA 1AIUA 3VI5A 2IIYA 2C4JA 1KBNA 3HJMA 3A3TA 1ZOFA 3HDCA 4GQCA 3FKFA 5F05A 4NXIA 2CA8A 2N5FA 5CRGA 4EDYA 4F2IA 4N11A 5F07A 4FYUA 4PXOA 2PVOC 1X0RA 1XG8A 1B8XA 1TW9A 3GH9A 6GSUA 1JFUA 1B9XC 4WXTA 2V1MA 3ZVJD 4WR4A 1TU7A 4MZCA 3C8EA 2JU5A 2CZ3A 2E0QA 3MSZA 2GSTA 1FW1A 1I9DA 3H79A 1O6JA 1ERWA 4MH3A 4H86A 6GSXA 1PL2A 3TKSA 5HQPA 4IELA 1TI3A 3HCZA 1ST9A 4MPGA 3TRXA 3F63A 4MCUA 3E3EA 4PX1A 2AB6A 5AISA 1FG4A 5IOXA 3HKRA 2XC2A 5FHIA 5HFKA 3TRPA 5ECQB 1ON4A 3US3A 2FHEA 4BVYA 4NV5A 1G7EA 1NW2A 1GSYA 3I9V2 1CQHA 1Z6NA 3F6DA 4TR3A 3FZAA 5HFGA 3LW9A 2GSSA 3GN3A 3HVNA 2OE3A 1AC1A 3HJPA 2R3XA 4V1Ag 3TKPA 1QMVA 3TRQA 1M0UA 1M3IA 3H8QA 2XBQA 2ZNMA 4KSMA 4MF7A 5F8BA 4ZL7A 3HHVA 1ZGNA 2YCDA 3UEMA 1EOHA 2GVPA 4MDCA 2HZFA 4ZB9A 4NV2A 1TI1A 1THXA 3I43A 4G10A 3EINA 1KNGA 2PU9C 4PTSA 3SBCA 2GQLA 4KF9A 4XS4B 6GSWA 2WRTA 3L9UA 2H1BA 2H0GA 2P5RA 2WB9A 5KN0A 2EIOA 2VOCA 4EUYA 1WRYA 1ZYNA 4MH2A 1GUKA 1TOFA 1ERTA 4HQSA 3HYPA 4JR6A 5GAND 4WR5A 4ZILA 3EMPA 3TOTA 2X8GA 4HJMA 2WS2A 3P90A 1M7TA 5ECKB 2YPMA 4WEYA 3WGEA 4FIWA 2R6KA 4YKFA 3WGDA 2NBSA 4HOJA 1ABAA 1A2MA 2IMFA 4Z2UA 4TOPA 2PMTA 4BA7A 1PN0A 1SJ6A 1FVKA 4HDEA 3UOMA 2MMNA 1K0OA 1OVNA 3EU3A 5HR1A 3NIVA 2H19A 5H5QA 1GH2A 3MAKA 1OYJA 4I5QA 3W8SA 2R37A 4KE3A 3CTFA 1Z5YE 3CXGA 3A2VA 3S9FA 4P3YB 1VRSD 3MWHA 3D4MA 4ILFA 4TXVA 4V2NA 2HLSA 3KJYA 3APOA 4AJ8A 4K9ZA 1ZL9A 2VCWA 2HRFA 2X4AA 1PL1A 4Z2TA 2MBSA 2WFCA 1UA5A 3O6TA 2H1GA 1V98A 1LBKA 1VF2A 2H76A 2H74A 2I3YA 2YP6A 4Z7XA 5G30A 5A5KA 4KUNA 2KHPA 2CVKA 2V32A 3KZQA 2AHEA 5ECSA 3GL5A 3GA4A 5B8BA 3UVHA 19GSA 4ZL9A 3VWVA 1YF0A 5DDLA 1GLQA 3ZVJA 4PQIA 4ML6A 1HNCA 1FO5A 4CHSA 1WMJA 1V58A 5J3RA 3C1RA 4HU7A 2QKEA 1JZDA 3KEBA 2GT6A 2Z9SA 1ZMAA 5ENUA 4D73A 1MTCA 2A2PA 2F8AA 5IO0A 1X9MB 3GX0A 5HR2A 2HNLA 2DJ0A 3HVSA 3N5OA 4ACSA 5FT3A 2YJHA 2IWTA 3TUEA 4OCEA 3WT1A 2WULA 1ACVA 2I4AA 3A5WA 1O73A 1TU8A 5ECPB 1EP8A 2FGXA 4IQ1A 1Z3EA 3HVVA 5ECOB 5H5RA 1TP9A 4MMMA 2GZZA 1GL8A 2RUEA 4GCIA 3C7MA 4POBA 1F3AA 4HU9A 2L4CA 5E59A 4YAVA 4K7NA 1WP0A 5LNKe 2B7JA 3IR4A 4I6XA 5DVBA 2JADA 1XIYA 1TRUA 4DSQA 1SKSB 3HD5A 1BAYA 7GSSA 5D8IA 2C0GA 5KOWA 5E4WA 1AUCA 4MABA 3TB2A 1OKDA 2FA4A 4L5LA 2YWOA 4ECJA 4K8MA 3ISOA 1JLWA 2HXKA 3EC3A 4EIQA 3MIXA 2N5AA 4JBBA 1ILOA 2L57A 4KW6A 4PUAA 3APSA 1FOVA 4WBRD 1PSQA 2DJJA 5AIXA 1NHYA 1T1VA 13GSA 3DD3A 3HZ4A 1XXUA 1MEKA 1X5DA 5J5NA 3V1WA 4XS4A 3ZTLA 3EYTA 1GULA 2YV7A 2H73A 2RLIA 18GSA 4BPYA 3CRTA 1GSFA 1ZYPA 1NSWA 3FEUA 2R5GA 5JWQB 5H5SA 4IHUA 2RUFA 5CP1A 3VPQA 1OKTA 2DJ2A 2H30A 3U5RE 2PWJA 1F2EA 2LSTA 3IHGA 2GQMA 2V2GA 4WETA 2WDUA 5J41A 2V6KA 3ZIJA 5L71A 2DMMA 4YQVA 2H72A 3KIJA 2YJ7A 3CMIA 1EOGA 3BCIA 4ZBDA 4GTUA 4POLA 4MF6A 4MJBA 1AAZA 4XRDA 1WOUA 4MNNA 2R4VA 3FYGA 3DEXA 3G7YA 4POKA 1G6YA 2FUG2 4EIPA 1A2JA 3EMXA 2DBCA 2FLSA 5F0GA
chains in the Genus database with same CATH topology
1XW5A 1C72A 3IOSA 1YQ1A 4GQFA 1O85A 4TR1B 1K3YA 4ULXA 1VGLA 1KTEA 4PQ1A 3WT2A 5ECNB 2DMLA 3F0IA 1YF1A 1BEDA 3TKQA 5IMDA 2V6OA 3LWAA 3RPPA 2NVLA 1M9BA 2C3TA 1K0DA 1N8JA 2VL2C 1PGTA 1A8LA 4PQHA 2HRNA 4Z2RA 1K0AA 4TXOA 2OE1A 2IMEA 1FB6A 1YKCA 4OFTA 3KCMA 3BD2A 4LL4B 4GLTA 2H0IA 1XOAA 1QUWA 2MMZA 3CSJA 3L78A 1BG5A 4LMWA 3KP8A 1ML6A 4CW9A 5FWGA 4ZBBA 1R5PA 1OC9B 2H01A 17GSA 1JLVA 3H1NA 1M99A 1XPVA 4ECIA 1JHBA 2DKIA 2H71A 1ZZYA 3UBLA 2NDOA 2FD3A 3TOUA 2VLVA 4PURA 4ZB6A 5IMAA 10GSA 4O5UA 4GWRA 4TRXA 2TRXA 4QQ7A 2LRCA 2F8FA 2C3NA 2KP1A 2HRKA 4X43A 4YH2A 3ZIVA 5LCZA 5GSTA 6GSTA 2P31A 1GTIA 3Q19A 4D73B 1URMA 5ECIB 2GSQA 3HZ8A 1TK5B 2LJAA 2BTOT 2ZCTA 2REMA 3FZ5A 3H4KA 4L5OA 2O8VB 4IJIA 2OACA 1DE1A 4LL1B 2DJ3A 1YDKA 2HSHA 5IPGA 2GGTA 3HJOA 2CVDA 3HXSA 16GSA 5CO3A 1PX7A 1LU4A 4K0NA 5DALA 3DKSA 4K5SA 2V41A 3KTBA 1T4YA 1GSDA 2GDRA 5JCGA 2VO4A 3IRAA 1VF3A 4XS1A 4X0XA 1PKZA 2FWGA 4K7OA 1GP1A 3KMOA 5COHA 1K0NA 5DCHA 4RQXA 2AV4A 3IC4A 20GSA 3PGTA 1O8WA 4ZB8A 1VF4A 1ERUA 1GTBA 3F4SA 4V2MA 3IDVA 3F9UA 4HJ2A 1MDKA 2CX3A 1A0RP 1O7UA 4XTSA 3QFBC 4USSA 2DJ1A 3CBUA 3GRXA 1TTZA 1YJ6A 5JCWA 2MBTA 2YNXA 3PR8A 1TKDB 1O8XA 1AXDA 2JL4A 3TCOA 2E2GA 4JZQA 2GZPA 2QC7A 4RI7A 4EDZA 4Q5FA 1Q98A 4ZXGA 3F3QA 2PBJA 5DQSA 3N9JA 3GSTA 4ISDA 5D96A 3GH6A 1YY7A 1ZCPA 5DJLA 3QFAC 1AQVA 2F3MA 4TR1A 1SU9A 5B7CA 4X4JA 4CDOA 2IL3A 2VCTA 3I6AA 2VAFA 2X99A 4GF0A 1X5EA 4HZ4A 5EL8A 4HEA2 4OWYA 3M8NA 2PUKC 4ZBAA 2XHFA 2TIRA 5IIZA 1PKWA 2FCHA 3IBHA 2JACA 1M9AA 3RAZA 2CAQA 5KN1A 4FO5A 2K8SA 2GS3A 2VM1A 2HT9A 4KX4A 1OC9A 3RBTA 1V57A 3IE3A 3PINA 5ECMB 3FR3A 2J9HA 4E8EA 3GKKA 1SD9A 3GKNA 3M9JA 4O92A 5JWRB 4HQZA 2DKHA 5CYYA 4JE1A 1XWBA 3IA1A 2H8LA 4TR4A 3KD0A 2AYTA 4FH8A 3GFKA 3GMFA 1B9YC 1SK2A 4A5PA 2X49A 2C0EA 4TXOB 3NOFA 4XIHA 5A4VA 2J23A 3WYWA 4O5QA 1YEXA 3IHQA 3O3TA 4MP4A 3GKXA 2EC4A 3GURA 2L5OA 3FR6A 4RUVA 3GIXA 4OD7A 2RM5A 1VF1A 4GXZA 2C0DA 4ECCA 1W89A 3O76A 2FNOA 1A0FA 4AF2A 1M2AA 4WF4A 3L0HA 2VCXA 3HA9A 4OO4A 2G0FA 3GTUB 1MD3A 1FVJA 4KNDA 4GRFA 3LQ7A 2N5BA 4K1FA 1QK8A 3IK9A 3F3RA 4MA9A 3TKSE 4RQRA 2L6CA 5A4UA 2RIIA 4QL9A 3G7IA 2L59A 2D2ZA 2FWEA 1NHOA 1DSBA 4TN8A 1IYHA 1GNWA 3UIWA 2IPAA 4WBJA 3UJ1A 2DIYA 1Z7RA 2YN1A 4KDUA 2FA8A 1TK0B 4YAPA 2GSRA 3TJBA 4K5RA 3FW2A 1MD4A 2HE3A 1Q4JA 4BVXA 2H6YA 1SL1B 2R0PA 4DSSA 1G7OA 1J08A 2GLRA 2CAIA 3D5JA 1EEMA 2MZCA 1BX9A 3UBKA 2GZYA 4MZBA 3G7JA 1SYXA 3EPTA 2B5YA 1J0FA 5ECLB 3ED3A 5CRHA 3J7Yk 4Q5NA 2GQKA 3UVTA 2K18A 1BYEA 3ME7A 1O81A 1GRXA 3WD6A 3VLNA 4ZIJA 3QD9A 1XWKA 2KP2A 2HYXA 3DYRA 3A2WA 3IAS2 4KAEA 5DALB 4L8EA 2DSAA 1G0TA 1WJKA 6GSVA 5HR3A 3W6GA 3L4NA 2HRAA 4O32A 4V1Ap 2KUCA 1SYRA 1GLPA 2DC5A 1PN9A 2PERA 1EWXA 4N30A 2H6XA 2QSIA 3VWUA 3VFIA 2B1KA 4XHMA 3IK7A 3R2QA 4F0BA 2B6MA 2C1YA 5AN1A 1U3IA 3L9SA 5KEJA 2UZ8A 4OCFA 3LG6A 2L4QA 4HS1A 1V40A 2F9SA 3IAM2 3ZL5A 3TJJA 3DWVA 4EXJA 4N0VA 4G0IA 5DQYA 4Q5QA 4LMVA 3KGKA 3VPTA 2PVQA 3M0FA 2M80A 4TKYA 1SJZA 4IN0A 1QFNA 4XRAA 2L6DA 1A24A 3VI7A 2O87A 2WCIA 2NPBA 4NHWA 3TKRA 3Q6OA 2F51A 5F06A 14GSA 4IBPA 4OFMA 1YKAA 3ZREA 1V2AA 4PNFA 4G19A 2MYGA 3QPMA 4PGTA 1F9MA 1MDIA 3E0UA 1ERVA 1H4OA 2X8HA 4OO5A 3LGCA 1TXXA 3GL3A 2P0GA 5IMZA 3DRNA 1XOBA 5IM9A 2M72A 3D21A 1QQ2A 1V9WA 4EKZA 4MJAA 2FY6A 4CY8A 2VCVA 3J7Yb 1LJRA 6GSSA 3KH7A 3E9JB 3ZFLA 1HD2A 2C0FA 4WKWA 4KDYA 4POMA 2LEGA 1DBYA 4IS0A 4IVFA 3FHKA 2DLXA 1R5AA 2R2JA 1M2DA 4FYBA 1Z6MA 2I1UA 1CQGA 2JSYA 2LQQA 2LQOA 4EL1A 4GSTA 4K6XA 3GTUA 3OR5A 2PPTA 2AUVA 3QDNA 3FRCA 3EU4A 4KGIA 4OFNA 3EWLA 2VM2A 3CYNA 5IOWA 2OA7A 1XCCA 3HVXA 5D9XA 1K3OA 4MF5A 1PMTA 3ZFBA 3H93A 1EGOA 1J9BA 2ZUPA 1XVQA 1Y6EA 2M46A 2CVBA 3D0ZA 4G9HA 5D9TA 5HFIA 1GSEA 1QGVA 3M9KA 2VL2A 3IPZA 3MNGA 2VL9A 3A2XA 3M3MA 5B6NA 4NMUA 5ID2A 2JZRA 4F82A 1YEPA 2QA2A 2O89A 1USBA 1XBSA 2EIRA 4XCSA 4YQUA 2B7KA 5KN3A 2A2SA 4MJEA 4DVCA 3QAWA 11GSA 1OE7A 5IMVA 5IMFA 5AIVA 3TJGA 2C8UA 4YKGA 4E8HA 4JU5A 4TW5A 4JRRA 4EO3A 5ECHB 2XBIA 3LXZA 4IP1A 4ZL8A 3QMXA 1QXHA 2ALBA 3K8NA 4KDXA 2DIZA 2LS5A 3NZNA 4F03A 1EV9A 1B48A 1XWGA 2E7PA 2TRCP 2HZEB 3MDKA 1WE0A 2XPEA 3D4TA 3UARA 1EEJA 2IFQA 5EPFA 1XVWA 2B5XA 3M1GA 3C71A 8GSSA 2I9HA 3EE2A 1SK1A 1HNBA 2E2MA 4BVXB 4DSSB 5D9VA 5G1KA 3CTGA 4O7HA 2VD1A 2YWMA 1S3AA 5CNWA 1XZOA 1U88A 2NTOA 3DGQA 3HY2A 4GSSA 3QOUA 4EC0A 4BL7A 3EVIA 2X64A 3QCPA 2A2RA 2C80A 4MK3A 4EF0A 3KP9A 2P5QA 2CX4A 3PPUA 4Q5RA 1GTAA 1E6BA 2H6ZA 2CQ9A 1DE2A 3P7XA 4BWQA 5BMUA 4IQAA 1K0BA 5G1LA 3LSZA 1I5GA 2MMAA 2AJQB 4IP6A 2YWNA 1T00A 1SK0A 4CY6A 3Q18A 3BOAA 4LLRA 1F6MC 1WPIA 2PN8A 3FY7A 2HSYA 1TRWA 3ERFA 1XW6A 3ERGA 1PD21 3G9BA 3VK9A 2OADA 4KA0A 4J56E 4F9ZA 1ZYQB 1U6TA 4DSRA 1SL0B 2AAWA 2HFDA 5DBQA 2YV9A 1Z9HA 2GTUA 1WIKA 1X9WB 4LA1A 5G5EA 1MDJA 5AGYA 3QR6A 2B3SA 1SKRB 2H70A 3FZ4A 3ZRDA 4ICYA 3VWXA 4MPFA 1X5CA 3CSHA 2MMOA 1SJIA 5C00A 1Y25A 1R26A 4FYCA 1RQMA 2ES7A 3GNJA 3LJRA 2VUPA 3GUSA 9GSSA 4I8BA 2I81A 3QAGA 2B5EA 3DXBA 3ME8A 4K0GA 3P2AA 22GSA 2K8VA 2WJUA 4HUAA 1XFLA 1B4PA 3UL3A 4NPBA 5BRTA 1SL2B 3F4TA 1BQ7A 3ERWA 4XS6A 2ON7A 2QGVA 5CRDA 4PNGA 1KEBA 2LRTA 4N10A 1PQNA 1K0MA 3C73A 4TVEA 1GSSA 2JZTA 1GSQA 1EV4A 1K0CA 2BMXA 4IGJA 1XWAA 1T4ZA 1SKWB 5DAKB 5J4UA 3AY8A 1OAZA 4K7IA 1PX6A 3GYKA 4N0ZA 1SENA 5DCGA 4ECBA 2VLTA 3KH9A 3GHAA 3CSIA 5EVOA 4L0WA 3DVWA 2K9FA 2LUSA 3APQA 3DMLA 4IJ3A 1JZWA 5JCUA 4I2UA 2OJLA 3TGZA 5HR0A 3DVXA 2YOIA 1OC8A 4F0CA 5ECRB 4J2FA 3LFLA 3U6VA 5GZZB 2X8CA 4RI6A 5ELAA 1FOHA 2FWHA 1AQXA 1RK4A 3LORA 2WGRA 1E2YA 1GWCA 5J9CA 3FR9A 4KCEA 2HZEA 4GSNA 3RHBA 5GSSA 1T8EB 5ID2B 5INYA 1GSUA 3KXOA 1OC3A 1TRVA 3QAVA 1U3AA 1AQWA 1XW9A 3UAPA 3C1SA 3GSSA 4AJ7A 4QL7A 5IO2A 1Z7PA 2IMIA 4TR0A 1R4WA 3JCML 1N2AA 5CRWA 2CV4A 2QA1A 2EIQA 3GV1A 3PH9A 1YZXA 5G2ZA 2ON5A 1XWCA 2VL3A 4EE0A 3F4RA 2HSMA 5G5FA 2PGTA 1FAAA 3ZLPA 4MLYA 5LD0A 3D6IA 1T3BA 1W4VA 1A2LA 2YZUA 2VIMA 4IW9A 1FHEA 2OE0A 4G0KA 4JR4A 1NM3A 3BBYA 4ID0A 1GNEA 2H1AA 2LTKA 2IFQB 2KLXA 5IMCA 3DIEA 3ZYWA 2LNSA 4I97A 4BWSA 4K2XA 1H75A 2VD0A 4NHZA 1F3BA 5D73A 2WZ9A 2IMDA 5A4WA 2A4HA 1K3LA 1F37A 4JEDA 6GSYA 3KTLA 4OMVA 1R7HA 3R3EA 5JWOB 3SWLA 3ZMKA 4L0UA 1GTUA 1HYUA 4J57E 4V2LA 2H1DA 2G2QA 1DUGA 3BJ5A 5ABRA 4BL7B 4AJ6A 2YANA 5D9WA 1TK8B 2BJXA 3MYDA 3RDWA 4KSOA 1TDIA 5D93A 2A4VA 2JSZA 4BVYB 2CZ2A 2L5LA 4O5RA 2R0CA 5B8AA 3IXRA 3L9VA 2RM6A 5DJMA 3TJFA 3KMNA 4KH7A 1X9SB 3RHCA 5CAXA 1A23A 3LEFA 2JZSA 1M2BA 5IPHA 5KOXA 2K6VA 3LXTA 5KN2A 1SD8A 4EVMA 3TDGA 5C04A 3ZITA 3BCKA 2YZHA 3UMAA 3Q74A 2YWIA 1HQOA 5G31A 2OBIA 3FMWA 1AW9A 1RW1A 2XPDA 2H75A 2OKAA 3GKMA 4ML1A 3EURA 3IV4A 5CREA 4FQUA 1A8YA 1UVZA 4PUFC 1UC7A 1THOA 2LJKA 1PA3A 3VWWA 1BJXA 2DJKA 4DEJA 2KOKA 2IJYA 1T7PB 2H0HA 4HI7A 2CT6A 12GSA 2LJRA 3WGXA 3A5IA 2O85A 1S3DA 1TJDA 4AGSA 2R0GA 4NAXA 4K2DA 5DAKA 3D22A 3LYPA 2H66A 1S3CA 2IN3A 2LV3A 1PRXA 1EZKA 1JZRA 1ZYEA 3KM6A 3VURA 4MJCA 3CRUA 1OE8A 2O7KA 4X1UA 1GUMA 5IQYA 4G0LA 3RPNA 1FB0A 3ZMLA 3FZ9A 4IKHA 1TRSA 2LKUA 1EP7A 3GX8A 2GT5A 5GAPD 4WF5A 2LRNA 4KB3A 1WWJA 4G2EA 4KCAA 5B6MA 2B1LA 1U87A 2HI7A 1EGRA 4YQMA 3LYKA 5EY6A 3IC8A 3P8WA 1HNAA 3ZZXA 1B4QA 3TKSC 1UN2A 2LNTA 2VLUA 2VCQA 4HZ2A 2VCZA 4MZWA 3F6FA 5ELGA 3TJKA 2OBKA 1JZOA 3F8UA 1G6WA 5J9BA 2C3QA 1GUHA 2FWFA 4NWYA 3I69A 1IYIA 3FK8A 3W8JA 4I2TA 2IMKA 1AIUA 3VI5A 2IIYA 2C4JA 1KBNA 3HJMA 3A3TA 1ZOFA 3HDCA 4GQCA 3FKFA 5F05A 4NXIA 2CA8A 2N5FA 5CRGA 4EDYA 4F2IA 4N11A 5F07A 4FYUA 4PXOA 2PVOC 1X0RA 1B8XA 1TW9A 3GH9A 6GSUA 1JFUA 1B9XC 4WXTA 2V1MA 3ZVJD 4WR4A 1TU7A 4MZCA 3C8EA 2JU5A 2CZ3A 2E0QA 3MSZA 2GSTA 1FW1A 1I9DA 3H79A 1O6JA 1ERWA 4MH3A 4H86A 6GSXA 1PL2A 3TKSA 5HQPA 4IELA 1TI3A 3HCZA 1ST9A 4MPGA 3TRXA 3F63A 4MCUA 3E3EA 4PX1A 2AB6A 5AISA 1FG4A 5IOXA 3HKRA 2XC2A 5FHIA 5HFKA 3TRPA 5ECQB 1ON4A 3US3A 2FHEA 4BVYA 4NV5A 1G7EA 1NW2A 1GSYA 3I9V2 1CQHA 1Z6NA 3F6DA 4TR3A 3FZAA 5HFGA 3LW9A 2GSSA 3GN3A 2OE3A 1AC1A 3HJPA 2R3XA 4V1Ag 3TKPA 1QMVA 3TRQA 1M0UA 3H8QA 4KSMA 2XBQA 2ZNMA 4MF7A 5F8BA 4ZL7A 3HHVA 1ZGNA 2YCDA 3UEMA 1EOHA 2GVPA 4MDCA 2HZFA 4ZB9A 4NV2A 1TI1A 1THXA 3I43A 4G10A 3EINA 1KNGA 2PU9C 4PTSA 3SBCA 2GQLA 4KF9A 4XS4B 6GSWA 2WRTA 3L9UA 2H1BA 2H0GA 2P5RA 2WB9A 5KN0A 2EIOA 2VOCA 4EUYA 1WRYA 1ZYNA 4MH2A 1GUKA 1TOFA 1ERTA 4HQSA 3HYPA 4JR6A 5GAND 4WR5A 4ZILA 3EMPA 3TOTA 2X8GA 4HJMA 2WS2A 3P90A 1M7TA 5ECKB 2YPMA 4WEYA 3WGEA 4FIWA 2R6KA 4YKFA 3WGDA 2NBSA 4HOJA 1ABAA 1A2MA 2IMFA 4Z2UA 4TOPA 2PMTA 4BA7A 1PN0A 1SJ6A 1FVKA 4HDEA 3UOMA 2MMNA 1K0OA 1OVNA 3EU3A 5HR1A 3NIVA 2H19A 5H5QA 1GH2A 3MAKA 1OYJA 4I5QA 3W8SA 2R37A 4KE3A 3CTFA 1Z5YE 3CXGA 3A2VA 3S9FA 4P3YB 1VRSD 3MWHA 3D4MA 4ILFA 4TXVA 4V2NA 2HLSA 3KJYA 3APOA 4AJ8A 4K9ZA 1ZL9A 2VCWA 2HRFA 2X4AA 1PL1A 4Z2TA 2MBSA 2WFCA 1UA5A 3O6TA 2H1GA 1V98A 1LBKA 1VF2A 2H76A 2H74A 2I3YA 2YP6A 4Z7XA 5G30A 5A5KA 4KUNA 2KHPA 2CVKA 2V32A 3KZQA 2AHEA 5ECSA 3GL5A 3GA4A 5B8BA 3UVHA 19GSA 4ZL9A 3VWVA 1YF0A 5DDLA 1GLQA 3ZVJA 4PQIA 4ML6A 1HNCA 1FO5A 4CHSA 1WMJA 1V58A 5J3RA 3C1RA 4HU7A 2QKEA 1JZDA 3KEBA 2GT6A 2Z9SA 1ZMAA 5ENUA 4D73A 1MTCA 2A2PA 2F8AA 5IO0A 1X9MB 3GX0A 5HR2A 2HNLA 2DJ0A 3HVSA 3N5OA 4ACSA 5FT3A 2YJHA 2IWTA 3TUEA 4OCEA 3WT1A 2WULA 1ACVA 2I4AA 3A5WA 1O73A 1TU8A 5ECPB 1EP8A 2FGXA 4IQ1A 1Z3EA 3HVVA 5ECOB 5H5RA 1TP9A 4MMMA 2GZZA 1GL8A 2RUEA 4GCIA 3C7MA 4POBA 1F3AA 4HU9A 2L4CA 5E59A 4YAVA 4K7NA 1WP0A 5LNKe 2B7JA 3IR4A 4I6XA 5DVBA 2JADA 1XIYA 1TRUA 4DSQA 1SKSB 3HD5A 1BAYA 7GSSA 5D8IA 2C0GA 5KOWA 5E4WA 1AUCA 4MABA 3TB2A 1OKDA 2FA4A 4L5LA 2YWOA 4ECJA 4K8MA 3ISOA 1JLWA 2HXKA 3EC3A 4EIQA 3MIXA 2N5AA 4JBBA 1ILOA 2L57A 4KW6A 4PUAA 3APSA 1FOVA 4WBRD 1PSQA 2DJJA 5AIXA 1NHYA 1T1VA 13GSA 3DD3A 3HZ4A 1XXUA 1MEKA 1X5DA 5J5NA 3V1WA 4XS4A 3ZTLA 3EYTA 1GULA 2YV7A 2H73A 2RLIA 18GSA 4BPYA 3CRTA 1GSFA 1ZYPA 1NSWA 3FEUA 2R5GA 5JWQB 5H5SA 4IHUA 2RUFA 5CP1A 3VPQA 1OKTA 2DJ2A 2H30A 3U5RE 2PWJA 1F2EA 2LSTA 3IHGA 2GQMA 2V2GA 4WETA 2WDUA 5J41A 2V6KA 3ZIJA 5L71A 2DMMA 4YQVA 2H72A 3KIJA 2YJ7A 3CMIA 1EOGA 3BCIA 4ZBDA 4GTUA 4POLA 4MF6A 4MJBA 1AAZA 4XRDA 1WOUA 4MNNA 2R4VA 3FYGA 3DEXA 3G7YA 4POKA 1G6YA 2FUG2 4EIPA 1A2JA 3EMXA 2DBCA 2FLSA 5F0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XW5 A;  1C72 A;  3IOS A;  1YQ1 A;  4GQF A;  1O85 A;  4TR1 B;  1K3Y A;  4ULX A;  1VGL A;  1KTE A;  4PQ1 A;  3WT2 A;  5ECN B;  2DML A;  3F0I A;  1YF1 A;  1BED A;  3TKQ A;  5IMD A;  2V6O A;  3LWA A;  3RPP A;  2NVL A;  1M9B A;  2C3T A;  1K0D A;  1N8J A;  2VL2 C;  1PGT A;  1A8L A;  4PQH A;  2HRN A;  1K0A A;  4TXO A;  2OE1 A;  2IME A;  1FB6 A;  1YKC A;  4OFT A;  3KCM A;  3BD2 A;  4LL4 B;  4GLT A;  2H0I A;  1XOA A;  1QUW A;  2MMZ A;  3CSJ A;  3L78 A;  1BG5 A;  4LMW A;  3KP8 A;  1ML6 A;  4CW9 A;  5FWG A;  4ZBB A;  1R5P A;  1OC9 B;  2H01 A;  17GS A;  1JLV A;  3H1N A;  1M99 A;  1XPV A;  4ECI A;  1JHB A;  2H71 A;  1ZZY A;  3UBL A;  2NDO A;  2FD3 A;  3TOU A;  2VLV A;  4PUR A;  4ZB6 A;  5IMA A;  10GS A;  4GWR A;  4TRX A;  2TRX A;  4QQ7 A;  2LRC A;  2F8F A;  2C3N A;  2KP1 A;  4X43 A;  4YH2 A;  3ZIV A;  5LCZ A;  5GST A;  6GST A;  2P31 A;  1GTI A;  3Q19 A;  4D73 B;  1URM A;  5ECI B;  2GSQ A;  3HZ8 A;  1TK5 B;  2LJA A;  2BTO T;  2ZCT A;  2REM A;  3FZ5 A;  3H4K A;  4L5O A;  2O8V B;  4IJI A;  2OAC A;  1DE1 A;  4LL1 B;  2DJ3 A;  1YDK A;  2HSH A;  5IPG A;  2GGT A;  3HJO A;  2CVD A;  3HXS A;  16GS A;  5CO3 A;  1PX7 A;  1LU4 A;  4K0N A;  5DAL A;  3DKS A;  2V41 A;  3KTB A;  1T4Y A;  1GSD A;  2GDR A;  5JCG A;  2VO4 A;  3IRA A;  1VF3 A;  4XS1 A;  4X0X A;  1PKZ A;  2FWG A;  4K7O A;  1GP1 A;  3KMO A;  5COH A;  1K0N A;  5DCH A;  4RQX A;  2AV4 A;  3IC4 A;  20GS A;  3PGT A;  1O8W A;  4ZB8 A;  1VF4 A;  1ERU A;  1GTB A;  3F4S A;  4V2M A;  3IDV A;  3F9U A;  4HJ2 A;  1MDK A;  2CX3 A;  1A0R P;  1O7U A;  4XTS A;  3QFB C;  2DJ1 A;  3CBU A;  3GRX A;  1TTZ A;  1YJ6 A;  5JCW A;  2MBT A;  2YNX A;  3PR8 A;  1TKD B;  1O8X A;  1AXD A;  2JL4 A;  3TCO A;  2E2G A;  4JZQ A;  2GZP A;  2QC7 A;  4RI7 A;  4EDZ A;  1Q98 A;  4Q5F A;  4ZXG A;  3F3Q A;  2PBJ A;  5DQS A;  3N9J A;  3GST A;  4ISD A;  5D96 A;  3GH6 A;  1YY7 A;  1ZCP A;  5DJL A;  3QFA C;  1AQV A;  2F3M A;  4TR1 A;  1SU9 A;  5B7C A;  4CDO A;  2IL3 A;  2VCT A;  3I6A A;  2VAF A;  2X99 A;  4GF0 A;  1X5E A;  4HZ4 A;  5EL8 A;  4HEA 2;  4OWY A;  3M8N A;  2PUK C;  4ZBA A;  2XHF A;  2TIR A;  5IIZ A;  1PKW A;  2FCH A;  3IBH A;  2JAC A;  1M9A A;  3RAZ A;  2CAQ A;  5KN1 A;  4FO5 A;  2K8S A;  2GS3 A;  2VM1 A;  2HT9 A;  4KX4 A;  1OC9 A;  3RBT A;  1V57 A;  3IE3 A;  3PIN A;  5ECM B;  3FR3 A;  2J9H A;  4E8E A;  3GKK A;  1SD9 A;  3GKN A;  3M9J A;  4O92 A;  5JWR B;  4HQZ A;  5CYY A;  4JE1 A;  1XWB A;  3IA1 A;  2H8L A;  4TR4 A;  3KD0 A;  2AYT A;  4FH8 A;  3GFK A;  3GMF A;  1B9Y C;  1SK2 A;  2C0E A;  4TXO B;  3NOF A;  4XIH A;  5A4V A;  2J23 A;  3WYW A;  1YEX A;  3IHQ A;  3O3T A;  4MP4 A;  3GKX A;  2EC4 A;  3GUR A;  2L5O A;  3FR6 A;  4RUV A;  3GIX A;  4OD7 A;  2RM5 A;  1VF1 A;  4GXZ A;  2C0D A;  4ECC A;  1W89 A;  3O76 A;  2FNO A;  1A0F A;  4AF2 A;  1M2A A;  4WF4 A;  3L0H A;  2VCX A;  3HA9 A;  4OO4 A;  2G0F A;  3GTU B;  1MD3 A;  1FVJ A;  4KND A;  4GRF A;  3LQ7 A;  2N5B A;  4K1F A;  1QK8 A;  3IK9 A;  3F3R A;  4MA9 A;  3TKS E;  4RQR A;  2L6C A;  5A4U A;  2RII A;  4QL9 A;  3G7I A;  2L59 A;  2D2Z A;  2FWE A;  1NHO A;  1DSB A;  4TN8 A;  1IYH A;  1GNW A;  3UIW A;  2IPA A;  4WBJ A;  3UJ1 A;  2DIY A;  1Z7R A;  2YN1 A;  4KDU A;  2FA8 A;  1TK0 B;  4YAP A;  2GSR A;  3TJB A;  3FW2 A;  1MD4 A;  2HE3 A;  1Q4J A;  4BVX A;  2H6Y A;  1SL1 B;  4DSS A;  1G7O A;  1J08 A;  2GLR A;  2CAI A;  3D5J A;  1EEM A;  2MZC A;  1BX9 A;  3UBK A;  2GZY A;  4MZB A;  3G7J A;  1SYX A;  2B5Y A;  1J0F A;  5ECL B;  3ED3 A;  5CRH A;  3J7Y k;  4Q5N A;  2GQK A;  3UVT A;  2K18 A;  1BYE A;  3ME7 A;  1O81 A;  1GRX A;  3WD6 A;  3VLN A;  4ZIJ A;  3QD9 A;  1XWK A;  2KP2 A;  2HYX A;  3DYR A;  3A2W A;  3IAS 2;  4KAE A;  5DAL B;  4L8E A;  2DSA A;  1G0T A;  1WJK A;  6GSV A;  5HR3 A;  3W6G A;  3L4N A;  4O32 A;  4V1A p;  2KUC A;  1SYR A;  1GLP A;  2DC5 A;  1PN9 A;  2PER A;  1EWX A;  4N30 A;  2H6X A;  2QSI A;  3VWU A;  3VFI A;  2B1K A;  4XHM A;  3IK7 A;  3R2Q A;  4F0B A;  2B6M A;  2C1Y A;  5AN1 A;  1U3I A;  3L9S A;  5KEJ A;  4OCF A;  3LG6 A;  2L4Q A;  4HS1 A;  1V40 A;  2F9S A;  3IAM 2;  3ZL5 A;  3TJJ A;  3DWV A;  4EXJ A;  4N0V A;  5DQY A;  4Q5Q A;  4LMV A;  3KGK A;  3VPT A;  2PVQ A;  3M0F A;  2M80 A;  4TKY A;  1SJZ A;  4IN0 A;  1QFN A;  4XRA A;  2L6D A;  1A24 A;  3VI7 A;  2O87 A;  2WCI A;  2NPB A;  4NHW A;  3TKR A;  3Q6O A;  2F51 A;  5F06 A;  14GS A;  4IBP A;  4OFM A;  1YKA A;  3ZRE A;  1V2A A;  4PNF A;  4G19 A;  2MYG A;  3QPM A;  4PGT A;  1F9M A;  1MDI A;  3E0U A;  1ERV A;  1H4O A;  2X8H A;  4OO5 A;  3LGC A;  1TXX A;  3GL3 A;  2P0G A;  5IMZ A;  3DRN A;  1XOB A;  5IM9 A;  2M72 A;  3D21 A;  1QQ2 A;  1V9W A;  4EKZ A;  4MJA A;  2FY6 A;  2VCV A;  3J7Y b;  1LJR A;  6GSS A;  3KH7 A;  3E9J B;  3ZFL A;  1HD2 A;  2C0F A;  4WKW A;  4KDY A;  4POM A;  2LEG A;  1DBY A;  4IS0 A;  4IVF A;  3FHK A;  2DLX A;  1R5A A;  2R2J A;  1M2D A;  4FYB A;  1Z6M A;  2I1U A;  1CQG A;  2JSY A;  2LQQ A;  2LQO A;  4EL1 A;  4GST A;  4K6X A;  3GTU A;  3OR5 A;  2PPT A;  2AUV A;  3QDN A;  3FRC A;  3EU4 A;  4KGI A;  4OFN A;  3EWL A;  2VM2 A;  3CYN A;  5IOW A;  2OA7 A;  1XCC A;  3HVX A;  5D9X A;  1K3O A;  4MF5 A;  1PMT A;  3ZFB A;  3H93 A;  1EGO A;  1J9B A;  2ZUP A;  1XVQ A;  1Y6E A;  2M46 A;  2CVB A;  3D0Z A;  4G9H A;  5D9T A;  5HFI A;  1GSE A;  1QGV A;  3M9K A;  2VL2 A;  3IPZ A;  3MNG A;  2VL9 A;  3A2X A;  3M3M A;  5B6N A;  4NMU A;  5ID2 A;  2JZR A;  4F82 A;  1YEP A;  2O89 A;  1USB A;  1XBS A;  2EIR A;  4XCS A;  4YQU A;  2B7K A;  5KN3 A;  2A2S A;  4MJE A;  4DVC A;  3QAW A;  11GS A;  1OE7 A;  5IMV A;  5IMF A;  5AIV A;  3TJG A;  2C8U A;  4E8H A;  4JU5 A;  4TW5 A;  4JRR A;  4EO3 A;  5ECH B;  2XBI A;  3LXZ A;  4IP1 A;  4ZL8 A;  3QMX A;  1QXH A;  2ALB A;  3K8N A;  4KDX A;  2DIZ A;  2LS5 A;  3NZN A;  4F03 A;  1EV9 A;  1B48 A;  1XWG A;  2E7P A;  2TRC P;  2HZE B;  3MDK A;  1WE0 A;  2XPE A;  3D4T A;  3UAR A;  1EEJ A;  2IFQ A;  5EPF A;  1XVW A;  2B5X A;  3M1G A;  3C71 A;  8GSS A;  2I9H A;  3EE2 A;  1SK1 A;  1HNB A;  2E2M A;  4DSS B;  5D9V A;  5G1K A;  3CTG A;  4O7H A;  2VD1 A;  2YWM A;  1S3A A;  5CNW A;  1XZO A;  1U88 A;  2NTO A;  3DGQ A;  3HY2 A;  4GSS A;  3QOU A;  4EC0 A;  4BL7 A;  3EVI A;  2X64 A;  3QCP A;  2A2R A;  2C80 A;  4MK3 A;  4EF0 A;  3KP9 A;  2P5Q A;  2CX4 A;  4Q5R A;  1GTA A;  1E6B A;  2H6Z A;  2CQ9 A;  1DE2 A;  3P7X A;  4BWQ A;  4IQA A;  1K0B A;  5G1L A;  3LSZ A;  1I5G A;  2MMA A;  2AJQ B;  4IP6 A;  2YWN A;  1T00 A;  1SK0 A;  3Q18 A;  3BOA A;  4LLR A;  1F6M C;  1WPI A;  2PN8 A;  3FY7 A;  2HSY A;  1TRW A;  3ERF A;  1XW6 A;  3ERG A;  1PD2 1;  3G9B A;  3VK9 A;  2OAD A;  4KA0 A;  4J56 E;  4F9Z A;  1ZYQ B;  1U6T A;  4DSR A;  1SL0 B;  2AAW A;  2HFD A;  5DBQ A;  2YV9 A;  1Z9H A;  2GTU A;  1WIK A;  1X9W B;  4LA1 A;  5G5E A;  1MDJ A;  5AGY A;  3QR6 A;  2B3S A;  1SKR B;  2H70 A;  3FZ4 A;  3ZRD A;  3VWX A;  4MPF A;  1X5C A;  3CSH A;  2MMO A;  1SJI A;  5C00 A;  1Y25 A;  1R26 A;  4FYC A;  1RQM A;  2ES7 A;  3GNJ A;  3LJR A;  2VUP A;  3GUS A;  9GSS A;  4I8B A;  2I81 A;  3QAG A;  2B5E A;  3DXB A;  3ME8 A;  4K0G A;  3P2A A;  22GS A;  2K8V A;  2WJU A;  4HUA A;  1XFL A;  1B4P A;  3UL3 A;  4NPB A;  1SL2 B;  3F4T A;  1BQ7 A;  3ERW A;  4XS6 A;  2ON7 A;  2QGV A;  5CRD A;  4PNG A;  1KEB A;  2LRT A;  4N10 A;  1PQN A;  1K0M A;  3C73 A;  4TVE A;  1GSS A;  2JZT A;  1GSQ A;  1EV4 A;  1K0C A;  2BMX A;  4IGJ A;  1XWA A;  1T4Z A;  1SKW B;  5DAK B;  5J4U A;  3AY8 A;  1OAZ A;  4K7I A;  1PX6 A;  3GYK A;  4N0Z A;  1SEN A;  5DCG A;  4ECB A;  2VLT A;  3KH9 A;  3GHA A;  3CSI A;  5EVO A;  4L0W A;  3DVW A;  2K9F A;  2LUS A;  3APQ A;  3DML A;  4IJ3 A;  1JZW A;  5JCU A;  4I2U A;  2OJL A;  3TGZ A;  5HR0 A;  3DVX A;  2YOI A;  1OC8 A;  4F0C A;  5ECR B;  4J2F A;  3LFL A;  3U6V A;  5GZZ B;  2X8C A;  4RI6 A;  5ELA A;  2FWH A;  1AQX A;  1RK4 A;  3LOR A;  2WGR A;  1E2Y A;  1GWC A;  5J9C A;  3FR9 A;  4KCE A;  2HZE A;  4GSN A;  3RHB A;  5GSS A;  1T8E B;  5ID2 B;  5INY A;  1GSU A;  3KXO A;  1OC3 A;  1TRV A;  3QAV A;  1U3A A;  1AQW A;  1XW9 A;  3UAP A;  3C1S A;  3GSS A;  4AJ7 A;  4QL7 A;  5IO2 A;  1Z7P A;  2IMI A;  4TR0 A;  1R4W A;  3JCM L;  1N2A A;  5CRW A;  2CV4 A;  2EIQ A;  3GV1 A;  3PH9 A;  1YZX A;  5G2Z A;  2ON5 A;  1XWC A;  2VL3 A;  4EE0 A;  3F4R A;  5G5F A;  2PGT A;  1FAA A;  3ZLP A;  4MLY A;  5LD0 A;  3D6I A;  1T3B A;  1W4V A;  1A2L A;  2YZU A;  2VIM A;  4IW9 A;  1FHE A;  2OE0 A;  4JR4 A;  1NM3 A;  3BBY A;  4ID0 A;  1GNE A;  2H1A A;  2LTK A;  2IFQ B;  2KLX A;  5IMC A;  3DIE A;  3ZYW A;  2LNS A;  4I97 A;  4BWS A;  1H75 A;  2VD0 A;  4NHZ A;  1F3B A;  5D73 A;  2WZ9 A;  2IMD A;  5A4W A;  1K3L A;  1F37 A;  4JED A;  6GSY A;  3KTL A;  4OMV A;  1R7H A;  5JWO B;  3SWL A;  3ZMK A;  4L0U A;  1GTU A;  1HYU A;  4J57 E;  4V2L A;  2H1D A;  2G2Q A;  1DUG A;  3BJ5 A;  5ABR A;  4AJ6 A;  2YAN A;  5D9W A;  1TK8 B;  2BJX A;  3RDW A;  4KSO A;  1TDI A;  5D93 A;  2A4V A;  2JSZ A;  2CZ2 A;  2L5L A;  4O5R A;  5B8A A;  3IXR A;  3L9V A;  2RM6 A;  5DJM A;  3TJF A;  3KMN A;  4KH7 A;  1X9S B;  3RHC A;  5CAX A;  1A23 A;  3LEF A;  2JZS A;  1M2B A;  5IPH A;  2K6V A;  3LXT A;  5KN2 A;  1SD8 A;  4EVM A;  3TDG A;  5C04 A;  3ZIT A;  3BCK A;  2YZH A;  3UMA A;  3Q74 A;  2YWI A;  1HQO A;  5G31 A;  2OBI A;  1AW9 A;  1RW1 A;  2XPD A;  2H75 A;  2OKA A;  3GKM A;  4ML1 A;  3EUR A;  3IV4 A;  5CRE A;  1A8Y A;  1UVZ A;  4PUF C;  1UC7 A;  1THO A;  2LJK A;  1PA3 A;  3VWW A;  1BJX A;  2DJK A;  4DEJ A;  2KOK A;  2IJY A;  1T7P B;  2H0H A;  4HI7 A;  2CT6 A;  12GS A;  2LJR A;  3WGX A;  2O85 A;  1S3D A;  1TJD A;  4AGS A;  4NAX A;  4K2D A;  5DAK A;  3D22 A;  3LYP A;  2H66 A;  1S3C A;  2IN3 A;  2LV3 A;  1PRX A;  1EZK A;  1JZR A;  1ZYE A;  3KM6 A;  3VUR A;  4MJC A;  3CRU A;  1OE8 A;  2O7K A;  4X1U A;  1GUM A;  5IQY A;  3RPN A;  1FB0 A;  3ZML A;  3FZ9 A;  4IKH A;  1TRS A;  2LKU A;  1EP7 A;  3GX8 A;  2GT5 A;  5GAP D;  4WF5 A;  2LRN A;  4KB3 A;  1WWJ A;  4G2E A;  4KCA A;  5B6M A;  2B1L A;  1U87 A;  2HI7 A;  1EGR A;  4YQM A;  3LYK A;  5EY6 A;  3P8W A;  1HNA A;  3ZZX A;  1B4Q A;  3TKS C;  1UN2 A;  2LNT A;  2VLU A;  2VCQ A;  4HZ2 A;  2VCZ A;  4MZW A;  3F6F A;  5ELG A;  3TJK A;  2OBK A;  1JZO A;  3F8U A;  1G6W A;  5J9B A;  2C3Q A;  1GUH A;  2FWF A;  4NWY A;  3I69 A;  1IYI A;  3FK8 A;  3W8J A;  4I2T A;  2IMK A;  1AIU A;  3VI5 A;  2IIY A;  2C4J A;  1KBN A;  3HJM A;  3A3T A;  1ZOF A;  3HDC A;  4GQC A;  3FKF A;  5F05 A;  4NXI A;  2CA8 A;  2N5F A;  5CRG A;  4EDY A;  4F2I A;  4N11 A;  5F07 A;  4FYU A;  4PXO A;  2PVO C;  1X0R A;  1B8X A;  1TW9 A;  3GH9 A;  6GSU A;  1JFU A;  1B9X C;  4WXT A;  2V1M A;  3ZVJ D;  4WR4 A;  1TU7 A;  4MZC A;  3C8E A;  2JU5 A;  2CZ3 A;  2E0Q A;  3MSZ A;  2GST A;  1FW1 A;  1I9D A;  3H79 A;  1O6J A;  1ERW A;  4MH3 A;  4H86 A;  6GSX A;  1PL2 A;  3TKS A;  5HQP A;  4IEL A;  1TI3 A;  3HCZ A;  1ST9 A;  4MPG A;  3TRX A;  3F63 A;  4MCU A;  3E3E A;  4PX1 A;  2AB6 A;  5AIS A;  1FG4 A;  5IOX A;  3HKR A;  2XC2 A;  5FHI A;  5HFK A;  3TRP A;  5ECQ B;  1ON4 A;  3US3 A;  2FHE A;  4BVY A;  4NV5 A;  1G7E A;  1NW2 A;  1GSY A;  3I9V 2;  1CQH A;  1Z6N A;  3F6D A;  4TR3 A;  3FZA A;  5HFG A;  2GSS A;  3GN3 A;  2OE3 A;  1AC1 A;  3HJP A;  2R3X A;  4V1A g;  3TKP A;  1QMV A;  3TRQ A;  1M0U A;  3H8Q A;  4KSM A;  2XBQ A;  2ZNM A;  4MF7 A;  5F8B A;  4ZL7 A;  3HHV A;  1ZGN A;  2YCD A;  3UEM A;  1EOH A;  2GVP A;  4MDC A;  2HZF A;  4ZB9 A;  4NV2 A;  1TI1 A;  1THX A;  3I43 A;  4G10 A;  3EIN A;  1KNG A;  2PU9 C;  3SBC A;  2GQL A;  4XS4 B;  6GSW A;  2WRT A;  3L9U A;  2H1B A;  2H0G A;  2P5R A;  2WB9 A;  5KN0 A;  2EIO A;  2VOC A;  4EUY A;  1WRY A;  4MH2 A;  1GUK A;  1TOF A;  1ERT A;  4HQS A;  3HYP A;  4JR6 A;  5GAN D;  4WR5 A;  4ZIL A;  3EMP A;  3TOT A;  2X8G A;  4HJM A;  2WS2 A;  3P90 A;  1M7T A;  5ECK B;  2YPM A;  4WEY A;  3WGE A;  4FIW A;  2R6K A;  3WGD A;  2NBS A;  4HOJ A;  1ABA A;  1A2M A;  2IMF A;  4TOP A;  2PMT A;  4BA7 A;  1SJ6 A;  1FVK A;  4HDE A;  3UOM A;  2MMN A;  1K0O A;  1OVN A;  3EU3 A;  5HR1 A;  3NIV A;  2H19 A;  5H5Q A;  1GH2 A;  3MAK A;  1OYJ A;  4I5Q A;  3W8S A;  2R37 A;  4KE3 A;  3CTF A;  1Z5Y E;  3CXG A;  3A2V A;  3S9F A;  4P3Y B;  1VRS D;  3MWH A;  3D4M A;  4ILF A;  4TXV A;  4V2N A;  2HLS A;  3KJY A;  3APO A;  4AJ8 A;  4K9Z A;  1ZL9 A;  2VCW A;  2HRF A;  1PL1 A;  2MBS A;  2WFC A;  1UA5 A;  3O6T A;  2H1G A;  1V98 A;  1LBK A;  1VF2 A;  2H76 A;  2H74 A;  2I3Y A;  2YP6 A;  4Z7X A;  5G30 A;  5A5K A;  4KUN A;  2KHP A;  2CVK A;  2V32 A;  3KZQ A;  2AHE A;  5ECS A;  3GL5 A;  3GA4 A;  5B8B A;  3UVH A;  19GS A;  4ZL9 A;  3VWV A;  1YF0 A;  5DDL A;  1GLQ A;  3ZVJ A;  4PQI A;  4ML6 A;  1HNC A;  1FO5 A;  4CHS A;  1WMJ A;  1V58 A;  5J3R A;  3C1R A;  4HU7 A;  2QKE A;  1JZD A;  3KEB A;  2GT6 A;  2Z9S A;  1ZMA A;  5ENU A;  4D73 A;  1MTC A;  2F8A A;  5IO0 A;  1X9M B;  3GX0 A;  5HR2 A;  2HNL A;  2DJ0 A;  3HVS A;  3N5O A;  4ACS A;  5FT3 A;  2YJH A;  2IWT A;  3TUE A;  4OCE A;  3WT1 A;  2WUL A;  1ACV A;  2I4A A;  3A5W A;  1O73 A;  1TU8 A;  5ECP B;  1EP8 A;  2FGX A;  4IQ1 A;  1Z3E A;  3HVV A;  5ECO B;  5H5R A;  1TP9 A;  4MMM A;  2GZZ A;  1GL8 A;  2RUE A;  4GCI A;  3C7M A;  4POB A;  1F3A A;  4HU9 A;  2L4C A;  5E59 A;  4YAV A;  4K7N A;  1WP0 A;  5LNK e;  2B7J A;  3IR4 A;  4I6X A;  5DVB A;  2JAD A;  1XIY A;  1TRU A;  4DSQ A;  1SKS B;  3HD5 A;  1BAY A;  7GSS A;  5D8I A;  2C0G A;  5E4W A;  1AUC A;  4MAB A;  3TB2 A;  1OKD A;  2FA4 A;  4L5L A;  2YWO A;  4ECJ A;  4K8M A;  3ISO A;  1JLW A;  2HXK A;  3EC3 A;  2N5A A;  4JBB A;  1ILO A;  2L57 A;  4KW6 A;  4PUA A;  3APS A;  1FOV A;  4WBR D;  1PSQ A;  2DJJ A;  5AIX A;  1NHY A;  1T1V A;  13GS A;  3DD3 A;  3HZ4 A;  1XXU A;  1MEK A;  1X5D A;  5J5N A;  3V1W A;  4XS4 A;  3ZTL A;  3EYT A;  1GUL A;  2YV7 A;  2H73 A;  2RLI A;  18GS A;  4BPY A;  3CRT A;  1GSF A;  1NSW A;  3FEU A;  2R5G A;  5JWQ B;  5H5S A;  4IHU A;  2RUF A;  5CP1 A;  3VPQ A;  1OKT A;  2DJ2 A;  2H30 A;  3U5R E;  2PWJ A;  1F2E A;  2LST A;  2GQM A;  2V2G A;  4WET A;  2WDU A;  5J41 A;  2V6K A;  3ZIJ A;  5L71 A;  2DMM A;  4YQV A;  2H72 A;  3KIJ A;  2YJ7 A;  3CMI A;  1EOG A;  3BCI A;  4ZBD A;  4GTU A;  4POL A;  4MF6 A;  4MJB A;  1AAZ A;  4XRD A;  1WOU A;  2R4V A;  3FYG A;  3DEX A;  3G7Y A;  4POK A;  1G6Y A;  2FUG 2;  1A2J A;  3EMX A;  2DBC A;  2FLS A;  5F0G A; 
#chains in the Genus database with same CATH topology
 1XW5 A;  1C72 A;  3IOS A;  1YQ1 A;  4GQF A;  1O85 A;  4TR1 B;  1K3Y A;  4ULX A;  1VGL A;  1KTE A;  4PQ1 A;  3WT2 A;  5ECN B;  2DML A;  3F0I A;  1YF1 A;  1BED A;  3TKQ A;  5IMD A;  2V6O A;  3LWA A;  3RPP A;  2NVL A;  1M9B A;  2C3T A;  1K0D A;  1N8J A;  2VL2 C;  1PGT A;  1A8L A;  4PQH A;  2HRN A;  4Z2R A;  1K0A A;  4TXO A;  2OE1 A;  2IME A;  1FB6 A;  1YKC A;  4OFT A;  3KCM A;  3BD2 A;  4LL4 B;  4GLT A;  2H0I A;  1XOA A;  1QUW A;  2MMZ A;  3CSJ A;  3L78 A;  1BG5 A;  4LMW A;  3KP8 A;  1ML6 A;  4CW9 A;  5FWG A;  4ZBB A;  1R5P A;  1OC9 B;  2H01 A;  17GS A;  1JLV A;  3H1N A;  1M99 A;  1XPV A;  4ECI A;  1JHB A;  2DKI A;  2H71 A;  1ZZY A;  3UBL A;  2NDO A;  2FD3 A;  3TOU A;  2VLV A;  4PUR A;  4ZB6 A;  5IMA A;  10GS A;  4O5U A;  4GWR A;  4TRX A;  2TRX A;  4QQ7 A;  2LRC A;  2F8F A;  2C3N A;  2KP1 A;  2HRK A;  4X43 A;  4YH2 A;  3ZIV A;  5LCZ A;  5GST A;  6GST A;  2P31 A;  1GTI A;  3Q19 A;  4D73 B;  1URM A;  5ECI B;  2GSQ A;  3HZ8 A;  1TK5 B;  2LJA A;  2BTO T;  2ZCT A;  2REM A;  3FZ5 A;  3H4K A;  4L5O A;  2O8V B;  4IJI A;  2OAC A;  1DE1 A;  4LL1 B;  2DJ3 A;  1YDK A;  2HSH A;  5IPG A;  2GGT A;  3HJO A;  2CVD A;  3HXS A;  16GS A;  5CO3 A;  1PX7 A;  1LU4 A;  4K0N A;  5DAL A;  3DKS A;  4K5S A;  2V41 A;  3KTB A;  1T4Y A;  1GSD A;  2GDR A;  5JCG A;  2VO4 A;  3IRA A;  1VF3 A;  4XS1 A;  4X0X A;  1PKZ A;  2FWG A;  4K7O A;  1GP1 A;  3KMO A;  5COH A;  1K0N A;  5DCH A;  4RQX A;  2AV4 A;  3IC4 A;  20GS A;  3PGT A;  1O8W A;  4ZB8 A;  1VF4 A;  1ERU A;  1GTB A;  3F4S A;  4V2M A;  3IDV A;  3F9U A;  4HJ2 A;  1MDK A;  2CX3 A;  1A0R P;  1O7U A;  4XTS A;  3QFB C;  4USS A;  2DJ1 A;  3CBU A;  3GRX A;  1TTZ A;  1YJ6 A;  5JCW A;  2MBT A;  2YNX A;  3PR8 A;  1TKD B;  1O8X A;  1AXD A;  2JL4 A;  3TCO A;  2E2G A;  4JZQ A;  2GZP A;  2QC7 A;  4RI7 A;  4EDZ A;  4Q5F A;  1Q98 A;  4ZXG A;  3F3Q A;  2PBJ A;  5DQS A;  3N9J A;  3GST A;  4ISD A;  5D96 A;  3GH6 A;  1YY7 A;  1ZCP A;  5DJL A;  3QFA C;  1AQV A;  2F3M A;  4TR1 A;  1SU9 A;  5B7C A;  4X4J A;  4CDO A;  2IL3 A;  2VCT A;  3I6A A;  2VAF A;  2X99 A;  4GF0 A;  1X5E A;  4HZ4 A;  5EL8 A;  4HEA 2;  4OWY A;  3M8N A;  2PUK C;  4ZBA A;  2XHF A;  2TIR A;  5IIZ A;  1PKW A;  2FCH A;  3IBH A;  3CQF A;  2JAC A;  1M9A A;  3RAZ A;  2CAQ A;  5KN1 A;  4FO5 A;  2K8S A;  2GS3 A;  2VM1 A;  2HT9 A;  4KX4 A;  1OC9 A;  3RBT A;  1V57 A;  3IE3 A;  3PIN A;  5ECM B;  3FR3 A;  2J9H A;  4E8E A;  3GKK A;  1SD9 A;  3GKN A;  3M9J A;  4O92 A;  5JWR B;  4HQZ A;  2DKH A;  5CYY A;  4JE1 A;  1XWB A;  3IA1 A;  2H8L A;  4TR4 A;  3KD0 A;  2AYT A;  4FH8 A;  3GFK A;  3GMF A;  1B9Y C;  1SK2 A;  4A5P A;  1M3J A;  2X49 A;  2C0E A;  4TXO B;  3NOF A;  4XIH A;  5A4V A;  2J23 A;  3WYW A;  4O5Q A;  1YEX A;  3IHQ A;  3O3T A;  4MP4 A;  3GKX A;  2EC4 A;  3GUR A;  2L5O A;  3FR6 A;  4RUV A;  3GIX A;  4OD7 A;  2RM5 A;  1VF1 A;  4GXZ A;  2C0D A;  4ECC A;  1W89 A;  3O76 A;  2FNO A;  1A0F A;  4AF2 A;  1M2A A;  4WF4 A;  3L0H A;  2VCX A;  3HA9 A;  4OO4 A;  2G0F A;  3GTU B;  1MD3 A;  1FVJ A;  4KND A;  4GRF A;  3LQ7 A;  2N5B A;  4K1F A;  1QK8 A;  3IK9 A;  3F3R A;  4MA9 A;  3TKS E;  4RQR A;  2L6C A;  5A4U A;  2RII A;  4QL9 A;  3G7I A;  2L59 A;  2D2Z A;  2FWE A;  1NHO A;  1DSB A;  4TN8 A;  1IYH A;  1GNW A;  3UIW A;  2IPA A;  4WBJ A;  3UJ1 A;  2DIY A;  1Z7R A;  2YN1 A;  4KDU A;  2FA8 A;  1TK0 B;  4YAP A;  2GSR A;  3TJB A;  4K5R A;  3FW2 A;  1MD4 A;  2HE3 A;  1Q4J A;  4BVX A;  2H6Y A;  1SL1 B;  2R0P A;  4DSS A;  1G7O A;  1J08 A;  2GLR A;  2CAI A;  3D5J A;  1EEM A;  2MZC A;  1BX9 A;  3UBK A;  2GZY A;  4MZB A;  3G7J A;  1SYX A;  3EPT A;  2B5Y A;  1J0F A;  5ECL B;  3ED3 A;  5CRH A;  3J7Y k;  4Q5N A;  2GQK A;  3UVT A;  2K18 A;  1BYE A;  3ME7 A;  1O81 A;  1GRX A;  3WD6 A;  3VLN A;  4ZIJ A;  3QD9 A;  1XWK A;  2KP2 A;  2HYX A;  3DYR A;  3A2W A;  3IAS 2;  4KAE A;  5DAL B;  4L8E A;  2DSA A;  1G0T A;  1WJK A;  6GSV A;  5HR3 A;  3W6G A;  3L4N A;  2HRA A;  4O32 A;  4V1A p;  2KUC A;  1SYR A;  1GLP A;  2DC5 A;  1PN9 A;  2PER A;  1EWX A;  4N30 A;  2H6X A;  2QSI A;  3VWU A;  3VFI A;  2B1K A;  4XHM A;  3IK7 A;  3R2Q A;  4F0B A;  2B6M A;  2C1Y A;  5AN1 A;  1U3I A;  3L9S A;  5KEJ A;  2UZ8 A;  4OCF A;  3LG6 A;  1S3R A;  2L4Q A;  4HS1 A;  1V40 A;  2F9S A;  3IAM 2;  3ZL5 A;  3TJJ A;  3DWV A;  4EXJ A;  4N0V A;  4G0I A;  5DQY A;  4Q5Q A;  4LMV A;  3KGK A;  3VPT A;  2PVQ A;  3M0F A;  2M80 A;  4TKY A;  1SJZ A;  4IN0 A;  1QFN A;  4XRA A;  2L6D A;  1A24 A;  3VI7 A;  2O87 A;  2WCI A;  2NPB A;  4NHW A;  3TKR A;  3Q6O A;  2F51 A;  5F06 A;  14GS A;  4IBP A;  4OFM A;  1YKA A;  3ZRE A;  1V2A A;  4PNF A;  4G19 A;  2MYG A;  3QPM A;  4PGT A;  1F9M A;  1MDI A;  3E0U A;  1ERV A;  1H4O A;  2X8H A;  4OO5 A;  3LGC A;  1TXX A;  3GL3 A;  2P0G A;  5IMZ A;  3DRN A;  1XOB A;  5IM9 A;  2M72 A;  3D21 A;  1QQ2 A;  1V9W A;  4EKZ A;  4MJA A;  2FY6 A;  4CY8 A;  2VCV A;  3J7Y b;  1LJR A;  6GSS A;  3KH7 A;  3E9J B;  3ZFL A;  1HD2 A;  2C0F A;  4WKW A;  4KDY A;  4POM A;  2LEG A;  1DBY A;  4IS0 A;  4IVF A;  3FHK A;  2DLX A;  1R5A A;  2R2J A;  1M2D A;  4FYB A;  1Z6M A;  2I1U A;  1CQG A;  2JSY A;  2LQQ A;  2LQO A;  4EL1 A;  4GST A;  4K6X A;  3GTU A;  3OR5 A;  2PPT A;  2AUV A;  3QDN A;  3FRC A;  3EU4 A;  4KGI A;  4OFN A;  3EWL A;  2VM2 A;  3CYN A;  5IOW A;  2OA7 A;  1XCC A;  3HVX A;  5D9X A;  1K3O A;  4MF5 A;  1PMT A;  3ZFB A;  3H93 A;  1EGO A;  1J9B A;  2ZUP A;  1XVQ A;  1Y6E A;  2M46 A;  2CVB A;  3D0Z A;  4G9H A;  5D9T A;  5HFI A;  1GSE A;  1QGV A;  3M9K A;  2VL2 A;  3IPZ A;  3MNG A;  2VL9 A;  3A2X A;  3M3M A;  5B6N A;  4NMU A;  5ID2 A;  2JZR A;  4F82 A;  1YEP A;  2QA2 A;  2O89 A;  1USB A;  1XBS A;  2EIR A;  4XCS A;  4YQU A;  2B7K A;  5KN3 A;  2A2S A;  4MJE A;  4DVC A;  3QAW A;  11GS A;  1OE7 A;  5IMV A;  5IMF A;  5AIV A;  3TJG A;  2C8U A;  4YKG A;  4E8H A;  4JU5 A;  4TW5 A;  4JRR A;  4EO3 A;  5ECH B;  2XBI A;  3LXZ A;  4IP1 A;  4ZL8 A;  3QMX A;  1QXH A;  2ALB A;  3K8N A;  4KDX A;  2DIZ A;  2LS5 A;  3NZN A;  4F03 A;  1EV9 A;  1B48 A;  1XWG A;  2E7P A;  2TRC P;  2HZE B;  3MDK A;  1WE0 A;  2XPE A;  3D4T A;  3UAR A;  1EEJ A;  2IFQ A;  5EPF A;  1XVW A;  2B5X A;  3M1G A;  3C71 A;  8GSS A;  2I9H A;  3EE2 A;  1SK1 A;  1HNB A;  2E2M A;  4BVX B;  4DSS B;  5D9V A;  5G1K A;  3CTG A;  4O7H A;  2VD1 A;  2YWM A;  1S3A A;  5CNW A;  1XZO A;  1U88 A;  2NTO A;  3DGQ A;  3HY2 A;  4GSS A;  3QOU A;  4EC0 A;  4BL7 A;  3EVI A;  2X64 A;  3QCP A;  2A2R A;  2C80 A;  4MK3 A;  4EF0 A;  3KP9 A;  2P5Q A;  2CX4 A;  3PPU A;  4Q5R A;  1GTA A;  1E6B A;  2H6Z A;  2CQ9 A;  1DE2 A;  3P7X A;  4BWQ A;  5BMU A;  4IQA A;  1K0B A;  5G1L A;  3LSZ A;  1I5G A;  2MMA A;  2AJQ B;  4IP6 A;  2YWN A;  1T00 A;  1SK0 A;  4CY6 A;  3Q18 A;  3BOA A;  4LLR A;  1F6M C;  1WPI A;  2PN8 A;  3FY7 A;  2HSY A;  1TRW A;  3ERF A;  1XW6 A;  3ERG A;  1PD2 1;  3G9B A;  3VK9 A;  2OAD A;  4KA0 A;  4J56 E;  4F9Z A;  1ZYQ B;  1U6T A;  4DSR A;  1SL0 B;  2AAW A;  2HFD A;  5DBQ A;  2YV9 A;  1Z9H A;  2GTU A;  1WIK A;  1X9W B;  4LA1 A;  5G5E A;  1MDJ A;  5AGY A;  3QR6 A;  2B3S A;  1SKR B;  2H70 A;  3FZ4 A;  3ZRD A;  4ICY A;  3VWX A;  4MPF A;  1X5C A;  3CSH A;  2MMO A;  1SJI A;  5C00 A;  1Y25 A;  1R26 A;  4FYC A;  1RQM A;  2ES7 A;  3GNJ A;  3LJR A;  2VUP A;  3GUS A;  9GSS A;  4I8B A;  2I81 A;  3QAG A;  2B5E A;  3DXB A;  3ME8 A;  4K0G A;  3P2A A;  22GS A;  2K8V A;  2WJU A;  4HUA A;  1XFL A;  1B4P A;  3UL3 A;  4NPB A;  5BRT A;  1SL2 B;  3F4T A;  1BQ7 A;  3ERW A;  4XS6 A;  2ON7 A;  2QGV A;  5CRD A;  4PNG A;  1KEB A;  2LRT A;  4N10 A;  1PQN A;  1K0M A;  3C73 A;  4TVE A;  1GSS A;  2JZT A;  1GSQ A;  1EV4 A;  1K0C A;  2BMX A;  4IGJ A;  1XWA A;  1T4Z A;  1SKW B;  5DAK B;  5J4U A;  3AY8 A;  1OAZ A;  4K7I A;  1PX6 A;  3GYK A;  4N0Z A;  1SEN A;  5DCG A;  4ECB A;  2VLT A;  3KH9 A;  3GHA A;  3CSI A;  5EVO A;  4L0W A;  3DVW A;  2K9F A;  2LUS A;  3APQ A;  3DML A;  4IJ3 A;  1JZW A;  5JCU A;  4I2U A;  2OJL A;  3TGZ A;  5HR0 A;  3DVX A;  2YOI A;  1OC8 A;  4F0C A;  5ECR B;  4J2F A;  3LFL A;  3U6V A;  1PFO A;  5GZZ B;  2X8C A;  4RI6 A;  5ELA A;  1FOH A;  2FWH A;  1AQX A;  1RK4 A;  3LOR A;  2WGR A;  1E2Y A;  1GWC A;  5J9C A;  3FR9 A;  4KCE A;  2HZE A;  4GSN A;  3RHB A;  5GSS A;  1T8E B;  5ID2 B;  5INY A;  1GSU A;  3KXO A;  1OC3 A;  1TRV A;  3QAV A;  1U3A A;  1AQW A;  1XW9 A;  3UAP A;  3C1S A;  3GSS A;  4AJ7 A;  4QL7 A;  5IO2 A;  1Z7P A;  2IMI A;  4TR0 A;  1R4W A;  3JCM L;  1N2A A;  5CRW A;  2CV4 A;  2QA1 A;  2EIQ A;  3GV1 A;  3PH9 A;  1YZX A;  5G2Z A;  2ON5 A;  1XWC A;  2VL3 A;  4EE0 A;  3F4R A;  2HSM A;  5G5F A;  2PGT A;  1FAA A;  3ZLP A;  4MLY A;  5LD0 A;  3D6I A;  1T3B A;  1W4V A;  1A2L A;  2YZU A;  2VIM A;  4IW9 A;  1FHE A;  2OE0 A;  4G0K A;  4JR4 A;  1NM3 A;  3BBY A;  4ID0 A;  1GNE A;  2H1A A;  2LTK A;  2IFQ B;  2KLX A;  5IMC A;  3DIE A;  3ZYW A;  2LNS A;  4I97 A;  4BWS A;  4K2X A;  1H75 A;  2VD0 A;  4NHZ A;  1F3B A;  5D73 A;  2WZ9 A;  2IMD A;  5A4W A;  2A4H A;  1K3L A;  1F37 A;  4JED A;  6GSY A;  3KTL A;  4OMV A;  1R7H A;  3R3E A;  5JWO B;  3SWL A;  3ZMK A;  4L0U A;  1GTU A;  1HYU A;  4J57 E;  4V2L A;  2H1D A;  2G2Q A;  1DUG A;  3BJ5 A;  5ABR A;  4BL7 B;  4AJ6 A;  2YAN A;  5D9W A;  1TK8 B;  2BJX A;  3MYD A;  3RDW A;  4KSO A;  1TDI A;  5D93 A;  2A4V A;  2JSZ A;  4BVY B;  2CZ2 A;  2L5L A;  4O5R A;  2R0C A;  5B8A A;  3IXR A;  3L9V A;  2RM6 A;  5DJM A;  3TJF A;  3KMN A;  4KH7 A;  1X9S B;  3RHC A;  5CAX A;  1A23 A;  3LEF A;  2JZS A;  1M2B A;  5IPH A;  5KOX A;  2K6V A;  3LXT A;  5KN2 A;  1SD8 A;  4EVM A;  3TDG A;  5C04 A;  3ZIT A;  3BCK A;  2YZH A;  3UMA A;  3Q74 A;  2YWI A;  1HQO A;  5G31 A;  2OBI A;  3FMW A;  1AW9 A;  1RW1 A;  2XPD A;  2H75 A;  2OKA A;  3GKM A;  4ML1 A;  3EUR A;  3IV4 A;  5CRE A;  4FQU A;  1A8Y A;  1UVZ A;  4PUF C;  1UC7 A;  1THO A;  2LJK A;  1PA3 A;  3VWW A;  1BJX A;  2DJK A;  4DEJ A;  2KOK A;  2IJY A;  1T7P B;  2H0H A;  4HI7 A;  2CT6 A;  12GS A;  2LJR A;  3WGX A;  4BIK A;  3A5I A;  2O85 A;  1S3D A;  1TJD A;  4AGS A;  2R0G A;  4NAX A;  4K2D A;  5DAK A;  3D22 A;  3LYP A;  2H66 A;  1S3C A;  2IN3 A;  2LV3 A;  1PRX A;  1EZK A;  1JZR A;  1ZYE A;  3KM6 A;  3VUR A;  4MJC A;  3CRU A;  1OE8 A;  2O7K A;  4X1U A;  1GUM A;  5IQY A;  4G0L A;  3RPN A;  1FB0 A;  3ZML A;  3FZ9 A;  4IKH A;  1TRS A;  2LKU A;  1EP7 A;  3GX8 A;  2GT5 A;  5GAP D;  4WF5 A;  2LRN A;  4KB3 A;  1WWJ A;  4G2E A;  4KCA A;  5B6M A;  2B1L A;  1U87 A;  2HI7 A;  1EGR A;  4YQM A;  3LYK A;  5EY6 A;  3IC8 A;  3P8W A;  1HNA A;  3ZZX A;  1B4Q A;  3TKS C;  1UN2 A;  2LNT A;  2VLU A;  2VCQ A;  4HZ2 A;  2VCZ A;  4MZW A;  3F6F A;  5ELG A;  3TJK A;  4HSC X;  2OBK A;  1JZO A;  3F8U A;  1G6W A;  5J9B A;  2C3Q A;  1GUH A;  2FWF A;  4NWY A;  3I69 A;  1IYI A;  3FK8 A;  3W8J A;  4I2T A;  2IMK A;  1AIU A;  3VI5 A;  2IIY A;  2C4J A;  1KBN A;  3HJM A;  3A3T A;  1ZOF A;  3HDC A;  4GQC A;  3FKF A;  5F05 A;  4NXI A;  2CA8 A;  2N5F A;  5CRG A;  4EDY A;  4F2I A;  4N11 A;  5F07 A;  4FYU A;  4PXO A;  2PVO C;  1X0R A;  1XG8 A;  1B8X A;  1TW9 A;  3GH9 A;  6GSU A;  1JFU A;  1B9X C;  4WXT A;  2V1M A;  3ZVJ D;  4WR4 A;  1TU7 A;  4MZC A;  3C8E A;  2JU5 A;  2CZ3 A;  2E0Q A;  3MSZ A;  2GST A;  1FW1 A;  1I9D A;  3H79 A;  1O6J A;  1ERW A;  4MH3 A;  4H86 A;  6GSX A;  1PL2 A;  3TKS A;  5HQP A;  4IEL A;  1TI3 A;  3HCZ A;  1ST9 A;  4MPG A;  3TRX A;  3F63 A;  4MCU A;  3E3E A;  4PX1 A;  2AB6 A;  5AIS A;  1FG4 A;  5IOX A;  3HKR A;  2XC2 A;  5FHI A;  5HFK A;  3TRP A;  5ECQ B;  1ON4 A;  3US3 A;  2FHE A;  4BVY A;  4NV5 A;  1G7E A;  1NW2 A;  1GSY A;  3I9V 2;  1CQH A;  1Z6N A;  3F6D A;  4TR3 A;  3FZA A;  5HFG A;  3LW9 A;  2GSS A;  3GN3 A;  3HVN A;  2OE3 A;  1AC1 A;  3HJP A;  2R3X A;  4V1A g;  3TKP A;  1QMV A;  3TRQ A;  1M0U A;  1M3I A;  3H8Q A;  2XBQ A;  2ZNM A;  4KSM A;  4MF7 A;  5F8B A;  4ZL7 A;  3HHV A;  1ZGN A;  2YCD A;  3UEM A;  1EOH A;  2GVP A;  4MDC A;  2HZF A;  4ZB9 A;  4NV2 A;  1TI1 A;  1THX A;  3I43 A;  4G10 A;  3EIN A;  1KNG A;  2PU9 C;  4PTS A;  3SBC A;  2GQL A;  4KF9 A;  4XS4 B;  6GSW A;  2WRT A;  3L9U A;  2H1B A;  2H0G A;  2P5R A;  2WB9 A;  5KN0 A;  2EIO A;  2VOC A;  4EUY A;  1WRY A;  1ZYN A;  4MH2 A;  1GUK A;  1TOF A;  1ERT A;  4HQS A;  3HYP A;  4JR6 A;  5GAN D;  4WR5 A;  4ZIL A;  3EMP A;  3TOT A;  2X8G A;  4HJM A;  2WS2 A;  3P90 A;  1M7T A;  5ECK B;  2YPM A;  4WEY A;  3WGE A;  4FIW A;  2R6K A;  4YKF A;  3WGD A;  2NBS A;  4HOJ A;  1ABA A;  1A2M A;  2IMF A;  4Z2U A;  4TOP A;  2PMT A;  4BA7 A;  1PN0 A;  1SJ6 A;  1FVK A;  4HDE A;  3UOM A;  2MMN A;  1K0O A;  1OVN A;  3EU3 A;  5HR1 A;  3NIV A;  2H19 A;  5H5Q A;  1GH2 A;  3MAK A;  1OYJ A;  4I5Q A;  3W8S A;  2R37 A;  4KE3 A;  3CTF A;  1Z5Y E;  3CXG A;  3A2V A;  3S9F A;  4P3Y B;  1VRS D;  3MWH A;  3D4M A;  4ILF A;  4TXV A;  4V2N A;  2HLS A;  3KJY A;  3APO A;  4AJ8 A;  4K9Z A;  1ZL9 A;  2VCW A;  2HRF A;  2X4A A;  1PL1 A;  4Z2T A;  2MBS A;  2WFC A;  1UA5 A;  3O6T A;  2H1G A;  1V98 A;  1LBK A;  1VF2 A;  2H76 A;  2H74 A;  2I3Y A;  2YP6 A;  4Z7X A;  5G30 A;  5A5K A;  4KUN A;  2KHP A;  2CVK A;  2V32 A;  3KZQ A;  2AHE A;  5ECS A;  3GL5 A;  3GA4 A;  5B8B A;  3UVH A;  19GS A;  4ZL9 A;  3VWV A;  1YF0 A;  5DDL A;  1GLQ A;  3ZVJ A;  4PQI A;  4ML6 A;  1HNC A;  1FO5 A;  4CHS A;  1WMJ A;  1V58 A;  5J3R A;  3C1R A;  4HU7 A;  2QKE A;  1JZD A;  3KEB A;  2GT6 A;  2Z9S A;  1ZMA A;  5ENU A;  4D73 A;  1MTC A;  2A2P A;  2F8A A;  5IO0 A;  1X9M B;  3GX0 A;  5HR2 A;  2HNL A;  2DJ0 A;  3HVS A;  3N5O A;  4ACS A;  5FT3 A;  2YJH A;  2IWT A;  3TUE A;  4OCE A;  3WT1 A;  2WUL A;  1ACV A;  2I4A A;  3A5W A;  1O73 A;  1TU8 A;  5ECP B;  1EP8 A;  2FGX A;  4IQ1 A;  1Z3E A;  3HVV A;  5ECO B;  5H5R A;  1TP9 A;  4MMM A;  2GZZ A;  1GL8 A;  2RUE A;  4GCI A;  3C7M A;  4POB A;  1F3A A;  4HU9 A;  2L4C A;  5E59 A;  4YAV A;  4K7N A;  1WP0 A;  5LNK e;  2B7J A;  3IR4 A;  4I6X A;  5DVB A;  2JAD A;  1XIY A;  1TRU A;  4DSQ A;  1SKS B;  3HD5 A;  1BAY A;  7GSS A;  5D8I A;  2C0G A;  5KOW A;  5E4W A;  1AUC A;  4MAB A;  3TB2 A;  1OKD A;  2FA4 A;  4L5L A;  2YWO A;  4ECJ A;  4K8M A;  3ISO A;  1JLW A;  2HXK A;  3EC3 A;  4EIQ A;  3MIX A;  2N5A A;  4JBB A;  1ILO A;  2L57 A;  4KW6 A;  4PUA A;  3APS A;  1FOV A;  4WBR D;  1PSQ A;  2DJJ A;  5AIX A;  1NHY A;  1T1V A;  13GS A;  3DD3 A;  3HZ4 A;  1XXU A;  1MEK A;  1X5D A;  5J5N A;  3V1W A;  4XS4 A;  3ZTL A;  3EYT A;  1GUL A;  2YV7 A;  2H73 A;  2RLI A;  18GS A;  4BPY A;  3CRT A;  1GSF A;  1ZYP A;  1NSW A;  3FEU A;  2R5G A;  5JWQ B;  5H5S A;  4IHU A;  2RUF A;  5CP1 A;  3VPQ A;  1OKT A;  2DJ2 A;  2H30 A;  3U5R E;  2PWJ A;  1F2E A;  2LST A;  3IHG A;  2GQM A;  2V2G A;  4WET A;  2WDU A;  5J41 A;  2V6K A;  3ZIJ A;  5L71 A;  2DMM A;  4YQV A;  2H72 A;  3KIJ A;  2YJ7 A;  3CMI A;  1EOG A;  3BCI A;  4ZBD A;  4GTU A;  4POL A;  4MF6 A;  4MJB A;  1AAZ A;  4XRD A;  1WOU A;  4MNN A;  2R4V A;  3FYG A;  3DEX A;  3G7Y A;  4POK A;  1G6Y A;  2FUG 2;  4EIP A;  1A2J A;  3EMX A;  2DBC A;  2FLS A;  5F0G A; 
#chains in the Genus database with same CATH homology
 1XW5 A;  1C72 A;  3IOS A;  1YQ1 A;  4GQF A;  1O85 A;  4TR1 B;  1K3Y A;  4ULX A;  1VGL A;  1KTE A;  4PQ1 A;  3WT2 A;  5ECN B;  2DML A;  3F0I A;  1YF1 A;  1BED A;  3TKQ A;  5IMD A;  2V6O A;  3LWA A;  3RPP A;  2NVL A;  1M9B A;  2C3T A;  1K0D A;  1N8J A;  2VL2 C;  1PGT A;  1A8L A;  4PQH A;  2HRN A;  4Z2R A;  1K0A A;  4TXO A;  2OE1 A;  2IME A;  1FB6 A;  1YKC A;  4OFT A;  3KCM A;  3BD2 A;  4LL4 B;  4GLT A;  2H0I A;  1XOA A;  1QUW A;  2MMZ A;  3CSJ A;  3L78 A;  1BG5 A;  4LMW A;  3KP8 A;  1ML6 A;  4CW9 A;  5FWG A;  4ZBB A;  1R5P A;  1OC9 B;  2H01 A;  17GS A;  1JLV A;  3H1N A;  1M99 A;  1XPV A;  4ECI A;  1JHB A;  2DKI A;  2H71 A;  1ZZY A;  3UBL A;  2NDO A;  2FD3 A;  3TOU A;  2VLV A;  4PUR A;  4ZB6 A;  5IMA A;  10GS A;  4O5U A;  4GWR A;  4TRX A;  2TRX A;  4QQ7 A;  2LRC A;  2F8F A;  2C3N A;  2KP1 A;  2HRK A;  4X43 A;  4YH2 A;  3ZIV A;  5LCZ A;  5GST A;  6GST A;  2P31 A;  1GTI A;  3Q19 A;  4D73 B;  1URM A;  5ECI B;  2GSQ A;  3HZ8 A;  1TK5 B;  2LJA A;  2BTO T;  2ZCT A;  2REM A;  3FZ5 A;  3H4K A;  4L5O A;  2O8V B;  4IJI A;  2OAC A;  1DE1 A;  4LL1 B;  2DJ3 A;  1YDK A;  2HSH A;  5IPG A;  2GGT A;  3HJO A;  2CVD A;  3HXS A;  16GS A;  5CO3 A;  1PX7 A;  1LU4 A;  4K0N A;  5DAL A;  3DKS A;  4K5S A;  2V41 A;  3KTB A;  1T4Y A;  1GSD A;  2GDR A;  5JCG A;  2VO4 A;  3IRA A;  1VF3 A;  4XS1 A;  4X0X A;  1PKZ A;  2FWG A;  4K7O A;  1GP1 A;  3KMO A;  5COH A;  1K0N A;  5DCH A;  4RQX A;  2AV4 A;  3IC4 A;  20GS A;  3PGT A;  1O8W A;  4ZB8 A;  1VF4 A;  1ERU A;  1GTB A;  3F4S A;  4V2M A;  3IDV A;  3F9U A;  4HJ2 A;  1MDK A;  2CX3 A;  1A0R P;  1O7U A;  4XTS A;  3QFB C;  4USS A;  2DJ1 A;  3CBU A;  3GRX A;  1TTZ A;  1YJ6 A;  5JCW A;  2MBT A;  2YNX A;  3PR8 A;  1TKD B;  1O8X A;  1AXD A;  2JL4 A;  3TCO A;  2E2G A;  4JZQ A;  2GZP A;  2QC7 A;  4RI7 A;  4EDZ A;  4Q5F A;  1Q98 A;  4ZXG A;  3F3Q A;  2PBJ A;  5DQS A;  3N9J A;  3GST A;  4ISD A;  5D96 A;  3GH6 A;  1YY7 A;  1ZCP A;  5DJL A;  3QFA C;  1AQV A;  2F3M A;  4TR1 A;  1SU9 A;  5B7C A;  4X4J A;  4CDO A;  2IL3 A;  2VCT A;  3I6A A;  2VAF A;  2X99 A;  4GF0 A;  1X5E A;  4HZ4 A;  5EL8 A;  4HEA 2;  4OWY A;  3M8N A;  2PUK C;  4ZBA A;  2XHF A;  2TIR A;  5IIZ A;  1PKW A;  2FCH A;  3IBH A;  2JAC A;  1M9A A;  3RAZ A;  2CAQ A;  5KN1 A;  4FO5 A;  2K8S A;  2GS3 A;  2VM1 A;  2HT9 A;  4KX4 A;  1OC9 A;  3RBT A;  1V57 A;  3IE3 A;  3PIN A;  5ECM B;  3FR3 A;  2J9H A;  4E8E A;  3GKK A;  1SD9 A;  3GKN A;  3M9J A;  4O92 A;  5JWR B;  4HQZ A;  2DKH A;  5CYY A;  4JE1 A;  1XWB A;  3IA1 A;  2H8L A;  4TR4 A;  3KD0 A;  2AYT A;  4FH8 A;  3GFK A;  3GMF A;  1B9Y C;  1SK2 A;  4A5P A;  2X49 A;  2C0E A;  4TXO B;  3NOF A;  4XIH A;  5A4V A;  2J23 A;  3WYW A;  4O5Q A;  1YEX A;  3IHQ A;  3O3T A;  4MP4 A;  3GKX A;  2EC4 A;  3GUR A;  2L5O A;  3FR6 A;  4RUV A;  3GIX A;  4OD7 A;  2RM5 A;  1VF1 A;  4GXZ A;  2C0D A;  4ECC A;  1W89 A;  3O76 A;  2FNO A;  1A0F A;  4AF2 A;  1M2A A;  4WF4 A;  3L0H A;  2VCX A;  3HA9 A;  4OO4 A;  2G0F A;  3GTU B;  1MD3 A;  1FVJ A;  4KND A;  4GRF A;  3LQ7 A;  2N5B A;  4K1F A;  1QK8 A;  3IK9 A;  3F3R A;  4MA9 A;  3TKS E;  4RQR A;  2L6C A;  5A4U A;  2RII A;  4QL9 A;  3G7I A;  2L59 A;  2D2Z A;  2FWE A;  1NHO A;  1DSB A;  4TN8 A;  1IYH A;  1GNW A;  3UIW A;  2IPA A;  4WBJ A;  3UJ1 A;  2DIY A;  1Z7R A;  2YN1 A;  4KDU A;  2FA8 A;  1TK0 B;  4YAP A;  2GSR A;  3TJB A;  4K5R A;  3FW2 A;  1MD4 A;  2HE3 A;  1Q4J A;  4BVX A;  2H6Y A;  1SL1 B;  2R0P A;  4DSS A;  1G7O A;  1J08 A;  2GLR A;  2CAI A;  3D5J A;  1EEM A;  2MZC A;  1BX9 A;  3UBK A;  2GZY A;  4MZB A;  3G7J A;  1SYX A;  3EPT A;  2B5Y A;  1J0F A;  5ECL B;  3ED3 A;  5CRH A;  3J7Y k;  4Q5N A;  2GQK A;  3UVT A;  2K18 A;  1BYE A;  3ME7 A;  1O81 A;  1GRX A;  3WD6 A;  3VLN A;  4ZIJ A;  3QD9 A;  1XWK A;  2KP2 A;  2HYX A;  3DYR A;  3A2W A;  3IAS 2;  4KAE A;  5DAL B;  4L8E A;  2DSA A;  1G0T A;  1WJK A;  6GSV A;  5HR3 A;  3W6G A;  3L4N A;  2HRA A;  4O32 A;  4V1A p;  2KUC A;  1SYR A;  1GLP A;  2DC5 A;  1PN9 A;  2PER A;  1EWX A;  4N30 A;  2H6X A;  2QSI A;  3VWU A;  3VFI A;  2B1K A;  4XHM A;  3IK7 A;  3R2Q A;  4F0B A;  2B6M A;  2C1Y A;  5AN1 A;  1U3I A;  3L9S A;  5KEJ A;  2UZ8 A;  4OCF A;  3LG6 A;  2L4Q A;  4HS1 A;  1V40 A;  2F9S A;  3IAM 2;  3ZL5 A;  3TJJ A;  3DWV A;  4EXJ A;  4N0V A;  4G0I A;  5DQY A;  4Q5Q A;  4LMV A;  3KGK A;  3VPT A;  2PVQ A;  3M0F A;  2M80 A;  4TKY A;  1SJZ A;  4IN0 A;  1QFN A;  4XRA A;  2L6D A;  1A24 A;  3VI7 A;  2O87 A;  2WCI A;  2NPB A;  4NHW A;  3TKR A;  3Q6O A;  2F51 A;  5F06 A;  14GS A;  4IBP A;  4OFM A;  1YKA A;  3ZRE A;  1V2A A;  4PNF A;  4G19 A;  2MYG A;  3QPM A;  4PGT A;  1F9M A;  1MDI A;  3E0U A;  1ERV A;  1H4O A;  2X8H A;  4OO5 A;  3LGC A;  1TXX A;  3GL3 A;  2P0G A;  5IMZ A;  3DRN A;  1XOB A;  5IM9 A;  2M72 A;  3D21 A;  1QQ2 A;  1V9W A;  4EKZ A;  4MJA A;  2FY6 A;  4CY8 A;  2VCV A;  3J7Y b;  1LJR A;  6GSS A;  3KH7 A;  3E9J B;  3ZFL A;  1HD2 A;  2C0F A;  4WKW A;  4KDY A;  4POM A;  2LEG A;  1DBY A;  4IS0 A;  4IVF A;  3FHK A;  2DLX A;  1R5A A;  2R2J A;  1M2D A;  4FYB A;  1Z6M A;  2I1U A;  1CQG A;  2JSY A;  2LQQ A;  2LQO A;  4EL1 A;  4GST A;  4K6X A;  3GTU A;  3OR5 A;  2PPT A;  2AUV A;  3QDN A;  3FRC A;  3EU4 A;  4KGI A;  4OFN A;  3EWL A;  2VM2 A;  3CYN A;  5IOW A;  2OA7 A;  1XCC A;  3HVX A;  5D9X A;  1K3O A;  4MF5 A;  1PMT A;  3ZFB A;  3H93 A;  1EGO A;  1J9B A;  2ZUP A;  1XVQ A;  1Y6E A;  2M46 A;  2CVB A;  3D0Z A;  4G9H A;  5D9T A;  5HFI A;  1GSE A;  1QGV A;  3M9K A;  2VL2 A;  3IPZ A;  3MNG A;  2VL9 A;  3A2X A;  3M3M A;  5B6N A;  4NMU A;  5ID2 A;  2JZR A;  4F82 A;  1YEP A;  2QA2 A;  2O89 A;  1USB A;  1XBS A;  2EIR A;  4XCS A;  4YQU A;  2B7K A;  5KN3 A;  2A2S A;  4MJE A;  4DVC A;  3QAW A;  11GS A;  1OE7 A;  5IMV A;  5IMF A;  5AIV A;  3TJG A;  2C8U A;  4YKG A;  4E8H A;  4JU5 A;  4TW5 A;  4JRR A;  4EO3 A;  5ECH B;  2XBI A;  3LXZ A;  4IP1 A;  4ZL8 A;  3QMX A;  1QXH A;  2ALB A;  3K8N A;  4KDX A;  2DIZ A;  2LS5 A;  3NZN A;  4F03 A;  1EV9 A;  1B48 A;  1XWG A;  2E7P A;  2TRC P;  2HZE B;  3MDK A;  1WE0 A;  2XPE A;  3D4T A;  3UAR A;  1EEJ A;  2IFQ A;  5EPF A;  1XVW A;  2B5X A;  3M1G A;  3C71 A;  8GSS A;  2I9H A;  3EE2 A;  1SK1 A;  1HNB A;  2E2M A;  4BVX B;  4DSS B;  5D9V A;  5G1K A;  3CTG A;  4O7H A;  2VD1 A;  2YWM A;  1S3A A;  5CNW A;  1XZO A;  1U88 A;  2NTO A;  3DGQ A;  3HY2 A;  4GSS A;  3QOU A;  4EC0 A;  4BL7 A;  3EVI A;  2X64 A;  3QCP A;  2A2R A;  2C80 A;  4MK3 A;  4EF0 A;  3KP9 A;  2P5Q A;  2CX4 A;  3PPU A;  4Q5R A;  1GTA A;  1E6B A;  2H6Z A;  2CQ9 A;  1DE2 A;  3P7X A;  4BWQ A;  5BMU A;  4IQA A;  1K0B A;  5G1L A;  3LSZ A;  1I5G A;  2MMA A;  2AJQ B;  4IP6 A;  2YWN A;  1T00 A;  1SK0 A;  4CY6 A;  3Q18 A;  3BOA A;  4LLR A;  1F6M C;  1WPI A;  2PN8 A;  3FY7 A;  2HSY A;  1TRW A;  3ERF A;  1XW6 A;  3ERG A;  1PD2 1;  3G9B A;  3VK9 A;  2OAD A;  4KA0 A;  4J56 E;  4F9Z A;  1ZYQ B;  1U6T A;  4DSR A;  1SL0 B;  2AAW A;  2HFD A;  5DBQ A;  2YV9 A;  1Z9H A;  2GTU A;  1WIK A;  1X9W B;  4LA1 A;  5G5E A;  1MDJ A;  5AGY A;  3QR6 A;  2B3S A;  1SKR B;  2H70 A;  3FZ4 A;  3ZRD A;  4ICY A;  3VWX A;  4MPF A;  1X5C A;  3CSH A;  2MMO A;  1SJI A;  5C00 A;  1Y25 A;  1R26 A;  4FYC A;  1RQM A;  2ES7 A;  3GNJ A;  3LJR A;  2VUP A;  3GUS A;  9GSS A;  4I8B A;  2I81 A;  3QAG A;  2B5E A;  3DXB A;  3ME8 A;  4K0G A;  3P2A A;  22GS A;  2K8V A;  2WJU A;  4HUA A;  1XFL A;  1B4P A;  3UL3 A;  4NPB A;  5BRT A;  1SL2 B;  3F4T A;  1BQ7 A;  3ERW A;  4XS6 A;  2ON7 A;  2QGV A;  5CRD A;  4PNG A;  1KEB A;  2LRT A;  4N10 A;  1PQN A;  1K0M A;  3C73 A;  4TVE A;  1GSS A;  2JZT A;  1GSQ A;  1EV4 A;  1K0C A;  2BMX A;  4IGJ A;  1XWA A;  1T4Z A;  1SKW B;  5DAK B;  5J4U A;  3AY8 A;  1OAZ A;  4K7I A;  1PX6 A;  3GYK A;  4N0Z A;  1SEN A;  5DCG A;  4ECB A;  2VLT A;  3KH9 A;  3GHA A;  3CSI A;  5EVO A;  4L0W A;  3DVW A;  2K9F A;  2LUS A;  3APQ A;  3DML A;  4IJ3 A;  1JZW A;  5JCU A;  4I2U A;  2OJL A;  3TGZ A;  5HR0 A;  3DVX A;  2YOI A;  1OC8 A;  4F0C A;  5ECR B;  4J2F A;  3LFL A;  3U6V A;  5GZZ B;  2X8C A;  4RI6 A;  5ELA A;  1FOH A;  2FWH A;  1AQX A;  1RK4 A;  3LOR A;  2WGR A;  1E2Y A;  1GWC A;  5J9C A;  3FR9 A;  4KCE A;  2HZE A;  4GSN A;  3RHB A;  5GSS A;  1T8E B;  5ID2 B;  5INY A;  1GSU A;  3KXO A;  1OC3 A;  1TRV A;  3QAV A;  1U3A A;  1AQW A;  1XW9 A;  3UAP A;  3C1S A;  3GSS A;  4AJ7 A;  4QL7 A;  5IO2 A;  1Z7P A;  2IMI A;  4TR0 A;  1R4W A;  3JCM L;  1N2A A;  5CRW A;  2CV4 A;  2QA1 A;  2EIQ A;  3GV1 A;  3PH9 A;  1YZX A;  5G2Z A;  2ON5 A;  1XWC A;  2VL3 A;  4EE0 A;  3F4R A;  2HSM A;  5G5F A;  2PGT A;  1FAA A;  3ZLP A;  4MLY A;  5LD0 A;  3D6I A;  1T3B A;  1W4V A;  1A2L A;  2YZU A;  2VIM A;  4IW9 A;  1FHE A;  2OE0 A;  4G0K A;  4JR4 A;  1NM3 A;  3BBY A;  4ID0 A;  1GNE A;  2H1A A;  2LTK A;  2IFQ B;  2KLX A;  5IMC A;  3DIE A;  3ZYW A;  2LNS A;  4I97 A;  4BWS A;  4K2X A;  1H75 A;  2VD0 A;  4NHZ A;  1F3B A;  5D73 A;  2WZ9 A;  2IMD A;  5A4W A;  2A4H A;  1K3L A;  1F37 A;  4JED A;  6GSY A;  3KTL A;  4OMV A;  1R7H A;  3R3E A;  5JWO B;  3SWL A;  3ZMK A;  4L0U A;  1GTU A;  1HYU A;  4J57 E;  4V2L A;  2H1D A;  2G2Q A;  1DUG A;  3BJ5 A;  5ABR A;  4BL7 B;  4AJ6 A;  2YAN A;  5D9W A;  1TK8 B;  2BJX A;  3MYD A;  3RDW A;  4KSO A;  1TDI A;  5D93 A;  2A4V A;  2JSZ A;  4BVY B;  2CZ2 A;  2L5L A;  4O5R A;  2R0C A;  5B8A A;  3IXR A;  3L9V A;  2RM6 A;  5DJM A;  3TJF A;  3KMN A;  4KH7 A;  1X9S B;  3RHC A;  5CAX A;  1A23 A;  3LEF A;  2JZS A;  1M2B A;  5IPH A;  5KOX A;  2K6V A;  3LXT A;  5KN2 A;  1SD8 A;  4EVM A;  3TDG A;  5C04 A;  3ZIT A;  3BCK A;  2YZH A;  3UMA A;  3Q74 A;  2YWI A;  1HQO A;  5G31 A;  2OBI A;  3FMW A;  1AW9 A;  1RW1 A;  2XPD A;  2H75 A;  2OKA A;  3GKM A;  4ML1 A;  3EUR A;  3IV4 A;  5CRE A;  4FQU A;  1A8Y A;  1UVZ A;  4PUF C;  1UC7 A;  1THO A;  2LJK A;  1PA3 A;  3VWW A;  1BJX A;  2DJK A;  4DEJ A;  2KOK A;  2IJY A;  1T7P B;  2H0H A;  4HI7 A;  2CT6 A;  12GS A;  2LJR A;  3WGX A;  3A5I A;  2O85 A;  1S3D A;  1TJD A;  4AGS A;  2R0G A;  4NAX A;  4K2D A;  5DAK A;  3D22 A;  3LYP A;  2H66 A;  1S3C A;  2IN3 A;  2LV3 A;  1PRX A;  1EZK A;  1JZR A;  1ZYE A;  3KM6 A;  3VUR A;  4MJC A;  3CRU A;  1OE8 A;  2O7K A;  4X1U A;  1GUM A;  5IQY A;  4G0L A;  3RPN A;  1FB0 A;  3ZML A;  3FZ9 A;  4IKH A;  1TRS A;  2LKU A;  1EP7 A;  3GX8 A;  2GT5 A;  5GAP D;  4WF5 A;  2LRN A;  4KB3 A;  1WWJ A;  4G2E A;  4KCA A;  5B6M A;  2B1L A;  1U87 A;  2HI7 A;  1EGR A;  4YQM A;  3LYK A;  5EY6 A;  3IC8 A;  3P8W A;  1HNA A;  3ZZX A;  1B4Q A;  3TKS C;  1UN2 A;  2LNT A;  2VLU A;  2VCQ A;  4HZ2 A;  2VCZ A;  4MZW A;  3F6F A;  5ELG A;  3TJK A;  2OBK A;  1JZO A;  3F8U A;  1G6W A;  5J9B A;  2C3Q A;  1GUH A;  2FWF A;  4NWY A;  3I69 A;  1IYI A;  3FK8 A;  3W8J A;  4I2T A;  2IMK A;  1AIU A;  3VI5 A;  2IIY A;  2C4J A;  1KBN A;  3HJM A;  3A3T A;  1ZOF A;  3HDC A;  4GQC A;  3FKF A;  5F05 A;  4NXI A;  2CA8 A;  2N5F A;  5CRG A;  4EDY A;  4F2I A;  4N11 A;  5F07 A;  4FYU A;  4PXO A;  2PVO C;  1X0R A;  1B8X A;  1TW9 A;  3GH9 A;  6GSU A;  1JFU A;  1B9X C;  4WXT A;  2V1M A;  3ZVJ D;  4WR4 A;  1TU7 A;  4MZC A;  3C8E A;  2JU5 A;  2CZ3 A;  2E0Q A;  3MSZ A;  2GST A;  1FW1 A;  1I9D A;  3H79 A;  1O6J A;  1ERW A;  4MH3 A;  4H86 A;  6GSX A;  1PL2 A;  3TKS A;  5HQP A;  4IEL A;  1TI3 A;  3HCZ A;  1ST9 A;  4MPG A;  3TRX A;  3F63 A;  4MCU A;  3E3E A;  4PX1 A;  2AB6 A;  5AIS A;  1FG4 A;  5IOX A;  3HKR A;  2XC2 A;  5FHI A;  5HFK A;  3TRP A;  5ECQ B;  1ON4 A;  3US3 A;  2FHE A;  4BVY A;  4NV5 A;  1G7E A;  1NW2 A;  1GSY A;  3I9V 2;  1CQH A;  1Z6N A;  3F6D A;  4TR3 A;  3FZA A;  5HFG A;  3LW9 A;  2GSS A;  3GN3 A;  2OE3 A;  1AC1 A;  3HJP A;  2R3X A;  4V1A g;  3TKP A;  1QMV A;  3TRQ A;  1M0U A;  3H8Q A;  4KSM A;  2XBQ A;  2ZNM A;  4MF7 A;  5F8B A;  4ZL7 A;  3HHV A;  1ZGN A;  2YCD A;  3UEM A;  1EOH A;  2GVP A;  4MDC A;  2HZF A;  4ZB9 A;  4NV2 A;  1TI1 A;  1THX A;  3I43 A;  4G10 A;  3EIN A;  1KNG A;  2PU9 C;  4PTS A;  3SBC A;  2GQL A;  4KF9 A;  4XS4 B;  6GSW A;  2WRT A;  3L9U A;  2H1B A;  2H0G A;  2P5R A;  2WB9 A;  5KN0 A;  2EIO A;  2VOC A;  4EUY A;  1WRY A;  1ZYN A;  4MH2 A;  1GUK A;  1TOF A;  1ERT A;  4HQS A;  3HYP A;  4JR6 A;  5GAN D;  4WR5 A;  4ZIL A;  3EMP A;  3TOT A;  2X8G A;  4HJM A;  2WS2 A;  3P90 A;  1M7T A;  5ECK B;  2YPM A;  4WEY A;  3WGE A;  4FIW A;  2R6K A;  4YKF A;  3WGD A;  2NBS A;  4HOJ A;  1ABA A;  1A2M A;  2IMF A;  4Z2U A;  4TOP A;  2PMT A;  4BA7 A;  1PN0 A;  1SJ6 A;  1FVK A;  4HDE A;  3UOM A;  2MMN A;  1K0O A;  1OVN A;  3EU3 A;  5HR1 A;  3NIV A;  2H19 A;  5H5Q A;  1GH2 A;  3MAK A;  1OYJ A;  4I5Q A;  3W8S A;  2R37 A;  4KE3 A;  3CTF A;  1Z5Y E;  3CXG A;  3A2V A;  3S9F A;  4P3Y B;  1VRS D;  3MWH A;  3D4M A;  4ILF A;  4TXV A;  4V2N A;  2HLS A;  3KJY A;  3APO A;  4AJ8 A;  4K9Z A;  1ZL9 A;  2VCW A;  2HRF A;  2X4A A;  1PL1 A;  4Z2T A;  2MBS A;  2WFC A;  1UA5 A;  3O6T A;  2H1G A;  1V98 A;  1LBK A;  1VF2 A;  2H76 A;  2H74 A;  2I3Y A;  2YP6 A;  4Z7X A;  5G30 A;  5A5K A;  4KUN A;  2KHP A;  2CVK A;  2V32 A;  3KZQ A;  2AHE A;  5ECS A;  3GL5 A;  3GA4 A;  5B8B A;  3UVH A;  19GS A;  4ZL9 A;  3VWV A;  1YF0 A;  5DDL A;  1GLQ A;  3ZVJ A;  4PQI A;  4ML6 A;  1HNC A;  1FO5 A;  4CHS A;  1WMJ A;  1V58 A;  5J3R A;  3C1R A;  4HU7 A;  2QKE A;  1JZD A;  3KEB A;  2GT6 A;  2Z9S A;  1ZMA A;  5ENU A;  4D73 A;  1MTC A;  2A2P A;  2F8A A;  5IO0 A;  1X9M B;  3GX0 A;  5HR2 A;  2HNL A;  2DJ0 A;  3HVS A;  3N5O A;  4ACS A;  5FT3 A;  2YJH A;  2IWT A;  3TUE A;  4OCE A;  3WT1 A;  2WUL A;  1ACV A;  2I4A A;  3A5W A;  1O73 A;  1TU8 A;  5ECP B;  1EP8 A;  2FGX A;  4IQ1 A;  1Z3E A;  3HVV A;  5ECO B;  5H5R A;  1TP9 A;  4MMM A;  2GZZ A;  1GL8 A;  2RUE A;  4GCI A;  3C7M A;  4POB A;  1F3A A;  4HU9 A;  2L4C A;  5E59 A;  4YAV A;  4K7N A;  1WP0 A;  5LNK e;  2B7J A;  3IR4 A;  4I6X A;  5DVB A;  2JAD A;  1XIY A;  1TRU A;  4DSQ A;  1SKS B;  3HD5 A;  1BAY A;  7GSS A;  5D8I A;  2C0G A;  5KOW A;  5E4W A;  1AUC A;  4MAB A;  3TB2 A;  1OKD A;  2FA4 A;  4L5L A;  2YWO A;  4ECJ A;  4K8M A;  3ISO A;  1JLW A;  2HXK A;  3EC3 A;  4EIQ A;  3MIX A;  2N5A A;  4JBB A;  1ILO A;  2L57 A;  4KW6 A;  4PUA A;  3APS A;  1FOV A;  4WBR D;  1PSQ A;  2DJJ A;  5AIX A;  1NHY A;  1T1V A;  13GS A;  3DD3 A;  3HZ4 A;  1XXU A;  1MEK A;  1X5D A;  5J5N A;  3V1W A;  4XS4 A;  3ZTL A;  3EYT A;  1GUL A;  2YV7 A;  2H73 A;  2RLI A;  18GS A;  4BPY A;  3CRT A;  1GSF A;  1ZYP A;  1NSW A;  3FEU A;  2R5G A;  5JWQ B;  5H5S A;  4IHU A;  2RUF A;  5CP1 A;  3VPQ A;  1OKT A;  2DJ2 A;  2H30 A;  3U5R E;  2PWJ A;  1F2E A;  2LST A;  3IHG A;  2GQM A;  2V2G A;  4WET A;  2WDU A;  5J41 A;  2V6K A;  3ZIJ A;  5L71 A;  2DMM A;  4YQV A;  2H72 A;  3KIJ A;  2YJ7 A;  3CMI A;  1EOG A;  3BCI A;  4ZBD A;  4GTU A;  4POL A;  4MF6 A;  4MJB A;  1AAZ A;  4XRD A;  1WOU A;  4MNN A;  2R4V A;  3FYG A;  3DEX A;  3G7Y A;  4POK A;  1G6Y A;  2FUG 2;  4EIP A;  1A2J A;  3EMX A;  2DBC A;  2FLS A;  5F0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...