2HXVA

Crystal structure of a diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase (tm1828) from thermotoga maritima at 1.80 a resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
349
structure length
349
Chain Sequence
HHHHMYETFMKRAIELAKKGLGRVNPNPPVGAVVVKDGRIIAEGFHPYFGGPHAERMAIESARKKGEDLRGATLIVTLEPCDHHGKTPPCTDLIIESGIKTVVIGTRDPNPVSGNGVEKFRNHGIEVIEGVLEEEVKKLCEFFITYVTKKRPFVALKYASTLDGKIADHRGDSKWITDKLRFKVHEMRNIYSAVLVGAGTVLKDNPQLTCRLKEGRNPVRVILDRKGVLSGKVFRVFEENARVIVFTESEEAEYPPHVEKALSDCSVESILRNLYERDIDSVLVEGGSKVFSEFLDHADVVFGFYSTKIFGKGLDVFSGYLSDVSVPPKFKVVNVEFSDSEFLVEMRPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase (TM1828) from Thermotoga maritima at 1.80 A resolution
rcsb
molecule keywords Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-ami
molecule tags Biosynthetic protein
source organism Thermotoga maritima
total genus 116
structure length 349
sequence length 349
ec nomenclature ec 1.1.1.193: 5-amino-6-(5-phosphoribosylamino)uracil reductase.
pdb deposition date 2006-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region
A PF01872 RibD_C RibD C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.140.10 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase, domain 2 2hxvA01
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 2hxvA02
3M09A 4K1RA 3M08A 3CLBA 1LY3A 1DG8A 1DRHA 1DHFA 3QGTA 3NXTA 4Q6AA 4HA9A 3F8YA 4OWPA 2LF1A 3NZ6X 4EIZA 3TQ9A 1WKQA 4KITC 4P9DA 2HXVA 2XW7A 3JWFA 3EEKA 3EELA 4PSTA 4ELEA 1S3UA 2C2TA 3FQFA 1UX0A 4M6KA 5ECXA 4QJCA 3QFXA 2G6VA 3NXOA 1WN6A 3FRFX 1RA8A 2Z3GA 4I13A 2B3JA 5HF2X 1DYHA 3IA5A 4QFTA 1DYIA 3K47A 2OG4A 4X5HA 1DISA 3FQCA 4XRBA 2CIGA 3Q1HA 2W3VA 1PD8A 3OJ6A 3SQYX 1ZABA 3F0VX 3IA4A 3DH1A 4Q0DA 4LEKX 2Z3IA 3QLRA 1CZ3A 5HF0X 3RO9A 3JWKA 1M7AA 3I3RA 4G95A 3IROA 4QJZD 1RB3A 1RB2A 2ANOA 3QLSA 4XT4A 1DHIA 1DR1A 1P6OA 5HQZA 1DYRA 4KEBA 5GAOA 3SRSX 4M6JA 3QLYA 4LCPA 2W9HA 4OCNB 1ALNA 3OAFA 4JXEA 4ELGA 4G3MA 3QLZA 2W3AA 5FDAA 2BLBA 4QI9A 2G84A 3SH2A 2KKSA 3F0QX 3E1UA 1OX7A 8DFRA 4KJKA 1VJ3A 1OHJA 1VQ2A 1RA2A 3CL9A 3NRRA 1RX6A 4ELBA 4LC5A 4ECKA 4F7OA 3UM5A 1AOEA 5HT4A 3EEMA 4KD7A 2KCQA 3RG9A 3QL3A 1IA4A 1DDRA 2CD2A 4MSDA 1E26A 3GYFA 4LD2A 5HSUA 1IA3A 4NQLA 3NZCX 2W3BA 2A8NA 3R2NA 4ZD5A 3VCOA 1JUVA 1TIYA 3I8AX 4QLGA 3KY8A 2JYBA 4F3WA 3K2HA 5JA3A 3FL8A 3FQVA 3NXRA 3SRWX 3CD2A 1LUDA 3FREX 1DR6A 1RA3A 2KGKA 1RF7A 5CW6A 2D5NA 3NZAX 4KY8A 5E8QA 4HOGA 4PDJA 1WWRA 1DHJA 2QLCA 3OCHA 3K45A 4HA7A 4KLXA 3SAIA 4DFRA 4LAEX 5HT5A 3DL6A 3SGYA 1VDRA 3SA1A 5HPBA 1DREA 1IA1A 3F91A 1PD9A 3D80A 1KLKA 2W3WA 4Q0EA 4QLFA 2QK8A 2HM9A 3RZVA 3DG8A 3DRCA 4DP3A 3NXXA 3RZUA 4KY4A 4E0QA 1RA1A 5DFRA 5DXVA 3S9UA 3FL9A 1J3IA 4FHBA 2NYTA 2W4LA 4KM2A 3DGAA 4KYAA 6DFRA 4KL9A 2O3KA 3SA2A 1DR5A 3FY8X 3L3RA 4XT8A 1DRFA 4NX7A 4P3QA 3F0UX 3ZPCA 4FGGA 2P8RA 4OCMB 3ZEFB 1LY4A 3KGYA 4EILA 1M79A 2OBCA 2FR6A 1RH3A 1S3YA 4XT7A 2B3ZA 1JOLA 1TDRA 4OCNA 1U72A 4OCLB 3FRAX 2H2QA 1RE7A 5HI6A 3IJFX 2RPZA 5U27A 3JW5A 7DFRA 1R5TA 4PQTA 5CCCA 4M7VA 3QYLA 2INQA 4ZD4A 4M6LA 3GI2A 1YSBA 1DG7A 1CTUA 3JWCA 4HOEA 1U70A 4P68A 1UX1A 1KMSA 4WIFA 1RX8A 1DR4A 1U71A 1S3VA 3CSEA 2HQPA 4KAKA 4X5IA 3JTWA 2FR5A 1BOZA 4MS7A 1M78A 2BLCA 4H96A 2ZZAA 4EJ1A 1KMVA 2DRCA 3ZPGA 3GHWA 1DR3A 3OCQA 1D1GA 4XT6A 1OHKA 3N0HA 3UM8A 3TQ8A 1YHOA 1HFPA 4X5JA 3DATA 4XT5A 3NXYA 1ZDRA 2D30A 3TQAA 4H95A 3QLXA 3DFRA 1RX4A 4LAHX 3FYVX 4EIGA 4P3RA 2HVVA 4QHVA 4MSJA 2ZNVA 4WIGA 1JTKA 5JG0X 1PDBA 3KJSA 3MPZA 3JWMA 1HFRA 3S7AA 4O8XB 3NZ9X 4FGHA 3FY9X 4PTJA 4ELHA 1QZFA 3F8ZA 4MSQA 1DRAA 2FZIA 1RX5A 4ILGC 4PSYA 2ANQA 3TQBA 4MSMA 3B8FA 1DF7A 4XE6X 1SEJA 4KM0A 4M7UA 4DPHA 3F0XX 4KBNA 4O8YB 3LG4A 4GH8A 2W9GA 4BGDC 3QYOA 3SRUX 4CD2A 1DR7A 3E0BA 3FQZA 1MQ0A 4HOFA 1OI0A 2ZNRA 1YSDA 3FRBX 5U26A 2HVWA 3INVA 4OR7A 4DDRA 3QL0A 2O95A 1J3JA 4OCMA 3HBBA 1MVSA 3SBGA 1AO8A 2L28A 1R5XA 3DMOA 1AI9A 4G8ZX 4ZFTA 4OCLA 3F0SX 2W9SA 3D84X 3EEJA 3SRRX 5HUIA 1RX9A 1IA2A 3SRQX 1J3KA 3NZDA 3GHCA 3K74A 4EG2A 3QG2A 2AZNA 3FRDX 4H98A 2P4GA 4IXFX 1JOMA 3NU0A 3NTZA 4OWPB 3EIGA 1DLSA 2Z3HA 1DRBA 4I1NA 5M52C 5HQYA 4IXED 1RX2A 3TD8A 4IXGX 3S3VA 3G8QA 2FZHA 2DHFA 3FQOA 2OIPA 4KJLA 4I43B 4P66A 2O7PA 2PW9A 4P9CA 1CTTA 1DAJA 3JSUA 1MVTA 4LCNA 3IRNA 4OSGA 4H97A 4HRWA 4HRQA 2C2SA 4XECX 4RGCA 3IRMA 1RC4A 3EX8A 1UAQA 1WN5A 1DLRA 3FS6A 3DL5A 3F0BX 4M2XA 1AF2A 4Q67A 1HFQA 3R33A 5EAJA 2BLAA 4P9EA 5C2OA 2GD9A 2ITHA 2W9TA 4PSSA 3JVXA 4O8XA 3KJRA 2W3MA 4X5FA 3ROAA 2BL9A 3KFYA 3FYWX 5M59B 1RX7A 1RX1A 3UM6A 2Z3JA 5HSRA 4LAGX 3DAUA 4X5GA 1CD2A 4ZFRA 1DYJA 5ECCA 1Z3AA 4LD4A 1BZFA 4D10F 2FZJA 2NX8A 1DR2A 3NZBX 4O8YA 2O96A 1RG7A 3QLWA 5HVEA 3HJ3A 4PTHA 3FQ0A 4KJJA 5CC9A 5DCAJ 4LCOA 1RX3A 1DIUA 1RA9A 3SR5X 3NXVA 1DG5A 4DPDA 4TU5X 2D0KA 5HVBA 1S3WA 4NX6A 4ELFA 1UWZA 1DDSA 3JW3A 1RD7A 4KFJA 4QLEA 1RB7A 3IX9A 2P87A 4KNEA 3GHVA
chains in the Genus database with same CATH superfamily
3M09A 4K1RA 3M08A 3CLBA 3VX8A 1DG8A 1LY3A 1DRHA 1DHFA 3QGTA 3NXTA 4Q6AA 4HA9A 3F8YA 4OWPA 2LF1A 3NZ6X 4EIZA 1PL0A 3TQ9A 1WKQA 4KITC 4P9DA 2HXVA 2XW7A 3JWFA 3EEKA 3EELA 4PSTA 4ELEA 1S3UA 2C2TA 3FQFA 1UX0A 4M6KA 5ECXA 4QJCA 3QFXA 2G6VA 3NXOA 1WN6A 3FRFX 1RA8A 2Z3GA 4I13A 2B3JA 5HF2X 1DYHA 3IA5A 4QFTA 1DYIA 3K47A 2OG4A 4X5HA 1DISA 3FQCA 4XRBA 2CIGA 3Q1HA 2W3VA 1PD8A 3OJ6A 3SQYX 1ZABA 3F0VX 3IA4A 2B1GA 3DH1A 4Q0DA 4LEKX 2Z3IA 3QLRA 1CZ3A 5HF0X 3RO9A 3JWKA 1M7AA 3I3RA 4G95A 3IROA 4QJZD 1RB3A 1RB2A 2ANOA 3QLSA 4XT4A 1DHIA 1DR1A 1P6OA 5HQZA 1DYRA 4KEBA 5GAOA 3SRSX 4M6JA 3QLYA 4LCPA 2W9HA 4OCNB 1ALNA 3OAFA 4JXEA 4ELGA 4G3MA 3QLZA 2W3AA 5FDAA 2BLBA 4QI9A 2G84A 3SH2A 2KKSA 3F0QX 3E1UA 1OX7A 8DFRA 4KJKA 1VJ3A 1OHJA 1VQ2A 1RA2A 3CL9A 3NRRA 1RX6A 4ELBA 4LC5A 4ECKA 4F7OA 3UM5A 1AOEA 5HT4A 3EEMA 4KD7A 2KCQA 3RG9A 3QL3A 1IA4A 1DDRA 2CD2A 4MSDA 1E26A 3GYFA 4LD2A 5HSUA 1IA3A 4EHIA 4NQLA 3NZCX 2W3BA 2A8NA 3R2NA 4ZD5A 3VCOA 1JUVA 1TIYA 3I8AX 4QLGA 3KY8A 2JYBA 4F3WA 3K2HA 5JA3A 3FL8A 3FQVA 3NXRA 3SRWX 3CD2A 1LUDA 3FREX 1DR6A 1RA3A 2KGKA 1RF7A 5CW6A 2D5NA 3NZAX 4KY8A 5E8QA 4HOGA 4PDJA 1WWRA 1DHJA 2QLCA 3OCHA 3K45A 4HA7A 4KLXA 3SAIA 4DFRA 4LAEX 5HT5A 3DL6A 3SGYA 1VDRA 3SA1A 5HPBA 1DREA 1IA1A 3F91A 1PD9A 3D80A 1KLKA 2W3WA 4Q0EA 4QLFA 2QK8A 2HM9A 3RZVA 3DG8A 3DRCA 4DP3A 3NXXA 3RZUA 4KY4A 4E0QA 1RA1A 1ZCZA 5DFRA 5DXVA 3S9UA 3FL9A 1J3IA 4FHBA 2NYTA 2W4LA 4KM2A 3DGAA 4KYAA 6DFRA 4KL9A 2O3KA 3SA2A 1DR5A 3FY8X 3L3RA 4XT8A 1DRFA 4NX7A 4P3QA 3F0UX 2B1IA 3ZPCA 4FGGA 2P8RA 4OCMB 3ZEFB 1LY4A 3KGYA 4EILA 1M79A 2OBCA 2FR6A 1RH3A 1S3YA 4XT7A 2B3ZA 1JOLA 1TDRA 4OCNA 1U72A 4OCLB 3FRAX 1OZ0A 2H2QA 1RE7A 5HI6A 3IJFX 2RPZA 5U27A 3JW5A 7DFRA 1R5TA 4PQTA 5CCCA 4M7VA 3QYLA 2INQA 4ZD4A 4M6LA 3GI2A 3BH1A 1YSBA 1DG7A 1CTUA 3JWCA 4HOEA 1U70A 4P68A 1UX1A 1KMSA 4WIFA 1RX8A 1DR4A 1U71A 1S3VA 3CSEA 2HQPA 1PKXA 4KAKA 4X5IA 3JTWA 2FR5A 1BOZA 4MS7A 1M78A 2BLCA 4H96A 2ZZAA 4EJ1A 1KMVA 2DRCA 3ZPGA 3GHWA 1DR3A 3OCQA 1D1GA 4XT6A 1OHKA 3N0HA 3UM8A 3TQ8A 1YHOA 1HFPA 4X5JA 3DATA 4XT5A 3NXYA 1ZDRA 2D30A 4GGMX 3TQAA 4H95A 3QLXA 3DFRA 1RX4A 4LAHX 3FYVX 4EIGA 4P3RA 2HVVA 4QHVA 4MSJA 2ZNVA 4WIGA 1JTKA 5JG0X 1PDBA 3KJSA 3MPZA 3JWMA 1HFRA 3S7AA 4O8XB 3NZ9X 4FGHA 3FY9X 4PTJA 4A1OA 4ELHA 1QZFA 3F8ZA 4MSQA 1DRAA 2FZIA 1RX5A 1VK9A 4ILGC 4PSYA 2ANQA 3TQBA 4MSMA 3B8FA 1DF7A 4XE6X 1SEJA 4KM0A 1G8MA 4M7UA 4DPHA 3F0XX 4KBNA 4O8YB 3LG4A 4GH8A 2W9GA 4BGDC 3QYOA 3SRUX 4CD2A 1DR7A 3E0BA 3FQZA 1MQ0A 4HOFA 1OI0A 2ZNRA 1YSDA 3FRBX 5U26A 2HVWA 3INVA 4OR7A 4DDRA 3QL0A 2O95A 1J3JA 4OCMA 3HBBA 1MVSA 3SBGA 1AO8A 2L28A 1R5XA 3DMOA 1AI9A 4G8ZX 4ZFTA 4OCLA 3F0SX 2W9SA 3D84X 3EEJA 3SRRX 5HUIA 1RX9A 1IA2A 3SRQX 1J3KA 3NZDA 3GHCA 3K74A 4EG2A 3QG2A 2AZNA 3FRDX 4H98A 2P4GA 4IXFX 1JOMA 3NU0A 3NTZA 4OWPB 3EIGA 1DLSA 2Z3HA 1DRBA 4I1NA 5M52C 5HQYA 4IXED 1RX2A 3TD8A 4IXGX 3S3VA 3G8QA 2IU3A 2FZHA 2DHFA 3FQOA 2OIPA 4KJLA 4I43B 4P66A 2O7PA 2PW9A 4P9CA 1CTTA 1DAJA 3JSUA 1MVTA 4LCNA 4J6EA 3IRNA 4OSGA 4H97A 4HRWA 4HRQA 2C2SA 4XECX 4RGCA 3IRMA 1RC4A 3EX8A 1UAQA 1WN5A 1DLRA 3FS6A 3DL5A 3F0BX 4M2XA 1AF2A 2IU0A 4Q67A 1HFQA 3R33A 5EAJA 2BLAA 4P9EA 5C2OA 2GD9A 2ITHA 2W9TA 4PSSA 3JVXA 4O8XA 3KJRA 2W3MA 4X5FA 3ROAA 2BL9A 3KFYA 3FYWX 5M59B 1RX7A 1RX1A 3UM6A 2Z3JA 5HSRA 4LAGX 3DAUA 4X5GA 1P4RA 1CD2A 4ZFRA 1DYJA 5ECCA 1Z3AA 4LD4A 1BZFA 4D10F 2FZJA 2NX8A 1DR2A 3NZBX 4O8YA 2O96A 1M9NA 1RG7A 3QLWA 5HVEA 3HJ3A 4PTHA 3FQ0A 4KJJA 5CC9A 5DCAJ 4LCOA 1RX3A 1DIUA 1RA9A 3SR5X 3NXVA 1DG5A 4DPDA 4TU5X 2D0KA 5HVBA 1S3WA 4NX6A 4ELFA 1UWZA 1DDSA 3JW3A 1RD7A 4KFJA 4QLEA 1RB7A 3IX9A 3ZZMA 1THZA 2P87A 4KNEA 3GHVA
chains in the Genus database with same CATH topology
3M09A 4K1RA 3M08A 3CLBA 1LY3A 1DG8A 1DRHA 1DHFA 3QGTA 3NXTA 4Q6AA 4HA9A 3F8YA 4OWPA 2LF1A 3NZ6X 4EIZA 3TQ9A 1WKQA 4KITC 4P9DA 2HXVA 2XW7A 3JWFA 3EEKA 3EELA 4PSTA 4ELEA 1S3UA 2C2TA 3FQFA 1UX0A 4M6KA 5ECXA 4QJCA 3QFXA 2G6VA 3NXOA 1WN6A 3FRFX 1RA8A 2Z3GA 4I13A 2B3JA 5HF2X 1DYHA 3IA5A 4QFTA 1DYIA 3K47A 2OG4A 4X5HA 1DISA 3FQCA 4XRBA 2CIGA 3Q1HA 2W3VA 1PD8A 3OJ6A 3SQYX 1ZABA 3F0VX 3IA4A 3DH1A 4Q0DA 4LEKX 2Z3IA 3QLRA 1CZ3A 5HF0X 3RO9A 3JWKA 1M7AA 3I3RA 4G95A 3IROA 4QJZD 1RB3A 1RB2A 2ANOA 3QLSA 4XT4A 1DHIA 1DR1A 1P6OA 5HQZA 1DYRA 4KEBA 5GAOA 3SRSX 4M6JA 3QLYA 4LCPA 2W9HA 4OCNB 1ALNA 3OAFA 4JXEA 4ELGA 4G3MA 3QLZA 2W3AA 5FDAA 2BLBA 4QI9A 2G84A 3SH2A 2KKSA 3F0QX 3E1UA 1OX7A 8DFRA 4KJKA 1VJ3A 1OHJA 1VQ2A 1RA2A 3CL9A 3NRRA 1RX6A 4ELBA 4LC5A 4ECKA 4F7OA 3UM5A 1AOEA 5HT4A 3EEMA 4KD7A 2KCQA 3RG9A 3QL3A 1IA4A 1DDRA 2CD2A 4MSDA 1E26A 3GYFA 4LD2A 5HSUA 1IA3A 4NQLA 3NZCX 2W3BA 2A8NA 3R2NA 4ZD5A 3VCOA 1JUVA 1TIYA 3I8AX 4QLGA 3KY8A 2JYBA 4F3WA 3K2HA 5JA3A 3FL8A 3FQVA 3NXRA 3SRWX 3CD2A 1LUDA 3FREX 1DR6A 1RA3A 2KGKA 1RF7A 5CW6A 2D5NA 3NZAX 4KY8A 5E8QA 4HOGA 4PDJA 1WWRA 1DHJA 2QLCA 3OCHA 3K45A 4HA7A 4KLXA 3SAIA 4DFRA 4LAEX 5HT5A 3DL6A 3SGYA 1VDRA 3SA1A 5HPBA 1DREA 1IA1A 3F91A 1PD9A 3D80A 1KLKA 2W3WA 4Q0EA 4QLFA 2QK8A 2HM9A 3RZVA 3DG8A 3DRCA 4DP3A 3NXXA 3RZUA 4KY4A 4E0QA 1RA1A 5DFRA 5DXVA 3S9UA 3FL9A 1J3IA 4FHBA 2NYTA 2W4LA 4KM2A 3DGAA 4KYAA 6DFRA 4KL9A 2O3KA 3SA2A 1DR5A 3FY8X 3L3RA 4XT8A 1DRFA 4NX7A 4P3QA 3F0UX 3ZPCA 4FGGA 2P8RA 4OCMB 3ZEFB 1LY4A 3KGYA 4EILA 1M79A 2OBCA 2FR6A 1RH3A 1S3YA 4XT7A 2B3ZA 1JOLA 1TDRA 4OCNA 1U72A 4OCLB 3FRAX 2H2QA 1RE7A 5HI6A 3IJFX 2RPZA 5U27A 3JW5A 7DFRA 1R5TA 4PQTA 5CCCA 4M7VA 3QYLA 2INQA 4ZD4A 4M6LA 3GI2A 1YSBA 1DG7A 1CTUA 3JWCA 4HOEA 1U70A 4P68A 1UX1A 1KMSA 4WIFA 1RX8A 1DR4A 1U71A 1S3VA 3CSEA 2HQPA 4KAKA 4X5IA 3JTWA 2FR5A 1BOZA 4MS7A 1M78A 2BLCA 4H96A 2ZZAA 4EJ1A 1KMVA 2DRCA 3ZPGA 3GHWA 1DR3A 3OCQA 1D1GA 4XT6A 1OHKA 3N0HA 3UM8A 3TQ8A 1YHOA 1HFPA 4X5JA 3DATA 4XT5A 3NXYA 1ZDRA 2D30A 3TQAA 4H95A 3QLXA 3DFRA 1RX4A 4LAHX 3FYVX 4EIGA 4P3RA 2HVVA 4QHVA 4MSJA 2ZNVA 4WIGA 1JTKA 5JG0X 1PDBA 3KJSA 3MPZA 3JWMA 1HFRA 3S7AA 4O8XB 3NZ9X 4FGHA 3FY9X 4PTJA 4ELHA 1QZFA 3F8ZA 4MSQA 1DRAA 2FZIA 1RX5A 4ILGC 4PSYA 2ANQA 3TQBA 4MSMA 3B8FA 1DF7A 4XE6X 1SEJA 4KM0A 4M7UA 4DPHA 3F0XX 4KBNA 4O8YB 3LG4A 4GH8A 2W9GA 4BGDC 3QYOA 3SRUX 4CD2A 1DR7A 3E0BA 3FQZA 1MQ0A 4HOFA 1OI0A 2ZNRA 1YSDA 3FRBX 5U26A 2HVWA 3INVA 4OR7A 4DDRA 3QL0A 2O95A 1J3JA 4OCMA 3HBBA 1MVSA 3SBGA 1AO8A 2L28A 1R5XA 3DMOA 1AI9A 4G8ZX 4ZFTA 4OCLA 3F0SX 2W9SA 3D84X 3EEJA 3SRRX 5HUIA 1RX9A 1IA2A 3SRQX 1J3KA 3NZDA 3GHCA 3K74A 4EG2A 3QG2A 2AZNA 3FRDX 4H98A 2P4GA 4IXFX 1JOMA 3NU0A 3NTZA 4OWPB 3EIGA 1DLSA 2Z3HA 1DRBA 4I1NA 5M52C 5HQYA 4IXED 1RX2A 3TD8A 4IXGX 3S3VA 3G8QA 2FZHA 2DHFA 3FQOA 2OIPA 4KJLA 4I43B 4P66A 2O7PA 2PW9A 4P9CA 1CTTA 1DAJA 3JSUA 1MVTA 4LCNA 3IRNA 4OSGA 4H97A 4HRWA 4HRQA 2C2SA 4XECX 4RGCA 3IRMA 1RC4A 3EX8A 1UAQA 1WN5A 1DLRA 3FS6A 3DL5A 3F0BX 4M2XA 1AF2A 4Q67A 1HFQA 3R33A 5EAJA 2BLAA 4P9EA 5C2OA 2GD9A 2ITHA 2W9TA 4PSSA 3JVXA 4O8XA 3KJRA 2W3MA 4X5FA 3ROAA 2BL9A 3KFYA 3FYWX 5M59B 1RX7A 1RX1A 3UM6A 2Z3JA 5HSRA 4LAGX 3DAUA 4X5GA 1CD2A 4ZFRA 1DYJA 5ECCA 1Z3AA 4LD4A 1BZFA 4D10F 2FZJA 2NX8A 1DR2A 3NZBX 4O8YA 2O96A 1RG7A 3QLWA 5HVEA 3HJ3A 4PTHA 3FQ0A 4KJJA 5CC9A 5DCAJ 4LCOA 1RX3A 1DIUA 1RA9A 3SR5X 3NXVA 1DG5A 4DPDA 4TU5X 2D0KA 5HVBA 1S3WA 4NX6A 4ELFA 1UWZA 1DDSA 3JW3A 1RD7A 4KFJA 4QLEA 1RB7A 3IX9A 2P87A 4KNEA 3GHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M09 A;  4K1R A;  3M08 A;  3CLB A;  1LY3 A;  1DG8 A;  1DRH A;  1DHF A;  3QGT A;  3NXT A;  4Q6A A;  4HA9 A;  3F8Y A;  4OWP A;  2LF1 A;  3NZ6 X;  4EIZ A;  3TQ9 A;  1WKQ A;  4KIT C;  4P9D A;  2HXV A;  2XW7 A;  3JWF A;  3EEK A;  3EEL A;  4PST A;  4ELE A;  1S3U A;  2C2T A;  3FQF A;  1UX0 A;  4M6K A;  5ECX A;  4QJC A;  3QFX A;  2G6V A;  3NXO A;  1WN6 A;  3FRF X;  1RA8 A;  2Z3G A;  4I13 A;  2B3J A;  5HF2 X;  1DYH A;  3IA5 A;  4QFT A;  1DYI A;  3K47 A;  2OG4 A;  4X5H A;  1DIS A;  3FQC A;  4XRB A;  2CIG A;  3Q1H A;  2W3V A;  1PD8 A;  3OJ6 A;  3SQY X;  1ZAB A;  3F0V X;  3IA4 A;  3DH1 A;  4Q0D A;  4LEK X;  2Z3I A;  3QLR A;  1CZ3 A;  5HF0 X;  3RO9 A;  3JWK A;  1M7A A;  3I3R A;  4G95 A;  3IRO A;  4QJZ D;  1RB3 A;  1RB2 A;  2ANO A;  3QLS A;  4XT4 A;  1DHI A;  1DR1 A;  1P6O A;  5HQZ A;  1DYR A;  4KEB A;  5GAO A;  3SRS X;  4M6J A;  3QLY A;  4LCP A;  2W9H A;  4OCN B;  1ALN A;  3OAF A;  4JXE A;  4ELG A;  4G3M A;  3QLZ A;  2W3A A;  5FDA A;  2BLB A;  4QI9 A;  2G84 A;  3SH2 A;  2KKS A;  3F0Q X;  3E1U A;  1OX7 A;  8DFR A;  4KJK A;  1VJ3 A;  1OHJ A;  1VQ2 A;  1RA2 A;  3CL9 A;  3NRR A;  1RX6 A;  4ELB A;  4LC5 A;  4ECK A;  4F7O A;  3UM5 A;  1AOE A;  5HT4 A;  3EEM A;  4KD7 A;  2KCQ A;  3RG9 A;  3QL3 A;  1IA4 A;  1DDR A;  2CD2 A;  4MSD A;  1E26 A;  3GYF A;  4LD2 A;  5HSU A;  1IA3 A;  4NQL A;  3NZC X;  2W3B A;  2A8N A;  3R2N A;  4ZD5 A;  3VCO A;  1JUV A;  1TIY A;  3I8A X;  4QLG A;  3KY8 A;  2JYB A;  4F3W A;  3K2H A;  5JA3 A;  3FL8 A;  3FQV A;  3NXR A;  3SRW X;  3CD2 A;  1LUD A;  3FRE X;  1DR6 A;  1RA3 A;  2KGK A;  1RF7 A;  5CW6 A;  2D5N A;  3NZA X;  4KY8 A;  5E8Q A;  4HOG A;  4PDJ A;  1WWR A;  1DHJ A;  2QLC A;  3OCH A;  3K45 A;  4HA7 A;  4KLX A;  3SAI A;  4DFR A;  4LAE X;  5HT5 A;  3DL6 A;  3SGY A;  1VDR A;  3SA1 A;  5HPB A;  1DRE A;  1IA1 A;  3F91 A;  1PD9 A;  3D80 A;  1KLK A;  2W3W A;  4Q0E A;  4QLF A;  2QK8 A;  2HM9 A;  3RZV A;  3DG8 A;  3DRC A;  4DP3 A;  3NXX A;  3RZU A;  4KY4 A;  4E0Q A;  1RA1 A;  5DFR A;  5DXV A;  3S9U A;  3FL9 A;  1J3I A;  4FHB A;  2NYT A;  2W4L A;  4KM2 A;  3DGA A;  4KYA A;  6DFR A;  4KL9 A;  2O3K A;  3SA2 A;  1DR5 A;  3FY8 X;  3L3R A;  4XT8 A;  1DRF A;  4NX7 A;  4P3Q A;  3F0U X;  3ZPC A;  4FGG A;  2P8R A;  4OCM B;  3ZEF B;  1LY4 A;  3KGY A;  4EIL A;  1M79 A;  2OBC A;  2FR6 A;  1RH3 A;  1S3Y A;  4XT7 A;  2B3Z A;  1JOL A;  1TDR A;  4OCN A;  1U72 A;  4OCL B;  3FRA X;  2H2Q A;  1RE7 A;  5HI6 A;  3IJF X;  2RPZ A;  5U27 A;  3JW5 A;  7DFR A;  1R5T A;  4PQT A;  5CCC A;  4M7V A;  3QYL A;  2INQ A;  4ZD4 A;  4M6L A;  3GI2 A;  1YSB A;  1DG7 A;  1CTU A;  3JWC A;  4HOE A;  1U70 A;  4P68 A;  1UX1 A;  1KMS A;  4WIF A;  1RX8 A;  1DR4 A;  1U71 A;  1S3V A;  3CSE A;  2HQP A;  4KAK A;  4X5I A;  3JTW A;  2FR5 A;  1BOZ A;  4MS7 A;  1M78 A;  2BLC A;  4H96 A;  2ZZA A;  4EJ1 A;  1KMV A;  2DRC A;  3ZPG A;  3GHW A;  1DR3 A;  3OCQ A;  1D1G A;  4XT6 A;  1OHK A;  3N0H A;  3UM8 A;  3TQ8 A;  1YHO A;  1HFP A;  4X5J A;  3DAT A;  4XT5 A;  3NXY A;  1ZDR A;  2D30 A;  3TQA A;  4H95 A;  3QLX A;  3DFR A;  1RX4 A;  4LAH X;  3FYV X;  4EIG A;  4P3R A;  2HVV A;  4QHV A;  4MSJ A;  2ZNV A;  4WIG A;  1JTK A;  5JG0 X;  1PDB A;  3KJS A;  3MPZ A;  3JWM A;  1HFR A;  3S7A A;  4O8X B;  3NZ9 X;  4FGH A;  3FY9 X;  4PTJ A;  4ELH A;  1QZF A;  3F8Z A;  4MSQ A;  1DRA A;  2FZI A;  1RX5 A;  4ILG C;  4PSY A;  2ANQ A;  3TQB A;  4MSM A;  3B8F A;  1DF7 A;  4XE6 X;  1SEJ A;  4KM0 A;  4M7U A;  4DPH A;  3F0X X;  4KBN A;  4O8Y B;  3LG4 A;  4GH8 A;  2W9G A;  4BGD C;  3QYO A;  3SRU X;  4CD2 A;  1DR7 A;  3E0B A;  3FQZ A;  1MQ0 A;  4HOF A;  1OI0 A;  2ZNR A;  1YSD A;  3FRB X;  5U26 A;  2HVW A;  3INV A;  4OR7 A;  4DDR A;  3QL0 A;  2O95 A;  1J3J A;  4OCM A;  3HBB A;  1MVS A;  3SBG A;  1AO8 A;  2L28 A;  1R5X A;  3DMO A;  1AI9 A;  4G8Z X;  4ZFT A;  4OCL A;  3F0S X;  2W9S A;  3D84 X;  3EEJ A;  3SRR X;  5HUI A;  1RX9 A;  1IA2 A;  3SRQ X;  1J3K A;  3NZD A;  3GHC A;  3K74 A;  4EG2 A;  3QG2 A;  2AZN A;  3FRD X;  4H98 A;  2P4G A;  4IXF X;  1JOM A;  3NU0 A;  3NTZ A;  4OWP B;  3EIG A;  1DLS A;  2Z3H A;  1DRB A;  4I1N A;  5M52 C;  5HQY A;  4IXE D;  1RX2 A;  3TD8 A;  4IXG X;  3S3V A;  3G8Q A;  2FZH A;  2DHF A;  3FQO A;  2OIP A;  4KJL A;  4I43 B;  4P66 A;  2O7P A;  2PW9 A;  4P9C A;  1CTT A;  1DAJ A;  3JSU A;  1MVT A;  4LCN A;  3IRN A;  4OSG A;  4H97 A;  4HRW A;  4HRQ A;  2C2S A;  4XEC X;  4RGC A;  3IRM A;  1RC4 A;  3EX8 A;  1UAQ A;  1WN5 A;  1DLR A;  3FS6 A;  3DL5 A;  3F0B X;  4M2X A;  1AF2 A;  4Q67 A;  1HFQ A;  3R33 A;  5EAJ A;  2BLA A;  4P9E A;  5C2O A;  2GD9 A;  2ITH A;  2W9T A;  4PSS A;  3JVX A;  4O8X A;  3KJR A;  2W3M A;  4X5F A;  3ROA A;  2BL9 A;  3KFY A;  3FYW X;  5M59 B;  1RX7 A;  1RX1 A;  3UM6 A;  2Z3J A;  5HSR A;  4LAG X;  3DAU A;  4X5G A;  1CD2 A;  4ZFR A;  1DYJ A;  5ECC A;  1Z3A A;  4LD4 A;  1BZF A;  4D10 F;  2FZJ A;  2NX8 A;  1DR2 A;  3NZB X;  4O8Y A;  2O96 A;  1RG7 A;  3QLW A;  5HVE A;  3HJ3 A;  4PTH A;  3FQ0 A;  4KJJ A;  5CC9 A;  5DCA J;  4LCO A;  1RX3 A;  1DIU A;  1RA9 A;  3SR5 X;  3NXV A;  1DG5 A;  4DPD A;  4TU5 X;  2D0K A;  5HVB A;  1S3W A;  4NX6 A;  4ELF A;  1UWZ A;  1DDS A;  3JW3 A;  1RD7 A;  4KFJ A;  4QLE A;  1RB7 A;  3IX9 A;  2P87 A;  4KNE A;  3GHV A; 
#chains in the Genus database with same CATH topology
 3M09 A;  4K1R A;  3M08 A;  3CLB A;  3VX8 A;  1DG8 A;  1LY3 A;  1DRH A;  1DHF A;  3QGT A;  3NXT A;  4Q6A A;  4HA9 A;  3F8Y A;  4OWP A;  2LF1 A;  3NZ6 X;  4EIZ A;  1PL0 A;  3TQ9 A;  1WKQ A;  4KIT C;  4P9D A;  2HXV A;  2XW7 A;  3JWF A;  3EEK A;  3EEL A;  4PST A;  4ELE A;  1S3U A;  2C2T A;  3FQF A;  1UX0 A;  4M6K A;  5ECX A;  4QJC A;  3QFX A;  2G6V A;  3NXO A;  1WN6 A;  3FRF X;  1RA8 A;  2Z3G A;  4I13 A;  2B3J A;  5HF2 X;  1DYH A;  3IA5 A;  4QFT A;  1DYI A;  3K47 A;  2OG4 A;  4X5H A;  1DIS A;  3FQC A;  4XRB A;  2CIG A;  3Q1H A;  2W3V A;  1PD8 A;  3OJ6 A;  3SQY X;  1ZAB A;  3F0V X;  3IA4 A;  2B1G A;  3DH1 A;  4Q0D A;  4LEK X;  2Z3I A;  3QLR A;  1CZ3 A;  5HF0 X;  3RO9 A;  3JWK A;  1M7A A;  3I3R A;  4G95 A;  3IRO A;  4QJZ D;  1RB3 A;  1RB2 A;  2ANO A;  3QLS A;  4XT4 A;  1DHI A;  1DR1 A;  1P6O A;  5HQZ A;  1DYR A;  4KEB A;  5GAO A;  3SRS X;  4M6J A;  3QLY A;  4LCP A;  2W9H A;  4OCN B;  1ALN A;  3OAF A;  4JXE A;  4ELG A;  4G3M A;  3QLZ A;  2W3A A;  5FDA A;  2BLB A;  4QI9 A;  2G84 A;  3SH2 A;  2KKS A;  3F0Q X;  3E1U A;  1OX7 A;  8DFR A;  4KJK A;  1VJ3 A;  1OHJ A;  1VQ2 A;  1RA2 A;  3CL9 A;  3NRR A;  1RX6 A;  4ELB A;  4LC5 A;  4ECK A;  4F7O A;  3UM5 A;  1AOE A;  5HT4 A;  3EEM A;  4KD7 A;  2KCQ A;  3RG9 A;  3QL3 A;  1IA4 A;  1DDR A;  2CD2 A;  4MSD A;  1E26 A;  3GYF A;  4LD2 A;  5HSU A;  1IA3 A;  4EHI A;  4NQL A;  3NZC X;  2W3B A;  2A8N A;  3R2N A;  4ZD5 A;  3VCO A;  1JUV A;  1TIY A;  3I8A X;  4QLG A;  3KY8 A;  2JYB A;  4F3W A;  3K2H A;  5JA3 A;  3FL8 A;  3FQV A;  3NXR A;  3SRW X;  3CD2 A;  1LUD A;  3FRE X;  1DR6 A;  1RA3 A;  2KGK A;  1RF7 A;  5CW6 A;  2D5N A;  3NZA X;  4KY8 A;  5E8Q A;  4HOG A;  4PDJ A;  1WWR A;  1DHJ A;  2QLC A;  3OCH A;  3K45 A;  4HA7 A;  4KLX A;  3SAI A;  4DFR A;  4LAE X;  5HT5 A;  3DL6 A;  3SGY A;  1VDR A;  3SA1 A;  5HPB A;  1DRE A;  1IA1 A;  3F91 A;  1PD9 A;  3D80 A;  1KLK A;  2W3W A;  4Q0E A;  4QLF A;  2QK8 A;  2HM9 A;  3RZV A;  3DG8 A;  3DRC A;  4DP3 A;  3NXX A;  3RZU A;  4KY4 A;  4E0Q A;  1RA1 A;  1ZCZ A;  5DFR A;  5DXV A;  3S9U A;  3FL9 A;  1J3I A;  4FHB A;  2NYT A;  2W4L A;  4KM2 A;  3DGA A;  4KYA A;  6DFR A;  4KL9 A;  2O3K A;  3SA2 A;  1DR5 A;  3FY8 X;  3L3R A;  4XT8 A;  1DRF A;  4NX7 A;  4P3Q A;  3F0U X;  2B1I A;  3ZPC A;  4FGG A;  2P8R A;  4OCM B;  3ZEF B;  1LY4 A;  3KGY A;  4EIL A;  1M79 A;  2OBC A;  2FR6 A;  1RH3 A;  1S3Y A;  4XT7 A;  2B3Z A;  1JOL A;  1TDR A;  4OCN A;  1U72 A;  4OCL B;  3FRA X;  1OZ0 A;  2H2Q A;  1RE7 A;  5HI6 A;  3IJF X;  2RPZ A;  5U27 A;  3JW5 A;  7DFR A;  1R5T A;  4PQT A;  5CCC A;  4M7V A;  3QYL A;  2INQ A;  4ZD4 A;  4M6L A;  3GI2 A;  3BH1 A;  1YSB A;  1DG7 A;  1CTU A;  3JWC A;  4HOE A;  1U70 A;  4P68 A;  1UX1 A;  1KMS A;  4WIF A;  1RX8 A;  1DR4 A;  1U71 A;  1S3V A;  3CSE A;  2HQP A;  1PKX A;  4KAK A;  4X5I A;  3JTW A;  2FR5 A;  1BOZ A;  4MS7 A;  1M78 A;  2BLC A;  4H96 A;  2ZZA A;  4EJ1 A;  1KMV A;  2DRC A;  3ZPG A;  3GHW A;  1DR3 A;  3OCQ A;  1D1G A;  4XT6 A;  1OHK A;  3N0H A;  3UM8 A;  3TQ8 A;  1YHO A;  1HFP A;  4X5J A;  3DAT A;  4XT5 A;  3NXY A;  1ZDR A;  2D30 A;  4GGM X;  3TQA A;  4H95 A;  3QLX A;  3DFR A;  1RX4 A;  4LAH X;  3FYV X;  4EIG A;  4P3R A;  2HVV A;  4QHV A;  4MSJ A;  2ZNV A;  4WIG A;  1JTK A;  5JG0 X;  1PDB A;  3KJS A;  3MPZ A;  3JWM A;  1HFR A;  3S7A A;  4O8X B;  3NZ9 X;  4FGH A;  3FY9 X;  4PTJ A;  4A1O A;  4ELH A;  1QZF A;  3F8Z A;  4MSQ A;  1DRA A;  2FZI A;  1RX5 A;  1VK9 A;  4ILG C;  4PSY A;  2ANQ A;  3TQB A;  4MSM A;  3B8F A;  1DF7 A;  4XE6 X;  1SEJ A;  4KM0 A;  1G8M A;  4M7U A;  4DPH A;  3F0X X;  4KBN A;  4O8Y B;  3LG4 A;  4GH8 A;  2W9G A;  4BGD C;  3QYO A;  3SRU X;  4CD2 A;  1DR7 A;  3E0B A;  3FQZ A;  1MQ0 A;  4HOF A;  1OI0 A;  2ZNR A;  1YSD A;  3FRB X;  5U26 A;  2HVW A;  3INV A;  4OR7 A;  4DDR A;  3QL0 A;  2O95 A;  1J3J A;  4OCM A;  3HBB A;  1MVS A;  3SBG A;  1AO8 A;  2L28 A;  1R5X A;  3DMO A;  1AI9 A;  4G8Z X;  4ZFT A;  4OCL A;  3F0S X;  2W9S A;  3D84 X;  3EEJ A;  3SRR X;  5HUI A;  1RX9 A;  1IA2 A;  3SRQ X;  1J3K A;  3NZD A;  3GHC A;  3K74 A;  4EG2 A;  3QG2 A;  2AZN A;  3FRD X;  4H98 A;  2P4G A;  4IXF X;  1JOM A;  3NU0 A;  3NTZ A;  4OWP B;  3EIG A;  1DLS A;  2Z3H A;  1DRB A;  4I1N A;  5M52 C;  5HQY A;  4IXE D;  1RX2 A;  3TD8 A;  4IXG X;  3S3V A;  3G8Q A;  2IU3 A;  2FZH A;  2DHF A;  3FQO A;  2OIP A;  4KJL A;  4I43 B;  4P66 A;  2O7P A;  2PW9 A;  4P9C A;  1CTT A;  1DAJ A;  3JSU A;  1MVT A;  4LCN A;  4J6E A;  3IRN A;  4OSG A;  4H97 A;  4HRW A;  4HRQ A;  2C2S A;  4XEC X;  4RGC A;  3IRM A;  1RC4 A;  3EX8 A;  1UAQ A;  1WN5 A;  1DLR A;  3FS6 A;  3DL5 A;  3F0B X;  4M2X A;  1AF2 A;  2IU0 A;  4Q67 A;  1HFQ A;  3R33 A;  5EAJ A;  2BLA A;  4P9E A;  5C2O A;  2GD9 A;  2ITH A;  2W9T A;  4PSS A;  3JVX A;  4O8X A;  3KJR A;  2W3M A;  4X5F A;  3ROA A;  2BL9 A;  3KFY A;  3FYW X;  5M59 B;  1RX7 A;  1RX1 A;  3UM6 A;  2Z3J A;  5HSR A;  4LAG X;  3DAU A;  4X5G A;  1P4R A;  1CD2 A;  4ZFR A;  1DYJ A;  5ECC A;  1Z3A A;  4LD4 A;  1BZF A;  4D10 F;  2FZJ A;  2NX8 A;  1DR2 A;  3NZB X;  4O8Y A;  2O96 A;  1M9N A;  1RG7 A;  3QLW A;  5HVE A;  3HJ3 A;  4PTH A;  3FQ0 A;  4KJJ A;  5CC9 A;  5DCA J;  4LCO A;  1RX3 A;  1DIU A;  1RA9 A;  3SR5 X;  3NXV A;  1DG5 A;  4DPD A;  4TU5 X;  2D0K A;  5HVB A;  1S3W A;  4NX6 A;  4ELF A;  1UWZ A;  1DDS A;  3JW3 A;  1RD7 A;  4KFJ A;  4QLE A;  1RB7 A;  3IX9 A;  3ZZM A;  1THZ A;  2P87 A;  4KNE A;  3GHV A; 
#chains in the Genus database with same CATH homology
 3M09 A;  4K1R A;  3M08 A;  3CLB A;  1LY3 A;  1DG8 A;  1DRH A;  1DHF A;  3QGT A;  3NXT A;  4Q6A A;  4HA9 A;  3F8Y A;  4OWP A;  2LF1 A;  3NZ6 X;  4EIZ A;  3TQ9 A;  1WKQ A;  4KIT C;  4P9D A;  2HXV A;  2XW7 A;  3JWF A;  3EEK A;  3EEL A;  4PST A;  4ELE A;  1S3U A;  2C2T A;  3FQF A;  1UX0 A;  4M6K A;  5ECX A;  4QJC A;  3QFX A;  2G6V A;  3NXO A;  1WN6 A;  3FRF X;  1RA8 A;  2Z3G A;  4I13 A;  2B3J A;  5HF2 X;  1DYH A;  3IA5 A;  4QFT A;  1DYI A;  3K47 A;  2OG4 A;  4X5H A;  1DIS A;  3FQC A;  4XRB A;  2CIG A;  3Q1H A;  2W3V A;  1PD8 A;  3OJ6 A;  3SQY X;  1ZAB A;  3F0V X;  3IA4 A;  3DH1 A;  4Q0D A;  4LEK X;  2Z3I A;  3QLR A;  1CZ3 A;  5HF0 X;  3RO9 A;  3JWK A;  1M7A A;  3I3R A;  4G95 A;  3IRO A;  4QJZ D;  1RB3 A;  1RB2 A;  2ANO A;  3QLS A;  4XT4 A;  1DHI A;  1DR1 A;  1P6O A;  5HQZ A;  1DYR A;  4KEB A;  5GAO A;  3SRS X;  4M6J A;  3QLY A;  4LCP A;  2W9H A;  4OCN B;  1ALN A;  3OAF A;  4JXE A;  4ELG A;  4G3M A;  3QLZ A;  2W3A A;  5FDA A;  2BLB A;  4QI9 A;  2G84 A;  3SH2 A;  2KKS A;  3F0Q X;  3E1U A;  1OX7 A;  8DFR A;  4KJK A;  1VJ3 A;  1OHJ A;  1VQ2 A;  1RA2 A;  3CL9 A;  3NRR A;  1RX6 A;  4ELB A;  4LC5 A;  4ECK A;  4F7O A;  3UM5 A;  1AOE A;  5HT4 A;  3EEM A;  4KD7 A;  2KCQ A;  3RG9 A;  3QL3 A;  1IA4 A;  1DDR A;  2CD2 A;  4MSD A;  1E26 A;  3GYF A;  4LD2 A;  5HSU A;  1IA3 A;  4NQL A;  3NZC X;  2W3B A;  2A8N A;  3R2N A;  4ZD5 A;  3VCO A;  1JUV A;  1TIY A;  3I8A X;  4QLG A;  3KY8 A;  2JYB A;  4F3W A;  3K2H A;  5JA3 A;  3FL8 A;  3FQV A;  3NXR A;  3SRW X;  3CD2 A;  1LUD A;  3FRE X;  1DR6 A;  1RA3 A;  2KGK A;  1RF7 A;  5CW6 A;  2D5N A;  3NZA X;  4KY8 A;  5E8Q A;  4HOG A;  4PDJ A;  1WWR A;  1DHJ A;  2QLC A;  3OCH A;  3K45 A;  4HA7 A;  4KLX A;  3SAI A;  4DFR A;  4LAE X;  5HT5 A;  3DL6 A;  3SGY A;  1VDR A;  3SA1 A;  5HPB A;  1DRE A;  1IA1 A;  3F91 A;  1PD9 A;  3D80 A;  1KLK A;  2W3W A;  4Q0E A;  4QLF A;  2QK8 A;  2HM9 A;  3RZV A;  3DG8 A;  3DRC A;  4DP3 A;  3NXX A;  3RZU A;  4KY4 A;  4E0Q A;  1RA1 A;  5DFR A;  5DXV A;  3S9U A;  3FL9 A;  1J3I A;  4FHB A;  2NYT A;  2W4L A;  4KM2 A;  3DGA A;  4KYA A;  6DFR A;  4KL9 A;  2O3K A;  3SA2 A;  1DR5 A;  3FY8 X;  3L3R A;  4XT8 A;  1DRF A;  4NX7 A;  4P3Q A;  3F0U X;  3ZPC A;  4FGG A;  2P8R A;  4OCM B;  3ZEF B;  1LY4 A;  3KGY A;  4EIL A;  1M79 A;  2OBC A;  2FR6 A;  1RH3 A;  1S3Y A;  4XT7 A;  2B3Z A;  1JOL A;  1TDR A;  4OCN A;  1U72 A;  4OCL B;  3FRA X;  2H2Q A;  1RE7 A;  5HI6 A;  3IJF X;  2RPZ A;  5U27 A;  3JW5 A;  7DFR A;  1R5T A;  4PQT A;  5CCC A;  4M7V A;  3QYL A;  2INQ A;  4ZD4 A;  4M6L A;  3GI2 A;  1YSB A;  1DG7 A;  1CTU A;  3JWC A;  4HOE A;  1U70 A;  4P68 A;  1UX1 A;  1KMS A;  4WIF A;  1RX8 A;  1DR4 A;  1U71 A;  1S3V A;  3CSE A;  2HQP A;  4KAK A;  4X5I A;  3JTW A;  2FR5 A;  1BOZ A;  4MS7 A;  1M78 A;  2BLC A;  4H96 A;  2ZZA A;  4EJ1 A;  1KMV A;  2DRC A;  3ZPG A;  3GHW A;  1DR3 A;  3OCQ A;  1D1G A;  4XT6 A;  1OHK A;  3N0H A;  3UM8 A;  3TQ8 A;  1YHO A;  1HFP A;  4X5J A;  3DAT A;  4XT5 A;  3NXY A;  1ZDR A;  2D30 A;  3TQA A;  4H95 A;  3QLX A;  3DFR A;  1RX4 A;  4LAH X;  3FYV X;  4EIG A;  4P3R A;  2HVV A;  4QHV A;  4MSJ A;  2ZNV A;  4WIG A;  1JTK A;  5JG0 X;  1PDB A;  3KJS A;  3MPZ A;  3JWM A;  1HFR A;  3S7A A;  4O8X B;  3NZ9 X;  4FGH A;  3FY9 X;  4PTJ A;  4ELH A;  1QZF A;  3F8Z A;  4MSQ A;  1DRA A;  2FZI A;  1RX5 A;  4ILG C;  4PSY A;  2ANQ A;  3TQB A;  4MSM A;  3B8F A;  1DF7 A;  4XE6 X;  1SEJ A;  4KM0 A;  4M7U A;  4DPH A;  3F0X X;  4KBN A;  4O8Y B;  3LG4 A;  4GH8 A;  2W9G A;  4BGD C;  3QYO A;  3SRU X;  4CD2 A;  1DR7 A;  3E0B A;  3FQZ A;  1MQ0 A;  4HOF A;  1OI0 A;  2ZNR A;  1YSD A;  3FRB X;  5U26 A;  2HVW A;  3INV A;  4OR7 A;  4DDR A;  3QL0 A;  2O95 A;  1J3J A;  4OCM A;  3HBB A;  1MVS A;  3SBG A;  1AO8 A;  2L28 A;  1R5X A;  3DMO A;  1AI9 A;  4G8Z X;  4ZFT A;  4OCL A;  3F0S X;  2W9S A;  3D84 X;  3EEJ A;  3SRR X;  5HUI A;  1RX9 A;  1IA2 A;  3SRQ X;  1J3K A;  3NZD A;  3GHC A;  3K74 A;  4EG2 A;  3QG2 A;  2AZN A;  3FRD X;  4H98 A;  2P4G A;  4IXF X;  1JOM A;  3NU0 A;  3NTZ A;  4OWP B;  3EIG A;  1DLS A;  2Z3H A;  1DRB A;  4I1N A;  5M52 C;  5HQY A;  4IXE D;  1RX2 A;  3TD8 A;  4IXG X;  3S3V A;  3G8Q A;  2FZH A;  2DHF A;  3FQO A;  2OIP A;  4KJL A;  4I43 B;  4P66 A;  2O7P A;  2PW9 A;  4P9C A;  1CTT A;  1DAJ A;  3JSU A;  1MVT A;  4LCN A;  3IRN A;  4OSG A;  4H97 A;  4HRW A;  4HRQ A;  2C2S A;  4XEC X;  4RGC A;  3IRM A;  1RC4 A;  3EX8 A;  1UAQ A;  1WN5 A;  1DLR A;  3FS6 A;  3DL5 A;  3F0B X;  4M2X A;  1AF2 A;  4Q67 A;  1HFQ A;  3R33 A;  5EAJ A;  2BLA A;  4P9E A;  5C2O A;  2GD9 A;  2ITH A;  2W9T A;  4PSS A;  3JVX A;  4O8X A;  3KJR A;  2W3M A;  4X5F A;  3ROA A;  2BL9 A;  3KFY A;  3FYW X;  5M59 B;  1RX7 A;  1RX1 A;  3UM6 A;  2Z3J A;  5HSR A;  4LAG X;  3DAU A;  4X5G A;  1CD2 A;  4ZFR A;  1DYJ A;  5ECC A;  1Z3A A;  4LD4 A;  1BZF A;  4D10 F;  2FZJ A;  2NX8 A;  1DR2 A;  3NZB X;  4O8Y A;  2O96 A;  1RG7 A;  3QLW A;  5HVE A;  3HJ3 A;  4PTH A;  3FQ0 A;  4KJJ A;  5CC9 A;  5DCA J;  4LCO A;  1RX3 A;  1DIU A;  1RA9 A;  3SR5 X;  3NXV A;  1DG5 A;  4DPD A;  4TU5 X;  2D0K A;  5HVB A;  1S3W A;  4NX6 A;  4ELF A;  1UWZ A;  1DDS A;  3JW3 A;  1RD7 A;  4KFJ A;  4QLE A;  1RB7 A;  3IX9 A;  2P87 A;  4KNE A;  3GHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...