2HYPA

Crystal structure of rv0805 d66a mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
256
structure length
230
Chain Sequence
PRPDYVLLHISDTHLIGGDDADDRLGELLEQLNQSGLRPDAIVFTGDLAAKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCGCNLVHVYPDTVVHSVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein RV0805
publication title Structural and Biochemical Analysis of the Rv0805 Cyclic Nucleotide Phosphodiesterase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 69
structure length 230
sequence length 256
ec nomenclature ec 3.1.4.53: 3',5'-cyclic-AMP phosphodiesterase.
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2hypA00
3E7BA 5J28A 2HYPA 2IE4C 2ZBMA 3HVQA 4H2GA 3ZTVA 5JJTA 4M0VA 1QFCA 2QFRA 3RL4A 3E7AA 4O4KA 1XZWA 1UTEA 2WDEA 4FBWA 3C9FA 3V4YA 3ICFA 1JK7A 5C1VA 1Z2XA 5HPEA 5EQVA 3GVEA 3H66A 2KKNA 4H2FA 4ORCA 5INBA 1OIDA 2JOGA 3EGHA 4MOYA 2BCDA 2AHDA 3RL3A 4H2IA 2O8AA 4DT2A 1MF8A 4MOVA 4TUGA 1S95A 1IT6A 1Z2WA 2Z1AA 4JA7A 4V0VA 3C5WC 4H2BA 2GJUA 2A22A 4I5LC 2P6BA 3IB8A 3QG5C 2Z72A 1USHA 1FJMA 1SU1A 4IYPC 1OI8A 1S3MA 3CK2A 2YVTA 4H1YP 4UT3A 1S8EA 3PSNA 1OIEA 2BDXA 3IB7A 1WAO1 4V0XA 4Q7FA 4DSYA 2WDDA 4MP0A 4O5GA 4HD0A 4XPNA 3DW8C 3LL8A 2R17A 4FBKA 3H63A 1HP1A 1TCOA 4DHLA 4O24A 1S3NA 3QFKA 1T70A 2HYOA 4G9JA 2XMOA 4ZX2A 1W24A 3H60A 4J6OA 4FCXA 2NYMC 3T1IA 3QFNA 1S70A 3H67A 2IAEC 1HO5A 3H62B 4B2OA 2NXFA 1QHWA 4H1SA 4KBPA 4I5NC 1WARA 4UT2A 4OR9A 2O8GA 3H61A 3H68A 4O43A 4UWQA 4WWLA 4F0ZA 4TUIA 3THNA 1G5BA 3QFMA 1M63A 5GTUA 2DFJA 5IOHA 1HPUA 4NZVA 5JPEA 1NNWA 4ZVZA 2CV9A 3THOB 5JPFA 4ORBA 2Q8UA 3N5UA 4YKEA 4LU9A 3QFOA 3RL5A 2WDFA 4IL1A 1KBPA 3JYFA 3K7VC 1UF3A 5F3WA 3KBPA 2Z06A 1V73A 2BQ8X 3ZU0A 3RQZA 4KKZA 1U32A 3H69A 2NPPC 1AUIA 2NYLC 4UT3B 5B8IA 3IVDA 4LTYA 3K7WC 1S3LA 3AV0A 3EGGA 3AUZA 4ORAA 2QJCA 2USHA 3TGHA 3P71C 1T71A 3DSCA 2IE3C 2QFPA 3FGAC 4V0WA 2HY1A 2WDCA 4JA9A 1II7A 1XM7A 5DNYA 3DSDA 4FBQA 3H64A 3IVEA 4LACC 3PSOA
chains in the Genus database with same CATH superfamily
3E7BA 5J28A 2HYPA 2IE4C 2ZBMA 3HVQA 4H2GA 3ZTVA 5JJTA 4M0VA 1QFCA 2ZO9B 2QFRA 3RL4A 3E7AA 4O4KA 1XZWA 1UTEA 2WDEA 4FBWA 3C9FA 3V4YA 3ICFA 1JK7A 5C1VA 1Z2XA 5HPEA 5EQVA 3GVEA 3H66A 2KKNA 4H2FA 4ORCA 5INBA 1OIDA 2JOGA 2DXLA 3EGHA 4MOYA 2BCDA 2AHDA 3RL3A 4H2IA 2O8AA 4DT2A 1MF8A 4MOVA 4TUGA 1S95A 1IT6A 1Z2WA 2Z1AA 4JA7A 4V0VA 3C5WC 4H2BA 2GJUA 2A22A 4I5LC 2P6BA 3IB8A 3QG5C 2Z72A 1USHA 1FJMA 1SU1A 4IYPC 1OI8A 1S3MA 3CK2A 2YVTA 4H1YP 4UT3A 1S8EA 3PSNA 1OIEA 2BDXA 3IB7A 1WAO1 4V0XA 4Q7FA 4DSYA 2WDDA 4MP0A 4O5GA 4HD0A 4XPNA 3DW8C 3LL8A 2R17A 3D03A 3H63A 4FBKA 1HP1A 1TCOA 4DHLA 4O24A 1S3NA 2ZOAA 3QFKA 1T70A 2HYOA 4G9JA 2XMOA 4ZX2A 1W24A 3H60A 4J6OA 4FCXA 2NYMC 3T1IA 3QFNA 1S70A 3H67A 2IAEC 1HO5A 3H62B 4B2OA 2NXFA 1QHWA 4H1SA 4KBPA 4I5NC 1WARA 4UT2A 4OR9A 2O8GA 3H61A 3H68A 4O43A 4UWQA 4WWLA 4F0ZA 4TUIA 3THNA 1G5BA 3QFMA 1M63A 5GTUA 3E0JA 2DFJA 5IOHA 1HPUA 4NZVA 5JPEA 1NNWA 4ZVZA 2CV9A 3THOB 5JPFA 4ORBA 2Q8UA 3N5UA 4YKEA 4LU9A 3QFOA 3RL5A 2WDFA 4IL1A 1KBPA 3JYFA 3K7VC 1UF3A 5F3WA 3KBPA 2Z06A 1V73A 2BQ8X 3ZU0A 3RQZA 4KKZA 1U32A 3H69A 2NPPC 1AUIA 2NYLC 4UT3B 5B8IA 3IVDA 2YEQA 4LTYA 3K7WC 1S3LA 2DXNA 3AV0A 3AUZA 3EGGA 4ORAA 2QJCA 2USHA 3FLOA 3TGHA 3P71C 1T71A 3DSCA 2IE3C 2QFPA 3FGAC 4V0WA 2HY1A 2WDCA 4JA9A 1II7A 1XM7A 5DNYA 3DSDA 4FBQA 3H64A 3IVEA 4LACC 3PSOA
chains in the Genus database with same CATH topology
3E7BA 5J28A 2HYPA 2IE4C 2ZBMA 3HVQA 4H2GA 3ZTVA 5JJTA 4M0VA 1QFCA 2ZO9B 2QFRA 3RL4A 3E7AA 4O4KA 1XZWA 1UTEA 2WDEA 4FBWA 3C9FA 3V4YA 3ICFA 1JK7A 5C1VA 1Z2XA 5HPEA 5EQVA 3GVEA 3H66A 2KKNA 4H2FA 4ORCA 5INBA 1OIDA 2JOGA 2DXLA 3EGHA 4MOYA 2BCDA 2AHDA 3RL3A 4H2IA 2O8AA 4DT2A 1MF8A 4MOVA 4TUGA 1S95A 1IT6A 1Z2WA 2Z1AA 4JA7A 4V0VA 3C5WC 4H2BA 2GJUA 2A22A 4I5LC 2P6BA 3IB8A 3QG5C 2Z72A 1USHA 1FJMA 1SU1A 4IYPC 1OI8A 1S3MA 3CK2A 2YVTA 4H1YP 4UT3A 1S8EA 3PSNA 1OIEA 2BDXA 3IB7A 1WAO1 4V0XA 4Q7FA 4DSYA 2WDDA 4MP0A 4O5GA 4HD0A 4XPNA 3DW8C 3LL8A 2R17A 3D03A 3H63A 4FBKA 1HP1A 1TCOA 4DHLA 4O24A 1S3NA 2ZOAA 3QFKA 1T70A 2HYOA 4G9JA 2XMOA 4ZX2A 1W24A 3H60A 4J6OA 4FCXA 2NYMC 3T1IA 3QFNA 1S70A 3H67A 2IAEC 1HO5A 3H62B 4B2OA 2NXFA 1QHWA 4H1SA 4KBPA 4I5NC 1WARA 4UT2A 4OR9A 2O8GA 3H61A 3H68A 4O43A 4UWQA 4WWLA 4F0ZA 4TUIA 3THNA 1G5BA 3QFMA 1M63A 5GTUA 3E0JA 2DFJA 5IOHA 1HPUA 4NZVA 5JPEA 1NNWA 4ZVZA 2CV9A 3THOB 5JPFA 4ORBA 2Q8UA 3N5UA 4YKEA 4LU9A 3QFOA 3RL5A 2WDFA 4IL1A 1KBPA 3JYFA 3K7VC 1UF3A 5F3WA 3KBPA 2Z06A 1V73A 2BQ8X 3ZU0A 3RQZA 4KKZA 1U32A 3H69A 2NPPC 1AUIA 2NYLC 4UT3B 5B8IA 3IVDA 2YEQA 4LTYA 3K7WC 1S3LA 2DXNA 3AV0A 3AUZA 3EGGA 4ORAA 2QJCA 2USHA 3FLOA 3TGHA 3P71C 1T71A 3DSCA 2IE3C 2QFPA 3FGAC 4V0WA 2HY1A 2WDCA 4JA9A 1II7A 1XM7A 5DNYA 3DSDA 4FBQA 3H64A 3IVEA 4LACC 3PSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E7B A;  5J28 A;  2HYP A;  2IE4 C;  2ZBM A;  3HVQ A;  4H2G A;  3ZTV A;  5JJT A;  4M0V A;  1QFC A;  2QFR A;  3RL4 A;  3E7A A;  4O4K A;  1XZW A;  1UTE A;  2WDE A;  4FBW A;  3C9F A;  3V4Y A;  3ICF A;  1JK7 A;  5C1V A;  1Z2X A;  5HPE A;  5EQV A;  3GVE A;  3H66 A;  2KKN A;  4H2F A;  4ORC A;  5INB A;  1OID A;  2JOG A;  3EGH A;  4MOY A;  2BCD A;  2AHD A;  3RL3 A;  4H2I A;  2O8A A;  4DT2 A;  1MF8 A;  4MOV A;  4TUG A;  1S95 A;  1IT6 A;  1Z2W A;  2Z1A A;  4JA7 A;  4V0V A;  3C5W C;  4H2B A;  2GJU A;  2A22 A;  4I5L C;  2P6B A;  3IB8 A;  3QG5 C;  2Z72 A;  1USH A;  1FJM A;  1SU1 A;  4IYP C;  1OI8 A;  1S3M A;  3CK2 A;  2YVT A;  4H1Y P;  4UT3 A;  1S8E A;  3PSN A;  1OIE A;  2BDX A;  3IB7 A;  1WAO 1;  4V0X A;  4Q7F A;  4DSY A;  2WDD A;  4MP0 A;  4O5G A;  4HD0 A;  4XPN A;  3DW8 C;  3LL8 A;  2R17 A;  4FBK A;  3H63 A;  1HP1 A;  1TCO A;  4DHL A;  4O24 A;  1S3N A;  3QFK A;  1T70 A;  2HYO A;  4G9J A;  2XMO A;  4ZX2 A;  1W24 A;  3H60 A;  4J6O A;  4FCX A;  2NYM C;  3T1I A;  3QFN A;  1S70 A;  3H67 A;  2IAE C;  1HO5 A;  3H62 B;  4B2O A;  2NXF A;  1QHW A;  4H1S A;  4KBP A;  4I5N C;  1WAR A;  4UT2 A;  4OR9 A;  2O8G A;  3H61 A;  3H68 A;  4O43 A;  4UWQ A;  4WWL A;  4F0Z A;  4TUI A;  3THN A;  1G5B A;  3QFM A;  1M63 A;  5GTU A;  2DFJ A;  5IOH A;  1HPU A;  4NZV A;  5JPE A;  1NNW A;  4ZVZ A;  2CV9 A;  3THO B;  5JPF A;  4ORB A;  2Q8U A;  3N5U A;  4YKE A;  4LU9 A;  3QFO A;  3RL5 A;  2WDF A;  4IL1 A;  1KBP A;  3JYF A;  3K7V C;  1UF3 A;  5F3W A;  3KBP A;  2Z06 A;  1V73 A;  2BQ8 X;  3ZU0 A;  3RQZ A;  4KKZ A;  1U32 A;  3H69 A;  2NPP C;  1AUI A;  2NYL C;  4UT3 B;  5B8I A;  3IVD A;  4LTY A;  3K7W C;  1S3L A;  3AV0 A;  3EGG A;  3AUZ A;  4ORA A;  2QJC A;  2USH A;  3TGH A;  3P71 C;  1T71 A;  3DSC A;  2IE3 C;  2QFP A;  3FGA C;  4V0W A;  2HY1 A;  2WDC A;  4JA9 A;  1II7 A;  1XM7 A;  5DNY A;  3DSD A;  4FBQ A;  3H64 A;  3IVE A;  4LAC C;  3PSO A; 
#chains in the Genus database with same CATH topology
 3E7B A;  5J28 A;  2HYP A;  2IE4 C;  2ZBM A;  3HVQ A;  4H2G A;  3ZTV A;  5JJT A;  4M0V A;  1QFC A;  2ZO9 B;  2QFR A;  3RL4 A;  3E7A A;  4O4K A;  1XZW A;  1UTE A;  2WDE A;  4FBW A;  3C9F A;  3V4Y A;  3ICF A;  1JK7 A;  5C1V A;  1Z2X A;  5HPE A;  5EQV A;  3GVE A;  3H66 A;  2KKN A;  4H2F A;  4ORC A;  5INB A;  1OID A;  2JOG A;  2DXL A;  3EGH A;  4MOY A;  2BCD A;  2AHD A;  3RL3 A;  4H2I A;  2O8A A;  4DT2 A;  1MF8 A;  4MOV A;  4TUG A;  1S95 A;  1IT6 A;  1Z2W A;  2Z1A A;  4JA7 A;  4V0V A;  3C5W C;  4H2B A;  2GJU A;  2A22 A;  4I5L C;  2P6B A;  3IB8 A;  3QG5 C;  2Z72 A;  1USH A;  1FJM A;  1SU1 A;  4IYP C;  1OI8 A;  1S3M A;  3CK2 A;  2YVT A;  4H1Y P;  4UT3 A;  1S8E A;  3PSN A;  1OIE A;  2BDX A;  3IB7 A;  1WAO 1;  4V0X A;  4Q7F A;  4DSY A;  2WDD A;  4MP0 A;  4O5G A;  4HD0 A;  4XPN A;  3DW8 C;  3LL8 A;  2R17 A;  3D03 A;  3H63 A;  4FBK A;  1HP1 A;  1TCO A;  4DHL A;  4O24 A;  1S3N A;  2ZOA A;  3QFK A;  1T70 A;  2HYO A;  4G9J A;  2XMO A;  4ZX2 A;  1W24 A;  3H60 A;  4J6O A;  4FCX A;  2NYM C;  3T1I A;  3QFN A;  1S70 A;  3H67 A;  2IAE C;  1HO5 A;  3H62 B;  4B2O A;  2NXF A;  1QHW A;  4H1S A;  4KBP A;  4I5N C;  1WAR A;  4UT2 A;  4OR9 A;  2O8G A;  3H61 A;  3H68 A;  4O43 A;  4UWQ A;  4WWL A;  4F0Z A;  4TUI A;  3THN A;  1G5B A;  3QFM A;  1M63 A;  5GTU A;  3E0J A;  2DFJ A;  5IOH A;  1HPU A;  4NZV A;  5JPE A;  1NNW A;  4ZVZ A;  2CV9 A;  3THO B;  5JPF A;  4ORB A;  2Q8U A;  3N5U A;  4YKE A;  4LU9 A;  3QFO A;  3RL5 A;  2WDF A;  4IL1 A;  1KBP A;  3JYF A;  3K7V C;  1UF3 A;  5F3W A;  3KBP A;  2Z06 A;  1V73 A;  2BQ8 X;  3ZU0 A;  3RQZ A;  4KKZ A;  1U32 A;  3H69 A;  2NPP C;  1AUI A;  2NYL C;  4UT3 B;  5B8I A;  3IVD A;  2YEQ A;  4LTY A;  3K7W C;  1S3L A;  2DXN A;  3AV0 A;  3AUZ A;  3EGG A;  4ORA A;  2QJC A;  2USH A;  3FLO A;  3TGH A;  3P71 C;  1T71 A;  3DSC A;  2IE3 C;  2QFP A;  3FGA C;  4V0W A;  2HY1 A;  2WDC A;  4JA9 A;  1II7 A;  1XM7 A;  5DNY A;  3DSD A;  4FBQ A;  3H64 A;  3IVE A;  4LAC C;  3PSO A; 
#chains in the Genus database with same CATH homology
 3E7B A;  5J28 A;  2HYP A;  2IE4 C;  2ZBM A;  3HVQ A;  4H2G A;  3ZTV A;  5JJT A;  4M0V A;  1QFC A;  2ZO9 B;  2QFR A;  3RL4 A;  3E7A A;  4O4K A;  1XZW A;  1UTE A;  2WDE A;  4FBW A;  3C9F A;  3V4Y A;  3ICF A;  1JK7 A;  5C1V A;  1Z2X A;  5HPE A;  5EQV A;  3GVE A;  3H66 A;  2KKN A;  4H2F A;  4ORC A;  5INB A;  1OID A;  2JOG A;  2DXL A;  3EGH A;  4MOY A;  2BCD A;  2AHD A;  3RL3 A;  4H2I A;  2O8A A;  4DT2 A;  1MF8 A;  4MOV A;  4TUG A;  1S95 A;  1IT6 A;  1Z2W A;  2Z1A A;  4JA7 A;  4V0V A;  3C5W C;  4H2B A;  2GJU A;  2A22 A;  4I5L C;  2P6B A;  3IB8 A;  3QG5 C;  2Z72 A;  1USH A;  1FJM A;  1SU1 A;  4IYP C;  1OI8 A;  1S3M A;  3CK2 A;  2YVT A;  4H1Y P;  4UT3 A;  1S8E A;  3PSN A;  1OIE A;  2BDX A;  3IB7 A;  1WAO 1;  4V0X A;  4Q7F A;  4DSY A;  2WDD A;  4MP0 A;  4O5G A;  4HD0 A;  4XPN A;  3DW8 C;  3LL8 A;  2R17 A;  3D03 A;  3H63 A;  4FBK A;  1HP1 A;  1TCO A;  4DHL A;  4O24 A;  1S3N A;  2ZOA A;  3QFK A;  1T70 A;  2HYO A;  4G9J A;  2XMO A;  4ZX2 A;  1W24 A;  3H60 A;  4J6O A;  4FCX A;  2NYM C;  3T1I A;  3QFN A;  1S70 A;  3H67 A;  2IAE C;  1HO5 A;  3H62 B;  4B2O A;  2NXF A;  1QHW A;  4H1S A;  4KBP A;  4I5N C;  1WAR A;  4UT2 A;  4OR9 A;  2O8G A;  3H61 A;  3H68 A;  4O43 A;  4UWQ A;  4WWL A;  4F0Z A;  4TUI A;  3THN A;  1G5B A;  3QFM A;  1M63 A;  5GTU A;  3E0J A;  2DFJ A;  5IOH A;  1HPU A;  4NZV A;  5JPE A;  1NNW A;  4ZVZ A;  2CV9 A;  3THO B;  5JPF A;  4ORB A;  2Q8U A;  3N5U A;  4YKE A;  4LU9 A;  3QFO A;  3RL5 A;  2WDF A;  4IL1 A;  1KBP A;  3JYF A;  3K7V C;  1UF3 A;  5F3W A;  3KBP A;  2Z06 A;  1V73 A;  2BQ8 X;  3ZU0 A;  3RQZ A;  4KKZ A;  1U32 A;  3H69 A;  2NPP C;  1AUI A;  2NYL C;  4UT3 B;  5B8I A;  3IVD A;  2YEQ A;  4LTY A;  3K7W C;  1S3L A;  2DXN A;  3AV0 A;  3AUZ A;  3EGG A;  4ORA A;  2QJC A;  2USH A;  3FLO A;  3TGH A;  3P71 C;  1T71 A;  3DSC A;  2IE3 C;  2QFP A;  3FGA C;  4V0W A;  2HY1 A;  2WDC A;  4JA9 A;  1II7 A;  1XM7 A;  5DNY A;  3DSD A;  4FBQ A;  3H64 A;  3IVE A;  4LAC C;  3PSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...