2HYNA

Complete ensemble of nmr structures of unphosphorylated human phospholamban pentamer
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
52
structure length
52
Chain Sequence
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cardiac phospholamban
publication title Structure determination of symmetric homo-oligomers by a complete search of symmetry configuration space, using NMR restraints and van der Waals packing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/signaling protein
total genus 20
structure length 52
sequence length 52
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hynA00
1N7LA 2KYVA 1FJPA 2KB7P 2M3BA 2HYNA 1FJKA 1ZLLA
chains in the Genus database with same CATH superfamily
3GF3A 1NU1G 2H88C 2WMMA 2ZYDA 3MGNA 1SQPG 3S9OA 5KJ7A 1QVGO 2XV5A 3KHUA 3VMZA 1N7SB 4ASVA 3L73E 4PJ0E 3TGUD 3H32A 3A0BH 3PHLA 1LTSC 1FC2C 4BXLA 4UB6H 1Y8AA 2YIUC 1KV4A 4JQ0D 3L70D 3W67A 1SQXE 4JF7A 2QJKB 1QL1A 3JC22 1KB9D 3KPEA 3AE8C 1SP4A 3P32A 1T3JA 1KN7A 2YXQB 3JCUE 4Z1MH 4L76A 1J2JB 1KQFB 3HUSA 3A0BE 2P67A 1T3UA 2OYHB 2FYNC 1JUNA 1BGYG 4U3FE 3EFGA 3B5NB 1CZQA 3V4WA 2WPSA 4BRYA 2HR3A 3GW6A 1Q86Q 4EI2A 1VQ4P 4CPGA 3V5BA 5GTHH 4U7JA 3AE7C 2R3SA 3RBXA 1CW5A 1PL5A 1EXJA 3L75D 4LC1A 4YXWH 2KLVA 2CPBA 2CK3H 2Q7CA 1KFNA 2PRRA 3GMAA 3LW5J 3L37A 1BE3D 4HYTB 2Q9IA 1SQBD 2D2CB 3FWNA 3AE1C 3CMAP 2A45I 1HGVA 5AVZB 1VF5B 1LT1A 3L4FA 2E74C 1LTJB 3AEEC 1NTMJ 1IK9A 2W90A 5GTHE 2HODB 2B89A 2R5BA 1EDKA 3FXDA 1XTGB 1EZVI 1GU4A 3L73D 1LP1B 1KYOI 3PRJA 3H1LD 2E76C 1SQVK 3M9HA 1FS0E 4N6JA 2KB7P 3W68A 1SQVG 3TNUB 1X22A 2Q6QA 4GT1A 1RE3A 1USEA 2ZYGA 3Q2YA 2RN0A 1EDIA 2YXRB 3O8ZA 2E74D 2K9JB 1M1JB 1L0LK 3H1JJ 1ZRTE 1PP9E 2K1AA 2K3RA 3H1IJ 1L0LG 4U3FD 2H7HA 1VQ7P 3IAOA 4HB1A 3TF5A 4H0LC 4JYBA 1NOHA 3WU2E 1N73B 4PD4H 3P8MC 3BRVB 1GD2E 4M3LA 4PV1B 3U1AA 5KLVJ 1WRGA 1JY2P 3L72E 1GL2C 1M56D 3CX5E 1OIPA 3GHGC 5APXA 3OJAB 3Q3DA 4WWIA 3OW2O 4XE5B 4WY4B 3NFQA 1AFOA 2KUBA 3TSIA 1LTGC 2KXPB 5AVRB 3VMYA 1EXIA 3M06A 3L71J 1DH3A 2QA4P 3T97A 2M3BA 3EQ2A 3E1IA 4AQRD 3ZDMA 3H1HJ 2JKVA 2IBZE 3FX0A 4H0LD 1JTHA 1SQXK 4GKGA 4IOIH 2P7JA 3P8CD 1SQXG 5AVSB 2FFDA 2FYUE 3AE9C 3U59A 3D71A 2AXTH 2HPCA 1GL2D 3PTZA 2BCCE 2P1JA 2POHA 1MV8A 1G1IA 2RH0A 1NU1E 2N9YB 1SQQJ 2NPSA 3HD7A 1SQPE 3JSVC 2QJKC 1AV1A 3CWBJ 1RF1B 2ITAA 3BCCJ 1BCCJ 1FZFA 1JCCA 3WUVA 1VQ5P 4RO0A 2AXTE 1RQUA 2KNCB 1ZRTD 1PP9D 2JWAA 5KAFH 2KI7B 2HLOA 3QWOC 1VQ9P 1L4AC 2O1KA 3LW5H 2JR8A 2ZAEB 1CI6B 2C9NY 2RMZA 3B4SA 5AW7B 4I2LC 2AEFA 2WITA 2ZFCA 1OW8A 3SFDC 1FZCA 1G2CB 1EC5A 1S2EA 3AEDC 1FDOA 2IDBA 3L72D 1NTKK 2KZIA 1PV3A 1IFDA 1GL2A 2FXOA 2QM8A 3CX5D 1L0NJ 5KAFE 1GU5A 3GHGA 3AEAC 2R5DA 1NTKG 3L74J 4ZKUA 4D6TD 4B86A 1HBWA 2PAJA 1Q82Q 2I8DA 1QEXA 3ITKA 2D2CC 5AW1B 4HKZH 1HJ0A 2LR2A 3AECC 1VF5C 1L4AD 1VQKP 4KHXA 1PGOA 2IBZD 2AEMA 3CXHH 5KJ7C 1N7SA 1Q90D 1NH4A 3L36A 3A5TA 2FYUD 1LT9B 1UIXA 1RH5B 1ZR4A 2BCCD 2BEQD 2PGDA 2ZT9C 4XA4A 1NU1D 4LGDE 1QVFO 1SQPD 4ZMDA 3V2PA 2D2CD 1N2DC 3CXHE 3H1KJ 1QLED 2QIWA 2NZ2A 1VF5D 2IFMA 1LTAC 1IFMA 3Q1MA 3H1JE 1KORA 2A45H 3H1IE 5B66H 1NAFA 3HUSC 4NPEA 1KTMA 3RGUA 5AVWB 1JB0J 1SQVE 5KJ7D 4C7NA 2OYHA 1KD1Q 1HVVA 1OVUA 2FXMA 4HH2A 1URQB 3B5NA 1OXZA 3CCQP 3PJSK 1FDMA 3CD6P 1N73C 3AEGC 3KZIH 1M7LA 1MFZA 2ZT9D 5B5EH 5AW0B 3VYIA 2Y9YA 3CCUP 2WVRA 5B66E 5KAIH 1K9MQ 1L0LE 1BGYD 1M8OB 4H44B 1SS1A 3VN0A 4L73A 5CCHC 3IR9A 3MZWB 2IYPA 3RK3C 2KK7A 3WUUA 1OVRA 2VRSA 3KZIE 3CCRP 2Z4EA 4I7ZB 4R4MA 2MJZA 5B5EE 1NVOA 1LTJA 3RL0g 4OGQB 1JY3N 2HODA 4ZKPA 4DT0A 1ZXGA 2V7QJ 2WPRA 4PV1D 3RL0C 5L8RJ 1LP1A 2XNDH 2YO2A 4DZOA 3RBZA 2KYVA 4Y99B 3Q5PA 1YITP 3D6YA 3CPWO 4R4LA 3CCMP 2Y0CA 2QJYB 2BASA 1M90Q 2B9BA 2XDJA 3HE4B 3TNUA 2YKPA 5CCHD 3R4YA 3RK3D 4NPFX 3CWBE 1NTZJ 1RF1C 3I5CA 3PH0A 1PGQA 1AVYA 2LXBA 1RE3C 4OWFA 2OTKE 2E42A 2K9JA 3NTNA 4OVNF 2WQYC 1JY2N 1M1JA 2WPQA 2K37A 2FXPA 1SQVD 2JWDA 3BVHA 4UB6E 3RL0D 1VQNP 3K5BA 1N73A 2FBWC 1S1CX 1IFNA 1QX8A 5H2FH 1NTMK 3D70A 4H13B 1L0NE 4YPCA 2E75B 1NTMG 3L74E 2I1KA 2O3JA 1L0LD 3B8EB 1P84D 4RJTA 1KB9I 3AE4C 4WY4A 5CCHA 2LKMA 1DD4A 1FE6A 3M0DC 4JBZA 1OW6A 5AVYB 1OWAA 1K04A 3TDKA 1NWQA 4K3AA 1IFPA 3VTPC 3HE5B 1X79B 2B87B 3AE2C 2WWWA 1PIXA 3S1KA 1VDFA 1NKNA 1NTKE 1VQOP 2N1TB 1KZUB 3IFMA 2HYNA 1LWUB 2FFDC 1H88A 3CC7P 1FJPA 1N86A 3WMM0 2V4HA 5AW9B 1P84I 1ZP0C 1JMBA 3H1JG 3HRNA 5TISH 3H1IG 3CL3D 4HJGH 2E5YA 1EDLA 2NPSC 3HD7C 1NAYA 3H1KE 1SQXD 4DCKA 1JM0A 2KSEA 1GK4A 1RF1A 5KLVK 1BDCA 3Q5SA 5AVUB 3WUTA 3RK2B 5KLVG 3E1RA 2QEXP 3TGUJ 5CBOA 2XKMA 2A45G 3PLNA 5TISE 3P7KA 2WSFJ 5CJ0A 2MKVA 3L35A 1URQC 1YI2P 1CI6A 4L75A 3L70J 1KQLA 5AW8B 1FDIA 3MUDC 2J59M 2R44A 2ZYAA 1G2CA 3C8VA 3PP5A 4XFJA 1FZCC 3L71G 5APWA 1YHQP 3KDPB 4EYYQ 2WT7B 3H1HG 2IYOA 5APTA 2NPSD 3HD7D 2G8YA 1AJYA 1K05A 1W5CE 1J1DC 4YXDC 2Q5UA 2GM4A 1FJKA 3BATA 2YKQA 1RHZB 4BWNA 4I7ZC 3M0DA 2DW3A 2JDIH 4PD4E 1OFCX 1YTZI 1SQQK 4OGQC 2L91A 1URQD 1SQQG 1NTKD 2XNXA 3L75J 3CWBG 2A06G 1N7SC 3BCCG 1BE3J 1LT9A 2OYIB 4Y99C 1SQBJ 3FWLA 2W83C 3F5HA 1ZR2A 3EFFK 1NTZE 1HF9A 1RQVA 1FOSF 5CHXA 1YIJP 2L5GB 3L73J 4OGQD 1L0NK 1E5WA 3H1LJ 5AW2B 1L0NG 3SSUA 1PGPA 3L74G 1RF0A 5AW4B 1URQA 2OYHC 1N7SD 1S5LX 2I1JA 3B5NC 5DJUB 3MUDA 3ABVC 1W2EA 2JJLA 2PP6A 5AVTB 3CC2P 5AW5B 5BU5A 1WT6A 1KFMA 4AYCA 1PZQA 3VMXA 2UWJE 3II6A 4U3FJ 4N3YB 1VQ8P 3U1CA 1IO4A 1VPCA 5AVXB 5KKZB 4PD4D 1H0TB 2SPZA 3N4XA 2M5AB 1H8AA 1NTME 1LTJC 2N1TC 1BSNA 1VQMP 3B5ND 1LWUC 3H1KG 3SWYA 3I55P 3G71P 1EDJA 4WBAA 5E79H 3VP9A 1JO5A 3CX5I 3KXDA 1YQ4C 1L2PA 2WSFH 2O01N 2OGUA 1HJBA 3HE4A 5TJHA 1GK6A 2KZJA 2ZVOB 3V2NA 4IL6X 3TYYA 2H8PD 1HTLC 1JY3O 1IC2A 1YJNP 5APQA 4EDFA 4OH8B 2Y0DA 2N9BA 1Y47A 2E76B 3V6IA 5E79E 2Y0EA 3TGUE 1PPJG 4EOTA 5APUA 2IBZI 3EWKA 1M1JC 2N1TD 2QG4A 4UB8H 3A0HH 1ZLLA 2W27A 2QSIA 3H25A 3L70E 1CSBA 2J5UA 2E43A 3C9IA 4GIFA 1VQPP 2KSJA 4TLFA 2ZJSE 5CMZA 4PV1C 1KYOH 1NGMB 5KLVE 3C1LA 4TT3H 4DJGA 2GUSA 1PP9J 1NO4A 2G3AA 2M0BA 1FZEA 5CJ4A 4UB8E 3UIAA 2YNYA 2P2UA 1GMJA 4H0LB 3BASA 2WZ7A 3M91A 4WY4C 2CPSA 4C7RA 2W8ZA 1PFIA 5APYA 1EZVE 3QH9A 1S72P 3L71E 1IJDB 1HWTC 1KYOE 3HE5A 2B87A 1G1JA 1NTMD 3H1HE 3L72J 1DEEG 1AQTA 4ZNCA 4GDOA 2B88A 2E5TA 2N1TA 1KILB 1NTZK 3O6QB 1YJWP 4D6TJ 1ZW0A 5KAIE 4I6MC 1NTZG 1LTIC 1LWUA 1OX3A 5AW3B 4AUWA 2OYIC 1SFCB 1OZHA 1RE4A 2YO3A 1AA0A 2WSCJ 2QJPB 4W7YA 1Q7YQ 3NMDA 1SQQE 5CCGC 4W7ZA 4WY4D 2H89C 3CXHD 3CCEP 2A06E 3BCCE 3JCUH 1BCCE 2IX7C 2FYUJ 3H1LE 4NPDA 2P10A 4KT0J 2QRXA 3H1JD 2BCCJ 1VQLP 1J1EB 1N8RQ 3H1ID 4N78E 3CCVP 2GA1A 1NU1J 4JYCA 3GF7A 1SQPJ 1RY3A 1H89A 1TU3F 1ZOYC 3IF4A 2WT7A 2WSEJ 5KLVD 1YYCA 3OA7A 1S9KE 5CCGD 1FZBA 2FY8A 2KS1B 3CXHI 2WTYA 1L4AB 4C7NB 2QE7H 2M8RA 3AE6C 4QMAA 1R5SA 1D7MA 3HTKB 1MUUA 1FOSE 1NKZB 1LJ2A 2O01J 5KKZC 1IFJA 3KYQA 1EZVD 1FU1A 3L71D 2H43A 1KYOD 5H2FE 2KLUA 3H1HD 4YTPC 1KC8Q 5APSA 1X0TA 2YMYA 3SWFA 3IN6A 3SWKA 1LTBC 2W6AA 5KLIB 2YMKA 1BGYJ 1U57A 1ZMEC 2OYIA 4IFMA 1GZLA 1VQ6P 1BDDA 1HGZA 1AQ5A 1LT9C 2AXCA 3TGUG 1S4XA 3MIWA 2JO1A 1SVFA 2LXCB 1SQQD 5CCGA 2PFXA 3P8CE 3L70G 1W2BO 2HG5D 3CWBD 2A06D 3BCCD 1BCCD 1NHLA 4WB4A 1X9VA 1GW3A 1NJIQ 1ZV8A 4L74A 2KNCA 1DX7A 2ZT9B 4N78D 1KILE 3H32B 1JY3P 1WMKA 1U7JA 3F89A 4KJMA 1RF0C 3A3YB 1MFTA 1KMIZ 3WU2H 3D6ZA 3E7KA 1GTWA 5KTBA 5CBNA 2XU6A 1GDTA 1EZVG 4I1LA 1S9KD 1PPJE 3CX5H 1NYHA 1L0ND 3HUSB 2Z5HA 1JNMA 3L74D 2JEEA 3CLQA 1SQVJ 1M1KQ 1DIPA 3L75G 1SQBK 4H44C 1E79H 1A02F 2V7QH 2E76D 1JCDA 1BE3G 1SQBG 4BRYB 1S3JA 2OARA 3I56P 2P58A 1H0TA 1MZ9A 2WSCH 2M5AA 2OYOA 2W6BA 4ASWA 2Z5IA 2RKLA 1JOCA 3V4QA 1KILC 2W6JH 3USSA 1YBKA 2WSSH 4D6TE 2YKOA 1L0LJ 2Y9ZA 2Q1KA 2Q3IA 2OTJP 1USDA 1SFCC 3RK3B 2FKWB 3L73G 3H6PA 1T8ZA 1DEBA 1IFIA 1BCCG 1VL2A 2KOGA 3H1LG 4WVZA 2QJPC 2QJYC 1IK7A 1S5LH 1HH0A 4H44D 2M3EA 4Y28J 3CCSP 1DD3A 1X8YA 3Q5RA 1A02J 3H1KD 3RL0B 2XZRA 2C0WA 3V2QA 2WSEH 5BVZA 3S4RA 4MN4C 3VOPA 1Q2NA 2IPPA 4GOEA 1KILD 4IFFA 1J1EC 2ZXXA 1UIIA 1S5LE 1MKMA 1SFCD 2YIUB 4U3FG 1LNQA 3CCJP 5AW6B 2O01H 5APVA 1SQXJ 2IFNA 2OQQA 1Y9BA 1YQ3C 1PPJD 4H13C 1JEKA 3CMEP 5C39A 2OTLP 2QVAA 2E75C 4LLHA 2FYNB 4W80A 1QL2A 5DJTB 3LIDA 1U7MA 5M1BA 3MD0A 2FYZA 2R32A 2NRGA 1HUCA 1PGJA 1K73Q 4GOFA 4IL6H 3AE3C 3FXEA 3G4SP 4C46A 1KILA 3O6QA 5KLIC 2IZ1A 1EQ7A 1BGYE 1SFCA 3G6EP 1OW7A 3SFEC 1FZAA 3TK1A 4H13D 1RE4C 3M9BA 3VP8A 2GUVA 2E75D 4IL6E 4RESB 1LGHB 3M9QA 2QM7A 3T97B 2C9LY 5AVQB 2E74B 3AEBC 1NTKJ 1FBMA 1JTHB 2K9YA 1R5LA 1NTZD 1GW4A 2JP3A 5GTIH 4RKUJ 2KP8A 1KB9H 1K8AQ 2FFDB 4PD4I 1KQGB 3MTUE 4O9BA 3BRTB 1R8EA 2HPCB 3RK2C 1PP9G 3KQGA 4DOJA 2AEJA 3N7NA 2J58A 5BU8B 1IZNB 2O1JA 4EIJA 3CI9A 2NPSB 3RK3E 3HD7B 3GLMA 2R3CA 1T2KC 5GTIE 1OMIA 3MHVA 1KB9E 3CCLP 5K5GB 2HFED 3V2RA 3CC4P 3GG2A 2C0XA 1BSHA 1YTZT 3NXSA 1ZN5A 1FAVA 3L72G 2KS1A 2BEZF 1QGKB 1L4AA 4IFDK 1Z56A 1P84H 1JY2O 3VMAA 1FZGA 1LTTC 3HTKA 4D6TG 2Q3EA 1SLQA 3A0HE 3LIEA 4JPZB 4A7PA 2KIKA 1KQSO 5AVVB 3RK2D 1FZCB 1M57D 3A2AA 3FGAD 3G9RA 3G3ZA 1N7LA 1GL2B 1Q81Q 2IBZG 5EFWB 3B71A 1JMMA 1P84E 3GHGB 1J1DB 1T2KD 3OAKA 1AVOA 2K88A 3L75E 2FYUK 1OVVA 1YJ9P 2IZ0A 1BE3E 2FYUG 1SQBE 4PJ0H 1T6AA 1XTCC 3MP7B 2WPVB 3M0AA 2ZXEB 2BCCG 3AEFC 4K35A 1NU1K 3AE5C 3R2PA 2ZVNB 4GODA 1SQPK 3A7OA
chains in the Genus database with same CATH topology
1N7SC 1LT9A 2OYIB 5KJ7C 4Y99C 1N7SA 3MGNA 3MIWA 5KJ7A 1SVFA 2XV5A 1NH4A 3L36A 3A5TA 1LT9B 5CCGA 3VMZA 1N7SB 1ZR4A 3P8CE 1ZR2A 2HG5D 4XA4A 4LGDE 1NHLA 4WB4A 3H32A 1X9VA 1GW3A 1FOSF 3V2PA 5CHXA 1LTSC 2L5GB 1N2DC 1ZV8A 1DX7A 4N78D 3H32B 1L0NK 1E5WA 1JY3P 2IFMA 1LTAC 4JF7A 1QL1A 3KPEA 5AW2B 1RF0C 1IFMA 1SP4A 3P32A 1RF0A 1T3JA 3A3YB 2A45H 5AW4B 1URQA 1NAFA 3HUSC 1J2JB 1N7SD 2OYHC 5AVWB 2I1JA 5KJ7D 1GTWA 4C7NA 3HUSA 2OYHA 5KTBA 3B5NC 3MUDA 1HVVA 2P67A 2XU6A 1GDTA 2FXMA 4HH2A 1W2EA 1T3UA 1URQB 3B5NA 1OXZA 4I1LA 2JJLA 1S9KD 2PP6A 1FDMA 3HUSB 5AVTB 2OYHB 2Z5HA 1JUNA 1N73C 1JNMA 2JEEA 3CLQA 1M7LA 3EFGA 3B5NB 1CZQA 1MFZA 3V4WA 2WPSA 5AW5B 5AW0B 5BU5A 1WT6A 1KFMA 3VYIA 4AYCA 1SQBK 1A02F 3VMXA 1JCDA 3II6A 2OARA 3V5BA 1MZ9A 2WSCH 4N3YB 3U1CA 1IO4A 1VPCA 5AVXB 3VN0A 2W6BA 5CCHC 3IR9A 2Z5IA 1CW5A 3RK3C 1JOCA 4LC1A 2KLVA 3V4QA 1KILC 2CPBA 2VRSA 3N4XA 2Q7CA 1KFNA 2YKOA 2Z4EA 3L37A 4HYTB 1H8AA 2MJZA 2Q3IA 2Q9IA 1LTJC 2N1TC 1LTJA 1SFCC 3RK3B 3B5ND 1JY3N 2FKWB 3H6PA 2A45I 1T8ZA 2HODA 1HGVA 5AVZB 1DEBA 1IFIA 3L4FA 1LWUC 2KOGA 1LTJB 3SWYA 4ZKPA 1IK9A 2HODB 4WBAA 2R5BA 3VP9A 2WPRA 1JO5A 3RL0C 1XTGB 2YO2A 1HH0A 4DZOA 2KYVA 4Y99B 2WSFH 1HJBA 3HE4A 1GU4A 1GK6A 3V2NA 2BASA 1X8YA 3TYYA 1A02J 2H8PD 1HTLC 1JY3O 3RL0B 2XZRA 2XDJA 1IC2A 2C0WA 3V2QA 3HE4B 3TNUA 2YKPA 1SQVK 3M9HA 2WSEH 5BVZA 5CCHD 5APQA 4N6JA 2KB7P 3VOPA 3RK3D 2IPPA 4OH8B 1KILD 3TNUB 4IFFA 2N9BA 1J1EC 1RF1C 3I5CA 4EOTA 1RE3C 5APUA 4GT1A 2E42A 1M1JC 2N1TD 1RE3A 1SFCD 3NTNA 1JY2N 1M1JA 5AW6B 2O01H 2WPQA 1ZLLA 2W27A 5APVA 3O8ZA 2IFNA 1CSBA 1M1JB 1L0LK 2E43A 3C9IA 4GIFA 3BVHA 3RL0D 2KSJA 5CMZA 2H7HA 1N73A 4JYBA 1IFNA 2GUSA 1NO4A 1FZEA 1NTMK 5CJ4A 4LLHA 4W80A 1NOHA 1N73B 1QL2A 3P8MC 3BRVB 1GD2E 3LIDA 3UIAA 2YNYA 3MD0A 2P2UA 4M3LA 2I1KA 3U1AA 3BASA 2FYZA 3B8EB 2R32A 1WRGA 1JY2P 2WZ7A 1HUCA 3M91A 1GL2C 4WY4C 2CPSA 4C7RA 3GHGC 5APXA 3OJAB 4WY4A 5CCHA 1PFIA 4C46A 5APYA 2LKMA 1KILA 1IJDB 1HWTC 3M0DC 3HE5A 1EQ7A 4XE5B 4WY4B 3NFQA 5AVYB 1G1JA 1OWAA 1AFOA 3TSIA 1LTGC 2N1TA 1KILB 1NTZK 5AVRB 1NWQA 1SFCA 3VMYA 3M06A 3VTPC 3HE5B 1X79B 2WWWA 4I6MC 1FZAA 3TK1A 1DH3A 1LTIC 3T97A 1LWUA 2M3BA 3EQ2A 1RE4C 1NKNA 1VDFA 3E1IA 2N1TB 3M9BA 1KZUB 5AW3B 3VP8A 4AQRD 4AUWA 2OYIC 1SFCB 2GUVA 3IFMA 1RE4A 4RESB 1LGHB 2HYNA 2YO3A 3M9QA 2QM7A 1JTHA 1SQXK 2C9LY 1LWUB 4GKGA 5AVQB 2P7JA 2FFDC 3P8CD 1H88A 5AVSB 2FFDA 1FJPA 1FBMA 1N86A 1JTHB 3WMM0 4W7YA 3NMDA 5AW9B 1GW4A 2KP8A 5CCGC 3HRNA 4W7ZA 3U59A 2FFDB 2HPCA 1GL2D 4WY4D 2P1JA 3CL3D 2POHA 1MV8A 1G1IA 2NPSC 3MTUE 4O9BA 3HD7C 3BRTB 2HPCB 3RK2C 2NPSA 2IX7C 3KQGA 1GK4A 3HD7A 4DOJA 1RF1A 3N7NA 2J58A 5BU8B 2O1JA 4EIJA 5KLVK 3CI9A 1J1EB 2NPSB 4N78E 3HD7B 5AVUB 1RF1B 3RK2B 2R3CA 1FZFA 1JCCA 4JYCA 1T2KC 2XKMA 2A45G 2HFED 3P7KA 3V2RA 5CJ0A 1RY3A 1H89A 3L35A 1URQC 2C0XA 1CI6A 1YTZT 2HLOA 3NXSA 1ZN5A 1FAVA 1KQLA 1L4AC 2O1KA 5AW8B 2J59M 3LW5H 1L4AA 4IFDK 2WT7A 1Z56A 1G2CA 1JY2O 1CI6B 2C9NY 1FZGA 3PP5A 1YYCA 3OA7A 1S9KE 5AW7B 4I2LC 1LTTC 3HTKA 5CCGD 2WITA 2ZFCA 1FZBA 1FZCC 5APWA 1SLQA 3LIEA 2WTYA 1L4AB 4C7NB 3KDPB 2WT7B 1FZCA 1G2CB 2M8RA 5AVVB 3HTKB 5APTA 1MUUA 2NPSD 1FOSE 1NKZB 3HD7D 3RK2D 1NTKK 1IFDA 1FZCB 1GL2A 1J1DC 2QM8A 1GU5A 3GHGA 2R5DA 1IFJA 3A2AA 2Q5UA 3KYQA 4ZKUA 2GM4A 1FJKA 1FU1A 3G3ZA 4B86A 3BATA 2YKQA 2H43A 1HBWA 1N7LA 2PAJA 1GL2B 1JMMA 3GHGB 3M0DA 1J1DB 1T2KD 3OAKA 5APSA 5AW1B 2YMYA 3SWFA 1YTZI 1SQQK 1LTBC 2FYUK 2W6AA 1URQD 2XNXA 1XTCC 1L4AD 4KHXA 2OYIA 3M0AA 2ZXEB 4IFMA 1GZLA 1NU1K 3R2PA 1HGZA 1AQ5A 1LT9C 1SQPK 3A7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7L A;  2KYV A;  1FJP A;  2KB7 P;  2M3B A;  2HYN A;  1FJK A;  1ZLL A; 
#chains in the Genus database with same CATH topology
 3GF3 A;  1NU1 G;  2H88 C;  2WMM A;  2ZYD A;  3MGN A;  1SQP G;  3S9O A;  5KJ7 A;  1QVG O;  2XV5 A;  3KHU A;  3VMZ A;  1N7S B;  4ASV A;  3L73 E;  4PJ0 E;  3TGU D;  3H32 A;  3A0B H;  3PHL A;  1LTS C;  1FC2 C;  4BXL A;  4UB6 H;  1Y8A A;  2YIU C;  1KV4 A;  4JQ0 D;  3L70 D;  3W67 A;  1SQX E;  4JF7 A;  2QJK B;  1QL1 A;  3JC2 2;  1KB9 D;  3KPE A;  3AE8 C;  1SP4 A;  3P32 A;  1T3J A;  1KN7 A;  2YXQ B;  3JCU E;  4Z1M H;  4L76 A;  1J2J B;  1KQF B;  3HUS A;  3A0B E;  2P67 A;  1T3U A;  2OYH B;  2FYN C;  1JUN A;  1BGY G;  4U3F E;  3EFG A;  3B5N B;  1CZQ A;  3V4W A;  2WPS A;  4BRY A;  2HR3 A;  3GW6 A;  1Q86 Q;  4EI2 A;  1VQ4 P;  4CPG A;  3V5B A;  5GTH H;  4U7J A;  3AE7 C;  2R3S A;  3RBX A;  1CW5 A;  1PL5 A;  1EXJ A;  3L75 D;  4LC1 A;  4YXW H;  2KLV A;  2CPB A;  2CK3 H;  2Q7C A;  1KFN A;  2PRR A;  3GMA A;  3LW5 J;  3L37 A;  1BE3 D;  4HYT B;  2Q9I A;  1SQB D;  2D2C B;  3FWN A;  3AE1 C;  3CMA P;  2A45 I;  1HGV A;  5AVZ B;  1VF5 B;  1LT1 A;  3L4F A;  2E74 C;  1LTJ B;  3AEE C;  1NTM J;  1IK9 A;  2W90 A;  5GTH E;  2HOD B;  2B89 A;  2R5B A;  1EDK A;  3FXD A;  1XTG B;  1EZV I;  1GU4 A;  3L73 D;  1LP1 B;  1KYO I;  3PRJ A;  3H1L D;  2E76 C;  1SQV K;  3M9H A;  1FS0 E;  4N6J A;  2KB7 P;  3W68 A;  1SQV G;  3TNU B;  1X22 A;  2Q6Q A;  4GT1 A;  1RE3 A;  1USE A;  2ZYG A;  3Q2Y A;  2RN0 A;  1EDI A;  2YXR B;  3O8Z A;  2E74 D;  2K9J B;  1M1J B;  1L0L K;  3H1J J;  1ZRT E;  1PP9 E;  2K1A A;  2K3R A;  3H1I J;  1L0L G;  4U3F D;  2H7H A;  1VQ7 P;  3IAO A;  4HB1 A;  3TF5 A;  4H0L C;  4JYB A;  1NOH A;  3WU2 E;  1N73 B;  4PD4 H;  3P8M C;  3BRV B;  1GD2 E;  4M3L A;  4PV1 B;  3U1A A;  5KLV J;  1WRG A;  1JY2 P;  3L72 E;  1GL2 C;  1M56 D;  3CX5 E;  1OIP A;  3GHG C;  5APX A;  3OJA B;  3Q3D A;  4WWI A;  3OW2 O;  4XE5 B;  4WY4 B;  3NFQ A;  1AFO A;  2KUB A;  3TSI A;  1LTG C;  2KXP B;  5AVR B;  3VMY A;  1EXI A;  3M06 A;  3L71 J;  1DH3 A;  2QA4 P;  3T97 A;  2M3B A;  3EQ2 A;  3E1I A;  4AQR D;  3ZDM A;  3H1H J;  2JKV A;  2IBZ E;  3FX0 A;  4H0L D;  1JTH A;  1SQX K;  4GKG A;  4IOI H;  2P7J A;  3P8C D;  1SQX G;  5AVS B;  2FFD A;  2FYU E;  3AE9 C;  3U59 A;  3D71 A;  2AXT H;  2HPC A;  1GL2 D;  3PTZ A;  2BCC E;  2P1J A;  2POH A;  1MV8 A;  1G1I A;  2RH0 A;  1NU1 E;  2N9Y B;  1SQQ J;  2NPS A;  3HD7 A;  1SQP E;  3JSV C;  2QJK C;  1AV1 A;  3CWB J;  1RF1 B;  2ITA A;  3BCC J;  1BCC J;  1FZF A;  1JCC A;  3WUV A;  1VQ5 P;  4RO0 A;  2AXT E;  1RQU A;  2KNC B;  1ZRT D;  1PP9 D;  2JWA A;  5KAF H;  2KI7 B;  2HLO A;  3QWO C;  1VQ9 P;  1L4A C;  2O1K A;  3LW5 H;  2JR8 A;  2ZAE B;  1CI6 B;  2C9N Y;  2RMZ A;  3B4S A;  5AW7 B;  4I2L C;  2AEF A;  2WIT A;  2ZFC A;  1OW8 A;  3SFD C;  1FZC A;  1G2C B;  1EC5 A;  1S2E A;  3AED C;  1FDO A;  2IDB A;  3L72 D;  1NTK K;  2KZI A;  1PV3 A;  1IFD A;  1GL2 A;  2FXO A;  2QM8 A;  3CX5 D;  1L0N J;  5KAF E;  1GU5 A;  3GHG A;  3AEA C;  2R5D A;  1NTK G;  3L74 J;  4ZKU A;  4D6T D;  4B86 A;  1HBW A;  2PAJ A;  1Q82 Q;  2I8D A;  1QEX A;  3ITK A;  2D2C C;  5AW1 B;  4HKZ H;  1HJ0 A;  2LR2 A;  3AEC C;  1VF5 C;  1L4A D;  1VQK P;  4KHX A;  1PGO A;  2IBZ D;  2AEM A;  3CXH H;  5KJ7 C;  1N7S A;  1Q90 D;  1NH4 A;  3L36 A;  3A5T A;  2FYU D;  1LT9 B;  1UIX A;  1RH5 B;  1ZR4 A;  2BCC D;  2BEQ D;  2PGD A;  2ZT9 C;  4XA4 A;  1NU1 D;  4LGD E;  1QVF O;  1SQP D;  4ZMD A;  3V2P A;  2D2C D;  1N2D C;  3CXH E;  3H1K J;  1QLE D;  2QIW A;  2NZ2 A;  1VF5 D;  2IFM A;  1LTA C;  1IFM A;  3Q1M A;  3H1J E;  1KOR A;  2A45 H;  3H1I E;  5B66 H;  1NAF A;  3HUS C;  4NPE A;  1KTM A;  3RGU A;  5AVW B;  1JB0 J;  1SQV E;  5KJ7 D;  4C7N A;  2OYH A;  1KD1 Q;  1HVV A;  1OVU A;  2FXM A;  4HH2 A;  1URQ B;  3B5N A;  1OXZ A;  3CCQ P;  3PJS K;  1FDM A;  3CD6 P;  1N73 C;  3AEG C;  3KZI H;  1M7L A;  1MFZ A;  2ZT9 D;  5B5E H;  5AW0 B;  3VYI A;  2Y9Y A;  3CCU P;  2WVR A;  5B66 E;  5KAI H;  1K9M Q;  1L0L E;  1BGY D;  1M8O B;  4H44 B;  1SS1 A;  3VN0 A;  4L73 A;  5CCH C;  3IR9 A;  3MZW B;  2IYP A;  3RK3 C;  2KK7 A;  3WUU A;  1OVR A;  2VRS A;  3KZI E;  3CCR P;  2Z4E A;  4I7Z B;  4R4M A;  2MJZ A;  5B5E E;  1NVO A;  1LTJ A;  3RL0 g;  4OGQ B;  1JY3 N;  2HOD A;  4ZKP A;  4DT0 A;  1ZXG A;  2V7Q J;  2WPR A;  4PV1 D;  3RL0 C;  5L8R J;  1LP1 A;  2XND H;  2YO2 A;  4DZO A;  3RBZ A;  2KYV A;  4Y99 B;  3Q5P A;  1YIT P;  3D6Y A;  3CPW O;  4R4L A;  3CCM P;  2Y0C A;  2QJY B;  2BAS A;  1M90 Q;  2B9B A;  2XDJ A;  3HE4 B;  3TNU A;  2YKP A;  5CCH D;  3R4Y A;  3RK3 D;  4NPF X;  3CWB E;  1NTZ J;  1RF1 C;  3I5C A;  3PH0 A;  1PGQ A;  1AVY A;  2LXB A;  1RE3 C;  4OWF A;  2OTK E;  2E42 A;  2K9J A;  3NTN A;  4OVN F;  2WQY C;  1JY2 N;  1M1J A;  2WPQ A;  2K37 A;  2FXP A;  1SQV D;  2JWD A;  3BVH A;  4UB6 E;  3RL0 D;  1VQN P;  3K5B A;  1N73 A;  2FBW C;  1S1C X;  1IFN A;  1QX8 A;  5H2F H;  1NTM K;  3D70 A;  4H13 B;  1L0N E;  4YPC A;  2E75 B;  1NTM G;  3L74 E;  2I1K A;  2O3J A;  1L0L D;  3B8E B;  1P84 D;  4RJT A;  1KB9 I;  3AE4 C;  4WY4 A;  5CCH A;  2LKM A;  1DD4 A;  1FE6 A;  3M0D C;  4JBZ A;  1OW6 A;  5AVY B;  1OWA A;  1K04 A;  3TDK A;  1NWQ A;  4K3A A;  1IFP A;  3VTP C;  3HE5 B;  1X79 B;  2B87 B;  3AE2 C;  2WWW A;  1PIX A;  3S1K A;  1VDF A;  1NKN A;  1NTK E;  1VQO P;  2N1T B;  1KZU B;  3IFM A;  2HYN A;  1LWU B;  2FFD C;  1H88 A;  3CC7 P;  1FJP A;  1N86 A;  3WMM 0;  2V4H A;  5AW9 B;  1P84 I;  1ZP0 C;  1JMB A;  3H1J G;  3HRN A;  5TIS H;  3H1I G;  3CL3 D;  4HJG H;  2E5Y A;  1EDL A;  2NPS C;  3HD7 C;  1NAY A;  3H1K E;  1SQX D;  4DCK A;  1JM0 A;  2KSE A;  1GK4 A;  1RF1 A;  5KLV K;  1BDC A;  3Q5S A;  5AVU B;  3WUT A;  3RK2 B;  5KLV G;  3E1R A;  2QEX P;  3TGU J;  5CBO A;  2XKM A;  2A45 G;  3PLN A;  5TIS E;  3P7K A;  2WSF J;  5CJ0 A;  2MKV A;  3L35 A;  1URQ C;  1YI2 P;  1CI6 A;  4L75 A;  3L70 J;  1KQL A;  5AW8 B;  1FDI A;  3MUD C;  2J59 M;  2R44 A;  2ZYA A;  1G2C A;  3C8V A;  3PP5 A;  4XFJ A;  1FZC C;  3L71 G;  5APW A;  1YHQ P;  3KDP B;  4EYY Q;  2WT7 B;  3H1H G;  2IYO A;  5APT A;  2NPS D;  3HD7 D;  2G8Y A;  1AJY A;  1K05 A;  1W5C E;  1J1D C;  4YXD C;  2Q5U A;  2GM4 A;  1FJK A;  3BAT A;  2YKQ A;  1RHZ B;  4BWN A;  4I7Z C;  3M0D A;  2DW3 A;  2JDI H;  4PD4 E;  1OFC X;  1YTZ I;  1SQQ K;  4OGQ C;  2L91 A;  1URQ D;  1SQQ G;  1NTK D;  2XNX A;  3L75 J;  3CWB G;  2A06 G;  1N7S C;  3BCC G;  1BE3 J;  1LT9 A;  2OYI B;  4Y99 C;  1SQB J;  3FWL A;  2W83 C;  3F5H A;  1ZR2 A;  3EFF K;  1NTZ E;  1HF9 A;  1RQV A;  1FOS F;  5CHX A;  1YIJ P;  2L5G B;  3L73 J;  4OGQ D;  1L0N K;  1E5W A;  3H1L J;  5AW2 B;  1L0N G;  3SSU A;  1PGP A;  3L74 G;  1RF0 A;  5AW4 B;  1URQ A;  2OYH C;  1N7S D;  1S5L X;  2I1J A;  3B5N C;  5DJU B;  3MUD A;  3ABV C;  1W2E A;  2JJL A;  2PP6 A;  5AVT B;  3CC2 P;  5AW5 B;  5BU5 A;  1WT6 A;  1KFM A;  4AYC A;  1PZQ A;  3VMX A;  2UWJ E;  3II6 A;  4U3F J;  4N3Y B;  1VQ8 P;  3U1C A;  1IO4 A;  1VPC A;  5AVX B;  5KKZ B;  4PD4 D;  1H0T B;  2SPZ A;  3N4X A;  2M5A B;  1H8A A;  1NTM E;  1LTJ C;  2N1T C;  1BSN A;  1VQM P;  3B5N D;  1LWU C;  3H1K G;  3SWY A;  3I55 P;  3G71 P;  1EDJ A;  4WBA A;  5E79 H;  3VP9 A;  1JO5 A;  3CX5 I;  3KXD A;  1YQ4 C;  1L2P A;  2WSF H;  2O01 N;  2OGU A;  1HJB A;  3HE4 A;  5TJH A;  1GK6 A;  2KZJ A;  2ZVO B;  3V2N A;  4IL6 X;  3TYY A;  2H8P D;  1HTL C;  1JY3 O;  1IC2 A;  1YJN P;  5APQ A;  4EDF A;  4OH8 B;  2Y0D A;  2N9B A;  1Y47 A;  2E76 B;  3V6I A;  5E79 E;  2Y0E A;  3TGU E;  1PPJ G;  4EOT A;  5APU A;  2IBZ I;  3EWK A;  1M1J C;  2N1T D;  2QG4 A;  4UB8 H;  3A0H H;  1ZLL A;  2W27 A;  2QSI A;  3H25 A;  3L70 E;  1CSB A;  2J5U A;  2E43 A;  3C9I A;  4GIF A;  1VQP P;  2KSJ A;  4TLF A;  2ZJS E;  5CMZ A;  4PV1 C;  1KYO H;  1NGM B;  5KLV E;  3C1L A;  4TT3 H;  4DJG A;  2GUS A;  1PP9 J;  1NO4 A;  2G3A A;  2M0B A;  1FZE A;  5CJ4 A;  4UB8 E;  3UIA A;  2YNY A;  2P2U A;  1GMJ A;  4H0L B;  3BAS A;  2WZ7 A;  3M91 A;  4WY4 C;  2CPS A;  4C7R A;  2W8Z A;  1PFI A;  5APY A;  1EZV E;  3QH9 A;  1S72 P;  3L71 E;  1IJD B;  1HWT C;  1KYO E;  3HE5 A;  2B87 A;  1G1J A;  1NTM D;  3H1H E;  3L72 J;  1DEE G;  1AQT A;  4ZNC A;  4GDO A;  2B88 A;  2E5T A;  2N1T A;  1KIL B;  1NTZ K;  3O6Q B;  1YJW P;  4D6T J;  1ZW0 A;  5KAI E;  4I6M C;  1NTZ G;  1LTI C;  1LWU A;  1OX3 A;  5AW3 B;  4AUW A;  2OYI C;  1SFC B;  1OZH A;  1RE4 A;  2YO3 A;  1AA0 A;  2WSC J;  2QJP B;  4W7Y A;  1Q7Y Q;  3NMD A;  1SQQ E;  5CCG C;  4W7Z A;  4WY4 D;  2H89 C;  3CXH D;  3CCE P;  2A06 E;  3BCC E;  3JCU H;  1BCC E;  2IX7 C;  2FYU J;  3H1L E;  4NPD A;  2P10 A;  4KT0 J;  2QRX A;  3H1J D;  2BCC J;  1VQL P;  1J1E B;  1N8R Q;  3H1I D;  4N78 E;  3CCV P;  2GA1 A;  1NU1 J;  4JYC A;  3GF7 A;  1SQP J;  1RY3 A;  1H89 A;  1TU3 F;  1ZOY C;  3IF4 A;  2WT7 A;  2WSE J;  5KLV D;  1YYC A;  3OA7 A;  1S9K E;  5CCG D;  1FZB A;  2FY8 A;  2KS1 B;  3CXH I;  2WTY A;  1L4A B;  4C7N B;  2QE7 H;  2M8R A;  3AE6 C;  4QMA A;  1R5S A;  1D7M A;  3HTK B;  1MUU A;  1FOS E;  1NKZ B;  1LJ2 A;  2O01 J;  5KKZ C;  1IFJ A;  3KYQ A;  1EZV D;  1FU1 A;  3L71 D;  2H43 A;  1KYO D;  5H2F E;  2KLU A;  3H1H D;  4YTP C;  1KC8 Q;  5APS A;  1X0T A;  2YMY A;  3SWF A;  3IN6 A;  3SWK A;  1LTB C;  2W6A A;  5KLI B;  2YMK A;  1BGY J;  1U57 A;  1ZME C;  2OYI A;  4IFM A;  1GZL A;  1VQ6 P;  1BDD A;  1HGZ A;  1AQ5 A;  1LT9 C;  2AXC A;  3TGU G;  1S4X A;  3MIW A;  2JO1 A;  1SVF A;  2LXC B;  1SQQ D;  5CCG A;  2PFX A;  3P8C E;  3L70 G;  1W2B O;  2HG5 D;  3CWB D;  2A06 D;  3BCC D;  1BCC D;  1NHL A;  4WB4 A;  1X9V A;  1GW3 A;  1NJI Q;  1ZV8 A;  4L74 A;  2KNC A;  1DX7 A;  2ZT9 B;  4N78 D;  1KIL E;  3H32 B;  1JY3 P;  1WMK A;  1U7J A;  3F89 A;  4KJM A;  1RF0 C;  3A3Y B;  1MFT A;  1KMI Z;  3WU2 H;  3D6Z A;  3E7K A;  1GTW A;  5KTB A;  5CBN A;  2XU6 A;  1GDT A;  1EZV G;  4I1L A;  1S9K D;  1PPJ E;  3CX5 H;  1NYH A;  1L0N D;  3HUS B;  2Z5H A;  1JNM A;  3L74 D;  2JEE A;  3CLQ A;  1SQV J;  1M1K Q;  1DIP A;  3L75 G;  1SQB K;  4H44 C;  1E79 H;  1A02 F;  2V7Q H;  2E76 D;  1JCD A;  1BE3 G;  1SQB G;  4BRY B;  1S3J A;  2OAR A;  3I56 P;  2P58 A;  1H0T A;  1MZ9 A;  2WSC H;  2M5A A;  2OYO A;  2W6B A;  4ASW A;  2Z5I A;  2RKL A;  1JOC A;  3V4Q A;  1KIL C;  2W6J H;  3USS A;  1YBK A;  2WSS H;  4D6T E;  2YKO A;  1L0L J;  2Y9Z A;  2Q1K A;  2Q3I A;  2OTJ P;  1USD A;  1SFC C;  3RK3 B;  2FKW B;  3L73 G;  3H6P A;  1T8Z A;  1DEB A;  1IFI A;  1BCC G;  1VL2 A;  2KOG A;  3H1L G;  4WVZ A;  2QJP C;  2QJY C;  1IK7 A;  1S5L H;  1HH0 A;  4H44 D;  2M3E A;  4Y28 J;  3CCS P;  1DD3 A;  1X8Y A;  3Q5R A;  1A02 J;  3H1K D;  3RL0 B;  2XZR A;  2C0W A;  3V2Q A;  2WSE H;  5BVZ A;  3S4R A;  4MN4 C;  3VOP A;  1Q2N A;  2IPP A;  4GOE A;  1KIL D;  4IFF A;  1J1E C;  2ZXX A;  1UII A;  1S5L E;  1MKM A;  1SFC D;  2YIU B;  4U3F G;  1LNQ A;  3CCJ P;  5AW6 B;  2O01 H;  5APV A;  1SQX J;  2IFN A;  2OQQ A;  1Y9B A;  1YQ3 C;  1PPJ D;  4H13 C;  1JEK A;  3CME P;  5C39 A;  2OTL P;  2QVA A;  2E75 C;  4LLH A;  2FYN B;  4W80 A;  1QL2 A;  5DJT B;  3LID A;  1U7M A;  5M1B A;  3MD0 A;  2FYZ A;  2R32 A;  2NRG A;  1HUC A;  1PGJ A;  1K73 Q;  4GOF A;  4IL6 H;  3AE3 C;  3FXE A;  3G4S P;  4C46 A;  1KIL A;  3O6Q A;  5KLI C;  2IZ1 A;  1EQ7 A;  1BGY E;  1SFC A;  3G6E P;  1OW7 A;  3SFE C;  1FZA A;  3TK1 A;  4H13 D;  1RE4 C;  3M9B A;  3VP8 A;  2GUV A;  2E75 D;  4IL6 E;  4RES B;  1LGH B;  3M9Q A;  2QM7 A;  3T97 B;  2C9L Y;  5AVQ B;  2E74 B;  3AEB C;  1NTK J;  1FBM A;  1JTH B;  2K9Y A;  1R5L A;  1NTZ D;  1GW4 A;  2JP3 A;  5GTI H;  4RKU J;  2KP8 A;  1KB9 H;  1K8A Q;  2FFD B;  4PD4 I;  1KQG B;  3MTU E;  4O9B A;  3BRT B;  1R8E A;  2HPC B;  3RK2 C;  1PP9 G;  3KQG A;  4DOJ A;  2AEJ A;  3N7N A;  2J58 A;  5BU8 B;  1IZN B;  2O1J A;  4EIJ A;  3CI9 A;  2NPS B;  3RK3 E;  3HD7 B;  3GLM A;  2R3C A;  1T2K C;  5GTI E;  1OMI A;  3MHV A;  1KB9 E;  3CCL P;  5K5G B;  2HFE D;  3V2R A;  3CC4 P;  3GG2 A;  2C0X A;  1BSH A;  1YTZ T;  3NXS A;  1ZN5 A;  1FAV A;  3L72 G;  2KS1 A;  2BEZ F;  1QGK B;  1L4A A;  4IFD K;  1Z56 A;  1P84 H;  1JY2 O;  3VMA A;  1FZG A;  1LTT C;  3HTK A;  4D6T G;  2Q3E A;  1SLQ A;  3A0H E;  3LIE A;  4JPZ B;  4A7P A;  2KIK A;  1KQS O;  5AVV B;  3RK2 D;  1FZC B;  1M57 D;  3A2A A;  3FGA D;  3G9R A;  3G3Z A;  1N7L A;  1GL2 B;  1Q81 Q;  2IBZ G;  5EFW B;  3B71 A;  1JMM A;  1P84 E;  3GHG B;  1J1D B;  1T2K D;  3OAK A;  1AVO A;  2K88 A;  3L75 E;  2FYU K;  1OVV A;  1YJ9 P;  2IZ0 A;  1BE3 E;  2FYU G;  1SQB E;  4PJ0 H;  1T6A A;  1XTC C;  3MP7 B;  2WPV B;  3M0A A;  2ZXE B;  2BCC G;  3AEF C;  4K35 A;  1NU1 K;  3AE5 C;  3R2P A;  2ZVN B;  4GOD A;  1SQP K;  3A7O A; 
#chains in the Genus database with same CATH homology
 1N7S C;  1LT9 A;  2OYI B;  5KJ7 C;  4Y99 C;  1N7S A;  3MGN A;  3MIW A;  5KJ7 A;  1SVF A;  2XV5 A;  1NH4 A;  3L36 A;  3A5T A;  1LT9 B;  5CCG A;  3VMZ A;  1N7S B;  1ZR4 A;  3P8C E;  1ZR2 A;  2HG5 D;  4XA4 A;  4LGD E;  1NHL A;  4WB4 A;  3H32 A;  1X9V A;  1GW3 A;  1FOS F;  3V2P A;  5CHX A;  1LTS C;  2L5G B;  1N2D C;  1ZV8 A;  1DX7 A;  4N78 D;  3H32 B;  1L0N K;  1E5W A;  1JY3 P;  2IFM A;  1LTA C;  4JF7 A;  1QL1 A;  3KPE A;  5AW2 B;  1RF0 C;  1IFM A;  1SP4 A;  3P32 A;  1RF0 A;  1T3J A;  3A3Y B;  2A45 H;  5AW4 B;  1URQ A;  1NAF A;  3HUS C;  1J2J B;  1N7S D;  2OYH C;  5AVW B;  2I1J A;  5KJ7 D;  1GTW A;  4C7N A;  3HUS A;  2OYH A;  5KTB A;  3B5N C;  3MUD A;  1HVV A;  2P67 A;  2XU6 A;  1GDT A;  2FXM A;  4HH2 A;  1W2E A;  1T3U A;  1URQ B;  3B5N A;  1OXZ A;  4I1L A;  2JJL A;  1S9K D;  2PP6 A;  1FDM A;  3HUS B;  5AVT B;  2OYH B;  2Z5H A;  1JUN A;  1N73 C;  1JNM A;  2JEE A;  3CLQ A;  1M7L A;  3EFG A;  3B5N B;  1CZQ A;  1MFZ A;  3V4W A;  2WPS A;  5AW5 B;  5AW0 B;  5BU5 A;  1WT6 A;  1KFM A;  3VYI A;  4AYC A;  1SQB K;  1A02 F;  3VMX A;  1JCD A;  3II6 A;  2OAR A;  3V5B A;  1MZ9 A;  2WSC H;  4N3Y B;  3U1C A;  1IO4 A;  1VPC A;  5AVX B;  3VN0 A;  2W6B A;  5CCH C;  3IR9 A;  2Z5I A;  1CW5 A;  3RK3 C;  1JOC A;  4LC1 A;  2KLV A;  3V4Q A;  1KIL C;  2CPB A;  2VRS A;  3N4X A;  2Q7C A;  1KFN A;  2YKO A;  2Z4E A;  3L37 A;  4HYT B;  1H8A A;  2MJZ A;  2Q3I A;  2Q9I A;  1LTJ C;  2N1T C;  1LTJ A;  1SFC C;  3RK3 B;  3B5N D;  1JY3 N;  2FKW B;  3H6P A;  2A45 I;  1T8Z A;  2HOD A;  1HGV A;  5AVZ B;  1DEB A;  1IFI A;  3L4F A;  1LWU C;  2KOG A;  1LTJ B;  3SWY A;  4ZKP A;  1IK9 A;  2HOD B;  4WBA A;  2R5B A;  3VP9 A;  2WPR A;  1JO5 A;  3RL0 C;  1XTG B;  2YO2 A;  1HH0 A;  4DZO A;  2KYV A;  4Y99 B;  2WSF H;  1HJB A;  3HE4 A;  1GU4 A;  1GK6 A;  3V2N A;  2BAS A;  1X8Y A;  3TYY A;  1A02 J;  2H8P D;  1HTL C;  1JY3 O;  3RL0 B;  2XZR A;  2XDJ A;  1IC2 A;  2C0W A;  3V2Q A;  3HE4 B;  3TNU A;  2YKP A;  1SQV K;  3M9H A;  2WSE H;  5BVZ A;  5CCH D;  5APQ A;  4N6J A;  2KB7 P;  3VOP A;  3RK3 D;  2IPP A;  4OH8 B;  1KIL D;  3TNU B;  4IFF A;  2N9B A;  1J1E C;  1RF1 C;  3I5C A;  4EOT A;  1RE3 C;  5APU A;  4GT1 A;  2E42 A;  1M1J C;  2N1T D;  1RE3 A;  1SFC D;  3NTN A;  1JY2 N;  1M1J A;  5AW6 B;  2O01 H;  2WPQ A;  1ZLL A;  2W27 A;  5APV A;  3O8Z A;  2IFN A;  1CSB A;  1M1J B;  1L0L K;  2E43 A;  3C9I A;  4GIF A;  3BVH A;  3RL0 D;  2KSJ A;  5CMZ A;  2H7H A;  1N73 A;  4JYB A;  1IFN A;  2GUS A;  1NO4 A;  1FZE A;  1NTM K;  5CJ4 A;  4LLH A;  4W80 A;  1NOH A;  1N73 B;  1QL2 A;  3P8M C;  3BRV B;  1GD2 E;  3LID A;  3UIA A;  2YNY A;  3MD0 A;  2P2U A;  4M3L A;  2I1K A;  3U1A A;  3BAS A;  2FYZ A;  3B8E B;  2R32 A;  1WRG A;  1JY2 P;  2WZ7 A;  1HUC A;  3M91 A;  1GL2 C;  4WY4 C;  2CPS A;  4C7R A;  3GHG C;  5APX A;  3OJA B;  4WY4 A;  5CCH A;  1PFI A;  4C46 A;  5APY A;  2LKM A;  1KIL A;  1IJD B;  1HWT C;  3M0D C;  3HE5 A;  1EQ7 A;  4XE5 B;  4WY4 B;  3NFQ A;  5AVY B;  1G1J A;  1OWA A;  1AFO A;  3TSI A;  1LTG C;  2N1T A;  1KIL B;  1NTZ K;  5AVR B;  1NWQ A;  1SFC A;  3VMY A;  3M06 A;  3VTP C;  3HE5 B;  1X79 B;  2WWW A;  4I6M C;  1FZA A;  3TK1 A;  1DH3 A;  1LTI C;  3T97 A;  1LWU A;  2M3B A;  3EQ2 A;  1RE4 C;  1NKN A;  1VDF A;  3E1I A;  2N1T B;  3M9B A;  1KZU B;  5AW3 B;  3VP8 A;  4AQR D;  4AUW A;  2OYI C;  1SFC B;  2GUV A;  3IFM A;  1RE4 A;  4RES B;  1LGH B;  2HYN A;  2YO3 A;  3M9Q A;  2QM7 A;  1JTH A;  1SQX K;  2C9L Y;  1LWU B;  4GKG A;  5AVQ B;  2P7J A;  2FFD C;  3P8C D;  1H88 A;  5AVS B;  2FFD A;  1FJP A;  1FBM A;  1N86 A;  1JTH B;  3WMM 0;  4W7Y A;  3NMD A;  5AW9 B;  1GW4 A;  2KP8 A;  5CCG C;  3HRN A;  4W7Z A;  3U59 A;  2FFD B;  2HPC A;  1GL2 D;  4WY4 D;  2P1J A;  3CL3 D;  2POH A;  1MV8 A;  1G1I A;  2NPS C;  3MTU E;  4O9B A;  3HD7 C;  3BRT B;  2HPC B;  3RK2 C;  2NPS A;  2IX7 C;  3KQG A;  1GK4 A;  3HD7 A;  4DOJ A;  1RF1 A;  3N7N A;  2J58 A;  5BU8 B;  2O1J A;  4EIJ A;  5KLV K;  3CI9 A;  1J1E B;  2NPS B;  4N78 E;  3HD7 B;  5AVU B;  1RF1 B;  3RK2 B;  2R3C A;  1FZF A;  1JCC A;  4JYC A;  1T2K C;  2XKM A;  2A45 G;  2HFE D;  3P7K A;  3V2R A;  5CJ0 A;  1RY3 A;  1H89 A;  3L35 A;  1URQ C;  2C0X A;  1CI6 A;  1YTZ T;  2HLO A;  3NXS A;  1ZN5 A;  1FAV A;  1KQL A;  1L4A C;  2O1K A;  5AW8 B;  2J59 M;  3LW5 H;  1L4A A;  4IFD K;  2WT7 A;  1Z56 A;  1G2C A;  1JY2 O;  1CI6 B;  2C9N Y;  1FZG A;  3PP5 A;  1YYC A;  3OA7 A;  1S9K E;  5AW7 B;  4I2L C;  1LTT C;  3HTK A;  5CCG D;  2WIT A;  2ZFC A;  1FZB A;  1FZC C;  5APW A;  1SLQ A;  3LIE A;  2WTY A;  1L4A B;  4C7N B;  3KDP B;  2WT7 B;  1FZC A;  1G2C B;  2M8R A;  5AVV B;  3HTK B;  5APT A;  1MUU A;  2NPS D;  1FOS E;  1NKZ B;  3HD7 D;  3RK2 D;  1NTK K;  1IFD A;  1FZC B;  1GL2 A;  1J1D C;  2QM8 A;  1GU5 A;  3GHG A;  2R5D A;  1IFJ A;  3A2A A;  2Q5U A;  3KYQ A;  4ZKU A;  2GM4 A;  1FJK A;  1FU1 A;  3G3Z A;  4B86 A;  3BAT A;  2YKQ A;  2H43 A;  1HBW A;  1N7L A;  2PAJ A;  1GL2 B;  1JMM A;  3GHG B;  3M0D A;  1J1D B;  1T2K D;  3OAK A;  5APS A;  5AW1 B;  2YMY A;  3SWF A;  1YTZ I;  1SQQ K;  1LTB C;  2FYU K;  2W6A A;  1URQ D;  2XNX A;  1XTC C;  1L4A D;  4KHX A;  2OYI A;  3M0A A;  2ZXE B;  4IFM A;  1GZL A;  1NU1 K;  3R2P A;  1HGZ A;  1AQ5 A;  1LT9 C;  1SQP K;  3A7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...