2HYNA

Complete ensemble of nmr structures of unphosphorylated human phospholamban pentamer
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
52
structure length
52
Chain Sequence
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of symmetric homo-oligomers by a complete search of symmetry configuration space, using NMR restraints and van der Waals packing.
pubmed doi rcsb
molecule keywords Cardiac phospholamban
molecule tags Membrane protein/signaling protein
source organism Homo sapiens
total genus 20
structure length 52
sequence length 52
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hynA00
2KB7P 2KYVA 1FJPA 1ZLLA 1N7LA 1FJKA 2HYNA 2M3BA
chains in the Genus database with same CATH superfamily
1SQVE 1T8ZA 2E75B 3LW5H 1YQ4C 3TGUD 5KAFH 2LKMA 3OAKA 1KYOD 1BCCE 1FC2C 1LNQA 3AEDC 4ASWA 2ZYDA 3WMM0 1QVFO 5AVSB 4DCKA 1NTKG 5AVYB 2IZ1A 1QX8A 4ZKUA 1A02F 2A45H 3MGNA 2C9NY 4WBAA 3RL0g 4YXDC 1ZR2A 1IFDA 1NTZG 1FZCA 2E74D 3AEGC 3NTNA 1SQQJ 3HUSB 4WVZA 4PV1C 3H1LG 2Y0CA 2O01H 1LP1A 3P8MC 5AW7B 1RY3A 3VP8A 2IBZG 2Q6QA 1JB0J 1S72P 1G2CB 1NTME 2V7QJ 1MV8A 5BVZA 1DX7A 5BU5A 3Q2YA 3AEFC 4YTPC 1AQTA 1FBMA 2G3AA 4K3AA 1OIPA 1SFCD 3TGUJ 1AV1A 1M1JB 3MP7B 2I1JA 1PP9G 1AFOA 3IF4A 5AVXB 4PJ0H 5AW3B 3PTZA 2JDIH 3CC2P 2WPQA 3QWOC 3P8CE 3E1RA 3D71A 2OYHB 3HTKA 2IYPA 1N7SC 3CWBD 1GK4A 4H0LB 3V2QA 2ZJSE 2GUVA 1AQ5A 1BGYG 4IL6H 5CBNA 1SQBK 3A0HE 3L71D 4DZOA 1IFPA 3CCLP 1JY2P 1KQGB 3H1KD 1LWUA 3A3YB 3L73E 5CCHC 3D6YA 1U57A 3WUTA 2BASA 3V4WA 3M0AA 1SQBG 3MUDC 2HPCA 2HLOA 1P84D 2QJKC 1URQB 1HWTC 3NFQA 3Q5PA 1WMKA 3GF3A 1L0LK 3VMAA 1SQPE 1CZQA 1KILB 1JY2O 2RN0A 3H1JG 1OVRA 1L0NK 5B66E 2QA4P 2WQYC 2ZVNB 3TGUE 1L0LD 3AE5C 3L70G 3MIWA 3CWBJ 1YJNP 4IL6X 2CK3H 4OGQD 4LLHA 5H2FE 1JO5A 4RESB 4LGDE 3OA7A 3L75G 4A7PA 3L71J 1MUUA 2KNCA 2QJPC 1OZHA 3VOPA 2LXBA 3H1KJ 2FYUK 3AEAC 3L74E 1IFIA 5TISE 1E79H 1GDTA 4BRYB 1GL2A 1GU4A 2FYUD 1AA0A 1LTJB 1NYHA 1FDOA 1EC5A 2YMYA 2M3EA 1UIXA 1YTZT 1A02J 1SVFA 4GODA 2JO1A 3K5BA 1N73C 3V2NA 1FU1A 1U7MA 2OYIB 3HE4B 1L0LJ 5L8RJ 2AXTH 1VF5D 3S1KA 1NAFA 2ZYGA 2D2CB 4ASVA 3KZIH 5AW0B 3VMYA 1RQUA 2Z4EA 2E75C 1JNMA 4C7NB 2WWWA 1YIJP 4WY4A 2QRXA 4L75A 1GMJA 2I1KA 4NPDA 2W6JH 1HTLC 2OTKE 3HRNA 2FYUJ 3FXDA 5AVZB 1HH0A 4NPFX 2AEMA 4UB8E 1HGZA 2A45I 4W7ZA 3L71E 1SQXD 1L4AB 3CXHH 1DH3A 4XE5B 3RK3D 3MHVA 3HUSC 1EDKA 3TNUB 3B71A 2NPSB 4ZNCA 4PV1B 3CCEP 3CPWO 1Q86Q 3B5NB 4JQ0D 5KAIH 1CW5A 1EZVD 2AEFA 3W67A 3H1HD 2IX7C 3I5CA 5K5GB 1DD3A 3AE7C 3WUVA 1M1JC 2O1JA 1SQVK 2WMMA 1J1EB 3A0BH 1KFNA 3GLMA 1NVOA 2HODB 2W8ZA 2OYHC 1USDA 1SQXJ 1H88A 1X9VA 3C1LA 4JPZB 1BCCD 4H0LC 3RK2B 3RGUA 1YYCA 1VDFA 5KLVG 1OXZA 1KN7A 4EDFA 3PRJA 3H1ID 4I2LC 1KILA 2A06G 2YO3A 2ZXEB 4H13B 1D7MA 5CJ4A 1PGPA 1LGHB 4RKUJ 5GTHE 2JP3A 4OH8B 3H1HJ 1NTMK 4HKZH 4ZMDA 3G9RA 2WSEH 1GL2D 5GTIH 3CLQA 2WSCH 2RMZA 3PHLA 1URQC 1SFCA 5KLIB 1H89A 1ZR4A 2XNXA 2WITA 3AE9C 1FJPA 3GHGB 1PGJA 3BCCE 3CCUP 1HUCA 3A5TA 2B87B 4BRYA 4U3FG 1S9KD 4B86A 1SP4A 5CJ0A 1BCCJ 3O6QB 5AVWB 1LT9B 3A7OA 1TU3F 1VPCA 5KAFE 2RH0A 3H1IJ 4TT3H 1NAYA 1BSNA 2P1JA 3FGAD 2N1TA 2R44A 3P8CD 3CCVP 3GMAA 4WY4D 3HE4A 1SQXE 3EFGA 2QJPB 4IFDK 3IAOA 2R5BA 1VQKP 1JMMA 1CSBA 2FBWC 2YNYA 3LIDA 1RE3A 1GW3A 3KQGA 1T2KD 1LTJC 4XFJA 1OX3A 2KZIA 3AEBC 1RF1C 2BEZF 1FZFA 2H7HA 1NKZB 1OW7A 3L73D 3H1HE 2OARA 1QL2A 1MZ9A 3PH0A 2J58A 2QSIA 3C9IA 1J1DB 1SQQG 2OYIC 1SQPK 2R5DA 1NOHA 2CPBA 4AQRD 2WPSA 4XA4A 1BE3E 2D2CC 1CI6B 1PPJG 1T6AA 3VMXA 3FWLA 1ZOYC 1SQPD 1L4AA 4EYYQ 2ZVOB 2L5GB 3TGUG 3L72G 2BCCE 3CCMP 2ZYAA 4L74A 3CMAP 3HD7B 3H1IE 2JJLA 2E5YA 3L36A 1W2BO 1L4AC 2PP6A 1L2PA 5AW5B 3L74D 2Q7CA 1JTHB 3CXHI 1URQD 3L73J 4IL6E 2ZT9B 4GDOA 3W68A 1USEA 1NTKD 4KT0J 3SWFA 2NPSC 4ZKPA 1LT1A 1OWAA 1KILD 1Q81Q 2E76C 3B5NC 3SFEC 1KQSO 2KS1B 2QM7A 1SQPJ 2IBZI 2FYNB 2IFNA 4IOIH 2R3CA 1KC8Q 1XTGB 1N7SA 2NZ2A 4GKGA 1OVVA 4H44D 2IPPA 2WSFJ 5EFWB 1S9KE 1J1EC 3EWKA 2FXMA 1N7LA 1R5LA 1J2JB 1ZMEC 1JUNA 3R4YA 2K37A 5APVA 1OVUA 4D6TD 2WTYA 5CCHA 2KIKA 1PP9D 3B4SA 1HGVA 3L74J 5E79H 3MUDA 3RK2C 1Y9BA 3P32A 2Q9IA 1NTKJ 3V2RA 3CWBG 1M8OB 4DT0A 2W6BA 3VP9A 2N1TD 3M9HA 2HR3A 2Q3IA 4H13C 2M5AA 2YXQB 4JF7A 3M06A 3L71G 3H1KG 1FJKA 1OMIA 3HE5A 3AECC 2DW3A 5KLIC 3M91A 4NPEA 4N78D 2E42A 3AE4C 2AXTE 3GHGC 3AE2C 3RL0B 4D6TJ 4RO0A 3KYQA 1DIPA 1PP9J 2E74B 1DD4A 3TYYA 1MFTA 1L0LG 1LT9C 3AE3C 1VQPP 3H25A 1L4AD 2KYVA 3CI9A 3OJAB 1ZV8A 1EDLA 2K9YA 1L0NG 4BXLA 2GUSA 3BRTB 1RE4C 1LTBC 1S3JA 4DJGA 1GW4A 4PV1D 1N73A 2YKPA 3U59A 2P10A 1VQ5P 3CL3D 1H0TA 1NTKE 1KQFB 4KHXA 2MJZA 3H32B 3CXHE 1VQMP 4GT1A 1KILE 1RF0C 3RBZA 2FFDB 4RJTA 3N7NA 2WSEJ 1NTZE 2FYUG 2WPVB 1JMBA 2JKVA 2PAJA 1IO4A 4PD4H 1RF1B 1J1DC 4OVNF 2UWJE 5KAIE 2IBZE 3Q3DA 2Y9ZA 5CCGC 1IK7A 4R4MA 2B9BA 1IZNB 4IFMA 3T97B 1N7SD 1VQOP 1KB9I 3A0BE 4D6TE 2V7QH 3BCCD 2H89C 3HUSA 3KHUA 1Q7YQ 1PP9E 3BVHA 2R32A 2KXPB 2LR2A 4H13D 4EI2A 2KK7A 2AEJA 1NGMB 2P7JA 1G2CA 2ITAA 1SQXK 3HD7C 2W27A 1YITP 5CCHD 1KYOH 1EXJA 2B89A 1H8AA 1G1IA 3D70A 2ZT9C 1LTIC 2HYNA 3S9OA 5KJ7C 1M1JA 1NH4A 2WT7B 2SPZA 1SLQA 1BGYE 1QLED 3CX5H 5KKZB 2E5TA 1LJ2A 1PZQA 2K1AA 1NU1D 5GTIE 1YI2P 2E76B 3PP5A 4OGQB 4N78E 2OYHA 1RHZB 2FYNC 1N2DC 3TF5A 1EZVG 3AE1C 3USSA 5CBOA 3BCCJ 3ZDMA 3M9QA 3KXDA 3BRVB 1HBWA 3G4SP 3V5BA 2Y9YA 1BE3D 3GW6A 1VQ8P 2AXCA 1LTGC 3EQ2A 3N4XA 3LW5J 2HFED 2R3SA 2YMKA 4L76A 4W80A 1QL1A 5DJUB 1DEEG 4LC1A 2N9BA 1FZCB 1RQVA 1QVGO 1IK9A 1SQVG 2KOGA 3L70E 1KMIZ 5AW1B 2QEXP 1GD2E 4GOFA 2W90A 2BCCD 1BCCG 1URQA 3U1CA 2FXOA 2ZAEB 2G8YA 1YJ9P 2KSEA 3L75E 3LIEA 3H1IG 1NU1J 2O01J 2Q5UA 5CHXA 4C46A 1IC2A 2YO2A 2VRSA 4UB8H 3E7KA 1PL5A 2O1KA 4Y28J 3WU2H 1S1CX 3H6PA 3UIAA 3G3ZA 1BE3J 3KPEA 2XNDH 1NHLA 2E75D 5APWA 1K73Q 1WT6A 1NTMG 3A2AA 2IDBA 1XTCC 3RL0C 1P84H 5APQA 3TK1A 2XU6A 4W7YA 3H32A 2E74C 3HTKB 3MZWB 1NKNA 1GK6A 3RK3B 1LTJA 1HJBA 1HVVA 2BCCJ 1BSHA 2K88A 3G6EP 3L37A 1RF1A 1QEXA 2KLUA 4U3FD 1PFIA 1VL2A 4I6MC 2E43A 1LWUB 1GU5A 4K35A 1M56D 2OYIA 3I56P 1K05A 2HPCB 1FS0E 1PIXA 2K3RA 2M8RA 2FFDC 2OYOA 5AVTB 1NU1E 4C7NA 2PFXA 2YXRB 4IFFA 4PD4I 1EDJA 3L73G 1FOSE 1JY3N 1AJYA 1R8EA 2KP8A 3C8VA 2IZ0A 1R5SA 1ZW0A 1AVOA 4UB6H 5APSA 2ZFCA 3M0DC 1S5LH 2M3BA 5C39A 4WB4A 1SQPG 4H0LD 1OFCX 2JWDA 1KB9H 3NXSA 3TNUA 3VMZA 4U3FJ 1VQ4P 2OTJP 3D6ZA 2WZ7A 1PPJD 4PJ0E 1PGOA 4MN4C 2NPSA 3CC4P 5AW9B 1FZBA 1GL2B 2QE7H 3B5NA 1X8YA 4AUWA 4N3YB 1FZEA 4OWFA 2ZXXA 2C9LY 4C7RA 1NTKK 4I7ZB 1KYOI 2YIUB 3L72D 1FE6A 3FXEA 1FZAA 1IFNA 1NTZK 3L74G 5KLVE 2M0BA 5KKZC 3CXHD 3SFDC 1GZLA 2A06E 2FXPA 3RL0D 3CX5I 3BASA 1S5LX 3CCRP 1IFMA 2QM8A 1NTZD 4OGQC 2HODA 2YKQA 3CCQP 3CX5D 1X0TA 4KJMA 3JCUH 2I8DA 3M9BA 3AE8C 4Y99B 3BATA 3H1LD 1ZXGA 1KD1Q 5B5EH 2IBZD 3VYIA 4WY4B 1HJ0A 1KZUB 3TSIA 2WPRA 1SS1A 1ZRTD 3V4QA 1VQLP 1YQ3C 3B8EB 3PLNA 1PGQA 1AVYA 2CPSA 3P7KA 3GF7A 2BEQD 2Q3EA 1FZCC 1X22A 3GG2A 4U3FE 3L72J 4D6TG 1VQ7P 1Q90D 2JEEA 4I1LA 2MKVA 3O8ZA 1M90Q 2J5UA 1GTWA 5AW6B 1W2EA 3ABVC 1LTAC 5CMZA 1BDCA 1K04A 1VF5C 4JYCA 4QMAA 1NTZJ 3GHGA 2IYOA 4R4LA 1FZGA 2JR8A 5AW4B 1KTMA 2Y0EA 2B87A 5APUA 3H1LJ 2J59M 2HG5D 2D2CD 3O6QA 1BGYD 1K8AQ 2C0WA 1LT9A 4HYTB 4PD4E 1Y8AA 1JY3P 2V4HA 1RE4A 3EFFK 3E1IA 3CD6P 2XZRA 1SQQE 1W5CE 1SQBD 2QJYB 1P84I 1NWQA 3KZIE 3MTUE 3FWNA 3RK3C 1PPJE 2OTLP 4L73A 1K9MQ 1JY3O 3PJSK 1RF0A 1JOCA 1NO4A 1T3JA 2H43A 3H1JD 2N9YB 1LWUC 1DEBA 2NPSD 1EQ7A 3L72E 3L70D 2H88C 4N6JA 1KYOE 1FOSF 2QIWA 3JC22 3JSVC 2E76D 1FDMA 3IR9A 1L0ND 4JBZA 3B5ND 1CI6A 5CCGA 3ITKA 3KDPB 1BGYJ 2O01N 4DOJA 5DJTB 5M1BA 1SFCB 4H44B 3L75D 1T3UA 2XKMA 1KORA 4AYCA 3CCSP 2P67A 1M57D 3CX5E 2WSCJ 1Q2NA 1OW8A 2JWAA 4HJGH 1Z56A 1SQBJ 3H1LE 4M3LA 3CCJP 3A0HH 5AVRB 5AVQB 3IFMA 4CPGA 1WRGA 3HD7A 1ZRTE 1FDIA 3H1JJ 1HF9A 2N1TB 1JTHA 3RK2D 5AW2B 5KJ7A 2GA1A 3BCCG 3L70J 3F89A 3L4FA 1IFJA 1KB9D 5AVUB 2L91A 1MKMA 1L0NJ 1GL2C 5B66H 2O3JA 4EOTA 2KS1A 3G71P 2P58A 2WSFH 2YKOA 3L75J 2K9JB 4I7ZC 2WVRA 1JEKA 3V2PA 2YIUC 3IN6A 2WSSH 5H2FH 5AW8B 3FX0A 1SQXG 2OGUA 3CWBE 2PGDA 3SSUA 1NU1K 2A45G 4HH2A 5TISH 1M1KQ 1EXIA 1YBKA 2QVAA 3WU2E 4Y99C 1JM0A 2GM4A 1NU1G 3H1KE 1EDIA 1M7LA 2XV5A 1OW6A 4Z1MH 2NRGA 1SQBE 3H1HG 4U7JA 4WY4C 2FY8A 2W6AA 2Y0DA 2KUBA 1P84E 3Q5RA 1S4XA 1EZVI 5AVVB 3AEEC 3II6A 1BE3G 1YHQP 1KV4A 1T2KC 3SWKA 3H1JE 1UIIA 2Q1KA 1N86A 3Q5SA 1L0LE 2OQQA 1Q82Q 1YTZI 1KQLA 2H8PD 1G1JA 2KZJA 1L0NE 3I55P 1LP1B 2Z5HA 2BCCG 5BU8B 3WUUA 3TDKA 1JCDA 2LXCB 2FKWB 1IJDB 1NJIQ 1SQVD 5KLVK 2Z5IA 3OW2O 3R2PA 1VF5B 2XDJA 5CCGD 4O9BA 5KLVD 1N7SB 3L35A 2A06D 2FYUE 1ZP0C 1JCCA 4UB6E 2QJYC 2P2UA 1BDDA 1S5LE 3HD7D 1E5WA 1ZN5A 4BWNA 1LTTC 3VTPC 5KTBA 1KB9E 1LTSC 1NTMD 1KFMA 2QJKB 4GOEA 2RKLA 2FFDA 3F5HA 4TLFA 1PV3A 4JYBA 1U7JA 1KILC 4YXWH 2ZT9D 2M5AB 1SQVJ 1ZLLA 5KJ7D 5APTA 3Q1MA 2KB7P 1QGKB 5KLVJ 3QH9A 3HE5B 2QG4A 1SFCC 2FYZA 4EIJA 4H44C 1YJWP 3M0DA 5APXA 3CC7P 1RH5B 4GIFA 2KLVA 3T97A 3V6IA 1FAVA 3U1AA 2PRRA 1Y47A 3RK3E 3CMEP 3SWYA 2B88A 3VN0A 1VQ9P 3S4RA 5APYA 3JCUE 4PD4D 4WWIA 1SQQK 5GTHH 1N8RQ 3RBXA 2K9JA 5B5EE 1NTMJ 1JY2N 2IFMA 1EZVE 1S2EA 2KI7B 2N1TC 1X79B 2POHA 1VQNP 4YPCA 1SQQD 1N73B 2KNCB 2WT7A 3AE6C 5TJHA 1H0TB 3MD0A 1RE3C 2C0XA 2KSJA 3NMDA 1MFZA 1VQ6P 4HB1A 5E79E 2W83C
chains in the Genus database with same CATH topology
1NTMK 1T8ZA 2WSEH 1GL2D 2P7JA 1G2CA 3LW5H 3CLQA 1SQXK 1RE4A 2WSCH 3HD7C 2LKMA 3OAKA 3E1IA 2XZRA 2W27A 1URQC 1SFCA 5CCHD 1H89A 1ZR4A 1NWQA 3WMM0 1H8AA 2XNXA 2WITA 5AVSB 3MTUE 1G1IA 5AVYB 3RK3C 1LTIC 2HYNA 5KJ7C 1M1JA 1NH4A 1FJPA 4ZKUA 1A02F 3GHGB 2WT7B 2A45H 3MGNA 1JY3O 4WBAA 2C9NY 1RF0A 1JOCA 1SLQA 1ZR2A 1IFDA 1HUCA 3A5TA 1FZCA 1NO4A 1T3JA 2H43A 3NTNA 1S9KD 4B86A 1SP4A 5CJ0A 3HUSB 5AVWB 1LT9B 1LWUC 1DEBA 3A7OA 3PP5A 1VPCA 4N78E 2O01H 2OYHA 2NPSD 1EQ7A 3P8MC 5AW7B 1RY3A 3VP8A 4N6JA 1FOSF 1N2DC 2P1JA 1FDMA 2N1TA 3IR9A 1G2CB 3P8CD 3B5ND 1CI6A 5CCGA 1MV8A 5BVZA 3KDPB 1DX7A 5BU5A 3M9QA 4WY4D 4DOJA 1HBWA 3BRVB 3HE4A 1SFCB 3EFGA 3V5BA 4IFDK 2R5BA 1T3UA 1FBMA 1JMMA 1LTGC 2XKMA 3EQ2A 1CSBA 3N4XA 2YNYA 4AYCA 2HFED 2P67A 1SFCD 3LIDA 1RE3A 1GW3A 3KQGA 1T2KD 4W80A 1LTJC 1M1JB 1QL1A 2I1JA 4LC1A 1Z56A 4M3LA 2N9BA 1FZCB 1AFOA 1RF1C 1IK9A 2KOGA 1FZFA 5AVRB 5AVQB 2H7HA 5AVXB 1NKZB 3IFMA 5AW1B 5AW3B 1GD2E 1WRGA 3HD7A 2OARA 2WPQA 1MZ9A 1QL2A 3P8CE 2OYHB 2J58A 3C9IA 1J1DB 1URQA 2OYIC 3U1CA 1SQPK 2R5DA 1NOHA 2CPBA 4AQRD 3HTKA 2WPSA 4XA4A 2N1TB 1JTHA 1CI6B 1N7SC 3LIEA 1GK4A 3RK2D 5AW2B 3V2QA 5KJ7A 2Q5UA 5CHXA 4C46A 3VMXA 2GUVA 1L4AA 1IC2A 3L4FA 1AQ5A 1IFJA 2YO2A 5AVUB 2VRSA 1SQBK 2L5GB 4DZOA 1GL2C 2O1KA 1JY2P 4EOTA 3H6PA 1LWUA 3A3YB 5CCHC 3UIAA 2WSFH 3G3ZA 2YKOA 3KPEA 3V2PA 2BASA 1NHLA 3V4WA 3M0AA 5APWA 1WT6A 2HPCA 3A2AA 3HD7B 2HLOA 1XTCC 3RL0C 2JJLA 5AW8B 5APQA 1URQB 3TK1A 1HWTC 2XU6A 1NU1K 3NFQA 4W7YA 3L36A 2A45G 1L4AC 2PP6A 3H32A 1L0LK 3HTKB 4HH2A 5AW5B 1NKNA 2Q7CA 1JTHB 1GK6A 1CZQA 1URQD 3RK3B 1KILB 1JY2O 1LTJA 1HJBA 1HVVA 1L0NK 3SWFA 2NPSC 4ZKPA 4Y99C 2GM4A 1OWAA 1KILD 1M7LA 2XV5A 3L37A 1RF1A 3MIWA 3B5NC 1PFIA 4LLHA 4WY4C 4I6MC 2E43A 1LWUB 1GU5A 2QM7A 2W6AA 2OYIA 1JO5A 2IFNA 5AVVB 3II6A 4RESB 4LGDE 3OA7A 1MUUA 2R3CA 2HPCB 1XTGB 1N7SA 1T2KC 3VOPA 4GKGA 2M8RA 2FYUK 2IPPA 1IFIA 2FFDC 1S9KE 1J1EC 1N86A 2FXMA 5AVTB 1N7LA 4C7NA 1J2JB 1GDTA 1JUNA 1GL2A 1YTZI 1GU4A 1KQLA 1LTJB 2H8PD 4IFFA 5APVA 2WTYA 1G1JA 1FOSE 2YMYA 5CCHA 1JY3N 2Z5HA 1YTZT 1A02J 5BU8B 2KP8A 1SVFA 1JCDA 1HGVA 2FKWB 1IJDB 3MUDA 3RK2C 5KLVK 3P32A 1N73C 2Z5IA 5APSA 2Q9IA 2ZFCA 3R2PA 3V2RA 3V2NA 1FU1A 3M0DC 2OYIB 3HE4B 2W6BA 2M3BA 3VP9A 2N1TD 2XDJA 4WB4A 3M9HA 1NAFA 5CCGD 2Q3IA 4O9BA 3NXSA 1N7SB 3TNUA 3VMZA 4JF7A 5AW0B 3M06A 2WZ7A 3VMYA 3L35A 2NPSA 2Z4EA 1FJKA 5AW9B 1FZBA 1JNMA 4C7NB 2WWWA 1GL2B 3B5NA 1X8YA 1JCCA 4AUWA 3HE5A 4N3YB 1FZEA 4WY4A 2C9LY 4C7RA 1NTKK 2I1KA 2P2UA 3M91A 4N78D 1HTLC 2E42A 3HD7D 1E5WA 1FZAA 3HRNA 1ZN5A 1LTTC 3VTPC 5AVZB 1HH0A 5KTBA 3GHGC 1IFNA 1LTSC 1NTZK 3RL0B 1KFMA 2FFDA 1HGZA 2A45I 4W7ZA 3KYQA 1GZLA 1L4AB 4JYBA 1KILC 1DH3A 4XE5B 3TYYA 3RK3D 3RL0D 3BASA 3HUSC 1IFMA 3TNUB 1ZLLA 5KJ7D 1LT9C 2QM8A 2HODA 2YKQA 1L4AD 5APTA 2KYVA 3CI9A 3OJAB 3M9BA 1ZV8A 2NPSB 4Y99B 3BATA 2KB7P 2GUSA 3BRTB 1RE4C 1LTBC 3B5NB 1GW4A 1N73A 1CW5A 2YKPA 3HE5B 3VYIA 1SFCC 4WY4B 3U59A 2FYZA 4EIJA 1KZUB 3TSIA 3M0DA 2WPRA 3CL3D 2IX7C 3I5CA 3V4QA 5APXA 4GIFA 2KLVA 3B8EB 3T97A 4KHXA 2MJZA 3H32B 1FAVA 3U1AA 1M1JC 2CPSA 4GT1A 3P7KA 2O1JA 1RF0C 1SQVK 3SWYA 2FFDB 3N7NA 3VN0A 1J1EB 5APYA 1FZCC 2PAJA 1KFNA 1IO4A 2JEEA 4I1LA 1RF1B 3O8ZA 1SQQK 2HODB 2OYHC 1J1DC 1JY2N 2IFMA 1GTWA 5AW6B 1W2EA 1LTAC 1H88A 5CMZA 1X9VA 2N1TC 1X79B 2POHA 4JYCA 5CCGC 3RK2B 1N73B 1YYCA 3GHGA 2WT7A 1FZGA 1VDFA 5AW4B 1OXZA 4IFMA 4I2LC 5APUA 2J59M 1KILA 2YO3A 2HG5D 3MD0A 1RE3C 2C0XA 1N7SD 2ZXEB 2KSJA 3HUSA 5CJ4A 2C0WA 1LT9A 3NMDA 1LGHB 4HYTB 1MFZA 3BVHA 1JY3P 2R32A 4OH8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KB7 P;  2KYV A;  1FJP A;  1ZLL A;  1N7L A;  1FJK A;  2HYN A;  2M3B A; 
#chains in the Genus database with same CATH topology
 1SQV E;  1T8Z A;  2E75 B;  3LW5 H;  1YQ4 C;  3TGU D;  5KAF H;  2LKM A;  3OAK A;  1KYO D;  1BCC E;  1FC2 C;  1LNQ A;  3AED C;  4ASW A;  2ZYD A;  3WMM 0;  1QVF O;  5AVS B;  4DCK A;  1NTK G;  5AVY B;  2IZ1 A;  1QX8 A;  4ZKU A;  1A02 F;  2A45 H;  3MGN A;  2C9N Y;  4WBA A;  3RL0 g;  4YXD C;  1ZR2 A;  1IFD A;  1NTZ G;  1FZC A;  2E74 D;  3AEG C;  3NTN A;  1SQQ J;  3HUS B;  4WVZ A;  4PV1 C;  3H1L G;  2Y0C A;  2O01 H;  1LP1 A;  3P8M C;  5AW7 B;  1RY3 A;  3VP8 A;  2IBZ G;  2Q6Q A;  1JB0 J;  1S72 P;  1G2C B;  1NTM E;  2V7Q J;  1MV8 A;  5BVZ A;  1DX7 A;  5BU5 A;  3Q2Y A;  3AEF C;  4YTP C;  1AQT A;  1FBM A;  2G3A A;  4K3A A;  1OIP A;  1SFC D;  3TGU J;  1AV1 A;  1M1J B;  3MP7 B;  2I1J A;  1PP9 G;  1AFO A;  3IF4 A;  5AVX B;  4PJ0 H;  5AW3 B;  3PTZ A;  2JDI H;  3CC2 P;  2WPQ A;  3QWO C;  3P8C E;  3E1R A;  3D71 A;  2OYH B;  3HTK A;  2IYP A;  1N7S C;  3CWB D;  1GK4 A;  4H0L B;  3V2Q A;  2ZJS E;  2GUV A;  1AQ5 A;  1BGY G;  4IL6 H;  5CBN A;  1SQB K;  3A0H E;  3L71 D;  4DZO A;  1IFP A;  3CCL P;  1JY2 P;  1KQG B;  3H1K D;  1LWU A;  3A3Y B;  3L73 E;  5CCH C;  3D6Y A;  1U57 A;  3WUT A;  2BAS A;  3V4W A;  3M0A A;  1SQB G;  3MUD C;  2HPC A;  2HLO A;  1P84 D;  2QJK C;  1URQ B;  1HWT C;  3NFQ A;  3Q5P A;  1WMK A;  3GF3 A;  1L0L K;  3VMA A;  1SQP E;  1CZQ A;  1KIL B;  1JY2 O;  2RN0 A;  3H1J G;  1OVR A;  1L0N K;  5B66 E;  2QA4 P;  2WQY C;  2ZVN B;  3TGU E;  1L0L D;  3AE5 C;  3L70 G;  3MIW A;  3CWB J;  1YJN P;  4IL6 X;  2CK3 H;  4OGQ D;  4LLH A;  5H2F E;  1JO5 A;  4RES B;  4LGD E;  3OA7 A;  3L75 G;  4A7P A;  3L71 J;  1MUU A;  2KNC A;  2QJP C;  1OZH A;  3VOP A;  2LXB A;  3H1K J;  2FYU K;  3AEA C;  3L74 E;  1IFI A;  5TIS E;  1E79 H;  1GDT A;  4BRY B;  1GL2 A;  1GU4 A;  2FYU D;  1AA0 A;  1LTJ B;  1NYH A;  1FDO A;  1EC5 A;  2YMY A;  2M3E A;  1UIX A;  1YTZ T;  1A02 J;  1SVF A;  4GOD A;  2JO1 A;  3K5B A;  1N73 C;  3V2N A;  1FU1 A;  1U7M A;  2OYI B;  3HE4 B;  1L0L J;  5L8R J;  2AXT H;  1VF5 D;  3S1K A;  1NAF A;  2ZYG A;  2D2C B;  4ASV A;  3KZI H;  5AW0 B;  3VMY A;  1RQU A;  2Z4E A;  2E75 C;  1JNM A;  4C7N B;  2WWW A;  1YIJ P;  4WY4 A;  2QRX A;  4L75 A;  1GMJ A;  2I1K A;  4NPD A;  2W6J H;  1HTL C;  2OTK E;  3HRN A;  2FYU J;  3FXD A;  5AVZ B;  1HH0 A;  4NPF X;  2AEM A;  4UB8 E;  1HGZ A;  2A45 I;  4W7Z A;  3L71 E;  1SQX D;  1L4A B;  3CXH H;  1DH3 A;  4XE5 B;  3RK3 D;  3MHV A;  3HUS C;  1EDK A;  3TNU B;  3B71 A;  2NPS B;  4ZNC A;  4PV1 B;  3CCE P;  3CPW O;  1Q86 Q;  3B5N B;  4JQ0 D;  5KAI H;  1CW5 A;  1EZV D;  2AEF A;  3W67 A;  3H1H D;  2IX7 C;  3I5C A;  5K5G B;  1DD3 A;  3AE7 C;  3WUV A;  1M1J C;  2O1J A;  1SQV K;  2WMM A;  1J1E B;  3A0B H;  1KFN A;  3GLM A;  1NVO A;  2HOD B;  2W8Z A;  2OYH C;  1USD A;  1SQX J;  1H88 A;  1X9V A;  3C1L A;  4JPZ B;  1BCC D;  4H0L C;  3RK2 B;  3RGU A;  1YYC A;  1VDF A;  5KLV G;  1OXZ A;  1KN7 A;  4EDF A;  3PRJ A;  3H1I D;  4I2L C;  1KIL A;  2A06 G;  2YO3 A;  2ZXE B;  4H13 B;  1D7M A;  5CJ4 A;  1PGP A;  1LGH B;  4RKU J;  5GTH E;  2JP3 A;  4OH8 B;  3H1H J;  1NTM K;  4HKZ H;  4ZMD A;  3G9R A;  2WSE H;  1GL2 D;  5GTI H;  3CLQ A;  2WSC H;  2RMZ A;  3PHL A;  1URQ C;  1SFC A;  5KLI B;  1H89 A;  1ZR4 A;  2XNX A;  2WIT A;  3AE9 C;  1FJP A;  3GHG B;  1PGJ A;  3BCC E;  3CCU P;  1HUC A;  3A5T A;  2B87 B;  4BRY A;  4U3F G;  1S9K D;  4B86 A;  1SP4 A;  5CJ0 A;  1BCC J;  3O6Q B;  5AVW B;  1LT9 B;  3A7O A;  1TU3 F;  1VPC A;  5KAF E;  2RH0 A;  3H1I J;  4TT3 H;  1NAY A;  1BSN A;  2P1J A;  3FGA D;  2N1T A;  2R44 A;  3P8C D;  3CCV P;  3GMA A;  4WY4 D;  3HE4 A;  1SQX E;  3EFG A;  2QJP B;  4IFD K;  3IAO A;  2R5B A;  1VQK P;  1JMM A;  1CSB A;  2FBW C;  2YNY A;  3LID A;  1RE3 A;  1GW3 A;  3KQG A;  1T2K D;  1LTJ C;  4XFJ A;  1OX3 A;  2KZI A;  3AEB C;  1RF1 C;  2BEZ F;  1FZF A;  2H7H A;  1NKZ B;  1OW7 A;  3L73 D;  3H1H E;  2OAR A;  1QL2 A;  1MZ9 A;  3PH0 A;  2J58 A;  2QSI A;  3C9I A;  1J1D B;  1SQQ G;  2OYI C;  1SQP K;  2R5D A;  1NOH A;  2CPB A;  4AQR D;  2WPS A;  4XA4 A;  1BE3 E;  2D2C C;  1CI6 B;  1PPJ G;  1T6A A;  3VMX A;  3FWL A;  1ZOY C;  1SQP D;  1L4A A;  4EYY Q;  2ZVO B;  2L5G B;  3TGU G;  3L72 G;  2BCC E;  3CCM P;  2ZYA A;  4L74 A;  3CMA P;  3HD7 B;  3H1I E;  2JJL A;  2E5Y A;  3L36 A;  1W2B O;  1L4A C;  2PP6 A;  1L2P A;  5AW5 B;  3L74 D;  2Q7C A;  1JTH B;  3CXH I;  1URQ D;  3L73 J;  4IL6 E;  2ZT9 B;  4GDO A;  3W68 A;  1USE A;  1NTK D;  4KT0 J;  3SWF A;  2NPS C;  4ZKP A;  1LT1 A;  1OWA A;  1KIL D;  1Q81 Q;  2E76 C;  3B5N C;  3SFE C;  1KQS O;  2KS1 B;  2QM7 A;  1SQP J;  2IBZ I;  2FYN B;  2IFN A;  4IOI H;  2R3C A;  1KC8 Q;  1XTG B;  1N7S A;  2NZ2 A;  4GKG A;  1OVV A;  4H44 D;  2IPP A;  2WSF J;  5EFW B;  1S9K E;  1J1E C;  3EWK A;  2FXM A;  1N7L A;  1R5L A;  1J2J B;  1ZME C;  1JUN A;  3R4Y A;  2K37 A;  5APV A;  1OVU A;  4D6T D;  2WTY A;  5CCH A;  2KIK A;  1PP9 D;  3B4S A;  1HGV A;  3L74 J;  5E79 H;  3MUD A;  3RK2 C;  1Y9B A;  3P32 A;  2Q9I A;  1NTK J;  3V2R A;  3CWB G;  1M8O B;  4DT0 A;  2W6B A;  3VP9 A;  2N1T D;  3M9H A;  2HR3 A;  2Q3I A;  4H13 C;  2M5A A;  2YXQ B;  4JF7 A;  3M06 A;  3L71 G;  3H1K G;  1FJK A;  1OMI A;  3HE5 A;  3AEC C;  2DW3 A;  5KLI C;  3M91 A;  4NPE A;  4N78 D;  2E42 A;  3AE4 C;  2AXT E;  3GHG C;  3AE2 C;  3RL0 B;  4D6T J;  4RO0 A;  3KYQ A;  1DIP A;  1PP9 J;  2E74 B;  1DD4 A;  3TYY A;  1MFT A;  1L0L G;  1LT9 C;  3AE3 C;  1VQP P;  3H25 A;  1L4A D;  2KYV A;  3CI9 A;  3OJA B;  1ZV8 A;  1EDL A;  2K9Y A;  1L0N G;  4BXL A;  2GUS A;  3BRT B;  1RE4 C;  1LTB C;  1S3J A;  4DJG A;  1GW4 A;  4PV1 D;  1N73 A;  2YKP A;  3U59 A;  2P10 A;  1VQ5 P;  3CL3 D;  1H0T A;  1NTK E;  1KQF B;  4KHX A;  2MJZ A;  3H32 B;  3CXH E;  1VQM P;  4GT1 A;  1KIL E;  1RF0 C;  3RBZ A;  2FFD B;  4RJT A;  3N7N A;  2WSE J;  1NTZ E;  2FYU G;  2WPV B;  1JMB A;  2JKV A;  2PAJ A;  1IO4 A;  4PD4 H;  1RF1 B;  1J1D C;  4OVN F;  2UWJ E;  5KAI E;  2IBZ E;  3Q3D A;  2Y9Z A;  5CCG C;  1IK7 A;  4R4M A;  2B9B A;  1IZN B;  4IFM A;  3T97 B;  1N7S D;  1VQO P;  1KB9 I;  3A0B E;  4D6T E;  2V7Q H;  3BCC D;  2H89 C;  3HUS A;  3KHU A;  1Q7Y Q;  1PP9 E;  3BVH A;  2R32 A;  2KXP B;  2LR2 A;  4H13 D;  4EI2 A;  2KK7 A;  2AEJ A;  1NGM B;  2P7J A;  1G2C A;  2ITA A;  1SQX K;  3HD7 C;  2W27 A;  1YIT P;  5CCH D;  1KYO H;  1EXJ A;  2B89 A;  1H8A A;  1G1I A;  3D70 A;  2ZT9 C;  1LTI C;  2HYN A;  3S9O A;  5KJ7 C;  1M1J A;  1NH4 A;  2WT7 B;  2SPZ A;  1SLQ A;  1BGY E;  1QLE D;  3CX5 H;  5KKZ B;  2E5T A;  1LJ2 A;  1PZQ A;  2K1A A;  1NU1 D;  5GTI E;  1YI2 P;  2E76 B;  3PP5 A;  4OGQ B;  4N78 E;  2OYH A;  1RHZ B;  2FYN C;  1N2D C;  3TF5 A;  1EZV G;  3AE1 C;  3USS A;  5CBO A;  3BCC J;  3ZDM A;  3M9Q A;  3KXD A;  3BRV B;  1HBW A;  3G4S P;  3V5B A;  2Y9Y A;  1BE3 D;  3GW6 A;  1VQ8 P;  2AXC A;  1LTG C;  3EQ2 A;  3N4X A;  3LW5 J;  2HFE D;  2R3S A;  2YMK A;  4L76 A;  4W80 A;  1QL1 A;  5DJU B;  1DEE G;  4LC1 A;  2N9B A;  1FZC B;  1RQV A;  1QVG O;  1IK9 A;  1SQV G;  2KOG A;  3L70 E;  1KMI Z;  5AW1 B;  2QEX P;  1GD2 E;  4GOF A;  2W90 A;  2BCC D;  1BCC G;  1URQ A;  3U1C A;  2FXO A;  2ZAE B;  2G8Y A;  1YJ9 P;  2KSE A;  3L75 E;  3LIE A;  3H1I G;  1NU1 J;  2O01 J;  2Q5U A;  5CHX A;  4C46 A;  1IC2 A;  2YO2 A;  2VRS A;  4UB8 H;  3E7K A;  1PL5 A;  2O1K A;  4Y28 J;  3WU2 H;  1S1C X;  3H6P A;  3UIA A;  3G3Z A;  1BE3 J;  3KPE A;  2XND H;  1NHL A;  2E75 D;  5APW A;  1K73 Q;  1WT6 A;  1NTM G;  3A2A A;  2IDB A;  1XTC C;  3RL0 C;  1P84 H;  5APQ A;  3TK1 A;  2XU6 A;  4W7Y A;  3H32 A;  2E74 C;  3HTK B;  3MZW B;  1NKN A;  1GK6 A;  3RK3 B;  1LTJ A;  1HJB A;  1HVV A;  2BCC J;  1BSH A;  2K88 A;  3G6E P;  3L37 A;  1RF1 A;  1QEX A;  2KLU A;  4U3F D;  1PFI A;  1VL2 A;  4I6M C;  2E43 A;  1LWU B;  1GU5 A;  4K35 A;  1M56 D;  2OYI A;  3I56 P;  1K05 A;  2HPC B;  1FS0 E;  1PIX A;  2K3R A;  2M8R A;  2FFD C;  2OYO A;  5AVT B;  1NU1 E;  4C7N A;  2PFX A;  2YXR B;  4IFF A;  4PD4 I;  1EDJ A;  3L73 G;  1FOS E;  1JY3 N;  1AJY A;  1R8E A;  2KP8 A;  3C8V A;  2IZ0 A;  1R5S A;  1ZW0 A;  1AVO A;  4UB6 H;  5APS A;  2ZFC A;  3M0D C;  1S5L H;  2M3B A;  5C39 A;  4WB4 A;  1SQP G;  4H0L D;  1OFC X;  2JWD A;  1KB9 H;  3NXS A;  3TNU A;  3VMZ A;  4U3F J;  1VQ4 P;  2OTJ P;  3D6Z A;  2WZ7 A;  1PPJ D;  4PJ0 E;  1PGO A;  4MN4 C;  2NPS A;  3CC4 P;  5AW9 B;  1FZB A;  1GL2 B;  2QE7 H;  3B5N A;  1X8Y A;  4AUW A;  4N3Y B;  1FZE A;  4OWF A;  2ZXX A;  2C9L Y;  4C7R A;  1NTK K;  4I7Z B;  1KYO I;  2YIU B;  3L72 D;  1FE6 A;  3FXE A;  1FZA A;  1IFN A;  1NTZ K;  3L74 G;  5KLV E;  2M0B A;  5KKZ C;  3CXH D;  3SFD C;  1GZL A;  2A06 E;  2FXP A;  3RL0 D;  3CX5 I;  3BAS A;  1S5L X;  3CCR P;  1IFM A;  2QM8 A;  1NTZ D;  4OGQ C;  2HOD A;  2YKQ A;  3CCQ P;  3CX5 D;  1X0T A;  4KJM A;  3JCU H;  2I8D A;  3M9B A;  3AE8 C;  4Y99 B;  3BAT A;  3H1L D;  1ZXG A;  1KD1 Q;  5B5E H;  2IBZ D;  3VYI A;  4WY4 B;  1HJ0 A;  1KZU B;  3TSI A;  2WPR A;  1SS1 A;  1ZRT D;  3V4Q A;  1VQL P;  1YQ3 C;  3B8E B;  3PLN A;  1PGQ A;  1AVY A;  2CPS A;  3P7K A;  3GF7 A;  2BEQ D;  2Q3E A;  1FZC C;  1X22 A;  3GG2 A;  4U3F E;  3L72 J;  4D6T G;  1VQ7 P;  1Q90 D;  2JEE A;  4I1L A;  2MKV A;  3O8Z A;  1M90 Q;  2J5U A;  1GTW A;  5AW6 B;  1W2E A;  3ABV C;  1LTA C;  5CMZ A;  1BDC A;  1K04 A;  1VF5 C;  4JYC A;  4QMA A;  1NTZ J;  3GHG A;  2IYO A;  4R4L A;  1FZG A;  2JR8 A;  5AW4 B;  1KTM A;  2Y0E A;  2B87 A;  5APU A;  3H1L J;  2J59 M;  2HG5 D;  2D2C D;  3O6Q A;  1BGY D;  1K8A Q;  2C0W A;  1LT9 A;  4HYT B;  4PD4 E;  1Y8A A;  1JY3 P;  2V4H A;  1RE4 A;  3EFF K;  3E1I A;  3CD6 P;  2XZR A;  1SQQ E;  1W5C E;  1SQB D;  2QJY B;  1P84 I;  1NWQ A;  3KZI E;  3MTU E;  3FWN A;  3RK3 C;  1PPJ E;  2OTL P;  4L73 A;  1K9M Q;  1JY3 O;  3PJS K;  1RF0 A;  1JOC A;  1NO4 A;  1T3J A;  2H43 A;  3H1J D;  2N9Y B;  1LWU C;  1DEB A;  2NPS D;  1EQ7 A;  3L72 E;  3L70 D;  2H88 C;  4N6J A;  1KYO E;  1FOS F;  2QIW A;  3JC2 2;  3JSV C;  2E76 D;  1FDM A;  3IR9 A;  1L0N D;  4JBZ A;  3B5N D;  1CI6 A;  5CCG A;  3ITK A;  3KDP B;  1BGY J;  2O01 N;  4DOJ A;  5DJT B;  5M1B A;  1SFC B;  4H44 B;  3L75 D;  1T3U A;  2XKM A;  1KOR A;  4AYC A;  3CCS P;  2P67 A;  1M57 D;  3CX5 E;  2WSC J;  1Q2N A;  1OW8 A;  2JWA A;  4HJG H;  1Z56 A;  1SQB J;  3H1L E;  4M3L A;  3CCJ P;  3A0H H;  5AVR B;  5AVQ B;  3IFM A;  4CPG A;  1WRG A;  3HD7 A;  1ZRT E;  1FDI A;  3H1J J;  1HF9 A;  2N1T B;  1JTH A;  3RK2 D;  5AW2 B;  5KJ7 A;  2GA1 A;  3BCC G;  3L70 J;  3F89 A;  3L4F A;  1IFJ A;  1KB9 D;  5AVU B;  2L91 A;  1MKM A;  1L0N J;  1GL2 C;  5B66 H;  2O3J A;  4EOT A;  2KS1 A;  3G71 P;  2P58 A;  2WSF H;  2YKO A;  3L75 J;  2K9J B;  4I7Z C;  2WVR A;  1JEK A;  3V2P A;  2YIU C;  3IN6 A;  2WSS H;  5H2F H;  5AW8 B;  3FX0 A;  1SQX G;  2OGU A;  3CWB E;  2PGD A;  3SSU A;  1NU1 K;  2A45 G;  4HH2 A;  5TIS H;  1M1K Q;  1EXI A;  1YBK A;  2QVA A;  3WU2 E;  4Y99 C;  1JM0 A;  2GM4 A;  1NU1 G;  3H1K E;  1EDI A;  1M7L A;  2XV5 A;  1OW6 A;  4Z1M H;  2NRG A;  1SQB E;  3H1H G;  4U7J A;  4WY4 C;  2FY8 A;  2W6A A;  2Y0D A;  2KUB A;  1P84 E;  3Q5R A;  1S4X A;  1EZV I;  5AVV B;  3AEE C;  3II6 A;  1BE3 G;  1YHQ P;  1KV4 A;  1T2K C;  3SWK A;  3H1J E;  1UII A;  2Q1K A;  1N86 A;  3Q5S A;  1L0L E;  2OQQ A;  1Q82 Q;  1YTZ I;  1KQL A;  2H8P D;  1G1J A;  2KZJ A;  1L0N E;  3I55 P;  1LP1 B;  2Z5H A;  2BCC G;  5BU8 B;  3WUU A;  3TDK A;  1JCD A;  2LXC B;  2FKW B;  1IJD B;  1NJI Q;  1SQV D;  5KLV K;  2Z5I A;  3OW2 O;  3R2P A;  1VF5 B;  2XDJ A;  5CCG D;  4O9B A;  5KLV D;  1N7S B;  3L35 A;  2A06 D;  2FYU E;  1ZP0 C;  1JCC A;  4UB6 E;  2QJY C;  2P2U A;  1BDD A;  1S5L E;  3HD7 D;  1E5W A;  1ZN5 A;  4BWN A;  1LTT C;  3VTP C;  5KTB A;  1KB9 E;  1LTS C;  1NTM D;  1KFM A;  2QJK B;  4GOE A;  2RKL A;  2FFD A;  3F5H A;  4TLF A;  1PV3 A;  4JYB A;  1U7J A;  1KIL C;  4YXW H;  2ZT9 D;  2M5A B;  1SQV J;  1ZLL A;  5KJ7 D;  5APT A;  3Q1M A;  2KB7 P;  1QGK B;  5KLV J;  3QH9 A;  3HE5 B;  2QG4 A;  1SFC C;  2FYZ A;  4EIJ A;  4H44 C;  1YJW P;  3M0D A;  5APX A;  3CC7 P;  1RH5 B;  4GIF A;  2KLV A;  3T97 A;  3V6I A;  1FAV A;  3U1A A;  2PRR A;  1Y47 A;  3RK3 E;  3CME P;  3SWY A;  2B88 A;  3VN0 A;  1VQ9 P;  3S4R A;  5APY A;  3JCU E;  4PD4 D;  4WWI A;  1SQQ K;  5GTH H;  1N8R Q;  3RBX A;  2K9J A;  5B5E E;  1NTM J;  1JY2 N;  2IFM A;  1EZV E;  1S2E A;  2KI7 B;  2N1T C;  1X79 B;  2POH A;  1VQN P;  4YPC A;  1SQQ D;  1N73 B;  2KNC B;  2WT7 A;  3AE6 C;  5TJH A;  1H0T B;  3MD0 A;  1RE3 C;  2C0X A;  2KSJ A;  3NMD A;  1MFZ A;  1VQ6 P;  4HB1 A;  5E79 E;  2W83 C; 
#chains in the Genus database with same CATH homology
 1NTM K;  1T8Z A;  2WSE H;  1GL2 D;  2P7J A;  1G2C A;  3LW5 H;  3CLQ A;  1SQX K;  1RE4 A;  2WSC H;  3HD7 C;  2LKM A;  3OAK A;  3E1I A;  2XZR A;  2W27 A;  1URQ C;  1SFC A;  5CCH D;  1H89 A;  1ZR4 A;  1NWQ A;  3WMM 0;  1H8A A;  2XNX A;  2WIT A;  5AVS B;  3MTU E;  1G1I A;  5AVY B;  3RK3 C;  1LTI C;  2HYN A;  5KJ7 C;  1M1J A;  1NH4 A;  1FJP A;  4ZKU A;  1A02 F;  3GHG B;  2WT7 B;  2A45 H;  3MGN A;  1JY3 O;  4WBA A;  2C9N Y;  1RF0 A;  1JOC A;  1SLQ A;  1ZR2 A;  1IFD A;  1HUC A;  3A5T A;  1FZC A;  1NO4 A;  1T3J A;  2H43 A;  3NTN A;  1S9K D;  4B86 A;  1SP4 A;  5CJ0 A;  3HUS B;  5AVW B;  1LT9 B;  1LWU C;  1DEB A;  3A7O A;  3PP5 A;  1VPC A;  4N78 E;  2O01 H;  2OYH A;  2NPS D;  1EQ7 A;  3P8M C;  5AW7 B;  1RY3 A;  3VP8 A;  4N6J A;  1FOS F;  1N2D C;  2P1J A;  1FDM A;  2N1T A;  3IR9 A;  1G2C B;  3P8C D;  3B5N D;  1CI6 A;  5CCG A;  1MV8 A;  5BVZ A;  3KDP B;  1DX7 A;  5BU5 A;  3M9Q A;  4WY4 D;  4DOJ A;  1HBW A;  3BRV B;  3HE4 A;  1SFC B;  3EFG A;  3V5B A;  4IFD K;  2R5B A;  1T3U A;  1FBM A;  1JMM A;  1LTG C;  2XKM A;  3EQ2 A;  1CSB A;  3N4X A;  2YNY A;  4AYC A;  2HFE D;  2P67 A;  1SFC D;  3LID A;  1RE3 A;  1GW3 A;  3KQG A;  1T2K D;  4W80 A;  1LTJ C;  1M1J B;  1QL1 A;  2I1J A;  4LC1 A;  1Z56 A;  4M3L A;  2N9B A;  1FZC B;  1AFO A;  1RF1 C;  1IK9 A;  2KOG A;  1FZF A;  5AVR B;  5AVQ B;  2H7H A;  5AVX B;  1NKZ B;  3IFM A;  5AW1 B;  5AW3 B;  1GD2 E;  1WRG A;  3HD7 A;  2OAR A;  2WPQ A;  1MZ9 A;  1QL2 A;  3P8C E;  2OYH B;  2J58 A;  3C9I A;  1J1D B;  1URQ A;  2OYI C;  3U1C A;  1SQP K;  2R5D A;  1NOH A;  2CPB A;  4AQR D;  3HTK A;  2WPS A;  4XA4 A;  2N1T B;  1JTH A;  1CI6 B;  1N7S C;  3LIE A;  1GK4 A;  3RK2 D;  5AW2 B;  3V2Q A;  5KJ7 A;  2Q5U A;  5CHX A;  4C46 A;  3VMX A;  2GUV A;  1L4A A;  1IC2 A;  3L4F A;  1AQ5 A;  1IFJ A;  2YO2 A;  5AVU B;  2VRS A;  1SQB K;  2L5G B;  4DZO A;  1GL2 C;  2O1K A;  1JY2 P;  4EOT A;  3H6P A;  1LWU A;  3A3Y B;  5CCH C;  3UIA A;  2WSF H;  3G3Z A;  2YKO A;  3KPE A;  3V2P A;  2BAS A;  1NHL A;  3V4W A;  3M0A A;  5APW A;  1WT6 A;  2HPC A;  3A2A A;  3HD7 B;  2HLO A;  1XTC C;  3RL0 C;  2JJL A;  5AW8 B;  5APQ A;  1URQ B;  3TK1 A;  1HWT C;  2XU6 A;  1NU1 K;  3NFQ A;  4W7Y A;  3L36 A;  2A45 G;  1L4A C;  2PP6 A;  3H32 A;  1L0L K;  3HTK B;  4HH2 A;  5AW5 B;  1NKN A;  2Q7C A;  1JTH B;  1GK6 A;  1CZQ A;  1URQ D;  3RK3 B;  1KIL B;  1JY2 O;  1LTJ A;  1HJB A;  1HVV A;  1L0N K;  3SWF A;  2NPS C;  4ZKP A;  4Y99 C;  2GM4 A;  1OWA A;  1KIL D;  1M7L A;  2XV5 A;  3L37 A;  1RF1 A;  3MIW A;  3B5N C;  1PFI A;  4LLH A;  4WY4 C;  4I6M C;  2E43 A;  1LWU B;  1GU5 A;  2QM7 A;  2W6A A;  2OYI A;  1JO5 A;  2IFN A;  5AVV B;  3II6 A;  4RES B;  4LGD E;  3OA7 A;  1MUU A;  2R3C A;  2HPC B;  1XTG B;  1N7S A;  1T2K C;  3VOP A;  4GKG A;  2M8R A;  2FYU K;  2IPP A;  1IFI A;  2FFD C;  1S9K E;  1J1E C;  1N86 A;  2FXM A;  5AVT B;  1N7L A;  4C7N A;  1J2J B;  1GDT A;  1JUN A;  1GL2 A;  1YTZ I;  1GU4 A;  1KQL A;  1LTJ B;  2H8P D;  4IFF A;  5APV A;  2WTY A;  1G1J A;  1FOS E;  2YMY A;  5CCH A;  1JY3 N;  2Z5H A;  1YTZ T;  1A02 J;  5BU8 B;  2KP8 A;  1SVF A;  1JCD A;  1HGV A;  2FKW B;  1IJD B;  3MUD A;  3RK2 C;  5KLV K;  3P32 A;  1N73 C;  2Z5I A;  5APS A;  2Q9I A;  2ZFC A;  3R2P A;  3V2R A;  3V2N A;  1FU1 A;  3M0D C;  2OYI B;  3HE4 B;  2W6B A;  2M3B A;  3VP9 A;  2N1T D;  2XDJ A;  4WB4 A;  3M9H A;  1NAF A;  5CCG D;  2Q3I A;  4O9B A;  3NXS A;  1N7S B;  3TNU A;  3VMZ A;  4JF7 A;  5AW0 B;  3M06 A;  2WZ7 A;  3VMY A;  3L35 A;  2NPS A;  2Z4E A;  1FJK A;  5AW9 B;  1FZB A;  1JNM A;  4C7N B;  2WWW A;  1GL2 B;  3B5N A;  1X8Y A;  1JCC A;  4AUW A;  3HE5 A;  4N3Y B;  1FZE A;  4WY4 A;  2C9L Y;  4C7R A;  1NTK K;  2I1K A;  2P2U A;  3M91 A;  4N78 D;  1HTL C;  2E42 A;  3HD7 D;  1E5W A;  1FZA A;  3HRN A;  1ZN5 A;  1LTT C;  3VTP C;  5AVZ B;  1HH0 A;  5KTB A;  3GHG C;  1IFN A;  1LTS C;  1NTZ K;  3RL0 B;  1KFM A;  2FFD A;  1HGZ A;  2A45 I;  4W7Z A;  3KYQ A;  1GZL A;  1L4A B;  4JYB A;  1KIL C;  1DH3 A;  4XE5 B;  3TYY A;  3RK3 D;  3RL0 D;  3BAS A;  3HUS C;  1IFM A;  3TNU B;  1ZLL A;  5KJ7 D;  1LT9 C;  2QM8 A;  2HOD A;  2YKQ A;  1L4A D;  5APT A;  2KYV A;  3CI9 A;  3OJA B;  3M9B A;  1ZV8 A;  2NPS B;  4Y99 B;  3BAT A;  2KB7 P;  2GUS A;  3BRT B;  1RE4 C;  1LTB C;  3B5N B;  1GW4 A;  1N73 A;  1CW5 A;  2YKP A;  3HE5 B;  3VYI A;  1SFC C;  4WY4 B;  3U59 A;  2FYZ A;  4EIJ A;  1KZU B;  3TSI A;  3M0D A;  2WPR A;  3CL3 D;  2IX7 C;  3I5C A;  3V4Q A;  5APX A;  4GIF A;  2KLV A;  3B8E B;  3T97 A;  4KHX A;  2MJZ A;  3H32 B;  1FAV A;  3U1A A;  1M1J C;  2CPS A;  4GT1 A;  3P7K A;  2O1J A;  1RF0 C;  1SQV K;  3SWY A;  2FFD B;  3N7N A;  3VN0 A;  1J1E B;  5APY A;  1FZC C;  2PAJ A;  1KFN A;  1IO4 A;  2JEE A;  4I1L A;  1RF1 B;  3O8Z A;  1SQQ K;  2HOD B;  2OYH C;  1J1D C;  1JY2 N;  2IFM A;  1GTW A;  5AW6 B;  1W2E A;  1LTA C;  1H88 A;  5CMZ A;  1X9V A;  2N1T C;  1X79 B;  2POH A;  4JYC A;  5CCG C;  3RK2 B;  1N73 B;  1YYC A;  3GHG A;  2WT7 A;  1FZG A;  1VDF A;  5AW4 B;  1OXZ A;  4IFM A;  4I2L C;  5APU A;  2J59 M;  1KIL A;  2YO3 A;  2HG5 D;  3MD0 A;  1RE3 C;  2C0X A;  1N7S D;  2ZXE B;  2KSJ A;  3HUS A;  5CJ4 A;  2C0W A;  1LT9 A;  3NMD A;  1LGH B;  4HYT B;  1MFZ A;  3BVH A;  1JY3 P;  2R32 A;  4OH8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...