2HZ4A

Abl kinase domain unligated and in complex with tetrahydrostaurosporine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
267
structure length
262
Chain Sequence
KWEMERTDITMKHKLGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural biology contributions to the discovery of drugs to treat chronic myelogenous leukaemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 262
sequence length 267
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hz4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hz4A01
4FSRA 3CC6A 3EZRA 2ZM3A 4XX9A 3TV6A 4BIBA 3CS9A 3GGFA 1BI8A 1ATPE 5ACKA 2R5TA 4BDDA 3F5XA 4D2RA 1YQJA 4LL0A 3EFLA 3PA3A 4TNDA 3IDPA 4MEDA 3C50A 2W1EA 4FTQA 4DG0E 4CGAA 5BYLA 1YI4A 2PE0A 1WBNA 5DN3A 5HCYA 2OO8X 1KE5A 1Q61A 3DPKA 3QRJA 4APPA 3MN3A 2Z7LA 3S00A 2C3KA 3F69A 3I7BA 4IFGA 3FMLA 3EQPA 5AR2A 2XKFA 4ITIA 5BUJA 4P90A 5J1WA 3HRCA 3NUYA 4FT3A 3BHVA 4NFMA 4H3QA 2RFNA 5AP6A 2VTOA 3RBWA 2BFYA 2WEVA 5AV4A 4L8MA 4EOPA 3FMJA 3SOAA 4F63A 5HLNA 5JN2A 3OY3A 4QP3A 2JFLA 1QPEA 3RTPA 4D5HA 3I0OA 4BWPA 3R04A 3UPXA 3PSDA 2RG5A 1E1VA 2CDZA 2QHNA 4GFOA 4BDKA 5JQ5A 4FEQA 3ID6C 2QODA 3UDBA 1OBDA 4S32A 3PPKA 1JSVA 2Y4IB 5IUIA 3UJGA 4MXYA 1PMVA 3SDJA 1PJKA 3BWJA 4MXAA 3KEXA 4IM0A 4YJPA 1NXKA 1J3HA 5A14A 3R7UA 4GIHA 2FH9A 4O0VA 4U8ZA 5D12A 4Z7HA 4RIXB 3QTSA 5ICPA 4EKKA 2X4ZA 5IG1A 3DAEA 3P7AA 4O7WA 5EI8A 3LAUA 4FV6A 1M7QA 3W1FA 5FLFA 5C03A 4IHPA 4D5KA 5CF6A 3MPTA 4AN9A 5H8BA 1UU7A 3L9PA 4E5WA 3R73A 4OAVB 4NKSA 2OJIA 5HU9A 2UZVA 4FICA 3RK7A 3SKCA 1K2PA 3M2WA 3U6IA 4TN6A 1Q97A 2XRWA 3BE2A 4XP3A 4BDIA 3BGPA 1W8CA 3KU2A 3HDMA 5HLPA 1U54A 4FEVA 1OVEA 2C6MA 1JBPE 3QTUA 5ETFA 2IW6A 3OWJA 3QA0A 4CNHA 1W82A 2WTWA 3MSSA 5HD4A 5LMBA 1KE7A 2PVFA 1SM2A 3O71A 4CLJA 4J97A 2YACA 2C47A 2WQMA 3FMNA 2X7GA 3QLGA 4ZTLA 5AV1A 3FI2A 1FVRA 3TG1A 4X3FB 2VO6A 3RI1A 4U45A 4Y5HA 4OR5A 2ITOA 4RPVA 1YDSE 4I6FA 2CSNA 1ZZLA 2EU9A 2XIKA 3FE3A 2BUJA 5I5ZA 5J7BA 5A9UA 4JL9A 4V01A 3ZFMA 4QP7A 3PE2A 3K5UA 3CLYA 3T3UA 3CPCA 2EUFB 3OXIA 3FMEA 3ZZEA 3OP5A 4U5JA 3MPMA 2ITVA 4DH5A 4MF1A 4UXQA 2OXDA 2J0KA 5CX9A 1ERKA 5IEYA 4B99A 3OUKA 3NCGA 2RKUA 3CJGA 4FKLA 4FSUA 1B6CB 4NU1A 4LG4A 5KMOA 3FLSA 3RPSA 4FV0A 3PIZA 3R7VA 5IH5A 5IMEA 5A4EA 3MI9A 5HNIX 3DXQA 1WBTA 3E7OA 3GNIB 3GU7A 5BUIA 2VV9A 3QALE 2A1AB 4QP8A 4HZRA 3DK3A 4Y8DA 5KMKA 4EL9A 4E6CA 2A0CX 3NEWA 4MCVA 2QC6A 3FC1X 3NIZA 3VS4A 1UV5A 1A48A 2UVYA 4RMZA 1UA2A 3PE1A 4FT7A 4YBKA 4FSTA 5DNRA 2QHMA 3FV8A 4IZAA 1JKKA 3FI4A 4TW9A 3VUTA 2OI4X 4EONA 1XH8A 3O7LB 3UE4A 3EN7A 1DI8A 2PL0A 4BCIA 5C26A 4NEUA 2XK3A 4U81A 3V5LA 4ZS4A 4Z7GA 3NMUF 3ALNA 1M14A 3C51A 3GCPA 5FDXA 2CLQA 1JWHA 2XKEA 2XB7A 2BIKB 2ZJWA 3MH1A 3O2MA 5L6WL 3R0TA 4GMYA 1NT2A 3PFQA 3MGYA 3ZZWA 4M7IA 5AM7A 3SV0A 3D5VA 4F7LA 3DFAA 4D1XA 1Q5KA 1RDQE 2XCHA 4FUXA 4KABA 5IA4A 2CKPA 5LOHA 4CD0A 2Q83A 4QMNA 3UG1A 3S4QA 3HRFA 3FSKA 3R02A 3SOCA 2OF4A 3TL8A 4WUNA 2P3GX 3G5DA 4GJ3A 5EOBA 4RA5A 4HW7A 3SG9A 1CM8A 4AWIA 4BGQA 3DK6A 2RFSA 4L01A 3QUPA 4IE9A 5AJQA 4ZY6A 3IO7A 5A46A 4FE2A 4D2TA 1E9HA 4IZ5A 2DWBA 3NLBA 3UVRA 3C9WA 4HVHA 3F5GA 3FZOA 3GCQA 4JVGA 5HQ0A 5JFSA 3ZS5A 2IZRA 2JKKA 5JRQA 5IQHA 3ZDIA 2I7QA 3VIDA 2X8IA 3DLSA 5ITAA 1F3MC 3MVJA 1VJYA 4E8AA 5IQIA 3LXLA 3Q53A 4HGLA 3UYTA 2Q0BA 4AT3A 4OBPA 3GCSA 2QR7A 3RPOA 4G3FA 5FXQA 1YWVA 3FY2A 5CNOA 5C8MA 1CDKA 3WF6A 4UEUA 4IC8A 3D9VA 3OUNB 2OGVA 3P79A 4M15A 4RWLA 4JNWA 4FVRA 2I0YA 3LFSA 2HELA 4YJVA 3KREA 4DEBA 4CRSA 4I6BA 4QYFA 1Y57A 2GFSA 5TT7A 4BVUA 2CNUA 3DQWA 3HRBA 1SNXA 2XK9A 4O0XA 3OBJA 4QPMA 4TYIA 4A9YA 3ZXTA 2AUHA 4BICA 2BDFA 5IDNA 2JBOA 3ZLWA 5AUZA 3TZ8A 4TWPA 5C4LA 5DH3A 3ZLXA 1UWJA 3VUKA 3RK9A 2XEYA 3DV3A 4JDJA 4YLJA 1W7HA 4R3PA 3BWFA 3ZO4A 4FNYA 2C6LA 2WU6A 2CKEA 3O96A 3AGMA 4UMQA 3AD5A 2F7EE 3C4ZA 4O0SA 5D7VA 4LV5A 4WG5A 1H0VA 5AV0A 4YURA 3BV2A 4FKJA 1H00A 4HYSA 5GZ9A 3GOPA 3R2BA 1LEZA 3QHWA 1ZYSA 4LUEA 4QMTA 4F6UA 1GZOA 4WBOA 1P14A 3IQ7A 4AQCA 2PMIA 2R7IA 2UW7A 2VTQA 4O0WA 5G1XA 3FKLA 3TKIA 4PTCA 4IADA 3L9NA 4ASZA 4B6LA 3NYXA 2XNOA 2JKOA 3R7IA 3A7IA 2PVJA 1UKIA 3H9FA 4FSQA 4ZY5A 5J9LA 3AG9A 4EOQA 5CI6A 4IVCA 3GBZA 3OS3A 4O21A 4AOTA 3RJCA 3SVVA 5KUPA 3PPJA 2QCSA 5LVMA 3DKCA 1XH7A 3JY9A 3MFUA 4FKPA 1PXJA 4WHZA 2IVSA 4TYJA 4N6YA 4FL3A 4CZYB 5HCXA 4RBLA 2WTJA 4OTRA 2PZYA 2R3OA 2GPHA 3BYSA 4GH2A 3WF8A 5AR3A 4ENYA 4EZ5A 5DEYA 4RFYA 4EH2A 2P2IA 4ALWA 4FTTA 2C5VA 4C36A 1ZOHA 4I41A 3C4CA 4YBJA 2UUEA 3SA0A 4ZTMA 5FBNC 4CRLA 2YA9A 3VF9A 4FZAB 4BZDA 5ETIA 3E87A 2B53A 4FTUA 2I0VA 4IAAA 1ZXEA 3QTWA 5HG5A 3UZTA 3JXWA 3C5IA 4IDVA 2UZEA 4ERKA 5CEMA 1WFCA 1H28A 3RAIA 1ZAOA 4WD5A 2X1NA 4C61A 5DHJA 3QWKA 3NX8A 2JDRA 4C3PA 2VNYA 5DWRA 3HAVA 5M06A 1U5RA 4ITHA 4QTCA 2QG7A 4ZZMA 4ORKA 3OROA 4F4PA 3IK3A 4HYIA 3KCKA 4DFZE 5LJJA 2P0CA 2QU6A 2VTLA 3DA6A 3FSFA 4JIKA 3GXLA 2BAQA 1JSTA 4Y83A 3PP1A 1ZOEA 2R3HA 3KRXA 4I1ZA 4QPAA 3R9DA 3I0QA 3ZCLA 3R9HA 1T46A 5FG8A 4PNIA 3L8SA 1XH5A 4ZTQA 3JVRA 3TDVA 3TUBA 4Q5HA 4H1MA 5M56A 3SC1A 4CFNA 5BVWA 1JKLA 4QMZA 3EN5A 2ZM4A 4YHTA 4RFZA 2UW4A 4QO9A 2J90A 3FKNA 3VAPA 3VBTA 2E9UA 2VWIA 4R5SA 1CMKE 3LFFA 1H01A 4IVBA 4MK0A 1M2RA 2XKDA 4O6LA 4PPCA 3HV3A 4CYJA 3D15A 5IA5A 4FUYA 5IUHA 3QXPA 5KHWA 4DTBA 4Y5QA 4FOBA 5CT0A 4C4HA 2ZM1A 4CMUA 2WMVA 2A4LA 4CQEA 5A6NA 4O7SA 1DI9A 3UIUA 2PZRA 2BZKB 3KCFA 4BDCA 3VQHA 4G34A 1OPKA 4HVDA 2W17A 5CSVA 4BZNA 1BL6A 2FUMA 2O64A 2VTJA 3E88A 4QNAA 4W9XA 5CTPA 5EKOA 5EW8A 4DFLA 5F9EA 4KBKA 3NVKI 3OTUA 4V04A 2GNFA 3P08A 5CF4A 4FA2A 2H9VA 2XK7A 5CVFA 4DGMA 4EH6A 4R7BA 4FKVA 2J0MB 3OZ6A 4AN3A 4ANNA 3PY1A 5BNJA 4FT0A 4GFGA 4IEBA 4YSMA 3TNQB 3VC4A 4BN1A 3WE8A 3A8WA 4FKRA 3EQGA 2IW9A 4X3FA 4A9RA 4F9WA 2ZV8A 2XF0A 4RX9A 3MH2A 4LMNA 4X2JA 3QGYA 3A2CA 3H10A 3OXTA 2XK8A 4FIIA 4YZDA 5L2QA 3SG8A 2WHBA 3OCGA 3Q3BA 4G6LA 5AX9A 3UO6A 2ERZE 4F64A 5IQGA 2VTPA 2FYSA 2R3NA 2VX3A 2BZHB 2V55A 4PWNA 4O84A 3AT4A 2PVNA 3SRVB 5AR8A 3RWPA 4FR4A 4A4LA 2O0UA 4WG3A 3L1SA 4EC8A 4FBXA 3ACKA 3MTLA 5AAEA 4KIKA 5C27A 2PZ5A 3MFTA 3OEFX 3ORZA 4Q9ZA 4YJNA 4BL1A 4EHEA 1ZMVA 2NRYA 4O96A 1XKKA 1Y6BA 5HU3A 5I9XA 5K4JA 4KB8A 2J2IB 4FNWA 4V0GB 2BTRA 3QC9A 5IA2A 3GFWA 4QMWA 1WVYA 4E26A 3TIYA 1FPUA 3VS3A 1PMUA 3EKNA 5KKRC 4CV9A 2PK9A 3UG2A 1LR4A 5K9IA 2PSQA 2ESMA 2GNIA 3H4JA 3R2YA 3O51A 3B8RA 3PY0A 4ACGA 2C0OA 1Z5MA 2GQGA 4GFMA 2C5YA 3GVUA 3PJ1A 3O8PA 3Q2MA 1H1WA 4JAIA 4M3QA 3VVHA 5KNJA 2PMOX 4NM5A 2P2HA 3W2CA 2XYNA 3MH0A 3ODYX 4YJQA 3I5NA 3DDPA 2CN5A 4LRJA 4DFNA 4ZJVA 1IEPA 3GC9A 2QONA 2BRNA 3CJFA 2WMAA 3DTCA 3BZ3A 3DAKA 4OTHA 4MXOA 4RRVA 4BYIA 4GU6A 3TZMA 3LIJA 3SLSA 2B0QA 4L3LA 4YTFA 4DTAA 3R8LA 4G31A 3UNZA 1ZY4A 3F3ZA 5HO7A 1RJBA 5HZNA 3SAYA 3IKAA 3O0GA 1OZ1A 4DEGA 2NO3A 2QLUA 4PNKA 3UQCA 2EB3A 4YZBA 3D7ZA 3PXQA 3NNXA 3OXZA 1BLXA 2W4OA 4KAOA 4QTDA 4AUAA 4BYJA 4O0YA 4AAAA 3V5WA 1OECA 4UMRA 2X2MA 2R0UA 1OMWA 3VUHA 3G0FA 3Q9ZA 1LEWA 4B0GA 2H96A 3QQGA 5CSHA 4YJOA 4WO5A 2OG8A 3R8UA 4BDEA 1ZYLA 2QO2A 4C58A 5HTCA 1Y6AA 4R78A 5IA0A 3CXWA 4FG7A 3UP7A 3SW4A 2CKOA 2X7OA 3KXGA 5A6OA 3HZTA 3PLAE 1H24A 4GUBA 5BQ0A 4LM5A 5JQ8A 4BGHA 4I4EA 1QL6A 3BPRA 3PPZA 4NK9A 4ONAA 3FPMA 2WMSA 4E5AX 5IUGA 5HTBA 2CGWA 3LFAA 3MJ2A 1LPUA 4PY1A 4QTAA 4XLVA 4E73A 4FZ7A 4UB7A 3HGKA 1YHWA 3C13A 3ORNA 3W16A 5CAUA 3KXHA 1KWPA 1P5EA 3EIDA 4DG2E 3KXMA 4ZJJA 4C57A 3LFDA 4JLCA 4GVAA 3AT3A 3U6HA 3CQWA 1GZ8A 4LL5A 2P4IA 2O63A 3DDQA 2C3JA 5AV3A 3RWQA 4CFUA 4CV8A 4DE4A 5J1VA 5FWKK 4EQMA 3FDNA 3C4EA 3R28A 4TYEA 4K0YA 4PDSA 3PG1A 4V05A 3QD2B 3BHTA 3AMAA 5FRIA 3VF8A 1SMHA 4C59A 1IASA 1JAMA 5J5TA 2X6EA 4AA0A 4FGRA 4GV1A 5CQUA 4YPSA 5J79A 5H2UA 5CXZA 2F9GA 2NPQA 2WMXA 2YAKA 2ACXA 3TN8A 5IZFA 5AP1A 3ZLSA 3QFVA 3G9LX 3ITZA 2GFCA 4H1JA 4PPBA 2R3LA 4Q5EA 4S2ZA 4YPDA 3ZDUA 1S9JA 2WPAA 3Q52A 5E8UA 2C68A 4TKSA 1G5SA 3NR9A 3E8CA 3ZO2A 4FV4A 3ORXA 4P5QA 2R0IA 5HVKA 4CKRA 4D4VA 4F09A 2BHHA 5GNKA 5FTGA 5J8IA 2FO0A 5E9EA 3MA3A 1NY3A 4EJ7A 1UU3A 5JK3A 3MFSA 4B7TA 3D0EA 4U43A 3WOWA 5B2MA 3OY1A 4I94A 3NUXA 4GT3A 4FZ6A 3U4UA 5HCZA 4YC3A 4RIWA 5CANA 3PVWA 4O7LA 2UZLA 1PXIA 1A9UA 2FSOX 4E5BA 4RWKA 3SD0A 1FVTA 4II5A 2VZ6A 5AA8A 1APME 4TWCA 5F4NA 4IJPA 3SXSA 1NA7A 3P5KA 4JDIA 4YZCA 3WZEA 4APCA 2OJ9A 2F2UA 3RHXA 5I4NA 4C4JA 4R3RA 5AAGA 2WZJA 4YZNA 1YHVA 2VGOA 4CKJA 2BVAA 2ITQA 2YJRA 3DK7A 4G3EA 3ZM9A 4FKOA 1Q3WA 5M57A 4U97A 3QLFA 4FIEA 4M13A 2RSVA 4M69B 3FMDA 5A4CA 2QQ7A 2YZLA 1PYXA 2EB2A 3FKOA 3PJCA 4IC7A 4EWQA 2RGPA 4H39A 5IQEA 3COMA 1KE8A 4YLLA 4RJ7A 4YJRA 3V8TA 3U9NA 3F88A 3QD4A 4YTCA 5HNGA 4G16A 3O8UA 3GFEA 3BBWA 4LRMA 2PWLA 5EI6A 4JR7A 1LUFA 4O22A 5HLWA 3LFEA 3ATTA 5K0KA 1Q8ZA 1XO2B 3GC7A 4FG9A 4DC2A 5K0XA 3ZRLA 2WFYA 1R78A 3OT3A 3V5PA 3W2QA 3H3CA 3M11A 4GS6A 4E6QA 1SNUA 1GAGA 3TEIA 4ZOGA 4AW5A 1Y8YA 4GYIA 4RVLA 4TL0A 2J0JA 4QP9A 5L4QA 4OTDA 4HPTE 3DZQA 4ENXA 4RC4A 4GEOA 3NYVA 4FV7A 4PQNA 4K11A 4B8MA 3BYMA 5BPYA 1IG1A 3B2TA 3DNEA 4BCGA 3LCDA 4BCFA 3UO5A 4EOSA 4FV5A 2C3LA 3PVUA 4FEXA 2YM4A 3B8QA 2ITYA 4DF3A 3W55A 2OFVA 4AZEA 4ZJIA 4GU9A 3QX4A 3COKA 4I0SA 3D4QA 2ZYBA 3QKKA 4WIHA 2FVDA 3E8DA 1HCKA 4CFXA 2GHGA 4MD8E 4M84A 4DG3E 5J9ZA 2V7OA 1YDTE 3AGLA 4QYHA 2W06A 3MA6A 4C2WA 3H0YA 3M42A 5JFWA 3MYGA 2GTNA 3WE4A 3GUBA 5DYJA 3PJ2A 4IM2A 3KY2A 3QYZA 3DKFA 2BRGA 5IQDA 3DZOA 4RSSA 4XP2A 4OTGA 5ANOA 4EQCA 2OSCA 4WRSA 3BYOA 3VHKA 2X0GA 5AIRA 4JDHA 4EH4A 3OCTA 3PZEA 4IDTA 4GKIA 3BI6A 1ZLTA 4ALUA 1BL7A 5EQEA 4G9CA 3QRIA 3O23A 4CXAA 3UNKA 3QTXA 4PMMA 1URWA 3FMMA 4IVAA 4OW8A 1OL1A 3KULA 3SW7A 4I24A 2BR1A 2XIYA 2OLCA 4HYUA 5EOLA 3DT1A 4FTCA 4R1YA 4E6DA 2W9FB 4DA5A 3U87A 4JR3A 2PYWA 1P4OA 3BKBA 2J4ZA 3DU8A 3PIXA 5AMNA 3SX9A 5M09A 2W5BA 1FOTA 1KE6A 2J9MA 2VTRA 4XOZA 3EL8A 3IW8A 1XH6A 1H8FA 3UPZA 1QPDA 5EQPA 5CASA 3O7LD 3FXZA 3C0GA 5KMMA 4D58A 3KK8A 3UOHA 5HX6A 2OK1A 3ZBFA 2JGZA 4BCHA 3FWQA 3K3JA 4GK2A 2UZDA 2OZAB 3EQRA 5L6PA 1RE8A 2YIWA 3FHIA 5CNNA 2OH0E 5J7HA 4FSMA 2SRCA 3DTWA 4BDHA 2W96B 4HVGA 3EN9A 4QP6A 2PVRA 5LMAA 3VNTA 1GIIA 5HI2A 1GIHA 2X81A 3UTOA 2IVTA 3ZMMA 4U7ZA 1JOWB 3I5ZA 3Q6UA 5CU0A 2GHMA 1MRYA 3MS9A 4NM3A 3SGCA 1L3RE 3CSVA 3D7TB 4FV8A 1H0WA 3ROYA 4MKCA 3EOCA 4KBAA 5KMNA 4CG9A 3QZIA 2IWIA 1V1KA 3P7CA 4YP8A 3ENHA 3S0OA 4U44A 4F1TA 4FIGA 1M17A 1PY5A 3NYOA 4QYGA 3KMMA 2OKRA 4U40A 4U6RA 4XG4A 5AEPA 5JEBA 4R1VA 5LCJA 4BI1A 2UW3A 4F1OA 4DGLC 4QTEA 2LAVA 2E9OA 2GNHA 2ZDUA 3E62A 3HECA 2VTHA 4UY9A 4OTPA 5HTIA 2J50A 1SVGA 4NJ3A 5IEVA 3O17A 3ZRKA 4ZY4A 4Y46A 5AV2A 2FGIA 4FKSA 4DEEA 4J98A 3VBWA 3DS6A 3FLQA 4QMSA 4PL4A 2JLDA 3UQGA 1YWNA 3GU8A 3QD0A 1OGUA 2BKKA 1PXMA 3W2SA 1KV1A 2R3IA 2WTKC 4E6AA 3R71A 1GJOA 2HCKA 2QR8A 5HO6A 4NUSA 4LOQA 3FZ1A 2G2FA 2WAJA 5KHXA 4HJOA 4UMUA 4UBAA 2XJ0A 3MESA 2JEDA 4NM7A 4DFYA 1O6LA 3PJ3A 4U80A 3DB6A 3R22A 1XBBA 4LOOA 5HOAA 4PP7A 4Y85A 1QPJA 4JRNA 4L00A 2Q0NA 4FYOA 3V5TA 3VBXA 5HGIA 3RK5A 4ZMFA 5TOZA 2B9JA 4FIFA 3P78A 1OIQA 2UW9A 3OCSA 3HNGA 4WNPA 2XVDA 5EDRA 3VHEA 4DEHA 3N51A 3TTJA 4IB0A 4IZ7A 4PUZA 3KN5A 5E8YA 4QD6A 5BX0A 5AUWA 2YLEA 2VTAA 1URCA 2B54A 5CAOA 5K5XA 3PZHA 3ZO1A 3WF9A 4AZTA 1PMEA 3IGGA 4MNEB 5AAFA 3O8TA 2W9ZB 4PTEA 4JIAA 1MRVA 4ANBA 4WA9A 3UVQA 2XNMA 3WYXA 4BGGA 4F6WA 1H25A 2XNEA 2BZJA 4NT4A 4DGOA 2GQRA 3LFBA 4IIRA 3Q2JA 2HXQA 4XG9A 3LLTA 4RVTA 3MFRA 2UZWE 2YDIA 2JKQA 2XRUA 3GEQA 3DFCB 4GK3A 4C4EA 5ETCA 2YLFA 5AWMA 4AT4A 2BDWA 5E91A 4I3ZA 4O1OA 3TXOA 4M0ZA 1FQ1B 4NW5A 5HVJA 5TKDA 4A07A 3NVMB 2H34A 4O6EA 5LWMA 3N4TA 3ZC5A 4IWDA 4NM0A 4BY9E 4D55A 3LKMA 5F20A 3RM7A 3EQFA 5HIBA 2YAAA 5DFPA 1M52A 3H30A 2HZ0A 4BIEA 2GCDA 3MWUA 3E7VA 2C5OA 2DS1A 4IQ6A 4N4SA 1OB3A 4J8MA 3RPYA 3U4WA 1S9IA 2CGXA 3OOGA 4EQUA 4N0SA 5LARA 3QQHA 3V51A 2F4JA 1OM1A 4CMTA 2IPXA 1BI7A 3QTIA 4O1PA 2XIRA 3GT8A 3QA8A 4CZUA 2I6LA 3L9LA 1CKPA 2PU8A 4BWXA 1VYWA 3Q9WA 5IA1A 2WTCA 3HX4A 4F0GA 5L6OA 5GIPE 2B7AA 1PXKA 5LVNA 4YJUA 5LVOA 1WZYA 2OWBA 1P2AA 4QP1A 4QQ5A 4G3CA 4L52A 2XUUA 3UC4A 1FBNA 4EK3A 1NVQA 4ZSJA 5CEIA 3IGOA 4BBMA 3AD4A 2F49A 2GS6A 4AGWA 2XBJA 3OMVA 4DT8A 5LQFA 3S1HA 1O6YA 3LHJA 4TZRA 2W1CA 3K5VA 2WQEA 3BU6A 3QUDA 4RLLA 2C0TA 2KTYA 3QTZA 4WNOA 3PXYA 4D4YA 3RZFA 4L45A 3UO4A 3VRYA 2AYPA 4D2WA 3R1QA 2B52A 3OFMA 4ITJA 5HE0A 3AC3A 5FXSA 4BCKA 2Y4IC 4O7VA 2YM5A 4EYJA 3C7QA 4QMQA 1UWHA 4KNBA 4EH7A 3ZC6A 2C4GA 4LGGA 4I5MA 5M53A 5CSXA 4AZFA 3KN6A 3DXNA 3F7WA 4L7FA 3HV7A 5E8VA 3C4WA 1ZARA 2W7XA 4RJ6A 2G15A 1PKDA 2C5NA 3BYVA 2HW6A 4FKGA 3GC8A 2WQBA 4RLKA 5BYZA 5HIEA 3MW1A 3N4VA 3BV3A 4XJ0A 3ZLYA 2B4SB 3A61A 4F0IA 3MVMA 2ETRA 3EL7A 3TWJA 4YJSA 3TV4A 4BZOA 4BKZA 2Z8CA 2QOHA 3OTVA 2VNWA 4N6ZA 5HG7A 5IMXA 2IW8A 4FK3A 2WMBA 1WBOA 3ZO3A 3ZXZA 4IFCA 5I3RA 3EYHA 3DBDA 2XJ2A 3D2KA 4RX5A 2UW0A 3FBVA 2JFMA 5CLPA 4AZVA 3ANQA 3W8LA 1GZKA 1ZRZA 3R1SA 3KF4A 1OI9A 4FTRA 1WCCA 2QURA 3Q9XA 4RT7A 3H0ZA 4UMTA 3TCPA 2IO6A 5GZAA 3ET7A 2EWAA 2VTIA 5HG8A 4CFFA 4GW8A 4AF3A 3MTFA 4C35A 2PUUA 3CY2A 4UZHA 3KF7A 3VUIA 2VWWA 2GTMA 1TQPA 4X3FC 5KKRB 1XH4A 3QU0A 3WI6A 3MPAA 5CVHA 5BVEA 4YHJA 4KA3A 2PVYA 2PZPA 2ONLA 2XJ1A 2YJSA 3LQ8A 4CTCA 4EHVA 1X8BA 3CTHA 3NPCA 5LVPA 1F5QA 1IA8A 5CAVA 2C30A 2W1IA 4TTHB 4DH1A 2YCRA 2G9XA 1FGKA 2V22A 1VR2A 2YM6A 3G90X 3ACJA 4NIFB 2CJMA 2JAVA 1QMZA 2QOFA 4I20A 4IX3A 5DI1A 4B8LA 4BRXA 2PVLA 2WMUA 3KK9A 4JT3A 3PDTA 3QKLA 3FMKA 3BLQA 5DA3A 4KIOA 3TNWA 1ZOGA 4FEWA 2RL5A 3OBGA 2UZOA 5H8GA 2C69A 4BB4A 4CFWA 3QF9A 4JAJA 5IA3A 3G9NA 2Z2WA 3R1YA 3V8SA 4EK6A 4RZWA 4RX8A 5CALA 2J5FA 3E3PA 1R1WA 4FT9A 4RJ8A 4USEA 4I6HA 5IH4A 3R21A 5DR9A 5E4HA 4L9IA 4TYHB 1LP4A 5JRSA 4L7SA 4K2RA 2FSTX 4DH8A 2OZOA 4FZFB 4P5ZA 5TF9A 4JQ8A 3TV7A 3P86A 3EJ1A 5FM2A 4KS8A 3OD6X 1OKYA 3BGQA 1CKJA 3ZM4A 1YVJA 3BQCA 3IOPA 2IVUA 3ZYAA 4AU8A 1DAYA 1JSUA 4CTBA 2WIHA 3F6XA 5LXMA 3ROCA 5AR4A 2WB8A 4FKQA 5A3XA 4RJ5A 4GKHA 5EHLA 4GSBA 4NTSA 3ALOA 4CEGA 3V6RA 2W5AA 5CT7A 4HGSA 4D1SA 3D5XA 3RMFA 5M4CA 3W32A 4C38A 4USDA 2R3FA 3LMHA 3TIZA 3CQEA 2C3IB 3PTGA 4AACA 3PVBA 4D2VA 1YKRA 2CNQA 2EXMA 4R7IA 5AP5A 4RIXA 5A4LA 2XP2A 4UMPA 5BYYA 3ELJA 3FJQE 4I23A 3UIXA 4EEVA 4BF2A 4ERWA 2OICA 4IWOA 4EOOA 5CZHA 3VS7A 4U9AA 2YEXA 3U51A 3ORPA 4C02A 4E4XA 3AC2A 4RIYB 4BHZA 5KBQA 1GZNA 3R8ZA 3NAYA 5EG3A 1OPLA 4FTIA 4IBMA 4X2FA 1G8AA 5AADA 3IDBA 5D7AA 5AP4A 4PTGA 3SHEA 3HEGA 3HYHA 4FTMA 4PDPA 5IH6A 3Q96A 3TZ9A 4DFUA 1RW8A 2G2HA 4MVFA 4ASDA 1L8TA 2I1MA 4TWNA 2C6OA 1RQQA 2DUVA 3TNPC 4YUQA 3FZPA 1G8SA 4ZTSA 1XHAA 2JIVA 3O50A 2VWYA 3KVXA 2GS7A 2XS0A 1UU8A 4UV0A 4C37A 4LV8A 2E9PA 2VTSA 3I79A 5TE0A 2FSLX 2O3PA 4ZLZA 2BALA 3IG7A 3KL8A 1PXLA 3QZGA 4MTAA 1W83A 3NUSA 4DN5A 3NW7A 3BBTB 2PMNX 5HNBA 4QMLA 4FGBA 3UZPA 2VO7A 3LE6A 4FKUA 5AP0A 4AW0A 3V5QA 3RCDA 4U42A 2VGPA 3Q4CA 4BKJA 3NW5A 4MYGA 5L2TA 4U3ZA 3FLNC 2JIIA 2X7FA 2R9SA 5EM7A 3UBDA 2UZTA 5HESA 4AFEA 3TNHA 4UWBA 3MVHA 4EH9A 3Q60A 2VTNA 2YDJA 3DJ5A 3MDYA 4JXFA 3NRMA 2OBJA 4MBIA 3D94A 3V01A 3PWDA 1M2PA 4H3PA 3M1SA 4J8NA 4O91A 2B9IA 1OPJA 2YFXA 4BCMA 3CY3A 1YXTA 2QOOA 4UALA 3UC3A 5A4QA 4OTIA 1JQHA 2Y6MA 3AXWA 3K2LA 2QKWB 3EFJA 4U0IA 5FEEA 2GQSA 1FVVA 1I09A 4FTJA 4HZSA 5AUVA 3LCTA 3QQKA 5C8KA 4HNIA 4I92A 3NGAA 3PYYA 1OBGA 4OBQA 4BTMA 1Q8WA 5JH6A 4FOCA 4KD1A 4H36A 3HL7A 2X4FA 4IJ9A 3A7HA 3I60A 4KS7A 4FC0A 4GL9A 1TQIA 4LGHA 4MD9E 2W0JA 4J7BA 3DGKA 5D41A 2OH4A 2PHKA 5ANEA 3CCNA 2HZNA 3JS2A 1R0EA 4XNEA 3OT8A 4DEAA 1OKVA 3VBQA 3PA5A 3FMHA 3LFCA 4M14A 4F0FA 5AP7A 3AOXA 2QLQA 5E8XA 5FUTA 3KXXA 4I22A 5GJDA 2C6EA 4XH6A 3VS0A 4LMUA 2EXEA 4EUTA 5CF5A 4I5PA 5F1ZA 1PF8A 4G1WA 3A99A 1XBCA 2YIRA 2WOTA 5T3QA 2OFUA 3V6SA 2AC5A 4XLIA 4MWHA 5I9WA 4WUAA 3A62A 4ZEGA 4PL5A 5L2SA 3IPHA 2HWOA 3OWLA 4I5HA 2WELA 3F3WA 1BKXA 4EC9A 2QD9A 3HUBA 1CKIA 1DAWA 1M7NA 4AG8A 2P55A 3NNWA 2Z7SA 4F7JA 4O81A 1YXVA 5E8ZA 4ZMEA 2XA4A 4X3JA 4DLJA 2R3KA 2YHVA 4FG8A 1Z9XA 3FAAA 3G51A 3QQJA 5B2KA 3JYAA 1TKIA 4F1MA 5HE3A 4TWOA 4D2PA 1PW2A 4W8DA 2YIQA 2OJFE 3PP0A 2VO3A 3V3VA 1U54B 4AE6A 5CEPA 4YZMA 2WD1A 4HCTA 3RALA 2NP8A 4JX7A 2ZOQA 3II5A 3WILA 3ZRMA 3ENMA 3RM6A 4NSTA 3T3VA 3LZBA 5CQWA 4ZLOA 3JR1A 3EN4A 3F2AA 3OW4A 1REJA 4RWIA 4ZSLA 4PF4A 4B9DA 1KOAA 2R3JA 4ZTHA 4C3FA 1Z57A 3AC5A 3HDNA 4D9TA 4YO4A 3KXZA 2QNJA 3CIKA 4QNYA 1K3AA 3VBYA 2HYYA 3G2FA 4AGCA 5JFXA 4X7QA 2R7BA 3BLHA 3PY3A 2XK4A 5LVLA 5H8EA 4YLKA 4BTFA 2GNJA 4N57A 5JGDA 2HZIA 3Q04A 2C0IA 3R7GA 3UIMA 5CWZA 4OBOA 2CHLA 3Q4UA 5TR6A 4Y72A 2WQOA 4YJTA 5KCVA 3R00A 3AQVA 4RVMA 2VAGA 3L8PA 5AM6A 5M4IA 4DH7A 3A60A 4KWPA 2YWVA 3BU3A 4E1ZA 4U3YA 3T9IA 3WZDA 3KXNA 4EZ7A 1WBPA 5BVDA 2NNWB 4XP0A 5L8LA 3NWWA 3QCYA 3GOKA 1H1QA 4AXAA 3ATSA 5EQYA 5AX3A 2QI8A 4YTHA 5AFVA 3R63A 4RZVA 4BI2A 4G5PA 4AX8A 3A8XA 1OIUA 3DQXA 3E93A 3QC4A 4DINA 2QO7A 4AGUA 4HCVA 5EM8A 3ZUVA 3UZRA 3S2PA 2XYUA 4DFBA 4K1BA 3Q5IA 4NWMA 3FZSA 2UZNA 3S3IA 4NKAA 2HXLA 3LM5A 4XCUA 5KMJA 4O38A 3N9XA 3UOLA 4RQKA 3LVPA 4NFNA 1J7LA 1MP8A 2BROA 4O7ZA 4AW1A 3R30A 4OTWA 2KULA 3BHHA 4XV3A 1AGWA 1ZY5A 5GHVA 5AIKA 2A2AA 2HK5A 4EH8A 2PPQA 1OL6A 4FZDB 5DR6A 1E1XA 1R39A 5E7RA 4K33A 5ANDA 2BAKA 5BMSA 2PMLX 5DBXA 4KKGA 5CAPA 4ACDA 4L53A 2BDJA 4W9WA 4A06A 4DYMA 5LWNA 3FI8A 1SZMA 4EBWA 5I9UA 4YZ9A 3KVWA 1UVRA 4JQ7A 2VTMA 4BFMA 2JITA 4XG2A 4ZZNA 2IG7A 3WZUA 4EJNA 3HA6A 3MB6A 4FTLA 4OTQA 4RJ4A 3VQUA 3OEZA 4G5JA 3OWPA 3ZBXA 1Y91A 4LFIA 5EK7A 2C6DA 4ACHA 2F7ZE 4JJRA 4IAFA 2CGVA 3DY7A 3F3TA 4MXCA 4F08A 3HV6A 3F3UA 2JDVA 3U8WA 4IZYA 2EXCX 5JGAA 4BWKA 3F61A 3QQFA 4QMXA 3GCVA 2IN6A 4UXLA 4AOJA 2Z60A 3KMUA 5KMLA 3R9OA 2CN8A 3LLAA 3RAHA 5EI2A 4F7NA 3TUDA 1PXNA 5C01A 4QP4A 2UV2A 5CS6A 3ULIA 4DITA 2YERA 2UW5A 3LJ1A 4ACCA 5M4FA 4YR8A 4R77A 5FP5A 4YNOA 5FBOA 5DIAA 4I0RA 5B2LA 4PL3A 3PLSA 4GT4A 1U4DA 4M66A 4D2SA 4AN2A 3P4KA 5ANGA 4YMJA 4X2NA 5HEZA 4A9SA 3A4PA 3P9JA 2YITA 3I4BA 3GC0A 3GP0A 3BHUA 3ETAA 3H9RA 4K77A 4FMQA 5FTQA 1ND4A 4FK6A 4G3DA 2HW7A 4I93A 3F9NA 1IAJA 5IQAA 4OT5A 5IDPA 4WNMA 4IAKA 3LMIA 2PUIA 3CPBA 2CCIA 4GRBA 4CMOA 5BVFA 4A7CA 3AMYA 1AD5A 3A7JA 4FIHA 5CI7A 3TI1A 5L8KA 2VTTA 3FC2A 5F95A 1YI3A 1O6KA 4O83A 3OOMA 3RVGA 2O8YA 2BZIB 4FV2A 4HPUE 2R3MA 5CU2A 1PRYA 4O82A 2Y9QA 1H4LA 3PSBA 5CXHA 2PUNA 5A4TA 3ORIA 3ZH8A 3QWJA 2C1AA 3R1NA 2G1TA 3E8NA 3QBNA 1J7UA 4O7YA 4QMUA 3UNJA 4HYHA 5HBJA 3BRBA 4CVAA 3FYKX 4F9BA 3MIYA 3WF5A 3RP9A 2GNLA 3E3BX 2XMYA 3KC3A 4FVPA 2Y7JA 3UMXA 3RAWA 3WF7A 4NYEA 4CT2A 4FTAA 4C62A 4CCBA 4UZDA 2ITNA 4DGNA 4A9TA 5CZIA 3BIZA 3EHAA 4M68A 2J0IA 3EN6A 3GU4A 4R3CA 4RG0A 4BC6A 1Q62A 1IA9A 2Z7RA 3KQ7A 4AGDA 1Q3DA 3HV4A 3TZ7A 4EK8A 4R7HA 3LCSA 4MBLA 3V5JA 3SRVA 2BILB 3HP2A 4EH5A 4J71A 3NYNA 3W8QA 3W33A 5JZJA 4CG8A 5HBHA 4EKLA 4C3RA 1JKSA 1YRPA 1IR3A 4ZP5A 3EMGA 3F5PA 4JOAA 4O86A 1JNKA 2JDOA 4KRDA 5L8JA 3NNVA 4V0GA 3WBLA 1CTPE 5L2IA 2PULA 3UGCA 2W5HA 3FYJX 1OUYA 1R0PA 2JBPA 2VWZA 4J99A 2OF2A 1BYGA 4M12A 2ITZA 3CKWA 3EWHA 3QUEA 4IVDA 4KUJA 5HHWA 4BTJA 3TT0A 4WNKA 5C8NA 3ZFXA 5FXRA 2ETKA 5BVOA 2JKMA 5HD7A 3MY1A 5EKNA 1DM2A 4F99A 5FDPA 3QRUA 3F66A 2WOUA 2HWPA 3LW0A 3LPBA 1XH9A 4HGEA 3TM0A 3ZEPA 1OKZA 3RPVA 4AT5A 2YM3A 3ORTA 4MH7A 2ZB0A 5M44A 3CGFA 3PXRA 4NZWB 3FPQA 4DCEA 3DJ6A 1VEBA 1G3NA 2BPMA 2E9NA 2YWPA 4P7EA 3VW8A 4LRKA 2GU8A 2RFEA 5EDPA 4TYGA 4AA4A 1PXPA 4JBQA 3HA8A 4NCTC 2B55A 1REKA 4YSJA 3ORMA 3P23A 3EFKA 4OUCA 4FTNA 2IZUA 4EH3A 5JKGA 3U9CA 5ANKA 5DT4A 3UVPA 5IISA 5E1SA 2B1PA 5GZ8A 2UZBA 1J1CA 2BIYA 2XNPA 4QMVA 5IU2A 1YI6A 4DEIA 5BMMA 4YTIA 3IOKA 4FTKA 4I4FA 2XIXA 1HOWA 4FYNA 4WBBB 4IAIA 3NCZA 3W18A 4A9UA 1VZOA 4EOJA 1Q8YA 4EORA 3C0HA 3ZHPC 5JFVA 2XCKA 5CYIA 3IS5A 3ZTXA 3A4OX 2UVZA 4TY1A 3T8OA 3VJNA 2WGJA 3QQLA 2OXXA 2VWVA 1ZMUA 1Q4LA 4TRLA 4BBEA 4BCJA 5C4KA 1VYZA 1H1PA 2XK6A 3RZBA 5HX8A 4FSZA 4FEUA 4IB3A 3NDMA 1QCFA 4PRJA 4FKWA 3NSZA 4XV1A 2DQ7X 3TKUA 4C4IA 3BEGA 2O5KA 4LUDA 3RPRA 2E9VA 2RG6A 2W99B 1J1BA 3BLRA 2XNBA 4CFVA 4XYFA 4B4LA 2R2PA 3UOJA 4RA4A 4IAZA 3VS6A 3EFWA 3WYYA 3QRTA 4L3JA 3W2RA 1OIRA 4L68A 1T45A 1YOMA 2QOIA 1PMNA 3TDWA 1WBVA 4ZIMA 5E8TA 5JSMA 5JT2A 2PE2A 3MY5A 2V0DA 4XRLA 3QXOA 3LXNA 4M8TA 2IZTA 5HE2A 4IMYA 2W1DA 2J0LA 2PY3A 4W8EA 3R8MA 2XEZA 1W84A 2CCHA 2CMWA 2P33A 3PRIA 5HE1A 3VJOA 3H9OA 1YWRA 4ANSA 5F94A 4ZAUA 2XNNA 2BFXA 4IXPA 3QGWA 3LCOA 2WIPA 3RCJA 4QMOA 4KIKB 3COHA 3COIA 3PJ8A 4MHAA 4USFA 3KRRA 4ZS0A 2IJMA 4FTOA 3HMMA 1ZYCA 5I3OA 4RJ3A 3DBFA 5CU6A 3LFQA 3WARA 4DEDA 4IW0A 1JVPP 4JBOA 2FB8A 2QOLA 5CEKA 3GCUA 1Y8GA 1MQBA 2EVAA 3I7CA 3QAME 4ZTNA 4AA5A 4MWIA 3VS2A 3HUCA 4BR3A 2IZSA 2WMTA 2YIYA 3L8XA 5EYKA 2ONLC 3GU5A 4EHGA 5IF1A 1OL2A 4LI5A 1B38A 3VWAA 4I21A 2PTKA 4QYYA 5DE2A 2I40A 3F7ZA 3QD3A 3RNYA 2BAJA 2V62A 4JBVA 2F2CB 3QHRA 4W4XA 4CLIA 1H1RA 4O0UA 2QOKA 2V5QA 1J7IA 2YABA 4EI4A 4IACA 4XEYA 4AW2A 4X6QC 4D4RA 5AA9A 3RGFA 4NCTA 5DLSA 1DS5A 4FI1A 4BBFA 1GNGA 5FD2A 1W98A 1M2QA 2J6MA 4JQEA 3PRFA 4ANMA 2AC3A 4R6VA 4JI9A 1WBWA 2BRMA 2WMQA 3KA0A 4M69A 3CTJA 4I5CA 5LCKA 3R7EA 1MUOA 1H27A 4XBRA 3HMPA 4M97A 3JVSA 1SVHA 4MX9A 4D0XA 4PDYA 3EB0A 1BUHA 3RHKA 4ANOA 2C1BA 3BU5A 2B9FA 3PG3A 4DCAA 3HP5A 3D14A 2RIOA 2QO9A 4R5YA 5ETAA 4MD7E 3VULA 4EOLA 2OJGA 1ZYDA 2A19B 2YIXA 4ARKA 4IX5A 3DBEA 2ITTA 3LFNA 3E64A 3MIAA 3DKOA 3PVGA 4G2FA 1B39A 4LQMA 4YHFA 3DKGA 5EHYA 4BCPA 4CZTA 5I0BA 2ZAZA 4AS0A 2A27A 2F7XE 4PX6A 4S33A 3AC8A 4E93A 3G15A 2G01A 4GVJA 2NRUA 3E8EA 4RWJA 2PZIA 2H8HA 2X2LA 3OG7A 3MBLA 3QL8A 2PE1A 4BCQA 2YCSA 4EZ3A 2XBAA 2J5EA 2QOQA 3JPVA 4FX3A 4WSYA 2WXVA 3KRLA 4Y73A 4Q9SA 5FGKA 4YO6A 4D28A 4I6QA 2X39A 4J1RA 3ZONA 4ANQA 5TO8A 4BDAA 1HCLA 3PXZA 4W4WA 4XRJA 4G17A 4MNFA 3QCSA 4N70A 4QQCA 4D4SA 3LQ5A 4WG4A 3KFAA 1FINA 1TQMA 4EK4A 3L8VA 3OHTA 3TJCA 3POZA 4JX3A 4IB5A 5CF8A 5GIOE 4WSQA 2UW8A 4BTKA 3EKKA 5BVNA 4IWPA 2J51A 2ZV9A 1UKHA 2ZDTA 1U5QA 4X0MA 4CSVA 1STCE 3QTRA 2FSMX 1YHSA 2XM9A 1OITA 4CT1A 5HICA 4F9YA 5AR5A 3GI3A 5DPVA 4O7NA 2Z02A 4PP9A 4KIPA 5CENA 4AE9A 4D9UA 2JDSA 3FQEA 2WTIA 1BMKA 4TT7A 4ZSGA 2Y4PA 5E8SA 1WAKA 4DHFA 2GSFA 5FM3A 3V8WA 4FNXA 3P1AA 3GQLA 3CEKA 2W1GA 5FEQA 5GJGA 3ZU7A 4HGTA 3NZ0A 2WNTA 5AUTA 4L46A 2VU3A 4MXXA 1QPCA 3FUPA 4LOPA 3NW6A 4U41A 1ZWSA 4ZLYA 3CP9A 3IW4A 1I44A 5CEQA 4RFMA 5J9YA 3U55A 3NUUA 4JG8A 3Q4ZA 1WMKA 4HCUA 4BI0A 3LQ3A 1UNHA 3OCBA 4EOMA 4FT5A 4JDKA 3AD6A 3CQUA 4F70A 4Z55A 4O7TA 3QRKA 4E20A 4RIWB 3GQIA 2GHLA 5EM5A 3ZSIA 2C5XA 4HNFA 2CLXA 5DGZA 3BYUA 3HMOA 4UWCA 2YDKA 3VUMA 4CCUA 5DMZA 3ORKA 4XS2A 4XV2A 3D2IA 3UYSA 5EDQA 3Q9YA 2H6DA 2OZAA 3DBQA 4QYEA 2ZV2A 4PDOA 2XZSA 3MH3A 4H58A 3T9TA 3RKBA 3FZRA 1GOLA 3DB8A 4KRCA 5EYDA 4EK5A 3U6JA 5KE0A 4DAWA 3MVLA 3U54A 2XNGA 2O65A 4A4OA 1H26A 3C1XA 3DBCA 4K18A 4HVSA 2BKZA 2J7TA 4PV0A 4BKYA 1PHKA 3BE9A 5DEWA 3REPA 4XV9A 4LYNA 4D1ZA 5FQDC 2W1FA 2CGUA 5DRDA 5DVRA 3QZHA 5BUEA 4BCNA 4FF8A 4G3GA 4MBJA 4QMYA 3THBA 3D7TA 1JLUE 3QKMA 3UQFA 1GIJA 3LCKA 1SVEA 4DBXA 2W1HA 2ETMA 3EQBA 3WZKA 2GS2A 3CD8A 1Q8UA 3C4XA 2Y8OA 5E90A 2X9FA 4DBNA 3K54A 1UNLA 3HAMA 1H08A 2QU5A 3ERKA 2C6KA 3C0IA 3GB2A 3Q5ZA 3D5UA 4ZSAA 1KV2A 3CD3A 3CGOA 4KINA 5KX8A 5IQCA 2X2KA 4ASXA 1FMKA 1V0OA 3DLZA 4H05A 4C4GA 4J53A 4AP7A 3CKXA 3DJ7A 4GJ2A 2VWUA 4XG7A 3R7OA 2X6DA 4QTBA 2HOGA 4FL1A 4OTFA 3DOGA 3RINA 3NUAA 2ERKA 2GNGA 3I81A 4IH8A 4D0WA 3UMWA 3G6HA 2XM8A 5CU3A 4P4CA 3FZTA 2W1ZA 3NS9A 4GUEA 4L3PA 4XOYA 5J5SA 4RIOA 1R3CA 5EW9A 3ZSHA 4F65A 4CYIA 1YOJA 4FV1A 1MQ4A 3CE3A 4JG6A 3EQIA 4G6NA 5EHOA 2JDTA 4LGDA 4FVQA 4PMSA 2FA2A 1BX6A 2WMRA 4OT6A 3IDCA 4FSYA 4FSWA 3AT2A 3TUCA 3P7BA 5I9YA 3F3VA 2CKQA 1O9UA 4I0TA 3ANRA 4X6RA 3HMIA 2BRBA 2I0EA 3QYWA 2YM7A 3DAJA 1NVSA 2XIZA 3KRJA 2PVMA 4MXZA 3FEGA 4FL2A 4NW6A 4U79A 3ZUUA 2JC6A 2VX1A 2YN8A 2W4JA 3KULB 4BCOA 4C2VA 2WO6A 4ACMA 4ZXTA 3CBLA 4RC3A 3POOA 4Y95A 3TACA 4ZK5A 4OGRA 3ZUTA 2R4BA 4NL0A 3EQHA 4K9YA 1Q24A 3NUNA 1ZMWA 4PMPA 5ANIA 4ANLA 2QG5A 3IECA 4F7SA 2BCJA 3EH9A 4MNEA 1H1SA 2X9EA 3VUDA 4UX9A 4EOIA 5T68A 3FLYA 1SYKA 4FV3A 3HMNA 2GMXA 4UYAA 4Z9LA 5M4UA 3R9NA 3FLWA 3TJDA 4S31A 4YC6A 4RVKA 4AFJA 3OF0A 2RF9A 3IW6A 4IX6A 5GINE 5FP6A 2G2IA 2UVXA 3KMWA 4KIQA 3SXRA 3HKOA 4FODA 3ZFYA 5B7VA 3R9RA 3TKHA 2YISA 5M55A 3R7YA 4EOKA 5AP2A 5K3YA 4L6QA 3QCXA 1J91A 3G33A 4GYGA 1OL5A 4J95A 4L44A 2YCQA 5IPJA 2VWXA 1Q41A 5JMSA 1JPAA 5E92A 5C9CA 3BGZA 4WT6A 3TNIA 2R3RA 2UZUE 3Q6WA 1YDRE 3BELA 2R3GA 3ODZX 5CSWA 5KO1A 5L2WA 4RX7A 3P0MA 2WTDA 2ZMDA 5CY3A 2YM8A 4O0TA 5AUXA 3VW6A 4GT5A 2JD5A 5HO8A 1KOBA 2VWBA 4GG5A 3A7FA 1ZZ2A 1NW1A 3N4UA 1XBAA 2JAMA 4RQVA 3FL4A 3GU6A 2OXYA 3VS1A 3MJ1A 3QTQA 1P4FA 3IW5A 4YGAA 3ZEWA 3LJ0A 3QZFA 4QOXA 3TTIA 5EYMA 4ZTRA 3AC1A 4YNEA 2B9HA 2YZAA 1ZYJA 4NH1A 1AQ1A 4HOKA 4E4LA 1YOLA 5JZNA 5L3AA 2OIDA 4TPTA 3C4FA 4QMMA 4FKIA 5D9HA 4E7WA 1OUKA 1MRUA 1UU9A 3W2PA 5IQBA 1K9AA 2R3QA 1F0QA 3LJ2A 4ID7A 4BDJA 2V7AA 4Q2AA 4XG6A 5M07A 5HG9A 1KSWA 3JY0A 3C5UA 5EM6A 3GENA 4O27B 2VD5A 4L43A 4YC8A 4E4NA 4OLIA 2ZV7A 5IKWA 4KKEA 4NJDA 2R3PA 2QVSE 3EQCA 5J95A 5C1QB 5K4IA 3EQDA 2GDOA 4M67A 4C7TA 2OIBA 1YXUA 5AP3A 5J87A 4QP2A 5CAQA 3F2RA 2WTVA 3E5AA 5I9ZA 3NUPA 4XUFA 3F2NA 4J52A 2WQNA 4RC2A 4JG7A 5HVYA 3VBVA 4JBPA 3W2OA 5D10A 1XQZA 3OW3A 4E3CA 2OJJA 4IB1A 4TXCA 2WKMA 5KBRA 2ZMCA 3I6UA 3BHYA 2Y0AA 2QOCA 1Q99A 4EHZA 4GK4A 1UNGA 1XR1A 4ASEA 4A4XA 3BCEA 5KZ0A 4O2PA 2R64A 5A54A 3B2WA 2BMCA 3VO3A 5M08A 3R6XA 2WMWA 3CR0A 2DYLA 3PSCA 5KMIA 2X8EA 4IX4A 3D83A 3WIKA 4K8AA 4W4VA 5ACBC 3DXPA 3A7GA 1V0BA 2XH5A 4WOVA 5CU4A 4L67A 5E1EA 1TVOA 5HIDA 3OC1A 4EBVA 3FXXA 5AUUA 1WBSA 4FKTA 3CTQA 4X2KA 4QQJA 3AMBA 3ULZA 3NIEA 4W4YA 2OIQA 4L42A 4IWQA 2W4KA 1KE9A 3KRWA 4C34A 4KBCA 5FEDA 2VUWA 3PA4A 4MQ2A 4UWYA 4C33A 5M51A 1GY3A 4NTTA 1IAHA 5BVKA 2PVKA 5ANJA 5D11A 5LMKC 3G6GA 4G9RA 3KKVA 2WU7A 5K5NA 2VRXA 1OIYA 4JS8A 4TNBA 4KKHA 3W10A 1PYEA 3FL5A 2BHEA 5DOSA 1A06A 1W0XC 3EYGA 3Q32A 3UP2A 5DRBA 2QKRA 4GIIA 4O2ZA 1JKTA 3JUHA 4E4MA 4X2GA 4BDBA 3VS5A 2CPKE 4CFMA 3IW7A 4QT1A 2PUPA 2REIA 3PUPA 4NIFA 5GJFA 5KZIA 4C8BA 2YCFA 4DGGA 4FNZA 4DTKA 4QMPA 4Z16A 2QOBA 3VUGA 4CQGA 4XBUA 4C4FA 3LXKA 3SQQA 5FTOA 2ZVAA 4BDFA 2BRHA 4IM3A 4XG3A 2BTSA 3DNDA 5D1JA 3FHRA 4BIDA 2RFDA 3L9MA 1FMOE 2VN9A 4FSNA 2HY81 3VN9A 3ZOSA 4G6OA 2VX0A 3K3IA 3LXPA 4H3BA 4XG8A 3DCVA 2ITPA 4TYHA 5DG5A 1XWSA 3R83A 5DR2A 4IANA 2W05A 4O7RA 4K6ZA 1XJDA 3F5UA 5H3QA 2WTKB 3AC4A 4QQTA 4X21A 1PKGA 4Z3VA 4YU2A 1OKWA 3I1AA 4XMOA 2C6IA 3E63A 2PVHA 4HVIA 4GCJA 3ORLA 3FQSA 5G6VA 4AZWA 5HKMA 1Q8TA 3PXKA 4MF0A 3R01A 3FY0A 5AR7A 4DFXE 3MY0A 2ITUA 1WVXA 3EZVA 1H07A 1EH4A 2XKCA 2WEIA 4EYMA 2HY0A 3FLZA 4P2KA 4RGJA 5DT3A 3OWKA 4O0RA 2ZB1A 2X8DA 3D5WA 3WIGA 4EUUA 3RNIA 2ITWA 4FV9A 1YW2A 3R8PA 5I9VA 3S95A 3MV5A 4JRVA 5EFQA 3MB7A 4R8QA 5B0XA 2I0HA 2VO0A 3VRZA 4IAYA 3QX2A 1U59A 5CSPA 3OVVA 3PXFA 4XHKB 3V04A 4KSQA 2UW6A 4RIYA 4S30A 5E8WA 3ZSGA 1IRKA 2F57A 3NNUA 5EW3A 4PPAA 5H9BA 1YXXA 4C0TA 3PIYA 3LMGA 4ZSEA 2HENA 3G0EA 5HBEA 2HIWA 1YXSA 3BEAA 2CNVA 4KSPA 2Y6OA 3FXWA 5EH0A 4DLIA 4EWHA 3F82A 4FIJA 3FI3A 1NVRA 1WVWA 3QQUA 2E2BA 3R8VA 2O2UA 2HAKA 4BDGA 3HLLA 4J96A 3LOKA 4WKQA 3PWYA 2Z7QA 4MQ1A 3BX5A 3LM0A 4QRCA 5DT0A 3SXFA 3UIBA 1FGIA 2ITXA 3KGAA 5LMKA 4AOIA 1V0PA 1KUTA 4DT9A 3RAKA 3Q4TA 5CVGA 4MAOA 3E92A 4PMTA 4BHNA 4QPSA 5HORA 4OAUC 3I6WA 4F9CA 3QCQA 3HV5A 4F9AA 4ALVA 4UYNA 1U46A 1CSNA 1OL7A 3UOKA 3FQHA 5IEXA 3BQRA 5IQFA 4GG7A 2JIUA 4M0YA 4DH3A 4UN0C 2IVVA 3IONA 4ZZOA 5JGBA 2C6TA 3KB7A 4CKIA 3HVCA 3UODA 3WZJA 4WRGA 4S34A 3NAXA 5T6KA 5AUYA 4AZSA 1PXOA 2HZ4A 2LGCA 5EYCA 4F6SA 2OU7A 5CEOA 2OW3A
chains in the Genus database with same CATH superfamily
4FSRA 3CC6A 3EZRA 2ZM3A 4XX9A 3TV6A 4BIBA 3W0OA 3CS9A 3GGFA 1BI8A 1ATPE 5ACKA 2R5TA 4BDDA 3F5XA 4D2RA 1YQJA 4LL0A 3EFLA 3PA3A 4TNDA 3IDPA 4MEDA 3C50A 2W1EA 4FTQA 3UDSA 4DG0E 4CGAA 5BYLA 1YI4A 2PE0A 1WBNA 5DN3A 5HCYA 2OO8X 1KE5A 1Q61A 3DPKA 3QRJA 4APPA 3MN3A 2Z7LA 3S00A 2C3KA 3F69A 3I7BA 4IFGA 3FMLA 3EQPA 5AR2A 2XKFA 4ITIA 5BUJA 4P90A 5J1WA 3HRCA 3NUYA 4FT3A 3BHVA 4NFMA 4H3QA 2RFNA 5AP6A 2VTOA 3RBWA 2BFYA 2WEVA 5AV4A 4L8MA 4EOPA 3FMJA 3SOAA 4F63A 5HLNA 5JN2A 3OY3A 4QP3A 2JFLA 1QPEA 3RTPA 4D5HA 3I0OA 4BWPA 3R04A 3UPXA 3PSDA 2RG5A 1E1VA 2CDZA 2QHNA 4GFOA 4BDKA 5JQ5A 4FEQA 3ID6C 2QODA 3UDBA 1OBDA 4S32A 3PPKA 1JSVA 2Y4IB 5IUIA 3UJGA 4MXYA 1PMVA 3SDJA 1PJKA 3BWJA 3PFYA 4MXAA 3KEXA 4IM0A 4YJPA 1NXKA 1J3HA 5A14A 3R7UA 4GIHA 2FH9A 4O0VA 4U8ZA 5D12A 4Z7HA 4RIXB 3QTSA 5ICPA 4EKKA 2X4ZA 5IG1A 3DAEA 3P7AA 4O7WA 5EI8A 3LAUA 4FV6A 1M7QA 3W1FA 5FLFA 5C03A 4IHPA 4D5KA 5CF6A 3MPTA 4AN9A 5H8BA 1UU7A 3L9PA 4E5WA 3R73A 4OAVB 4NKSA 4DDIA 2OJIA 5HU9A 2UZVA 4FICA 3RK7A 3SKCA 1K2PA 2AQXA 3M2WA 3U6IA 4TN6A 1Q97A 2XRWA 3BE2A 4XP3A 4BDIA 3BGPA 1W8CA 3KU2A 3HDMA 5HLPA 1U54A 4FEVA 1OVEA 2C6MA 1JBPE 3QTUA 5ETFA 2IW6A 3OWJA 3QA0A 4CNHA 1W82A 3BLAA 2WTWA 3MSSA 5HD4A 5LMBA 1KE7A 2PVFA 1SM2A 3O71A 4CLJA 4J97A 2YACA 2C47A 2WQMA 3FMNA 2X7GA 3QLGA 4ZTLA 5AV1A 3FI2A 1FVRA 3TG1A 4X3FB 2VO6A 3RI1A 4U45A 4Y5HA 4OR5A 2ITOA 4RPVA 1YDSE 4I6FA 2CSNA 1ZZLA 2EU9A 2XIKA 3FE3A 2BUJA 5I5ZA 5J7BA 5A9UA 4JL9A 4V01A 3ZFMA 4QP7A 3PE2A 3K5UA 3CLYA 3T3UA 3CPCA 2EUFB 3OXIA 3FMEA 3ZZEA 3OP5A 4U5JA 3MPMA 2ITVA 4DH5A 4MF1A 4UXQA 2OXDA 2J0KA 5CX9A 1ERKA 5IEYA 4B99A 3OUKA 3NCGA 2RKUA 3CJGA 4FKLA 4FSUA 1B6CB 4NU1A 4LG4A 5KMOA 3FLSA 3RPSA 4FV0A 3PIZA 3R7VA 5IH5A 5IMEA 5A4EA 3MI9A 5HNIX 3DXQA 1WBTA 3E7OA 3GNIB 3GU7A 5BUIA 2VV9A 4AXDA 3QALE 2A1AB 4QP8A 4HZRA 3DK3A 4Y8DA 5KMKA 4EL9A 4E6CA 2A0CX 3NEWA 4MCVA 2QC6A 3FC1X 3NIZA 3VS4A 1UV5A 1A48A 2UVYA 4RMZA 1UA2A 3PE1A 4FT7A 4YBKA 4FSTA 5DNRA 4DDGA 2QHMA 3FV8A 4IZAA 1JKKA 3FI4A 4TW9A 3VUTA 2OI4X 4EONA 1XH8A 3O7LB 3UE4A 3EN7A 1DI8A 2PL0A 4BCIA 5C26A 4NEUA 2XK3A 4U81A 3V5LA 4ZS4A 4Z7GA 3NMUF 3ALNA 1M14A 3C51A 3GCPA 5FDXA 2CLQA 1JWHA 2XKEA 2XB7A 2BIKB 2ZJWA 3MH1A 3O2MA 5L6WL 3R0TA 4GMYA 1NT2A 3PFQA 3MGYA 4O4BB 3ZZWA 4M7IA 5AM7A 3SV0A 3D5VA 4F7LA 3DFAA 4D1XA 1Q5KA 1RDQE 2XCHA 4FUXA 4KABA 5IA4A 2CKPA 5LOHA 4CD0A 2Q83A 4QMNA 3UG1A 3S4QA 3HRFA 3FSKA 3R02A 3SOCA 2OF4A 3TL8A 3TMOA 4WUNA 2P3GX 3G5DA 4GJ3A 5EOBA 4RA5A 4HW7A 3SG9A 1CM8A 4AWIA 4BGQA 3DK6A 2RFSA 4L01A 3QUPA 4IE9A 5AJQA 4ZY6A 3IO7A 5A46A 4FE2A 4D2TA 1E9HA 4IZ5A 4DHJA 2DWBA 3NLBA 3UVRA 3C9WA 4HVHA 3F5GA 3FZOA 3GCQA 4JVGA 5HQ0A 5JFSA 3ZS5A 2IZRA 2JKKA 5JRQA 5IQHA 3ZDIA 2I7QA 3VIDA 2X8IA 3DLSA 5ITAA 1F3MC 3MVJA 1VJYA 4E8AA 5IQIA 3LXLA 3Q53A 4HGLA 3UYTA 2Q0BA 4AT3A 4OBPA 3GCSA 2QR7A 3RPOA 4G3FA 5FXQA 1YWVA 3FY2A 5CNOA 5C8MA 1CDKA 3WF6A 4UEUA 4IC8A 3D9VA 3OUNB 2OGVA 3P79A 4M15A 4RWLA 4JNWA 4QEBA 4FVRA 1ST4A 2I0YA 3LFSA 2HELA 4YJVA 3KREA 4DEBA 4AQKA 4CRSA 4I6BA 4QYFA 1Y57A 2GFSA 5TT7A 4BVUA 2CNUA 3DQWA 3HRBA 1SNXA 2XK9A 4O0XA 3OBJA 4QPMA 4TYIA 4A9YA 3ZXTA 3AKKA 2AUHA 4BICA 2BDFA 5IDNA 2JBOA 3ZLWA 5AUZA 3TZ8A 4TWPA 5C4LA 5DH3A 3ZLXA 1UWJA 3VUKA 3RK9A 2XEYA 3DV3A 4JDJA 4YLJA 1W7HA 4R3PA 3BWFA 3ZO4A 4FNYA 2C6LA 2WU6A 2CKEA 3O96A 3AGMA 4UMQA 3AD5A 2F7EE 3C4ZA 4O0SA 5D7VA 4LV5A 4WG5A 1H0VA 5AV0A 4YURA 3BV2A 4FKJA 1H00A 4HYSA 5GZ9A 3GOPA 3R2BA 1LEZA 3QHWA 1ZYSA 4LUEA 4QMTA 4F6UA 1GZOA 4WBOA 1P14A 3IQ7A 4AQCA 2PMIA 2R7IA 2UW7A 2VTQA 4O0WA 5G1XA 3FKLA 3TKIA 2X0QA 4IADA 3L9NA 4PTCA 4ASZA 4B6LA 3NYXA 2XNOA 2JKOA 3R7IA 3A7IA 2PVJA 1UKIA 3H9FA 4FSQA 4ZY5A 5J9LA 3AG9A 4EOQA 4F78A 5CI6A 4IVCA 3GBZA 3OS3A 4O21A 4AOTA 3RJCA 3SVVA 5KUPA 3PPJA 2QCSA 5LVMA 3DKCA 1XH7A 3JY9A 3MFUA 4FKPA 1PXJA 4WHZA 2IVSA 4TYJA 4N6YA 4FL3A 4CZYB 5HCXA 4RBLA 2WTJA 4OTRA 2PZYA 2R3OA 2GPHA 3BYSA 4GH2A 3WF8A 5AR3A 4ENYA 4EZ5A 5DEYA 4RFYA 4EH2A 2P2IA 4ALWA 4FTTA 2C5VA 4C36A 1ZOHA 4I41A 3C4CA 4YBJA 2UUEA 1G8KA 3SA0A 4ZTMA 5FBNC 4CRLA 2YA9A 3VF9A 4FZAB 4BZDA 5ETIA 3E87A 2B53A 4FTUA 2I0VA 4IAAA 1ZXEA 3QTWA 5HG5A 3UZTA 3JXWA 3C5IA 4IDVA 2UZEA 4ERKA 5CEMA 1WFCA 1H28A 3RAIA 1ZAOA 4WD5A 2X1NA 4C61A 5DHJA 3QWKA 3NX8A 2JDRA 4C3PA 2VNYA 5DWRA 3HAVA 5M06A 1U5RA 4ITHA 4QTCA 2QG7A 4ZZMA 4ORKA 3OROA 4F4PA 3IK3A 4HYIA 3KCKA 4DFZE 5LJJA 2P0CA 2QU6A 2VTLA 3DA6A 3FSFA 4JIKA 3GXLA 2BAQA 1JSTA 4Y83A 3PP1A 1ZOEA 2R3HA 3KRXA 4I1ZA 4QPAA 3R9DA 3I0QA 3ZCLA 3R9HA 1T46A 5FG8A 4PNIA 3L8SA 1XH5A 4ZTQA 3JVRA 3TDVA 3TUBA 4Q5HA 4H1MA 5M56A 3SC1A 4CFNA 5BVWA 1JKLA 4QMZA 3EN5A 2ZM4A 4YHTA 4RFZA 2UW4A 4QO9A 2J90A 3FKNA 3VAPA 3VBTA 2E9UA 2VWIA 4R5SA 1CMKE 3LFFA 1H01A 4IVBA 4MK0A 1M2RA 2XKDA 4O6LA 4PPCA 3HV3A 4CYJA 3D15A 5IA5A 4FUYA 5IUHA 3QXPA 5KHWA 4DTBA 4Y5QA 4FOBA 5CT0A 4C4HA 2ZM1A 4CMUA 2WMVA 2A4LA 4CQEA 5A6NA 4O7SA 1DI9A 3UIUA 2PZRA 2BZKB 3KCFA 4BDCA 3VQHA 4G34A 1OPKA 4HVDA 2W17A 5CSVA 4BZNA 2A98A 1BL6A 2FUMA 2O64A 2VTJA 3E88A 4QNAA 4W9XA 5CTPA 5EKOA 5EW8A 4DFLA 5F9EA 4KBKA 3NVKI 3OTUA 4V04A 2GNFA 3P08A 5CF4A 4FA2A 2H9VA 2XK7A 5CVFA 4DGMA 4EH6A 4R7BA 4FKVA 2J0MB 3OZ6A 4AN3A 4ANNA 3PY1A 5BNJA 4FT0A 4GFGA 4IEBA 4YSMA 3TNQB 3VC4A 4BN1A 3WE8A 3A8WA 4FKRA 3EQGA 2IW9A 4X3FA 4A9RA 4F9WA 2ZV8A 2XF0A 4RX9A 3MH2A 4LMNA 4X2JA 3QGYA 3A2CA 3H10A 3OXTA 2XK8A 4FIIA 4YZDA 5L2QA 3SG8A 2WHBA 3OCGA 3Q3BA 4G6LA 5AX9A 3UO6A 2ERZE 4F64A 5IQGA 2VTPA 2FYSA 2R3NA 2VX3A 2BZHB 2V55A 4PWNA 4O84A 3AT4A 2PVNA 3SRVB 5AR8A 3RWPA 4FR4A 4A4LA 2O0UA 4WG3A 3L1SA 4EC8A 4FBXA 3ACKA 3MTLA 5AAEA 4KIKA 5C27A 2PZ5A 3MFTA 3OEFX 3ORZA 4Q9ZA 4YJNA 4BL1A 4EHEA 1ZMVA 2NRYA 4O96A 1XKKA 1Y6BA 5HU3A 5I9XA 5K4JA 4KB8A 2J2IB 4FNWA 4V0GB 2BTRA 3QC9A 5IA2A 3GFWA 4QMWA 1WVYA 4E26A 3W0PA 3TIYA 1FPUA 3VS3A 1PMUA 3EKNA 5KKRC 4CV9A 2PK9A 3UG2A 1LR4A 5K9IA 2PSQA 2ESMA 2GNIA 3H4JA 3R2YA 3O51A 3B8RA 3PY0A 4ACGA 2C0OA 1Z5MA 2GQGA 4GFMA 2C5YA 3GVUA 3PJ1A 3O8PA 3Q2MA 1H1WA 4JAIA 4M3QA 3VVHA 5KNJA 2PMOX 4NM5A 2P2HA 3W2CA 2XYNA 3MH0A 3ODYX 4YJQA 3I5NA 3DDPA 2CN5A 4LRJA 4DFNA 4ZJVA 1IEPA 3GC9A 2QONA 2BRNA 3CJFA 2WMAA 3DTCA 3BZ3A 3DAKA 4OTHA 4MXOA 4RRVA 4BYIA 4GU6A 3TZMA 3LIJA 3SLSA 2B0QA 4L3LA 4YTFA 4DTAA 3R8LA 4G31A 3UNZA 1ZY4A 3F3ZA 5HO7A 1RJBA 5HZNA 3SAYA 3IKAA 3O0GA 1OZ1A 4DEGA 2NO3A 2QLUA 4PNKA 3UQCA 4LV7A 2EB3A 4YZBA 3D7ZA 3PXQA 3NNXA 3OXZA 1BLXA 2W4OA 4KAOA 4QTDA 4AUAA 4BYJA 4O0YA 4AAAA 3V5WA 1OECA 4UMRA 2X2MA 2R0UA 1OMWA 3VUHA 3G0FA 3Q9ZA 1LEWA 4B0GA 2H96A 3QQGA 5CSHA 4YJOA 4WO5A 2OG8A 3R8UA 4BDEA 1ZYLA 2QO2A 4C58A 5HTCA 1Y6AA 2XAMA 4R78A 5IA0A 3CXWA 4FG7A 3UP7A 3SW4A 2CKOA 4BJJB 2X7OA 3KXGA 5A6OA 3HZTA 3PLAE 1H24A 4GUBA 5BQ0A 4LM5A 5JQ8A 4BGHA 4I4EA 1QL6A 3BPRA 3PPZA 4NK9A 4ONAA 3FPMA 2WMSA 4E5AX 5IUGA 5HTBA 2CGWA 3LFAA 3MJ2A 1LPUA 4PY1A 4QTAA 4XLVA 4E73A 4FZ7A 4UB7A 3HGKA 1YHWA 3C13A 3ORNA 3W16A 5CAUA 3KXHA 1KWPA 1P5EA 3EIDA 4DG2E 3KXMA 4ZJJA 4C57A 3LFDA 4JLCA 4GVAA 3AT3A 3U6HA 3CQWA 1GZ8A 4LL5A 2P4IA 2O63A 3DDQA 2C3JA 5AV3A 3RWQA 4CFUA 4CV8A 4DE4A 5J1VA 5FWKK 4EQMA 3FDNA 3C4EA 3R28A 4TYEA 4K0YA 4PDSA 3PG1A 4V05A 3QD2B 3BHTA 3AMAA 5FRIA 3VF8A 1SMHA 4C59A 1IASA 1JAMA 5J5TA 2X6EA 4AA0A 4FGRA 4GV1A 5CQUA 4YPSA 5J79A 5H2UA 5CXZA 2F9GA 2NPQA 2WMXA 2YAKA 2ACXA 3TN8A 5IZFA 5AP1A 3KIOC 3ZLSA 3QFVA 3G9LX 3ITZA 2GFCA 4H1JA 4PPBA 2R3LA 4Q5EA 4S2ZA 4YPDA 3ZDUA 1S9JA 2WPAA 3Q52A 5E8UA 2C68A 4TKSA 1G5SA 3NR9A 3E8CA 3ZO2A 4FV4A 3ORXA 4P5QA 2R0IA 5HVKA 4QDVA 4CKRA 4D4VA 4F09A 2BHHA 5GNKA 5FTGA 5J8IA 2FO0A 5E9EA 3MA3A 1NY3A 4EJ7A 1UU3A 5JK3A 3MFSA 4B7TA 3D0EA 4U43A 3WOWA 5B2MA 3OY1A 4I94A 3NUXA 4GT3A 4FZ6A 3U4UA 5HCZA 4YC3A 4RIWA 5CANA 3PVWA 4O7LA 2UZLA 1PXIA 1A9UA 2FSOX 4E5BA 4RWKA 3SD0A 1FVTA 4II5A 2VZ6A 5AA8A 1APME 4TWCA 5F4NA 4IJPA 3SXSA 1NA7A 3P5KA 4JDIA 4YZCA 3WZEA 4APCA 2OJ9A 2F2UA 3RHXA 5I4NA 4C4JA 4R3RA 4FRFA 5AAGA 2WZJA 4YZNA 1YHVA 2VGOA 4CKJA 2BVAA 2ITQA 2YJRA 3DK7A 4G3EA 3ZM9A 4FKOA 1Q3WA 5M57A 4U97A 3QLFA 4FIEA 4M13A 2RSVA 4M69B 3FMDA 5A4CA 2QQ7A 2YZLA 1PYXA 2EB2A 3FKOA 3PJCA 4IC7A 4EWQA 2RGPA 4H39A 5IQEA 3COMA 1KE8A 4YLLA 4RJ7A 4YJRA 3V8TA 3U9NA 3F88A 3QD4A 4YTCA 5HNGA 4G16A 3O8UA 3GFEA 3BBWA 4LRMA 2PWLA 5EI6A 4JR7A 1LUFA 4O22A 5HLWA 2IF8A 3LFEA 3ATTA 5K0KA 1Q8ZA 1XO2B 3GC7A 4FG9A 4DC2A 5K0XA 3ZRLA 2WFYA 1R78A 3OT3A 3V5PA 3W2QA 3H3CA 3M11A 4GS6A 4E6QA 1SNUA 1GAGA 3TEIA 4ZOGA 4AW5A 1Y8YA 4GYIA 4RVLA 4TL0A 2J0JA 4QP9A 5L4QA 4OTDA 4HPTE 3DZQA 4ENXA 4RC4A 4GEOA 3NYVA 4FV7A 4PQNA 4K11A 4B8MA 3BYMA 5BPYA 1IG1A 3B2TA 3DNEA 4BCGA 3LCDA 4BCFA 3UO5A 4EOSA 4FV5A 2C3LA 3PVUA 4FEXA 2YM4A 3B8QA 2ITYA 4DF3A 3W55A 2OFVA 4AZEA 4ZJIA 4GU9A 3QX4A 3COKA 4I0SA 3D4QA 2ZYBA 3QKKA 4WIHA 2FVDA 3E8DA 1HCKA 4CFXA 2GHGA 4MD8E 4M84A 4DG3E 5J9ZA 2V7OA 1YDTE 3AGLA 4QYHA 2W06A 3MA6A 4C2WA 3H0YA 3M42A 5JFWA 3MYGA 2GTNA 3WE4A 3GUBA 5DYJA 3PJ2A 4IM2A 3KY2A 3QYZA 3DKFA 2BRGA 5IQDA 3DZOA 4RSSA 4XP2A 4OTGA 5ANOA 4EQCA 2OSCA 4WRSA 3BYOA 3VHKA 2X0GA 5AIRA 4JDHA 4EH4A 3OCTA 3PZEA 4IDTA 4GKIA 3BI6A 1ZLTA 4ALUA 1BL7A 5EQEA 4G9CA 3QRIA 3O23A 4CXAA 3UNKA 3QTXA 4PMMA 1URWA 3FMMA 4IVAA 4OW8A 1OL1A 3KULA 3SW7A 4I24A 2BR1A 2XIYA 2OLCA 4HYUA 5EOLA 3DT1A 4FTCA 4DHIB 4R1YA 4AXCA 4E6DA 2W9FB 4DA5A 3U87A 4JR3A 2PYWA 1P4OA 3BKBA 2J4ZA 3DU8A 3PIXA 5AMNA 3SX9A 5M09A 2W5BA 1FOTA 1KE6A 2J9MA 2VTRA 4XOZA 3EL8A 3IW8A 1XH6A 1H8FA 3UPZA 1QPDA 5EQPA 5CASA 3O7LD 3FXZA 3C0GA 5KMMA 4D58A 3KK8A 3UOHA 5HX6A 2OK1A 3ZBFA 2JGZA 4BCHA 3FWQA 3K3JA 4GK2A 2UZDA 2OZAB 3EQRA 5L6PA 1RE8A 2YIWA 3FHIA 5CNNA 2OH0E 5J7HA 4FSMA 2SRCA 3DTWA 4BDHA 2W96B 4HVGA 3EN9A 4QP6A 2AEGA 2PVRA 5LMAA 3VNTA 1GIIA 5HI2A 1GIHA 2X81A 3UTOA 2IVTA 3ZMMA 4U7ZA 1JOWB 3I5ZA 3Q6UA 5CU0A 2GHMA 1MRYA 3MS9A 4NM3A 3SGCA 1L3RE 3CSVA 3D7TB 4FV8A 1H0WA 3ROYA 4MKCA 3EOCA 4KBAA 5KMNA 4CG9A 3QZIA 2IWIA 1V1KA 3P7CA 4YP8A 3ENHA 3S0OA 4U44A 4F1TA 4FIGA 1M17A 1PY5A 3NYOA 4QYGA 3KMMA 2OKRA 4U40A 4U6RA 4XG4A 5AEPA 5JEBA 4R1VA 5LCJA 4BI1A 2UW3A 4F1OA 4DGLC 4QTEA 2LAVA 2E9OA 4FJVA 2XAOA 2GNHA 2ZDUA 3E62A 3HECA 2VTHA 4UY9A 4OTPA 5HTIA 2J50A 2XANA 1SVGA 4NJ3A 5IEVA 3O17A 3ZRKA 4ZY4A 4Y46A 5AV2A 2FGIA 4FKSA 4DEEA 4J98A 3VBWA 3DS6A 3FLQA 4QMSA 4PL4A 2JLDA 3UQGA 1YWNA 3GU8A 3QD0A 1OGUA 2BKKA 1PXMA 3W2SA 1KV1A 2R3IA 2WTKC 4E6AA 3R71A 1GJOA 2HCKA 2QR8A 5HO6A 4NUSA 4LOQA 3FZ1A 2G2FA 2WAJA 5KHXA 4BJJA 4HJOA 4UMUA 4UBAA 2XJ0A 3MESA 2JEDA 4NM7A 4DFYA 1O6LA 3PJ3A 4U80A 3DB6A 3R22A 1XBBA 4LOOA 5HOAA 4PP7A 4Y85A 1QPJA 4JRNA 4L00A 2Q0NA 4FYOA 3V5TA 3VBXA 5HGIA 3RK5A 4ZMFA 5TOZA 2B9JA 4FIFA 3P78A 1OIQA 2UW9A 3OCSA 3HNGA 4WNPA 2XVDA 5EDRA 3VHEA 4DEHA 3N51A 3TTJA 4IB0A 4IZ7A 4PUZA 3KN5A 5E8YA 4QD6A 5BX0A 5AUWA 2YLEA 2VTAA 1URCA 2B54A 5CAOA 5K5XA 3PZHA 3ZO1A 3WF9A 4AZTA 1PMEA 3IGGA 4MNEB 5AAFA 3O8TA 2W9ZB 4PTEA 4JIAA 1MRVA 4ANBA 4WA9A 3UVQA 2XNMA 3WYXA 4BGGA 4F6WA 1H25A 2XNEA 2BZJA 4NT4A 4DGOA 2GQRA 3LFBA 4IIRA 3Q2JA 2HXQA 4XG9A 3LLTA 4RVTA 3MFRA 2UZWE 2YDIA 2JKQA 2XRUA 3GEQA 3DFCB 4GK3A 4C4EA 5ETCA 2YLFA 5AWMA 4AT4A 2BDWA 5E91A 4I3ZA 4O1OA 3TXOA 4M0ZA 1FQ1B 4NW5A 5HVJA 5TKDA 4A07A 3NVMB 2H34A 4O6EA 5LWMA 3N4TA 3ZC5A 4IWDA 4NM0A 4BY9E 4D55A 3LKMA 5F20A 3RM7A 3EQFA 5HIBA 2YAAA 5DFPA 1M52A 3H30A 1OGYA 2HZ0A 4BIEA 2GCDA 3MWUA 3E7VA 2C5OA 2DS1A 4IQ6A 4N4SA 1OB3A 4J8MA 3RPYA 3U4WA 1S9IA 2CGXA 3OOGA 4EQUA 4N0SA 5LARA 3QQHA 3V51A 2F4JA 1OM1A 4CMTA 2IPXA 1BI7A 3QTIA 4O1PA 2XIRA 3GT8A 3QA8A 4CZUA 2I6LA 3L9LA 1CKPA 2PU8A 4BWXA 1VYWA 3Q9WA 5IA1A 2WTCA 3HX4A 4F0GA 5L6OA 5GIPE 2B7AA 1PXKA 5LVNA 4YJUA 5LVOA 1WZYA 2OWBA 1P2AA 4QP1A 4QQ5A 4G3CA 4L52A 2XUUA 3UC4A 1FBNA 4EK3A 1NVQA 4ZSJA 5CEIA 3IGOA 4BBMA 3AD4A 2F49A 2GS6A 4AGWA 2XBJA 3OMVA 4DT8A 5LQFA 3S1HA 1O6YA 3LHJA 4TZRA 2W1CA 3K5VA 2WQEA 3BU6A 3QUDA 4RLLA 2C0TA 2KTYA 3QTZA 4WNOA 3PXYA 4D4YA 3RZFA 4L45A 3UO4A 3VRYA 2AYPA 4D2WA 3R1QA 2B52A 3OFMA 4ITJA 5HE0A 3AC3A 5FXSA 4BCKA 2Y4IC 4O7VA 2YM5A 4EYJA 3C7QA 4QMQA 1UWHA 4KNBA 4EH7A 3ZC6A 2C4GA 4LGGA 4I5MA 5M53A 5CSXA 4AZFA 3KN6A 3DXNA 3F7WA 4L7FA 3HV7A 5E8VA 3C4WA 1ZARA 2W7XA 4RJ6A 2G15A 1PKDA 2C5NA 3BYVA 2HW6A 4FKGA 3GC8A 2WQBA 4RLKA 5BYZA 5HIEA 3MW1A 3N4VA 3BV3A 4XJ0A 3ZLYA 2B4SB 3A61A 4F0IA 3MVMA 2ETRA 3EL7A 3TWJA 4YJSA 3TV4A 4BZOA 4BKZA 2Z8CA 2QOHA 3OTVA 2VNWA 4N6ZA 5HG7A 5IMXA 2IW8A 4FK3A 2WMBA 1WBOA 3ZO3A 3ZXZA 4IFCA 5I3RA 3EYHA 3DBDA 2XJ2A 3D2KA 4RX5A 2NYAA 2UW0A 3FBVA 2JFMA 5CLPA 4AZVA 3ANQA 3W8LA 1GZKA 1ZRZA 3R1SA 3KF4A 1OI9A 4FTRA 1WCCA 2QURA 3Q9XA 4RT7A 3H0ZA 4UMTA 3TCPA 2IO6A 5GZAA 3ET7A 2EWAA 2VTIA 5HG8A 4CFFA 4GW8A 4AF3A 3MTFA 4C35A 2PUUA 3CY2A 4UZHA 3KF7A 3VUIA 2VWWA 2GTMA 1TQPA 4X3FC 5KKRB 1XH4A 3QU0A 3WI6A 3MPAA 5CVHA 5BVEA 4YHJA 4KA3A 2PVYA 2PZPA 2ONLA 2XJ1A 2YJSA 3LQ8A 4CTCA 4EHVA 1X8BA 3CTHA 3NPCA 5LVPA 1F5QA 1IA8A 5CAVA 2C30A 2W1IA 4TTHB 4DH1A 2YCRA 2G9XA 1FGKA 2V22A 1VR2A 2YM6A 3G90X 3ACJA 4NIFB 2CJMA 2JAVA 1QMZA 2QOFA 4I20A 4IX3A 5DI1A 4B8LA 4BRXA 2PVLA 2WMUA 3KK9A 4JT3A 3PDTA 3QKLA 3FMKA 3BLQA 5DA3A 4KIOA 3TNWA 4I6LA 1ZOGA 4FEWA 2RL5A 3OBGA 2UZOA 5H8GA 2C69A 4BB4A 4CFWA 3QF9A 4JAJA 5IA3A 3G9NA 2Z2WA 3R1YA 3V8SA 4EK6A 4RZWA 4RX8A 5CALA 2J5FA 3E3PA 1R1WA 4FT9A 4RJ8A 4USEA 4I6HA 5IH4A 3R21A 3NFFB 5DR9A 5E4HA 4L9IA 4TYHB 1LP4A 5JRSA 4L7SA 4K2RA 2FSTX 4DH8A 2OZOA 4FZFB 4P5ZA 5TF9A 4JQ8A 3TV7A 3P86A 3EJ1A 5FM2A 4KS8A 3OD6X 1OKYA 3BGQA 1CKJA 3ZM4A 1YVJA 3BQCA 3IOPA 2IVUA 3ZYAA 4AU8A 1DAYA 1JSUA 4CTBA 2WIHA 3F6XA 5LXMA 3ROCA 5AR4A 2WB8A 4FKQA 5A3XA 4RJ5A 4GKHA 5EHLA 4GSBA 4NTSA 3ALOA 4CEGA 3V6RA 2W5AA 5CT7A 4HGSA 4D1SA 3D5XA 3RMFA 5M4CA 3W32A 4C38A 4USDA 2R3FA 3LMHA 3TIZA 3CQEA 2C3IB 3PTGA 4AACA 3PVBA 4D2VA 1YKRA 2CNQA 2EXMA 4R7IA 5AP5A 4RIXA 5A4LA 2XP2A 4UMPA 5BYYA 3ELJA 3FJQE 4I23A 3UIXA 4EEVA 4BF2A 3W0MA 4ERWA 2OICA 4IWOA 4EOOA 3W0QA 5CZHA 3VS7A 4U9AA 2YEXA 3U51A 3ORPA 4C02A 4E4XA 3AC2A 4RIYB 4BHZA 5KBQA 1GZNA 3R8ZA 3NAYA 5EG3A 1OPLA 4FTIA