2HYPA

Crystal structure of rv0805 d66a mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
256
structure length
230
Chain Sequence
PRPDYVLLHISDTHLIGGDDADDRLGELLEQLNQSGLRPDAIVFTGDLAAKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCGCNLVHVYPDTVVHSVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Analysis of the Rv0805 Cyclic Nucleotide Phosphodiesterase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Hypothetical protein RV0805
total genus 69
structure length 230
sequence length 256
ec nomenclature ec 3.1.4.53: 3',5'-cyclic-AMP phosphodiesterase.
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2hypA00
1S8EA 1TCOA 5HPEA 2NXFA 4I5NC 4UT3B 1XM7A 1HPUA 3H61A 1QHWA 4ORAA 1M63A 1S3LA 3E7AA 3RL4A 2GJUA 3PSNA 4H2FA 4V0WA 4UWQA 3IB7A 3RQZA 2NYMC 4KKZA 4ZX2A 4OR9A 2USHA 2XMOA 5JPFA 3ZU0A 3CK2A 4G9JA 3QFOA 4B2OA 1OIEA 5JPEA 4J6OA 2NPPC 2IE3C 3IVDA 4DSYA 4H2IA 3RL3A 1UF3A 1JK7A 1NNWA 4FCXA 4H2GA 1USHA 4FBKA 4JA7A 2WDCA 4MP0A 1WAO1 2HYPA 4IYPC 4UT2A 1T71A 3JYFA 4Q7FA 1S3NA 1T70A 4IL1A 1FJMA 4UT3A 4YKEA 1U32A 3DSDA 5IOHA 4I5LC 3QFNA 3TGHA 3H67A 4ZVZA 5F3WA 3C9FA 4LACC 3ICFA 4V0XA 1S95A 5EQVA 1V73A 4ORCA 3T1IA 2AHDA 3PSOA 1G5BA 1XZWA 1QFCA 4H2BA 3N5UA 1IT6A 4ORBA 2Z72A 2Z06A 3K7WC 4DT2A 4M0VA 4DHLA 5DNYA 2IAEC 3ZTVA 3QFMA 2ZBMA 2QFRA 4O24A 3DSCA 2CV9A 1S70A 1WARA 1Z2XA 5GTUA 3H60A 3HVQA 5JJTA 4NZVA 3GVEA 5C1VA 2YVTA 4HD0A 4LU9A 1HO5A 2JOGA 3AUZA 1UTEA 2WDEA 1HP1A 3IB8A 4V0VA 2DFJA 2HYOA 4H1YP 4MOYA 3H68A 3P71C 4XPNA 1OIDA 4WWLA 1W24A 3QG5C 2QFPA 4O4KA 3EGGA 1KBPA 1MF8A 1S3MA 4MOVA 1II7A 2WDDA 2O8GA 5B8IA 2BCDA 4H1SA 2BDXA 3V4YA 3H63A 4KBPA 3QFKA 2A22A 2P6BA 1AUIA 2HY1A 3H69A 2O8AA 2IE4C 4FBQA 2WDFA 2KKNA 3K7VC 2NYLC 4JA9A 2Z1AA 3H62B 4O43A 5INBA 2R17A 4TUGA 4TUIA 3AV0A 2BQ8X 3C5WC 3KBPA 3THOB 3DW8C 1Z2WA 2Q8UA 4O5GA 5J28A 3H66A 2QJCA 3RL5A 4LTYA 3IVEA 3E7BA 3LL8A 4F0ZA 3H64A 3EGHA 1OI8A 1SU1A 4FBWA 3THNA 3FGAC
chains in the Genus database with same CATH superfamily
1S8EA 1TCOA 5HPEA 2NXFA 4I5NC 4UT3B 1XM7A 1HPUA 3H61A 1QHWA 4ORAA 1M63A 1S3LA 3E7AA 3RL4A 2GJUA 3PSNA 4H2FA 4V0WA 4UWQA 3IB7A 3RQZA 3FLOA 2NYMC 4KKZA 4ZX2A 4OR9A 2USHA 2XMOA 5JPFA 3ZU0A 3CK2A 4G9JA 3QFOA 4B2OA 1OIEA 5JPEA 4J6OA 2NPPC 2ZOAA 2IE3C 3IVDA 4DSYA 4H2IA 3RL3A 1UF3A 1JK7A 1NNWA 4FCXA 4H2GA 1USHA 4FBKA 4JA7A 2WDCA 4MP0A 1WAO1 2HYPA 4IYPC 4UT2A 1T71A 3JYFA 4Q7FA 1S3NA 1T70A 4IL1A 1FJMA 4UT3A 4YKEA 1U32A 3DSDA 5IOHA 4I5LC 3QFNA 3TGHA 3H67A 4ZVZA 5F3WA 3C9FA 4LACC 3ICFA 4V0XA 1S95A 5EQVA 1V73A 4ORCA 3E0JA 2AHDA 3T1IA 3PSOA 1G5BA 1XZWA 1QFCA 4H2BA 3N5UA 1IT6A 2ZO9B 2DXNA 4ORBA 2Z72A 2Z06A 3K7WC 4DT2A 4M0VA 4DHLA 5DNYA 2IAEC 3ZTVA 3QFMA 2ZBMA 2QFRA 4O24A 3DSCA 2CV9A 1S70A 1WARA 1Z2XA 5GTUA 3H60A 3HVQA 5JJTA 4NZVA 3GVEA 5C1VA 2YVTA 4HD0A 4LU9A 1HO5A 2JOGA 2DXLA 3AUZA 1UTEA 3D03A 2WDEA 1HP1A 3IB8A 4V0VA 2DFJA 2HYOA 4H1YP 4MOYA 3H68A 3P71C 4XPNA 1OIDA 4WWLA 1W24A 3QG5C 2QFPA 4O4KA 3EGGA 1KBPA 1MF8A 1S3MA 4MOVA 1II7A 2WDDA 2O8GA 5B8IA 2BCDA 4H1SA 2BDXA 3V4YA 3H63A 4KBPA 3QFKA 2A22A 2P6BA 1AUIA 2HY1A 3H69A 2O8AA 2IE4C 4FBQA 2WDFA 2KKNA 3K7VC 2NYLC 4JA9A 2Z1AA 3H62B 4O43A 5INBA 2R17A 4TUGA 4TUIA 3AV0A 2BQ8X 3C5WC 3KBPA 3THOB 3DW8C 1Z2WA 2Q8UA 2YEQA 4O5GA 3H66A 2QJCA 5J28A 3RL5A 4LTYA 3IVEA 3E7BA 3LL8A 4F0ZA 3H64A 3EGHA 1OI8A 1SU1A 4FBWA 3THNA 3FGAC
chains in the Genus database with same CATH topology
1S8EA 1TCOA 5HPEA 2NXFA 4I5NC 4UT3B 1XM7A 1HPUA 3H61A 1QHWA 4ORAA 1M63A 1S3LA 3E7AA 3RL4A 2GJUA 3PSNA 4H2FA 4V0WA 4UWQA 3IB7A 3RQZA 3FLOA 2NYMC 4KKZA 4ZX2A 4OR9A 2USHA 2XMOA 5JPFA 3ZU0A 3CK2A 4G9JA 3QFOA 4B2OA 1OIEA 5JPEA 4J6OA 2NPPC 2ZOAA 2IE3C 3IVDA 4DSYA 4H2IA 3RL3A 1UF3A 1JK7A 1NNWA 4FCXA 4H2GA 1USHA 4FBKA 4JA7A 2WDCA 4MP0A 1WAO1 2HYPA 4IYPC 4UT2A 1T71A 3JYFA 4Q7FA 1S3NA 1T70A 4IL1A 1FJMA 4UT3A 4YKEA 1U32A 3DSDA 5IOHA 4I5LC 3QFNA 3TGHA 3H67A 4ZVZA 5F3WA 3C9FA 4LACC 3ICFA 4V0XA 1S95A 5EQVA 1V73A 4ORCA 3E0JA 2AHDA 3T1IA 3PSOA 1G5BA 1XZWA 1QFCA 4H2BA 3N5UA 1IT6A 2ZO9B 2DXNA 4ORBA 2Z72A 2Z06A 3K7WC 4DT2A 4M0VA 4DHLA 5DNYA 2IAEC 3ZTVA 3QFMA 2ZBMA 2QFRA 4O24A 3DSCA 2CV9A 1S70A 1WARA 1Z2XA 5GTUA 3H60A 3HVQA 5JJTA 4NZVA 3GVEA 5C1VA 2YVTA 4HD0A 4LU9A 1HO5A 2JOGA 2DXLA 3AUZA 1UTEA 3D03A 2WDEA 1HP1A 3IB8A 4V0VA 2DFJA 2HYOA 4H1YP 4MOYA 3H68A 3P71C 4XPNA 1OIDA 4WWLA 1W24A 3QG5C 2QFPA 4O4KA 3EGGA 1KBPA 1MF8A 1S3MA 4MOVA 1II7A 2WDDA 2O8GA 5B8IA 2BCDA 4H1SA 2BDXA 3V4YA 3H63A 4KBPA 3QFKA 2A22A 2P6BA 1AUIA 2HY1A 3H69A 2O8AA 2IE4C 4FBQA 2WDFA 2KKNA 3K7VC 2NYLC 4JA9A 2Z1AA 3H62B 4O43A 5INBA 2R17A 4TUGA 4TUIA 3AV0A 2BQ8X 3C5WC 3KBPA 3THOB 3DW8C 1Z2WA 2Q8UA 2YEQA 4O5GA 3H66A 2QJCA 5J28A 3RL5A 4LTYA 3IVEA 3E7BA 3LL8A 4F0ZA 3H64A 3EGHA 1OI8A 1SU1A 4FBWA 3THNA 3FGAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S8E A;  1TCO A;  5HPE A;  2NXF A;  4I5N C;  4UT3 B;  1XM7 A;  1HPU A;  3H61 A;  1QHW A;  4ORA A;  1M63 A;  1S3L A;  3E7A A;  3RL4 A;  2GJU A;  3PSN A;  4H2F A;  4V0W A;  4UWQ A;  3IB7 A;  3RQZ A;  2NYM C;  4KKZ A;  4ZX2 A;  4OR9 A;  2USH A;  2XMO A;  5JPF A;  3ZU0 A;  3CK2 A;  4G9J A;  3QFO A;  4B2O A;  1OIE A;  5JPE A;  4J6O A;  2NPP C;  2IE3 C;  3IVD A;  4DSY A;  4H2I A;  3RL3 A;  1UF3 A;  1JK7 A;  1NNW A;  4FCX A;  4H2G A;  1USH A;  4FBK A;  4JA7 A;  2WDC A;  4MP0 A;  1WAO 1;  2HYP A;  4IYP C;  4UT2 A;  1T71 A;  3JYF A;  4Q7F A;  1S3N A;  1T70 A;  4IL1 A;  1FJM A;  4UT3 A;  4YKE A;  1U32 A;  3DSD A;  5IOH A;  4I5L C;  3QFN A;  3TGH A;  3H67 A;  4ZVZ A;  5F3W A;  3C9F A;  4LAC C;  3ICF A;  4V0X A;  1S95 A;  5EQV A;  1V73 A;  4ORC A;  3T1I A;  2AHD A;  3PSO A;  1G5B A;  1XZW A;  1QFC A;  4H2B A;  3N5U A;  1IT6 A;  4ORB A;  2Z72 A;  2Z06 A;  3K7W C;  4DT2 A;  4M0V A;  4DHL A;  5DNY A;  2IAE C;  3ZTV A;  3QFM A;  2ZBM A;  2QFR A;  4O24 A;  3DSC A;  2CV9 A;  1S70 A;  1WAR A;  1Z2X A;  5GTU A;  3H60 A;  3HVQ A;  5JJT A;  4NZV A;  3GVE A;  5C1V A;  2YVT A;  4HD0 A;  4LU9 A;  1HO5 A;  2JOG A;  3AUZ A;  1UTE A;  2WDE A;  1HP1 A;  3IB8 A;  4V0V A;  2DFJ A;  2HYO A;  4H1Y P;  4MOY A;  3H68 A;  3P71 C;  4XPN A;  1OID A;  4WWL A;  1W24 A;  3QG5 C;  2QFP A;  4O4K A;  3EGG A;  1KBP A;  1MF8 A;  1S3M A;  4MOV A;  1II7 A;  2WDD A;  2O8G A;  5B8I A;  2BCD A;  4H1S A;  2BDX A;  3V4Y A;  3H63 A;  4KBP A;  3QFK A;  2A22 A;  2P6B A;  1AUI A;  2HY1 A;  3H69 A;  2O8A A;  2IE4 C;  4FBQ A;  2WDF A;  2KKN A;  3K7V C;  2NYL C;  4JA9 A;  2Z1A A;  3H62 B;  4O43 A;  5INB A;  2R17 A;  4TUG A;  4TUI A;  3AV0 A;  2BQ8 X;  3C5W C;  3KBP A;  3THO B;  3DW8 C;  1Z2W A;  2Q8U A;  4O5G A;  5J28 A;  3H66 A;  2QJC A;  3RL5 A;  4LTY A;  3IVE A;  3E7B A;  3LL8 A;  4F0Z A;  3H64 A;  3EGH A;  1OI8 A;  1SU1 A;  4FBW A;  3THN A;  3FGA C; 
#chains in the Genus database with same CATH topology
 1S8E A;  1TCO A;  5HPE A;  2NXF A;  4I5N C;  4UT3 B;  1XM7 A;  1HPU A;  3H61 A;  1QHW A;  4ORA A;  1M63 A;  1S3L A;  3E7A A;  3RL4 A;  2GJU A;  3PSN A;  4H2F A;  4V0W A;  4UWQ A;  3IB7 A;  3RQZ A;  3FLO A;  2NYM C;  4KKZ A;  4ZX2 A;  4OR9 A;  2USH A;  2XMO A;  5JPF A;  3ZU0 A;  3CK2 A;  4G9J A;  3QFO A;  4B2O A;  1OIE A;  5JPE A;  4J6O A;  2NPP C;  2ZOA A;  2IE3 C;  3IVD A;  4DSY A;  4H2I A;  3RL3 A;  1UF3 A;  1JK7 A;  1NNW A;  4FCX A;  4H2G A;  1USH A;  4FBK A;  4JA7 A;  2WDC A;  4MP0 A;  1WAO 1;  2HYP A;  4IYP C;  4UT2 A;  1T71 A;  3JYF A;  4Q7F A;  1S3N A;  1T70 A;  4IL1 A;  1FJM A;  4UT3 A;  4YKE A;  1U32 A;  3DSD A;  5IOH A;  4I5L C;  3QFN A;  3TGH A;  3H67 A;  4ZVZ A;  5F3W A;  3C9F A;  4LAC C;  3ICF A;  4V0X A;  1S95 A;  5EQV A;  1V73 A;  4ORC A;  3E0J A;  2AHD A;  3T1I A;  3PSO A;  1G5B A;  1XZW A;  1QFC A;  4H2B A;  3N5U A;  1IT6 A;  2ZO9 B;  2DXN A;  4ORB A;  2Z72 A;  2Z06 A;  3K7W C;  4DT2 A;  4M0V A;  4DHL A;  5DNY A;  2IAE C;  3ZTV A;  3QFM A;  2ZBM A;  2QFR A;  4O24 A;  3DSC A;  2CV9 A;  1S70 A;  1WAR A;  1Z2X A;  5GTU A;  3H60 A;  3HVQ A;  5JJT A;  4NZV A;  3GVE A;  5C1V A;  2YVT A;  4HD0 A;  4LU9 A;  1HO5 A;  2JOG A;  2DXL A;  3AUZ A;  1UTE A;  3D03 A;  2WDE A;  1HP1 A;  3IB8 A;  4V0V A;  2DFJ A;  2HYO A;  4H1Y P;  4MOY A;  3H68 A;  3P71 C;  4XPN A;  1OID A;  4WWL A;  1W24 A;  3QG5 C;  2QFP A;  4O4K A;  3EGG A;  1KBP A;  1MF8 A;  1S3M A;  4MOV A;  1II7 A;  2WDD A;  2O8G A;  5B8I A;  2BCD A;  4H1S A;  2BDX A;  3V4Y A;  3H63 A;  4KBP A;  3QFK A;  2A22 A;  2P6B A;  1AUI A;  2HY1 A;  3H69 A;  2O8A A;  2IE4 C;  4FBQ A;  2WDF A;  2KKN A;  3K7V C;  2NYL C;  4JA9 A;  2Z1A A;  3H62 B;  4O43 A;  5INB A;  2R17 A;  4TUG A;  4TUI A;  3AV0 A;  2BQ8 X;  3C5W C;  3KBP A;  3THO B;  3DW8 C;  1Z2W A;  2Q8U A;  2YEQ A;  4O5G A;  3H66 A;  2QJC A;  5J28 A;  3RL5 A;  4LTY A;  3IVE A;  3E7B A;  3LL8 A;  4F0Z A;  3H64 A;  3EGH A;  1OI8 A;  1SU1 A;  4FBW A;  3THN A;  3FGA C; 
#chains in the Genus database with same CATH homology
 1S8E A;  1TCO A;  5HPE A;  2NXF A;  4I5N C;  4UT3 B;  1XM7 A;  1HPU A;  3H61 A;  1QHW A;  4ORA A;  1M63 A;  1S3L A;  3E7A A;  3RL4 A;  2GJU A;  3PSN A;  4H2F A;  4V0W A;  4UWQ A;  3IB7 A;  3RQZ A;  3FLO A;  2NYM C;  4KKZ A;  4ZX2 A;  4OR9 A;  2USH A;  2XMO A;  5JPF A;  3ZU0 A;  3CK2 A;  4G9J A;  3QFO A;  4B2O A;  1OIE A;  5JPE A;  4J6O A;  2NPP C;  2ZOA A;  2IE3 C;  3IVD A;  4DSY A;  4H2I A;  3RL3 A;  1UF3 A;  1JK7 A;  1NNW A;  4FCX A;  4H2G A;  1USH A;  4FBK A;  4JA7 A;  2WDC A;  4MP0 A;  1WAO 1;  2HYP A;  4IYP C;  4UT2 A;  1T71 A;  3JYF A;  4Q7F A;  1S3N A;  1T70 A;  4IL1 A;  1FJM A;  4UT3 A;  4YKE A;  1U32 A;  3DSD A;  5IOH A;  4I5L C;  3QFN A;  3TGH A;  3H67 A;  4ZVZ A;  5F3W A;  3C9F A;  4LAC C;  3ICF A;  4V0X A;  1S95 A;  5EQV A;  1V73 A;  4ORC A;  3E0J A;  2AHD A;  3T1I A;  3PSO A;  1G5B A;  1XZW A;  1QFC A;  4H2B A;  3N5U A;  1IT6 A;  2ZO9 B;  2DXN A;  4ORB A;  2Z72 A;  2Z06 A;  3K7W C;  4DT2 A;  4M0V A;  4DHL A;  5DNY A;  2IAE C;  3ZTV A;  3QFM A;  2ZBM A;  2QFR A;  4O24 A;  3DSC A;  2CV9 A;  1S70 A;  1WAR A;  1Z2X A;  5GTU A;  3H60 A;  3HVQ A;  5JJT A;  4NZV A;  3GVE A;  5C1V A;  2YVT A;  4HD0 A;  4LU9 A;  1HO5 A;  2JOG A;  2DXL A;  3AUZ A;  1UTE A;  3D03 A;  2WDE A;  1HP1 A;  3IB8 A;  4V0V A;  2DFJ A;  2HYO A;  4H1Y P;  4MOY A;  3H68 A;  3P71 C;  4XPN A;  1OID A;  4WWL A;  1W24 A;  3QG5 C;  2QFP A;  4O4K A;  3EGG A;  1KBP A;  1MF8 A;  1S3M A;  4MOV A;  1II7 A;  2WDD A;  2O8G A;  5B8I A;  2BCD A;  4H1S A;  2BDX A;  3V4Y A;  3H63 A;  4KBP A;  3QFK A;  2A22 A;  2P6B A;  1AUI A;  2HY1 A;  3H69 A;  2O8A A;  2IE4 C;  4FBQ A;  2WDF A;  2KKN A;  3K7V C;  2NYL C;  4JA9 A;  2Z1A A;  3H62 B;  4O43 A;  5INB A;  2R17 A;  4TUG A;  4TUI A;  3AV0 A;  2BQ8 X;  3C5W C;  3KBP A;  3THO B;  3DW8 C;  1Z2W A;  2Q8U A;  2YEQ A;  4O5G A;  3H66 A;  2QJC A;  5J28 A;  3RL5 A;  4LTY A;  3IVE A;  3E7B A;  3LL8 A;  4F0Z A;  3H64 A;  3EGH A;  1OI8 A;  1SU1 A;  4FBW A;  3THN A;  3FGA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...