2HZ4A

Abl kinase domain unligated and in complex with tetrahydrostaurosporine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
267
structure length
262
Chain Sequence
KWEMERTDITMKHKLGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biology contributions to the discovery of drugs to treat chronic myelogenous leukaemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
total genus 83
structure length 262
sequence length 267
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hz4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hz4A01
3M42A 2XIKA 5L6OA 3GC8A 3JY9A 4DC2A 3DBFA 2XJ2A 2GNHA 5ACKA 4FSNA 4RWLA 4CKRA 3Q9WA 4RIYA 1MQBA 2QURA 3MH0A 4ZLYA 3OCSA 4GV1A 4Y5HA 3QCXA 4FVPA 2XK3A 4FV8A 4DH5A 4AGCA 2X0GA 3Q9ZA 3QUEA 5IA3A 1M2PA 3MN3A 4BB4A 4G3EA 4IX6A 2QC6A 2GNFA 4MEDA 3D7TA 4CSVA 4DE4A 4ASXA 4C2VA 1PW2A 1F3MC 4BKJA 1Z9XA 3HRBA 4IE9A 3OOGA 3LLTA 4GJ3A 3CTQA 4NFMA 3NWWA 4L7FA 3VUKA 3QYWA 2BAQA 4F9CA 4FZFB 3U51A 4CMTA 4W4YA 1UU9A 2VTHA 1KWPA 1REJA 4CG8A 4CLJA 4ZSLA 1GZ8A 4FKVA 4L6QA 4DYMA 2W0JA 3LFQA 4FTIA 3GB2A 5AM7A 3UZPA 4ANMA 3ZXZA 3ELJA 3MH3A 2ZMCA 3RI1A 4GSBA 3V01A 4ZLZA 5IF1A 1YQJA 3UP7A 3FXXA 5I9YA 3EFKA 4XYFA 5IA2A 2I7QA 4OT5A 2GNGA 4HVIA 4A9TA 3JPVA 2OJFE 1DAYA 3HX4A 4O21A 5LVMA 2X2LA 4X7QA 4AZSA 4FI1A 4FNYA 4Y85A 5ETCA 5JRSA 3CCNA 4V01A 2B9FA 3KRLA 4BN1A 2WELA 4YBKA 2ACXA 3LCOA 1MRUA 3G33A 2XNGA 3LHJA 5EM5A 4WD5A 2OFVA 2H8HA 4NCTC 5HG5A 2XBAA 2XRUA 3R8ZA 4S31A 4Y83A 4S34A 3AD5A 3NNXA 2CGWA 3WIGA 3MI9A 3QLFA 3R21A 4EHGA 3F3UA 3RMFA 4I0RA 3K2LA 3NCGA 1S9JA 3MV5A 5D10A 3R6XA 5AP5A 1W82A 4GVJA 3K3IA 2CLXA 4EZ3A 4MCVA 4F1MA 4TYJA 1Z57A 2VWYA 4PQNA 5DT4A 5KNJA 2BDWA 3QD3A 3SX9A 3LQ8A 4KIKA 4L9IA 2XK7A 3CE3A 4I6FA 1SM2A 2QD9A 4DEHA 3QZHA 4UB7A 3FMLA 3HYHA 4GFMA 1PY5A 3A7HA 2UZDA 2P4IA 2PMLX 3BE2A 4KIKB 3VUMA 2Z7SA 4O7YA 2G9XA 5HTBA 5ICPA 3DQXA 2CKEA 4YPDA 5AFVA 4M97A 4RIXA 4HGEA 5HHWA 2VGOA 3DT1A 4QTAA 3O7LD 3MB6A 4CQEA 3L9LA 1ZXEA 3FZOA 3ODYX 5E9EA 4I24A 4EBWA 4BIEA 5HICA 4ANBA 5CEPA 5DT0A 4EEVA 1OUYA 2OG8A 1YW2A 3PLSA 3DK3A 3COHA 2I40A 5K9IA 4ALVA 3ZU7A 4KB8A 3DXQA 4K33A 4BICA 2HZIA 5HTIA 4BDIA 5FM2A 3MIYA 4IX4A 2BRNA 4RJ7A 3CGOA 1UVRA 5TOZA 5A6OA 5LMKA 2W1FA 1OB3A 4I3ZA 5BVWA 3RPYA 4IWQA 2VTOA 4J7BA 3M1SA 3PPZA 3GI3A 3SRVA 4CTBA 5IH6A 5GIPE 3GOPA 4OTHA 4YTCA 3BQCA 4BWXA 5ACBC 4HVHA 3DFCB 1SMHA 3A62A 5FTGA 1S9IA 3Q32A 1V1KA 4M84A 5H8EA 2ITOA 5EDPA 2PZIA 2UW6A 4LOPA 3VUDA 4AZVA 3ZFYA 4HNFA 3ZXTA 2W1GA 2UZTA 4EHEA 1FINA 4F1TA 5B2KA 4AACA 5JQ5A 2OH0E 3DTWA 4NW6A 2UZWE 4ACMA 4CFFA 3S00A 2DS1A 3MA3A 5HORA 3S0OA 2YACA 4MBIA 1H01A 2VD5A 3MFSA 1DI8A 5AV0A 4TYEA 1K3AA 1YWVA 4ITIA 5HKMA 4FSQA 5FG8A 5BUEA 3CPCA 2OF2A 2YWVA 4CLIA 2V7AA 3P5KA 4GT4A 2Z8CA 3COKA 3I7CA 2BVAA 3BKBA 1E1XA 4F6UA 3WARA 4CRLA 1P4OA 4FKIA 4IB3A 3D5WA 4RX9A 5ETAA 4DFXE 3EN6A 2EU9A 2W4OA 3P23A 4TW9A 4CRSA 2YITA 2Q0NA 3TUBA 3DBQA 4ALUA 4FVRA 2VZ6A 4PY1A 2UZVA 3LJ0A 2F7EE 3C7QA 3GEQA 4GUBA 4XG7A 2VWVA 4O6EA 4O0SA 4W8DA 3TCPA 4GIHA 2ZV2A 1U46A 3C9WA 1WAKA 3F69A 4D28A 1WVYA 3FLNC 4BCKA 1P14A 4F4PA 3Q2JA 4FSTA 2O64A 4C4EA 3FEGA 4FTCA 5CF8A 2HZ4A 3OZ6A 2JDVA 3G2FA 3QC9A 4L46A 5E92A 4EHZA 5AR2A 4AZWA 4WRGA 4E6DA 5H8GA 4ASEA 1BI7A 3KCKA 1Q99A 3KXXA 5AUVA 2YJSA 5LXMA 3TEIA 3KK8A 4D5HA 3ORIA 2RG5A 3FPMA 4X3FA 3NW5A 2UZEA 3DA6A 2QODA 3KMMA 4A06A 2V22A 1QCFA 3PSDA 4AGUA 4DEAA 2GS7A 2YLFA 4PTGA 4QQTA 3PA5A 4MNEB 4ZY6A 5F94A 5FWKK 4AZEA 2GDOA 2X4ZA 2GPHA 3JVRA 5AR4A 2C6MA 5L8LA 3P86A 3C5IA 3BHTA 3W18A 2BZJA 3PTGA 3DU8A 4U43A 3R1SA 4KUJA 4FMQA 4YHTA 4GT3A 4PPCA 5HVKA 2J2IB 3ZO4A 2GFCA 3LCSA 3ZO1A 5A4EA 5E8TA 4PX6A 2G01A 1OBDA 4YLJA 1MP8A 3JXWA 3UOLA 4AW1A 4YZNA 4TYIA 5AJQA 3UMXA 4AZFA 4YNEA 3OBJA 3UVRA 2FH9A 5GJFA 2GQGA 3HZTA 2B55A 4IC7A 3PA4A 5KMOA 1XH5A 4CEGA 4IC8A 1YHSA 3RP9A 4BCOA 5EQYA 4IDVA 2OIBA 3HVCA 3LVPA 4RC3A 2R4BA 3UDBA 3MVMA 3R1YA 5D41A 4BDHA 4H36A 4JIKA 3CBLA 4JAIA 2YLEA 2GCDA 4XV1A 3R8VA 2B4SB 3GP0A 4AF3A 2UV2A 5J5TA 4O7LA 1MRYA 4FTQA 5DRDA 5ANKA 5CEQA 4NTTA 4RLKA 4U41A 2C47A 3RHXA 4B6LA 4D1SA 4KIPA 4JLCA 1JKSA 3UNKA 3WILA 4IWPA 5IQIA 2HENA 1OIUA 4P4CA 4RWJA 3W2PA 4APCA 4FTRA 3TJDA 3Q53A 4W4VA 4BGHA 1B6CB 2W1DA 4FOBA 5HIBA 2BIYA 5ANOA 2BAJA 3UE4A 3UNJA 4TYGA 3VS5A 3TDVA 3TUCA 4D2TA 3I0OA 1FOTA 4FIHA 3SGCA 3EQRA 5J95A 5DH3A 5EM8A 4CT2A 3DZQA 3GT8A 4IW0A 5IQFA 5BVDA 4FUXA 4JBOA 4JRNA 4KWPA 3PXRA 5F20A 1JKLA 3QKKA 2I0VA 3EZVA 3QRIA 5B0XA 2ERKA 5CF5A 4L53A 4ZTMA 3GUBA 4FTTA 2R3HA 2QOFA 4D0WA 3THBA 5BVKA 3LW0A 4XLVA 3NUPA 4IAKA 3NUYA 4V0GA 4G3GA 4IEBA 3RK9A 4KKHA 4RA5A 3CGFA 4J71A 2W05A 4ZXTA 2E2BA 4R8QA 3TV6A 1NW1A 3MY1A 3WZDA 2QO2A 2R9SA 2H6DA 2WEIA 3FLZA 4O1OA 5HBJA 5GJGA 3E7VA 3PFQA 3PPKA 1ZOHA 3KGAA 4ZAUA 2PZPA 2QNJA 5DN3A 5E1SA 2C3KA 2F57A 3NLBA 1H8FA 3SOCA 5HQ0A 3A99A 4JQ8A 3LJ2A 5KZIA 4L52A 5B2LA 3E5AA 4LM5A 4MD7E 3F9NA 4QMVA 3QRTA 5K5XA 2RSVA 5M55A 5CAQA 2WQOA 3EYHA 4K18A 4AGWA 5EW8A 4IM2A 5AADA 4DH1A 3OD6X 3OUKA 1IA8A 4HYHA 3W8LA 3PPJA 4TTHB 2VTRA 4ZTSA 4N57A 4FTMA 1UV5A 3IG7A 1XHAA 5LJJA 2XKDA 4MH7A 1XH8A 2Q0BA 3DAJA 3QLGA 4KABA 3BU3A 1I44A 4I6HA 5KMJA 5EYDA 4PMTA 4F09A 3WF7A 2ZM4A 4H58A 2DWBA 3IOPA 4W4WA 3R7IA 3UJGA 1ZMVA 4FV4A 1W84A 3FI4A 4AAAA 4E5BA 2OZAB 4DEDA 5IEYA 3OXTA 3D83A 2QONA 2J0JA 4CD0A 3E87A 3GU4A 1R1WA 3KXGA 2YIYA 4XEYA 4JBPA 1SVEA 2V5QA 3AT2A 3POOA 1PMVA 2YIRA 2IVSA 3FUPA 4IACA 3GC7A 2ESMA 3DXNA 4I6BA 2XKEA 3PUPA 1XBBA 1YDTE 3TZ8A 3EQIA 1Y91A 4XG6A 3FQSA 3Q4TA 3DDQA 2WQNA 3KA0A 1UNLA 4E4XA 3ORTA 3TKHA 3LFEA 4DFYA 3U6HA 4NW5A 4IX3A 5CZIA 3ATSA 4C3FA 4BBEA 2R3FA 1YXXA 5CZHA 4BVUA 5F1ZA 3C13A 4IANA 1M2QA 4YJSA 4FV5A 2WTJA 3C4XA 4DG0E 2UW8A 4LOOA 5AR5A 4O0TA 4GYIA 4Z16A 3UPZA 3ZOSA 4YZBA 2BZKB 4EZ7A 5IISA 1ZARA 2AC3A 3Q6UA 5FXSA 4X2NA 5FBOA 4NM7A 3I6UA 2WOTA 4YZMA 1FVRA 1GIIA 4XV9A 4D4SA 1ND4A 4C7TA 1WMKA 3GC0A 3GU7A 3NR9A 3PJ1A 3ZSHA 4ZJIA 2JBPA 1KE5A 2C6OA 4BGGA 3LMHA 1F5QA 3KN5A 4QQJA 4WSQA 4M15A 2CKOA 4J52A 1H27A 4FNXA 3ANQA 3KULA 3V6RA 4EH3A 3BLRA 4MWHA 4F64A 4HYUA 3F61A 3GBZA 2ETRA 5K3YA 2VTIA 4FV3A 3W2SA 4ARKA 3TN8A 3UBDA 4C58A 3FYJX 4X3JA 3A8XA 1PXPA 4DGNA 1ZYLA 4YGAA 4O7ZA 3R02A 2QKRA 4XG9A 4YJUA 2G1TA 4LFIA 3P08A 4HPTE 4PDSA 5D7AA 3R7UA 5JGBA 4U5JA 4EH6A 4OGRA 3UVPA 4M67A 2VWZA 2GQSA 2X6EA 3QCSA 2W9FB 4FYOA 2PE0A 1WCCA 1WBPA 3IW7A 1MRVA 2PMOX 1J3HA 3KEXA 4FL1A 4RQKA 4Y72A 1V0PA 4ZIMA 1XKKA 2C0OA 1H24A 4KBCA 4H39A 3HGKA 4WBOA 1XQZA 3LFBA 3LFAA 2ITZA 5D11A 2PVJA 1OECA 2R3PA 3PG3A 4BCIA 5J5SA 2P55A 1GAGA 3C0HA 1L8TA 4U40A 4BDDA 5I3RA 4MNEA 4JX3A 4FKUA 4WG3A 4YJQA 4UN0C 1M17A 1IEPA 5DBXA 4QPMA 3V5JA 2C6LA 2UVXA 2HWPA 3TNIA 4H1JA 3VJNA 4CYIA 5IMEA 2YEXA 2OU7A 2Z7QA 2X7FA 3VWAA 3TI1A 4JRVA 4AX8A 5A4LA 3EHAA 3R7VA 4NEUA 4U3ZA 5M4FA 4TZRA 3NMUF 4RVTA 3RM7A 2CGVA 3GCUA 1YI3A 3NCZA 4QRCA 1GZOA 3UO6A 4MBJA 5C27A 4M68A 4UYNA 3K5VA 5M09A 5JFWA 3KRXA 3HRFA 4BI1A 5JFVA 2HZ0A 2CN8A 5CSHA 3VQHA 4CNHA 2HXLA 2BKKA 3I0QA 3P7AA 3LFSA 4ZMFA 4D2RA 3OS3A 4FA2A 4R5YA 4AN2A 1STCE 3BGZA 4AOIA 1K9AA 3R73A 2ONLA 4YMJA 4WRSA 2CKQA 2WMWA 3VRZA 4C4GA 3OF0A 1SNUA 3FC1X 4ANSA 2NRUA 5EYKA 3PVWA 5CF4A 2QO7A 4ZSEA 3ZONA 1YKRA 5HGIA 2OXDA 5A14A 3PWDA 2PUNA 1ZYDA 4O38A 1SVHA 2OF4A 3QTWA 4YJPA 3DBDA 4C38A 5BX0A 2PVKA 3B8RA 3DKOA 1KOBA 1YWRA 3KY2A 1NY3A 4ZSGA 3OHTA 4BBMA 4CKJA 4PWNA 5E7RA 4HW7A 5HIEA 4CG9A 1JNKA 2GS2A 3LQ5A 3QALE 2OXXA 5HU3A 2Z60A 3BHHA 3O7LB 5HU9A 4WIHA 2XH5A 4IXPA 5CTPA 3D7TB 3HV4A 5FTOA 1YXTA 5K0KA 3HLLA 2E9PA 4CZUA 5DE2A 5ANIA 4FTLA 3G6HA 3BYMA 3TKIA 3MFRA 4YJTA 3SOAA 3VBWA 4F7NA 4E5WA 5AUUA 3NVMB 3F5PA 4FG7A 4P90A 5CAVA 4U3YA 3ZUVA 4ENYA 1QL6A 4HCVA 4MQ2A 3VW8A 4B8LA 4DTAA 1XBCA 4YTIA 2R3RA 4YSJA 2WTDA 3R71A 3O8TA 1WBSA 4M0YA 2AUHA 2VWUA 2JDRA 3HP5A 2XF0A 1UWJA 5CALA 1YXSA 3QQHA 3OCGA 4QNYA 3FSFA 4YLKA 3D7ZA 3H3CA 4QMPA 4CZYB 4JXFA 4K9YA 4MYGA 4BZOA 2YZAA 4IX5A 4H05A 3H0ZA 4G16A 4EJNA 4OAVB 3SW7A 4EK4A 2NRYA 4G17A 2BMCA 3QD4A 4W8EA 3OG7A 4WO5A 4PMPA 1T45A 3F7ZA 1ZMUA 4JS8A 3SXFA 5G1XA 3ZDUA 2J0LA 3U6JA 3L8SA 3V5PA 1WBVA 2CLQA 5FUTA 5HD7A 1OZ1A 3WF9A 2GMXA 2X6DA 3LKMA 1IA9A 4IH8A 4TL0A 3BBWA 5AAFA 4EZ5A 5C4KA 2REIA 2BTSA 4BIDA 1AGWA 5C4LA 3I1AA 2ZMDA 2OJJA 3IW4A 5CSVA 2FYSA 3LM0A 3T3UA 3V3VA 3KCFA 2W4JA 3CD3A 4Z9LA 4YJVA 4BDKA 2VTSA 4CFXA 4DEBA 1IR3A 3RWQA 2G2FA 4P5QA 4FSWA 4OTIA 2OJIA 5HG7A 3FSKA 3FY2A 4BTJA 4FEVA 2IJMA 2Z02A 2C0TA 2R7IA 4JBQA 1A9UA 3MFUA 3Q5IA 4F65A 4O7NA 3BU6A 4U8ZA 2PWLA 3ZC5A 4UWCA 1U59A 1SVGA 4I20A 2LGCA 1FGKA 4QTBA 3JYAA 3W1FA 4I1ZA 2HW6A 1O6LA 2UZBA 3QQUA 3UQFA 3HUCA 2HYYA 1GNGA 2HZNA 1UWHA 2V0DA 2R0IA 4FKSA 3TZ9A 3UO4A 3QA8A 3ZBXA 4EWHA 2R3MA 2PSQA 4LG4A 3W2OA 3DKCA 2C5OA 3JY0A 3F3ZA 3MY0A 4BRXA 2VTPA 3QQGA 4DA5A 1DM2A 1FPUA 4FSUA 4U9AA 4XOYA 3ZUTA 4BCFA 5M53A 4HGSA 5M4IA 3U54A 3QHRA 4CKIA 3IW6A 3DJ7A 3KF7A 2DYLA 2XZSA 4FVQA 4XP3A 4EYMA 3C5UA 4EK8A 5FD2A 3AGMA 5HG8A 4FE2A 4ACDA 4OTPA 4CT1A 2WTIA 4FZ7A 2PVYA 4KSPA 2E9OA 3KXZA 3PXKA 5DOSA 1KE8A 1H4LA 2XEYA 4TNDA 1JVPP 4GVAA 2XIYA 4GK2A 5M06A 2R2PA 3V5WA 2R3KA 2YM8A 1UNGA 3LXKA 4OTRA 5HIDA 5J87A 3OXIA 3QRKA 4EBVA 4EQMA 5CI7A 3HV5A 3Q4ZA 2CSNA 2X2MA 2G2IA 5E8XA 3VULA 2C68A 5IQAA 4A4OA 3DBCA 4TNBA 4FBXA 3T9TA 4IB5A 4AT5A 5JN2A 5E91A 2XKCA 3UNZA 4ZTLA 4HYSA 4J1RA 4Q9ZA 3ZCLA 4YO4A 2WTKB 1IAJA 3B2TA 4USEA 4K11A 2JAVA 4QMSA 4ZZNA 4IAIA 5C26A 5DHJA 2OI4X 5BMSA 5L2WA 3JUHA 2BRGA 4U45A 3PXZA 4A07A 3GNIB 3CY2A 4GCJA 3RZFA 1L3RE 3I79A 4G3FA 4FV7A 3ZM4A 5JMSA 1JBPE 1SNXA 5CY3A 2W9ZB 3BI6A 5KHWA 3PJ8A 3WZUA 5CAOA 5CU6A 4FKTA 2A2AA 3E62A 2WMTA 1XBAA 3UO5A 3ZDIA 5IQDA 2R7BA 5IQHA 2UW0A 2CN5A 3LFCA 3SKCA 4KRCA 5DA3A 1FVTA 5HTCA 4XBUA 4JDHA 2VAGA 4I23A 5KX8A 5IH4A 3G9NA 4WBBB 3QTIA 3M2WA 4OAUC 3NYVA 3E64A 4NM5A 4EK5A 4IZYA 3LFNA 4GU9A 3TTIA 2J0IA 2ONLC 2J50A 2A4LA 2F2CB 3BLHA 3A61A 3KL8A 3PVUA 4X2KA 4LGHA 4D9TA 4JQEA 4XMOA 3KK9A 3GCQA 2GU8A 3H9FA 3LXNA 4G6OA 4L01A 4Q5EA 2PVLA 4TYHA 2X4FA 5IDNA 3QHWA 5A4TA 3R0TA 5L2SA 2RFSA 2NNWB 4YC3A 2PZRA 1YI4A 4D2SA 3KFAA 5C8NA 2BR1A 4JJRA 4OTWA 5DR2A 2QKWB 3H0YA 2OBJA 4RJ6A 4YLLA 1BKXA 4RJ5A 5KCVA 1Q3DA 1PXLA 4PV0A 2ETKA 3EJ1A 3FL4A 2W06A 2UW7A 1ZLTA 4D4RA 3R7OA 4AU8A 4CMUA 3LM5A 3SG8A 4MD8E 3W10A 1WBOA 4QMZA 5M08A 3MTLA 3F66A 2VO6A 3NUSA 5AUXA 4UMUA 2OKRA 4AN3A 2GTNA 5CXHA 3FI8A 5H2UA 3ALOA 3HV6A 4YJOA 1OVEA 2GTMA 5KBRA 4WG4A 4HGLA 2ITPA 5HVJA 2YAAA 5HLWA 1YOJA 1BMKA 2GFSA 4TT7A 4NJDA 2X7GA 5A4QA 3AC8A 1WFCA 4I93A 4RJ3A 4F99A 2W1IA 3MJ2A 3EKNA 1REKA 4AA4A 5M4UA 3PXYA 3RINA 3A4PA 4DAWA 3ORPA 4D58A 2QOQA 5HO7A 4U81A 3EIDA 4YO6A 4F6WA 2A0CX 3BZ3A 2HXQA 2PUIA 3E92A 1G3NA 3O17A 2WFYA 5I9XA 1XH9A 4WKQA 2BZIB 2UZNA 4AOJA 4M66A 2J5FA 2YDIA 5FBNC 4LGGA 4HCUA 2PTKA 5CEIA 1PJKA 1HCKA 3ZYAA 3WYYA 5AAEA 4PL5A 5E8SA 2QOCA 2B54A 5J8IA 2WU7A 3QZFA 5GIOE 2WIPA 2G15A 1PMUA 2WGJA 4L68A 2BAKA 2ZDTA 1H07A 5T6KA 2X9FA 4M69A 4BCNA 4ASDA 5HBEA 4DGGA 1MUOA 4BCPA 4U6RA 4X3FC 3ATTA 5AEPA 4RC4A 5AR3A 2XKFA 3NUXA 4FIEA 2ZV9A 5A54A 4P5ZA 5B2MA 2VWWA 3NUUA 4FV0A 4IMYA 5IZFA 4MQ1A 4EC8A 1M7NA 1V0BA 3ZUUA 2VTAA 5HZNA 2YIQA 1Y8GA 2C0IA 2WTKC 2YM5A 4R3RA 5ETIA 5IA5A 3S2PA 4O7TA 2HAKA 2UW3A 2C69A 3QC4A 4FT7A 1XJDA 4D1ZA 4PRJA 3RPVA 5AA9A 3IONA 1GZKA 4EH7A 1DAWA 4FZAB 2ZB1A 4EOPA 5L4QA 1WVXA 4MWIA 3R8UA 3UOHA 2XM9A 1PMEA 3LJ1A 4D9UA 4FK6A 4DTKA 4EWQA 2B9JA 3HMOA 2R0UA 1BI8A 5CU0A 2QCSA 3RPSA 3FMJA 3ROCA 4RPVA 2B7AA 4B4LA 2F4JA 1R78A 3WYXA 2E9UA 4A9SA 4EH9A 1URCA 2YAKA 3EN9A 4PTCA 3BE9A 1Q8TA 4GK3A 3DPKA 4BCJA 3OCTA 2VTJA 3QD0A 4FEXA 2PVRA 3FZSA 1XWSA 4BDAA 4RQVA 3COMA 1J7LA 5F95A 5ANDA 2BRMA 2R5TA 3VC4A 4C8BA 3ZRKA 5HX8A 2ZM1A 1V0OA 1NT2A 4MXXA 3RJCA 5J9YA 2FA2A 3LOKA 4ZJVA 4EQUA 4FV9A 5IMXA 5EKNA 3FLSA 3IDCA 4HZSA 2WMXA 2PY3A 2VWBA 3RK7A 5EW3A 3FDNA 4AA5A 4E73A 5IPJA 2OJGA 3AMYA 3A60A 3BYOA 3PVBA 4I92A 4GIIA 4L8MA 3KKVA 1H28A 3V8WA 2ZOQA 5M44A 4UMPA 3TG1A 4EJ7A 2PE2A 4DEIA 3NW6A 4NFNA 4AUAA 4ONAA 3IS5A 1JSTA 3CKWA 4IWOA 2ITUA 5J9ZA 1CSNA 3LPBA 2FO0A 3R30A 2VRXA 4Y5QA 1KE7A 2HY0A 1NVSA 3MFTA 2J0MB 3AC2A 3AXWA 3PYYA 4O0WA 4QMXA 5C9CA 2ZAZA 2W96B 5DT3A 4FSYA 4GFGA 4BGQA 2PUUA 5GZ9A 1Q8UA 3OY1A 3PRIA 5JH6A 2O3PA 4KBAA 3MS9A 5JZNA 2F7ZE 3W2RA 3UPXA 3PZHA 3OWPA 2HWOA 1WBWA 2OH4A 3IGOA 5AP4A 1OPJA 2OZAA 4O1PA 2OXYA 2PVHA 4KA3A 4F08A 3IQ7A 3WZEA 3BGQA 3F88A 4J99A 3UG1A 4NM3A 2BZHB 4L7SA 2CGUA 1OI9A 4ZTRA 1P5EA 2W99B 1ZYCA 1CMKE 1G8SA 5E1EA 3EOCA 4AT3A 2JLDA 5HO8A 2C3LA 4IWDA 1YWNA 1XH6A 2B52A 2PUPA 3G0EA 3FE3A 5EYCA 4E4NA 2C5NA 2OWBA 1P2AA 3QTUA 4MTAA 2PULA 4JR3A 5L2QA 4IM0A 4J97A 2QLQA 4J98A 5LVNA 4R1VA 3FMNA 4BTMA 5IA1A 4FTNA 1H1WA 3PP0A 3PWYA 4DLJA 2O2UA 1U54B 4I41A 3REPA 1H1SA 1B38A 3SAYA 4QQ5A 5I4NA 3IPHA 2YDKA 3SC1A 1KV1A 4K0YA 4NM0A 4F0FA 4I4EA 3PA3A 2JDTA 5EM7A 3LMIA 5KKRB 4O81A 4YZ9A 3K5UA 3IDPA 4EKKA 1KUTA 1ZYSA 3WI6A 5FLFA 3RNYA 5IQGA 2WHBA 1H08A 4XV3A 5AIRA 1YXUA 2O65A 5C01A 2X9EA 3VS6A 2YCRA 4NKSA 4ZLOA 1T46A 3R9RA 4LV8A 4L45A 3IGGA 3LXLA 5DR6A 3FMEA 3CEKA 2BHEA 2WTCA 3QBNA 4OT6A 5E8ZA 3WIKA 3CJFA 3MVLA 1CM8A 2CDZA 3H9RA 2XNBA 2EXEA 4PL4A 4QQCA 4WNKA 3EQGA 3RAWA 1E9HA 4CFNA 2BILB 2E9VA 3UYTA 4AE9A 4DF3A 3ZSIA 1QPDA 2BTRA 2J0KA 5AUYA 3EQDA 1UA2A 3VBQA 4ZJJA 4NIFA 3KU2A 3Q4CA 4H3BA 1UU7A 3DS6A 4RJ8A 4ZTQA 2QU6A 4MAOA 5CEKA 1CKPA 4ZEGA 3MESA 2IG7A 3RM6A 2CGXA 5ANEA 3HMPA 4BF2A 1NA7A 3H30A 3SRVB 4A4LA 3T8OA 3W55A 3NVKI 3G0FA 4OBPA 4BYIA 1G8AA 3QCYA 4G9RA 4JI9A 5CANA 2FSTX 5IUHA 5A3XA 5CQWA 1LUFA 3R22A 4XRLA 4IBMA 3R1NA 1H25A 3OWKA 3QQLA 4AZTA 3Q52A 4R5SA 2ERZE 3FQEA 3OOMA 2CPKE 2YM4A 4DG3E 3LQ3A 3R9NA 4FTOA 2WQBA 3NS9A 3ORXA 4IZ7A 3IO7A 2EXMA 2FSOX 4C4IA 4FGRA 3EFJA 5LCKA 5C8KA 4LUDA 3AC3A 4NT4A 2R3GA 5IDPA 4BZNA 3BCEA 4IAZA 1Q24A 3DKFA 4C2WA 4ZS4A 3EN7A 4U42A 2KTYA 2IVUA 5CAUA 4M12A 4EOOA 2C1BA 1RQQA 4ANNA 3FL5A 4O7SA 4GG5A 3P1AA 3ZLSA 5A46A 4MXZA 4YP8A 2VN9A 3TTJA 4AW2A 4QMWA 5GNKA 4I0TA 3BWFA 4M3QA 5J9LA 3OT8A 2RFNA 2Y7JA 2UUEA 3BQRA 2PVNA 1PXJA 2Q83A 4L3JA 4XCUA 3ANRA 3A7IA 4DEGA 3EN4A 4OTGA 4B8MA 4RFMA 4RIXB 4YZCA 1NXKA 3PLAE 3I60A 3C51A 3GCSA 3V51A 3ENMA 4KKEA 4NTSA 2QR8A 4BR3A 1PKDA 3A4OX 3CIKA 4AFJA 4D55A 4GKIA 3NUNA 3LFFA 3QA0A 1Q61A 3FQHA 1NVRA 2C6DA 3OXZA 2XIZA 3Q04A 2JIVA 3FHRA 3RTPA 4IZAA 3VW6A 3MJ1A 4FX3A 4MXAA 3QTQA 3OC1A 3ZLYA 1WBNA 4YHFA 4J8NA 5B7VA 4K2RA 3U4WA 4TKSA 3B2WA 2QOIA 3UIMA 3DTCA 5T3QA 5JRQA 5BVOA 1OL5A 5AMNA 5HOAA 2QG7A 3PJ2A 4F9YA 2J7TA 2VTLA 3MA6A 3VS0A 2QHMA 4YZDA 2W5HA 3CQUA 4EORA 2CCIA 4EUTA 4RIWB 5CEMA 5L6WL 4OW8A 2FSLX 2X7OA 3FZ1A 4TXCA 5AR7A 1WZYA 3E7OA 4E20A 2BKZA 3TKUA 4FKQA 3ZZWA 3PJCA 3BGPA 4F1OA 4GH2A 1A48A 4UALA 5E8UA 3SA0A 3OY3A 3L9NA 1BUHA 4HVSA 2PK9A 2WO6A 1A06A 3P9JA 4FT5A 3U8WA 3DZOA 4JQ7A 3ORLA 3BHUA 2QLUA 4FYNA 5C8MA 5I5ZA 3AGLA 4BCQA 2UZLA 4CV9A 2AC5A 1JSVA 3HL7A 3D5XA 4C59A 4ZZOA 4IAAA 4DINA 4TY1A 1H1QA 2IN6A 4TPTA 5HX6A 4WT6A 3Q9YA 2JC6A 5LWNA 3QCQA 4R78A 5KMMA 1OBGA 5BMMA 1FGIA 5A4CA 2X8DA 4WUNA 3NAXA 4B0GA 1YI6A 5IH5A 3BPRA 4AW5A 2YIXA 1OKZA 2XJ0A 4PF4A 5BPYA 4C34A 2QI8A 4QMQA 5DNRA 1YDRE 3AD4A 4ZY4A 3ZSGA 3E8EA 4Z55A 5I9WA 4G31A 2UW5A 4C35A 5LWMA 1CDKA 3E8DA 4XRJA 1O6YA 2ITXA 5LVLA 1ZOEA 4JNWA 1PRYA 1PXMA 3WE8A 5KMLA 1ZRZA 3L9MA 3I5ZA 2HW7A 2YZLA 4I0SA 4OTDA 2IO6A 3DKGA 4RWIA 3RK5A 5IQBA 3PDTA 5AP3A 2WNTA 3BYSA 2W1ZA 3LIJA 3F2AA 3GCPA 4YUQA 3MWUA 5JFSA 3IW8A 3OWJA 4RIYB 3R7EA 3EN5A 2P3GX 4M69B 3EKKA 4ITHA 4D1XA 4W4XA 1H1PA 1W98A 3DCVA 3RPOA 1R0PA 4IVDA 5JGDA 2JDOA 5EQPA 4GYGA 3ZC6A 3E8CA 4IJ9A 4II5A 3Q4UA 3QX4A 5FP6A 2YM7A 4ZZMA 5TO8A 4MF1A 2WEVA 4B7TA 5AP7A 3VUGA 2XYNA 3E8NA 3M11A 1H0WA 2VNWA 4LV5A 2Y6MA 3LE6A 5HEZA 4EH4A 4R7BA 3RWPA 4WNPA 5EI2A 5HE2A 5KE0A 4BHNA 3P78A 5BVEA 4NL0A 4KS8A 4DN5A 2C6TA 4EHVA 3A7FA 3DJ5A 1M52A 2Z7LA 4FNZA 2BALA 3QTXA 3FHIA 1LPUA 4G5PA 4MD9E 4O82A 3CXWA 2HY81 4BKYA 4C4JA 3QQJA 5E8VA 3TNQB 4Y46A 3OTVA 3CQWA 3UOKA 5KKRC 2WMVA 3TT0A 4NZWB 4QP4A 1OPLA 4FTJA 3CP9A 3DDPA 4Y8DA 3ZEPA 3DGKA 2YM3A 3V5QA 3W2CA 3KXNA 5JZJA 3FI2A 3DLSA 2B0QA 3CQEA 3RZBA 5H3QA 4CFWA 3ZEWA 4L42A 1AD5A 3H10A 1RW8A 2O8YA 2XJ1A 3BU5A 4FIFA 5AA8A 1APME 4QP8A 1ZOGA 1Y8YA 2VUWA 3O0GA 2I1MA 4JT3A 3FXZA 2OLCA 4DLIA 1GZNA 2W7XA 3PJ3A 5BYZA 3QWJA 4U79A 3WZJA 4D2WA 2JITA 3MVHA 3ETAA 1OL1A 2CMWA 4GW8A 4O91A 1ATPE 5D9HA 2EWAA 3D14A 3BWJA 4ERKA 1B39A 4L44A 2R3JA 2ZV8A 3Q6WA 4BDGA 2IZUA 4JX7A 2VTNA 3ORNA 3HA6A 5AP6A 2GQRA 1OL7A 5EQEA 1UKHA 5DI1A 1GIHA 4RSSA 4HPUE 2VX3A 4LRKA 5AWMA 4E93A 3W2QA 2XNEA 4KKGA 3WF5A 4X0MA 4DFNA 2P2HA 4PDYA 3GQIA 1J7UA 3II5A 4FIGA 1KSWA 4LI5A 4E1ZA 4UWYA 4D5KA 2DQ7X 3TNPC 2XNNA 2BROA 4C37A 5JFXA 1PKGA 3R28A 3F2RA 2PZ5A 4ZMEA 5DFPA 4BTKA 1UU3A 1UNHA 4YSMA 5FGKA 2F49A 3C1XA 1FMKA 3PRFA 4FSRA 4DH8A 3GGFA 3D2IA 2HCKA 4NYEA 3QX2A 4O0VA 3FYKX 2FUMA 3EH9A 4XS2A 2AYPA 4F0IA 3ZRMA 5M57A 5HCXA 4UMTA 2X81A 4NSTA 3QAME 5HVYA 1PHKA 5L3AA 4EH2A 5HI2A 3WBLA 1Q3WA 4FEQA 4DH3A 5EOLA 1O6KA 3VS4A 4IIRA 2XIRA 2XK8A 5CYIA 2WMBA 3K3JA 3LMGA 3CR0A 4MXYA 4XX9A 2J51A 4LRMA 4R3CA 4RVKA 2VX0A 4X6RA 4G9CA 4HVDA 4TYHB 4XG8A 3CD8A 4BDJA 4O96A 5L8JA 2JKKA 4IZ5A 4KS7A 4HJOA 2YM6A 3KXHA 5CNNA 2DUVA 2IVVA 5EHYA 1OMWA 4OLIA 4CYJA 5CSPA 5CSXA 3R7GA 3TV4A 3O8UA 3RGFA 1XO2B 3MVJA 4Q5HA 4PDOA 4NIFB 3BYVA 2GNIA 5LOHA 3JR1A 3GCVA 2W1CA 4IVCA 1UU8A 2YIWA 5J1VA 3E3PA 3Q3BA 5LARA 4YTHA 1J7IA 2XCKA 4FSMA 5DPVA 4ZTNA 3JS2A 3AT4A 1VJYA 3DV3A 4CFVA 4I5MA 4FKRA 1YOLA 3PSBA 4U97A 4EH5A 2RL5A 4YU2A 5AAGA 2I0HA 4BCMA 1ZY4A 2X1NA 4FICA 3SQQA 3FKNA 4A7CA 3VIDA 4CVAA 2C6KA 4I5CA 4JL9A 4RA4A 4BDCA 5F9EA 4QO9A 4CCBA 5IUIA 4ERWA 3R1QA 2VNYA 2F7XE 3F82A 4AQCA 3FY0A 4MK0A 4QMUA 1J1BA 4H3PA 4DCAA 4QYYA 5IQCA 4O0UA 3HECA 3NNVA 3ULIA 5D7VA 4QNAA 5CF6A 3U6IA 5J1WA 2EUFB 2OGVA 2X8EA 4TWNA 3N4UA 3DLZA 4H3QA 4FF8A 4BFMA 3V8TA 3EQBA 1JKKA 3FMDA 5EI6A 4IVBA 4U7ZA 2WMRA 4LQMA 3BHYA 3UIUA 4DEEA 3UG2A 3UODA 2VTMA 3OFMA 4WNMA 3ALNA 3A7GA 4AT4A 1RDQE 4OR5A 3R83A 5CQUA 2FSMX 3QD2B 4FSZA 5C03A 4P2KA 5E8YA 3W32A 3ZM9A 5E4HA 1ZYJA 1XH7A 4IB0A 2RF9A 2OW3A 3BBTB 4GU6A 2W1EA 2RG6A 2C6IA 4RC2A 4UWBA 3VS3A 4O2PA 5KZ0A 4F9WA 3MY5A 4FG9A 3RNIA 3ZLWA 3P0MA 4O86A 2QOOA 3PY0A 3N51A 2C3JA 5AP2A 4J8MA 3RCDA 3UQCA 3OT3A 4J96A 3UC4A 4KSQA 3LCKA 4MKCA 5HG9A 3P4KA 5HESA 2J9MA 1U5QA 2QOHA 3CLYA 3GC9A 5TE0A 4QD6A 1IAHA 4APPA 4RRVA 1X8BA 2VO7A 4ZS0A 3F5XA 2WIHA 3VF9A 4FIIA 3U4UA 4BCGA 4ASZA 5IEXA 3CKXA 3Q96A 3ZRLA 4LRJA 1IASA 4O2ZA 4E3CA 1U54A 2RKUA 4BWPA 4FODA 4QT1A 3VHEA 4ANLA 3QUPA 4AA0A 1M2RA 1M14A 3FMKA 3MB7A 2HOGA 2JFMA 4IAFA 3RALA 4JIAA 1Q62A 4FKPA 1OKVA 3P79A 5TF9A 2ITQA 3VBXA 4QMLA 4WHZA 4RX8A 3EB0A 3R2BA 4L00A 2IWIA 5BUIA 5KUPA 5D12A 4DBXA 1JKTA 2IZRA 3BRBA 4R7IA 4NH1A 1U4DA 3HP2A 3DK7A 4YPSA 3AT3A 3EWHA 2EVAA 2XB7A 2XEZA 4QTEA 1OM1A 4QMOA 4H1MA 2J5EA 3PIXA 3QXPA 3T9IA 4DCEA 2G2HA 5E90A 3ZZEA 2VTQA 5FDPA 3HRCA 2WMAA 3EQPA 3C4ZA 4YC6A 1PYEA 2GHLA 2WQMA 3FLYA 5CX9A 3VO3A 2VV9A 3O23A 4FIJA 1IG1A 2QOBA 4BTFA 4ZP5A 1ZAOA 1FQ1B 3AC5A 3PXQA 3QQFA 2WQEA 5BUJA 3HV7A 3NW7A 3R00A 4D4VA 5A6NA 3OEZA 4MXOA 3RAIA 4HNIA 1PXOA 3KRWA 3PE1A 5AIKA 3TM0A 4IDTA 3EL8A 4NCTA 1QPJA 3WZKA 4C62A 4CFUA 3PSCA 5DVRA 5IUGA 4F6SA 1DI9A 1YHVA 3DB8A 4FUYA 2XIXA 3F3WA 3TV7A 1BL6A 5HLPA 4MNFA 4QP1A 4C0TA 4X3FB 5BQ0A 5CU2A 1CKIA 1Q4LA 4PP9A 3Q5ZA 3HMMA 1YXVA 4XG3A 4UZDA 5KMIA 4UX9A 5CLPA 1Z5MA 3JVSA 1RJBA 2GS6A 2J90A 3BEGA 5DIAA 2R64A 4O84A 4W9WA 4YJRA 2PHKA 3POZA 2XCHA 3EMGA 3QZGA 4QYHA 2JKOA 5CI6A 5FEDA 5DG5A 5AUZA 3D15A 3DB6A 5H8BA 4L3PA 4QPSA 3R8MA 5IA4A 4RVLA 2H34A 5LCJA 3D94A 3TNWA 4PNIA 4O7VA 3LFDA 1MQ4A 2PVFA 3KC3A 4GMYA 5EKOA 4EOKA 4X2GA 2IZSA 2IVTA 1GIJA 4WUAA 3VJOA 4BIBA 5AP0A 5CENA 5M51A 3UC3A 4FL2A 4AGDA 4EYJA 2ITNA 4TRLA 3C50A 2HK5A 4LYNA 4QP7A 3ACKA 4HZRA 4OUCA 2VWIA 1JAMA 3GU6A 4PTEA 1VYWA 4AW0A 5K4IA 3V5LA 4D2VA 3AC1A 1H00A 3FWQA 2GHMA 3FPQA 4PL3A 3ID6C 3KULB 1K2PA 3R9HA 4IQ6A 4K1BA 3TL8A 4NJ3A 4G34A 4EI4A 5M4CA 1OL6A 4PPAA 5JSMA 3ZLXA 2RFDA 1YVJA 3I6WA 2BRHA 2XP2A 2XNMA 4XUFA 5CVGA 3VS2A 4JOAA 1DS5A 3C4EA 3KRJA 3EQHA 4AE6A 4USDA 4S32A 2PL0A 4N6ZA 5CWZA 2WU6A 2XUUA 5CS6A 2YHVA 3V5TA 4FTAA 3L9PA 5LMKC 5L6PA 4ZSJA 3PXFA 2IZTA 1LP4A 2QU5A 2YCFA 4M13A 3QGYA 1KV2A 2PVMA 2WZJA 3MPTA 4I22A 5AUTA 3CJGA 1GJOA 1H26A 3F7WA 3MPAA 3QKLA 3SXSA 3KB7A 4D2PA 3QZIA 3E3BX 4UBAA 2WPAA 3CSVA 2B9IA 4RVMA 5CNOA 3RPRA 3TIYA 5EOBA 2PPQA 3PIYA 1NVQA 3CPBA 3GQLA 2QVSE 2ZVAA 3Q9XA 4PUZA 2W1HA 4IADA 3FLQA 4Q2AA 5K4JA 2EB2A 4KBKA 4B99A 2YFXA 1ZWSA 3RVGA 3PIZA 3C0IA 2C30A 3F2NA 3Q60A 3AMAA 2H96A 4F7JA 1XR1A 2FGIA 3LCDA 5CU4A 4K6ZA 3IKAA 4DBNA 2ZB0A 4GFOA 1P4FA 2X39A 3NGAA 3R8LA 1VYZA 4I4FA 4ALWA 4UEUA 4UMRA 4OTFA 2CNUA 3FKLA 5JKGA 5M56A 3R04A 4U0IA 1WVWA 2W4KA 4JDKA 5CSWA 5EYMA 5IU2A 4F0GA 5M07A 5JT2A 3S4QA 4B9DA 4YTFA 2BDJA 3F6XA 4FKGA 4BDFA 5GZ8A 1YRPA 3SHEA 2O63A 4Z7GA 4FKLA 2OK1A 1IRKA 3L1SA 2WAJA 2Z7RA 3AQVA 4L67A 4TWOA 3Q2MA 5CT7A 3C0GA 4E4MA 3NPCA 1W8CA 4ANQA 2CHLA 3VUTA 4C4FA 2ITYA 3ULZA 3IDBA 2IW8A 1OUKA 4V0GB 5FTQA 1TVOA 2RFEA 4QP2A 2Y8OA 3RCJA 4C4HA 2VU3A 3E93A 2UW4A 5GZAA 3KMUA 4M14A 4K8AA 4PMMA 2QOLA 3VAPA 3QYZA 1FVVA 1VZOA 4E5AX 1OIQA 5BYLA 3GFWA 4XJ0A 3QGWA 4GT5A 4C3RA 1YDSE 5EM6A 2OO8X 3FBVA 4PDPA 2UVZA 2ZJWA 4JDIA 1ZZLA 3I81A 4V04A 3MH2A 3HEGA 3VBYA 5KO1A 3N4VA 4DHFA 3AC4A 3QF9A 4QP6A 4R77A 4C61A 4O7WA 1R0EA 5KBQA 3FZRA 3MYGA 3PG1A 5KMKA 2F2UA 2I0EA 1OKWA 5CVHA 3L8VA 2WMSA 1TQPA 1LEWA 4CTCA 5BYYA 1BYGA 4BZDA 4YURA 2V55A 2YISA 3RAHA 3WOWA 5IG1A 5G6VA 2A19B 4WOVA 3C4FA 4D0XA 2R3LA 4MVFA 1H1RA 4FTKA 3O8PA 1PMNA 3U9NA 4M7IA 5AV2A 4RIWA 4BC6A 5GJDA 4F63A 3VS1A 2B1PA 3HA8A 4RJ4A 1W83A 5FXQA 4E8AA 3W16A 3R9OA 2VGPA 2V7OA 3NEWA 3KN6A 3EFLA 2OFUA 3HDNA 3IECA 4JG8A 5FRIA 4WA9A 4W9XA 4I94A 4KINA 2XVDA 4DT8A 2FB8A 5JK3A 3KREA 3VBTA 2JIIA 4O27B 3QTSA 3NX8A 1R39A 2YA9A 3C4WA 3BEAA 4QMMA 3ZHPC 2F9GA 4ANOA 4EOIA 5BNJA 4FEWA 4XLIA 4I6QA 2J4ZA 2UVYA 5HNIX 2JKQA 3WE4A 3U87A 1JSUA 4X2JA 5HE1A 3FI3A 1GOLA 4C02A 3V6SA 5I0BA 3MPMA 2Y0AA 4G6LA 3F3TA 2XK9A 2GHGA 4C3PA 2QHNA 3H4JA 3UQGA 4EOSA 4JBVA 2X8IA 3VN9A 1YOMA 4BHZA 2ITVA 4GL9A 5L2IA 5BVNA 3PY1A 2NO3A 2YERA 2Y6OA 4V05A 5HCYA 5L8KA 1Q8ZA 5AX9A 4S2ZA 3WF6A 3PE2A 3MDYA 4WSYA 3DNDA 2OIQA 4F7SA 4ITJA 4JG6A 5CT0A 3DK6A 4FV2A 3FZPA 3ODZX 4MBLA 4R1YA 3WF8A 3O2MA 3HMIA 3FMMA 4FT0A 3QRJA 1QPCA 4LUEA 2YN8A 3CC6A 3S95A 3TJCA 4DFZE 2ZYBA 5BVFA 3SG9A 5DEWA 5L2TA 4FOCA 5A9UA 2JFLA 1QPEA 2Z2WA 3UGCA 4UYAA 5LMAA 1OGUA 1AQ1A 4N4SA 1BX6A 1UKIA 2X2KA 3UMWA 5K0XA 4XH6A 4RT7A 3D2KA 3DY7A 2W17A 4S33A 4CQGA 4RWKA 4PNKA 4PP7A 5EH0A 4GRBA 4M8TA 2JDSA 1Q41A 4QMYA 3NUAA 3DBEA 3TIZA 3BELA 3QKMA 3CS9A 1W0XC 3NYOA 3FZTA 4XG4A 3U55A 2JBOA 4FL3A 4GK4A 5EHOA 3C4CA 2P0CA 3ZO3A 4DITA 2PMNX 4LGDA 3EZRA 4MHAA 4QTDA 4LMNA 4OBQA 2CNQA 2XA4A 4I21A 5DWRA 2XK6A 4M0ZA 3G5DA 3KQ7A 3UOJA 3AG9A 4HVGA 1OITA 2ZV7A 5LQFA 4L3LA 4CXAA 4RIOA 5GINE 2GNJA 3OCBA 2C5VA 4N6YA 3D5UA 5I3OA 3VQUA 4G2FA 4F9AA 5J79A 4FZ6A 2A27A 3GXLA 2R3QA 3QFVA 1G5SA 2YJRA 1PYXA 2C5YA 3MTFA 1EH4A 1PXKA 3RBWA 1VEBA 1VR2A 2XS0A 5CU3A 3BIZA 1JWHA 4TWPA 5EG3A 5AV3A 4C57A 2OIDA 5J7BA 4JVGA 1FBNA 4U80A 4NWMA 5FEQA 5JEBA 3LZBA 3DXPA 3R2YA 4FGBA 4DFLA 3O50A 3DOGA 5J7HA 4O6LA 3TDWA 4HCTA 4PMSA 2Y4PA 4CV8A 1I09A 3SD0A 3GU5A 4GS6A 4EH8A 5DGZA 3P7CA 3G6GA 4FZDB 3UYSA 3PY3A 3BLQA 3D5VA 2VWXA 3ITZA 2Y4IB 4DGLC 3GFEA 3NYNA 3D4QA 3QUDA 3A8WA 3N9XA 1F0QA 4FT3A 4AS0A 3ZFMA 1CTPE 3T3VA 3ZBFA 5CASA 2BHHA 3TZMA 3KVWA 4TN6A 3EL7A 2XM8A 4G3CA 3ZFXA 4C33A 2JKMA 1TKIA 3CTHA 5C1QB 2BIKB 2C4GA 2VO0A 2BRBA 3PVGA 4E4LA 2WTWA 3SLSA 2XMYA 4RGJA 4BDEA 5KMNA 2SRCA 2WMUA 3CY3A 4BDBA 2CKPA 3DNEA 4WNOA 5EDRA 1U5RA 2OJ9A 4A4XA 1QMZA 3QWKA 4ZOGA 4RFZA 2ETMA 2RIOA 3G9LX 3I5NA 5DLSA 2B53A 4ACCA 4AFEA 5IEVA 2IPXA 4EUUA 3BHVA 1Q8WA 3MBLA 4DTBA 4KAOA 2QQ7A 4NUSA 3GENA 4UV0A 5AV1A 4FTUA 5EDQA 4RFYA 4FNWA 2QG5A 5HCZA 4LMUA 5DMZA 4AN9A 3PZEA 4RZVA 4A9RA 3FKOA 4QP3A 2GNLA 5DEYA 3G51A 3TNHA 4AP7A 5EFQA 4ZSAA 4FR4A 4ACGA 3AOXA 4OBOA 3VRYA 1JLUE 3TZ7A 5T68A 4EOQA 4BI0A 1KOAA 2BUJA 3NNWA 3ROYA 4IM3A 4Y95A 5IQEA 3OW4A 1W7HA 5KHXA 1R3CA 3GU8A 5D1JA 1Y57A 5LMBA 2WOUA 2WB8A 1WBTA 2BFXA 2CCHA 4WG5A 1J91A 3GVUA 3W33A 3KXMA 4Z3VA 3O96A 2VO3A 4LOQA 3QTRA 4EQCA 3KMWA 2OICA 3UVQA 2UZUE 3LCTA 4GG7A 3RHKA 4KIQA 3V8SA 1CKJA 4BY9E 4XG2A 1HOWA 4MF0A 3SDJA 1RE8A 2VTTA 3G90X 3FV8A 3OUNB 4FC0A 4R3PA 5HE3A 2I0YA 4Y73A 5TT7A 4UXQA 5TR6A 3VS7A 4E6AA 4XNEA 3NRMA 4X2FA 4ORKA 2I6LA 4KIOA 2W5AA 2BPMA 3VUHA 4XP0A 4XV2A 5HNGA 3VVHA 3HV3A 4IHPA 1TQIA 3KVXA 2XNPA 4NU1A 3QTZA 4YNOA 2C1AA 4G5JA 5ANJA 3ZS5A 4IAYA 4AG8A 4DFUA 2BDFA 4FK3A 4RMZA 4R7HA 3FLWA 4EOLA 3ET7A 3NIEA 4FEUA 3RAKA 3S1HA 4G6NA 3TACA 3VF8A 3L8XA 1OL2A 3D9VA 2A1AB 3O71A 2QOKA 3HUBA 3HKOA 5EI8A 4EONA 3ORZA 5AUWA 2PE1A 4QYGA 3ZH8A 2KULA 4EOJA 4FT9A 2LAVA 4DGMA 4DH7A 5AP1A 1KE6A 2RGPA 4QP9A 3MSSA 4EK6A 3K54A 3HNGA 4GUEA 4PPBA 3LXPA 4RX7A 5H9BA 5HD4A 4RX5A 3ZO2A 4BCHA 2P2IA 2YDJA 5LVOA 3HAMA 2W5BA 4MX9A 3U9CA 3HAVA 5F4NA 4JAJA 3QL8A 4BBFA 4DT9A 1OIRA 4RG0A 4I5HA 4JDJA 4X21A 3UIXA 2PZYA 4UY9A 2YABA 4RLLA 4KRDA 3DAKA 4UMQA 3O51A 5TKDA 4CMOA 2WXVA 3E88A 2JIUA 1OIYA 5EHLA 4ACHA 3EQFA 1YHWA 5ETFA 2XBJA 3DQWA 5K5NA 1BLXA 3MW1A 2P33A 1FMOE 2R3OA 4YC8A 1OPKA 5FM3A 3SW4A 1OKYA 3G15A 3DFAA 2BCJA 4QYFA 3N4TA 3UP2A 3H9OA 2HELA 5IKWA 2PU8A 4LL5A 1O9UA 3VUIA 4E6QA 5DR9A 2O0UA 1Y6AA 2CJMA 5ITAA 3LAUA 4XBRA 1BL7A 2YCQA 4FKJA 3FAAA 3SXRA 5HO6A 1ERKA 2UW9A 3ACJA 4YBJA 3BV3A 4ENXA 2E9NA 3I4BA 4FG8A 2ZM3A 2WMQA 2C6EA 4AOTA 4CFMA 1J1CA 4YHJA 2EB3A 3NZ0A 4XOZA 4E26A 3IOKA 3UIBA 3SVVA 3EQCA 2OSCA 2PMIA 3IK3A 3S3IA 5EW9A 2WTVA 4FV6A 4G3DA 5FXRA 1URWA 3HMNA 1HCLA 4XHKB 4FKWA 3SV0A 4BL1A 5IA0A 4QYEA 4QPAA 1Q97A 1M7QA 3MH1A 4RZWA 3UTOA 4EL9A 3ORKA 4J53A 2FVDA 1ZY5A 4LL0A 4S30A 5HBHA 2PYWA 4USFA 3DJ6A 2B9HA 4RBLA 5CEOA 2HIWA 1Q8YA 3F5UA 2H9VA 2IW9A 3RKBA 2GSFA 2JGZA 4R6VA 3F3VA 4DFBA 2JEDA 2EXCX 4NKAA 3V04A 2YWPA 4IB1A 3NSZA 4KD1A 4QMTA 3OEFX 3CTJA 4D4YA 2WKMA 3QQKA 3FMHA 3NYXA 2ZDUA 3FXWA 4K77A 3LLAA 2IW6A 4X6QC 3NIZA 4FKOA 4IFCA 3VNTA 3ZTXA 4AXAA 4EOMA 2JD5A 3E63A 4JR7A 1XH4A 3OP5A 4HGTA 3EFWA 4IJPA 2YCSA 3D0EA 2J6MA 5HNBA 1SZMA 3OTUA 2QO9A 2XK4A 3OWLA 4HYIA 4KNBA 4L43A 3TWJA 2NPQA 4BI2A 2WD1A 3COIA 5CXZA 4J95A 4C36A 4ZY5A 5AV4A 5HLNA 4GKHA 5JGAA 1TQMA 3OW3A 2O5KA 2Y9QA 3QU0A 3AMBA 4G1WA 1KE9A 3FC2A 3ERKA 4O0RA 4IFGA 5CVFA 1E1VA 3W8QA 3ORMA 4BWKA 5FEEA 4NK9A 5ANGA 5GHVA 5DRBA 2C5XA 4QOXA 4F70A 3R63A 4QMNA 1ZZ2A 4EK3A 4F7LA 4GEOA 1PXNA 2XYUA 4IVAA 4UXLA 5FDXA 5I9ZA 4TWCA 3UZTA 4FV1A 2V62A 2XRWA 3MIAA 4O0YA 5DYJA 2ITWA 3KRRA 4ZTHA 3NNUA 3NAYA 4AWIA 5LVPA 3KF4A 1H0VA 4UZHA 3R01A 5AR8A 2UZOA 4F9BA 4O7RA 2QR7A 3B8QA 3P7BA 2Y4IC 4A9YA 4CGAA 3PP1A 1ZMWA 4O22A 4BYJA 5JQ8A 1JQHA 5I9UA 4ZK5A 2JAMA 2BFYA 3R8PA 3EYGA 1LEZA 3TXOA 3FJQE 1LR4A 3ZMMA 1PF8A 4QTCA 4EKLA 4U44A 1SYKA 4GJ2A 5E8WA 4YJNA 3A2CA 4I5PA 5HE0A 3R9DA 4Q9SA 4A9UA 4E7WA 4CCUA 3TUDA 4HOKA 4P7EA 5AM6A 4OTQA 2VX1A 2C3IB 2NP8A 2CNVA 3GOKA 3IW5A 3BX5A 5I9VA 3MGYA 3R7YA 3I7BA 4N0SA 4N70A 3OROA 3ENHA 4XP2A 3VHKA 1GY3A 2ITTA 1JOWB 1Q5KA 3AD6A 3BYUA 4MXCA 2R3IA 3HDMA 3VBVA 2OZOA 3OBGA 3DAEA 3OVVA 4BKZA 4EC9A 5FP5A 3L8PA 5CAPA 5FQDC 4O0XA 4JG7A 1PXIA 3QXOA 4ID7A 4CZTA 3F5GA 3A7JA 4YR8A 1Y6BA 5AX3A 3QRUA 2XNOA 4E6CA 4Z7HA 4O83A 3UZRA 4DG2E 3OMVA 5EK7A 3BV2A 3NDMA 1JPAA 2R3NA 4DGOA
chains in the Genus database with same CATH superfamily
3M42A 2XIKA 5L6OA 3GC8A 3JY9A 4DC2A 3DBFA 2XJ2A 2GNHA 5ACKA 4FSNA 4RWLA 4CKRA 3Q9WA 4RIYA 3UDZA 1MQBA 2QURA 3MH0A 4ZLYA 3OCSA 4GV1A 4Y5HA 3QCXA 4FVPA 2XK3A 4FV8A 4DH5A 4AGCA 2X0GA 3Q9ZA 3QUEA 3ML1A 5IA3A 1M2PA 3MN3A 4BB4A 4G3EA 4IX6A 2QC6A 2GNFA 4MEDA 3D7TA 4CSVA 4DE4A 4ASXA 4C2VA 1PW2A 1F3MC 4BKJA 1Z9XA 3HRBA 4IE9A 3OOGA 3LLTA 4GJ3A 3CTQA 4NFMA 3NWWA 4L7FA 3VUKA 3QYWA 2BAQA 4F9CA 4FZFB 3U51A 4CMTA 4W4YA 1UU9A 2VTHA 1KWPA 1REJA 4CG8A 4CLJA 4ZSLA 1GZ8A 4FKVA 4L6QA 4DYMA 2W0JA 3LFQA 4FTIA 3GB2A 5AM7A 3UZPA 4ANMA 3ZXZA 3ELJA 3MH3A 2ZMCA 3RI1A 4GSBA 3V01A 4ZLZA 5IF1A 1YQJA 3UP7A 3FXXA 5I9YA 3EFKA 4XYFA 5IA2A 2I7QA 4QDVA 4OT5A 2GNGA 4HVIA 4A9TA 3JPVA 2OJFE 1DAYA 3HX4A 4O21A 5LVMA 2X2LA 4X7QA 4AZSA 4FI1A 4FNYA 4Y85A 5ETCA 5JRSA 3CCNA 4V01A 2B9FA 3KRLA 4BN1A 2WELA 4YBKA 2ACXA 3LCOA 1MRUA 3G33A 2XNGA 3LHJA 5EM5A 4WD5A 2OFVA 2H8HA 4NCTC 5HG5A 2XBAA 2XRUA 3R8ZA 4S31A 4Y83A 4S34A 3AD5A 3NNXA 2CGWA 3WIGA 3MI9A 3QLFA 3R21A 4EHGA 3F3UA 3RMFA 4I0RA 3K2LA 3NCGA 1S9JA 3MV5A 5D10A 3R6XA 5AP5A 1W82A 4GVJA 3K3IA 2CLXA 4EZ3A 4MCVA 4F1MA 4TYJA 1Z57A 2VWYA 4PQNA 5DT4A 5KNJA 2BDWA 3QD3A 3SX9A 3LQ8A 4KIKA 4L9IA 2XK7A 3CE3A 4I6FA 1SM2A 2QD9A 4DEHA 3QZHA 4UB7A 3FMLA 3HYHA 4GFMA 1PY5A 3A7HA 2UZDA 2P4IA 2PMLX 3BE2A 4KIKB 3VUMA 2Z7SA 4O7YA 2G9XA 2X0PA 5HTBA 5ICPA 3BLAA 3DQXA 2CKEA 4BJJA 4YPDA 5AFVA 4M97A 4RIXA 4HGEA 5HHWA 2VGOA 3DT1A 4QTAA 3O7LD 3MB6A 4CQEA 3L9LA 1ZXEA 3FZOA 3ODYX 5E9EA 4I24A 4EBWA 4BIEA 3UDSA 5HICA 4ANBA 5CEPA 5DT0A 4EEVA 1OUYA 2OG8A 1YW2A 3PLSA 3DK3A 3COHA 2I40A 5K9IA 4ALVA 3ZU7A 1TFFA 4KB8A 3DXQA 4K33A 4BICA 2HZIA 5HTIA 4BDIA 5FM2A 3MIYA 4IX4A 2BRNA 4RJ7A 3CGOA 1UVRA 5TOZA 5A6OA 5LMKA 2W1FA 1OB3A 4I3ZA 5BVWA 3RPYA 4IWQA 2VTOA 4J7BA 3M1SA 3PPZA 3GI3A 3SRVA 4CTBA 5IH6A 5GIPE 3GOPA 4OTHA 4YTCA 3BQCA 4BWXA 5ACBC 4HVHA 3DFCB 1SMHA 3A62A 5FTGA 1S9IA 3Q32A 1V1KA 4M84A 5H8EA 2ITOA 5EDPA 2PZIA 2UW6A 4LOPA 3VUDA 4AZVA 3ZFYA 4HNFA 3ZXTA 2W1GA 2UZTA 4EHEA 1FINA 4F1TA 5B2KA 4AACA 5JQ5A 2OH0E 3DTWA 4NW6A 2UZWE 4ACMA 4CFFA 3S00A 2DS1A 3MA3A 5HORA 3S0OA 2YACA 4MBIA 1H01A 2VD5A 3MFSA 1DI8A 5AV0A 4TYEA 1K3AA 1YWVA 4ITIA 4DHIB 5HKMA 4FSQA 5FG8A 4QEBA 5BUEA 3CPCA 2OF2A 2YWVA 4CLIA 3W0MA 2V7AA 3P5KA 4GT4A 2Z8CA 3COKA 3I7CA 2BVAA 3BKBA 1E1XA 4F6UA 3WARA 4CRLA 1P4OA 4FKIA 4IB3A 3D5WA 4RX9A 5ETAA 4DFXE 3EN6A 2EU9A 2W4OA 3P23A 4TW9A 3BL7A 3W0PA 4CRSA 2YITA 2Q0NA 3TUBA 3DBQA 4ALUA 4FVRA 2VZ6A 4PY1A 2UZVA 3LJ0A 2F7EE 3C7QA 3GEQA 4GUBA 4XG7A 2VWVA 4O6EA 4O0SA 4W8DA 3TCPA 4GIHA 2ZV2A 1U46A 3C9WA 1WAKA 3F69A 4D28A 1WVYA 3FLNC 4BCKA 1P14A 4F4PA 3Q2JA 4FSTA 2O64A 4C4EA 3FEGA 4FTCA 5CF8A 2HZ4A 3OZ6A 2JDVA 3G2FA 3QC9A 4L46A 5E92A 4EHZA 5AR2A 4AZWA 4WRGA 4E6DA 5H8GA 4ASEA 1BI7A 3KCKA 1Q99A 3KXXA 5AUVA 2YJSA 5LXMA 3TEIA 3KK8A 4D5HA 3ORIA 2XANA 2RG5A 3FPMA 4X3FA 3NW5A 2UZEA 3DA6A 2QODA 3KMMA 4A06A 2V22A 1QCFA 3PSDA 4AGUA 3P5JC 4DEAA 3VONA 2GS7A 2YLFA 4PTGA 4QQTA 3PA5A 4MNEB 4ZY6A 5F94A 5FWKK 4AZEA 2GDOA 2X4ZA 2GPHA 3JVRA 5AR4A 2C6MA 5L8LA 3P86A 3C5IA 3BHTA 3W18A 1G8JA 2BZJA 3PTGA 3DU8A 4U43A 3R1SA 4KUJA 4FMQA 4YHTA 4GT3A 4PPCA 5HVKA 2J2IB 3ZO4A 2GFCA 3LCSA 3ZO1A 5A4EA 5E8TA 4PX6A 2G01A 1OBDA 4YLJA 1MP8A 3JXWA 3UOLA 4AW1A 4YZNA 4TYIA 5AJQA 3UMXA 4AZFA 4YNEA 3OBJA 3UVRA 2FH9A 5GJFA 2GQGA 3HZTA 2B55A 4IC7A 3PA4A 4O4CA 5KMOA 1XH5A 4CEGA 4IC8A 1YHSA 3RP9A 4BCOA 5EQYA 4IDVA 2OIBA 3HVCA 3LVPA 4RC3A 2R4BA 3UDBA 3MVMA 3R1YA 5D41A 4BDHA 4H36A 4JIKA 3CBLA 3KIOC 4JAIA 2YLEA 2GCDA 4XV1A 3R8VA 2B4SB 3GP0A 4AF3A 2UV2A 5J5TA 4O7LA 1MRYA 4FTQA 5DRDA 5ANKA 5CEQA 4NTTA 4RLKA 4U41A 2C47A 3RHXA 4B6LA 4D1SA 4KIPA 4JLCA 1JKSA 3UNKA 3WILA 4IWPA 5IQIA 2HENA 1OIUA 4P4CA 4RWJA 3W2PA 4APCA 4FTRA 3TJDA 3Q53A 4W4VA 4BGHA 1B6CB 2W1DA 4FOBA 5HIBA 2BIYA 5ANOA 2BAJA 3UE4A 3UNJA 4TYGA 3VS5A 3TDVA 3W0SA 3TUCA 4D2TA 3I0OA 1FOTA 4FIHA 3SGCA 3EQRA 5J95A 5DH3A 5EM8A 4CT2A 3DZQA 2AEGA 3GT8A 4IW0A 5IQFA 5BVDA 4FUXA 4JBOA 4JRNA 4KWPA 3PXRA 5F20A 1JKLA 3QKKA 2I0VA 3EZVA 3QRIA 5B0XA 2ERKA 5CF5A 4L53A 4ZTMA 3GUBA 4FTTA 1XMMA 2R3HA 2QOFA 4D0WA 3THBA 5BVKA 3LW0A 4XLVA 3NUPA 4IAKA 3NUYA 4V0GA 4G3GA 4IEBA 3RK9A 4KKHA 4RA5A 3CGFA 4J71A 2W05A 4ZXTA 2E2BA 4R8QA 3TV6A 1NW1A 3MY1A 3WZDA 2QO2A 2R9SA 2H6DA 2WEIA 3FLZA 4O1OA 2XAMA 5HBJA 5GJGA 3E7VA 3PFQA 3PPKA 1ZOHA 3KGAA 4ZAUA 2PZPA 2QNJA 5DN3A 5E1SA 2C3KA 2F57A 3NLBA 1H8FA 3SOCA 5HQ0A 3A99A 4JQ8A 3LJ2A 5KZIA 4L52A 5B2LA 3E5AA 4LM5A 4MD7E 3F9NA 4QMVA 3QRTA 5K5XA 2RSVA 5M55A 5CAQA 2WQOA 3EYHA 4K18A 4AGWA 5EW8A 4IM2A 5AADA 1OGYA 4DH1A 3OD6X 3OUKA 4DHJA 1IA8A 4HYHA 3W8LA 3PPJA 4TTHB 2VTRA 4ZTSA 4N57A 4FTMA 1UV5A 3IG7A 1XHAA 5LJJA 2XKDA 4MH7A 1XH8A 2Q0BA 3DAJA 3QLGA 4KABA 3BU3A 1I44A 4I6HA 5KMJA 5EYDA 4PMTA 4F09A 3WF7A 2ZM4A 4H58A 2DWBA 3IOPA 4W4WA 3R7IA 3UJGA 1ZMVA 4FV4A 1W84A 3FI4A 4AAAA 4E5BA 2OZAB 4DEDA 5IEYA 3OXTA 3D83A 2QONA 2J0JA 4CD0A 3E87A 3GU4A 1R1WA 3KXGA 2YIYA 4XEYA 4JBPA 1SVEA 2V5QA 3AT2A 3POOA 1PMVA 2YIRA 2IVSA 3FUPA 4IACA 3GC7A 2ESMA 3DXNA 4I6BA 2XKEA 3PUPA 1XBBA 1YDTE 3TZ8A 3EQIA 1Y91A 4XG6A 3FQSA 3Q4TA 3DDQA 2WQNA 3KA0A 1UNLA 4E4XA 3ORTA 3TKHA 3LFEA 4DFYA 3U6HA 4NW5A 4IX3A 5CZIA 3ATSA 3W0QA 4C3FA 4BBEA 2R3FA 1YXXA 5CZHA 4BVUA 5F1ZA 3C13A 4IANA 1M2QA 4YJSA 4FV5A 2WTJA 3C4XA 4DG0E 2UW8A 4LOOA 5AR5A 4O0TA 4GYIA 4Z16A 3UPZA 3ZOSA 4YZBA 2BZKB 4EZ7A 5IISA 1ZARA 2AC3A 3Q6UA 5FXSA 4X2NA 5FBOA 4NM7A 3I6UA 2WOTA 4YZMA 1FVRA 1GIIA 4XV9A 4D4SA 1ND4A 4C7TA 1WMKA 3GC0A 3GU7A 3NR9A 3PJ1A 3ZSHA 4ZJIA 2JBPA 1KE5A 2C6OA 4BGGA 3LMHA 1F5QA 3KN5A 4QQJA 4FRFA 4M15A 4WSQA 4J52A 2CKOA 1H27A 4FNXA 3ANQA 3KULA 3V6RA 4EH3A 3BLRA 4MWHA 4F64A 3NFFB 4HYUA 3F61A 3GBZA 2ETRA 5K3YA 2VTIA 4FV3A 3W2SA 4ARKA 3TN8A 3UBDA 4C58A 3FYJX 4X3JA 3A8XA 1PXPA 4DGNA 1ZYLA 4YGAA 4O7ZA 3R02A 2QKRA 4XG9A 4YJUA 2G1TA 4LFIA 3P08A 4HPTE 4PDSA 5D7AA 3R7UA 5JGBA 4U5JA 4EH6A 4OGRA 3UVPA 3UDTA 4M67A 2VWZA 2GQSA 2X6EA 3QCSA 2W9FB 4FYOA 2PE0A 1WCCA 1WBPA 3IW7A 1MRVA 2PMOX 1J3HA 3KEXA 4FL1A 4RQKA 4Y72A 1V0PA 4ZIMA 1XKKA 2C0OA 1H24A 4KBCA 4H39A 3HGKA 4WBOA 1XQZA 3LFBA 3LFAA 2ITZA 5D11A 2PVJA 1OECA 2R3PA 3PG3A 4BCIA 5J5SA 2P55A 1GAGA 3C0HA 1L8TA 4U40A 4BDDA 5I3RA 4MNEA 4JX3A 4FKUA 4WG3A 4YJQA 4UN0C 1M17A 1IEPA 5DBXA 4QPMA 3V5JA 2C6LA 2UVXA 2HWPA 3TNIA 4H1JA 3VJNA 4CYIA 5IMEA 2YEXA 2OU7A 2Z7QA 2X7FA 3VWAA 3TI1A 4JRVA 4AX8A 5A4LA 3EHAA 3R7VA 4NEUA 4U3ZA 5M4FA 4TZRA 3NMUF 4RVTA 3RM7A 2CGVA 3GCUA 1YI3A 3NCZA 4QRCA 1GZOA 3UO6A 4MBJA 5C27A 4M68A 4UYNA 3K5VA 5M09A 5JFWA 3KRXA 3HRFA 4BI1A 5JFVA 2HZ0A 2CN8A 5CSHA 3VQHA 4CNHA 2HXLA 2BKKA 3I0QA 3P7AA 3LFSA 4ZMFA 4D2RA 3OS3A 4FA2A 4R5YA 4AN2A 1STCE 3BGZA 4AOIA 1K9AA 3R73A 2ONLA 4YMJA 4WRSA 1W2FA 2CKQA 2WMWA 3VRZA 4C4GA 3OF0A 1SNUA 3FC1X 4ANSA 2NRUA 5EYKA 3PVWA 5CF4A 2QO7A 4ZSEA 3ZONA 1YKRA 5HGIA 2OXDA 5A14A 3PWDA 2PUNA 1ZYDA 4O38A 1SVHA 2OF4A 3QTWA 4YJPA 3DBDA 4C38A 5BX0A 2PVKA 3B8RA 3DKOA 1KOBA 1YWRA 3KY2A 1NY3A 4ZSGA 3OHTA 4BBMA 2XAOA 4CKJA 4PWNA 5E7RA 4HW7A 5HIEA 4CG9A 1JNKA 2GS2A 3LQ5A 3QALE 2OXXA 5HU3A 2Z60A 3BHHA 3O7LB 5HU9A 4WIHA 2XH5A 4IXPA 5CTPA 3D7TB 3HV4A 5FTOA 1YXTA 5K0KA 3HLLA 4MUQA 2E9PA 4CZUA 4O4EA 5DE2A 5ANIA 4FTLA 3G6HA 3BYMA 3TKIA 3MFRA 4YJTA 3SOAA 3VBWA 4F7NA 4E5WA 4F78A 5AUUA 3NVMB 3F5PA 4FG7A 4P90A 5CAVA 3AKJA 4U3YA 3ZUVA 4ENYA 1QL6A 4HCVA 4MQ2A 3VW8A 4B8LA 4DTAA 1XBCA 4YTIA 2R3RA 4YSJA 2WTDA 3R71A 3O8TA 1WBSA 4M0YA 2AUHA 2VWUA 2JDRA 3HP5A 2XF0A 1UWJA 5CALA 1YXSA 3QQHA 3OCGA 4QNYA 3FSFA 4YLKA 3D7ZA 3H3CA 4QMPA 4CZYB 4JXFA 4K9YA 4MYGA 4BZOA 2YZAA 4IX5A 4H05A 3H0ZA 4G16A 4EJNA 4OAVB 3SW7A 4EK4A 2NRYA 4G17A 2BMCA 3QD4A 4W8EA 3OG7A 4WO5A 4PMPA 1T45A 3F7ZA 1ZMUA 4JS8A 3SXFA 5G1XA 3ZDUA 1W2CA 2J0LA 3U6JA 3L8SA 3V5PA 1WBVA 2CLQA 5FUTA 5HD7A 1OZ1A 3WF9A 2GMXA 2X6DA 3LKMA 1IA9A 4IH8A 4TL0A 3BBWA 5AAFA 4EZ5A 5C4KA 2REIA 2BTSA 4BIDA 1AGWA 5C4LA 3I1AA 2ZMDA 2OJJA 3IW4A 5CSVA 2FYSA 3LM0A 3T3UA 3V3VA 3KCFA 2W4JA 3CD3A 4Z9LA 3O5AA 4YJVA 4BDKA 2VTSA 4CFXA 4DEBA 1IR3A 3RWQA 2G2FA 4P5QA 4FSWA 4OTIA 2OJIA 5HG7A 3FSKA 3FY2A 4BTJA 4FEVA 2IJMA 2Z02A 2C0TA 2R7IA 4JBQA 1A9UA 3MFUA 3Q5IA 4F65A 4O7NA 3BU6A 5BV3A 4U8ZA 2PWLA 3ZC5A 4UWCA 1U59A 3W0NA 1SVGA 4I20A 2LGCA 1FGKA 4QTBA 3JYAA 3W1FA 4I1ZA 2HW6A 1O6LA 2UZBA 3QQUA 3PFYA 3UQFA 3HUCA 2HYYA 1GNGA 2HZNA 1UWHA 2V0DA 2R0IA 4FKSA 3TZ9A 3UO4A 3QA8A 3ZBXA 4EWHA 2R3MA 2PSQA 4LG4A 3W2OA 3DKCA 2C5OA 3JY0A 3F3ZA 3MY0A 4BRXA 2VTPA 3QQGA 4DA5A 1DM2A 1FPUA 4FSUA 4U9AA 4XOYA 3ZUTA 4BCFA 5M53A 4HGSA 5M4IA 3U54A 3QHRA 4CKIA 3IW6A 3DJ7A 3KF7A 2DYLA 2XZSA 4FVQA 4XP3A 4EYMA 3C5UA 4EK8A 5FD2A 3AGMA 5HG8A 4FE2A 4ACDA 4OTPA 4CT1A 2WTIA 4FZ7A 2PVYA 4KSPA 2E9OA 3KXZA 3PXKA 5DOSA 1KE8A 1H4LA 2XEYA 4TNDA 1JVPP 4GVAA 2XIYA 4GK2A 5M06A 2R2PA 3V5WA 2R3KA 2YM8A 1UNGA 3LXKA 4OTRA 5HIDA 5J87A 3OXIA 3QRKA 4EBVA 4EQMA 5CI7A 3HV5A 3Q4ZA 2CSNA 2X2MA 2G2IA 5E8XA 3VULA 2C68A 5IQAA 4A4OA 3DBCA 4TNBA 4FBXA 3T9TA 4IB5A 4AT5A 5JN2A 5E91A 2XKCA 3UNZA 4ZTLA 4HYSA 4J1RA 4Q9ZA 3ZCLA 4YO4A 2WTKB 1IAJA 3B2TA 4USEA 4K11A 2JAVA 4QMSA 4ZZNA 4IAIA 5C26A 5DHJA 2OI4X 5BMSA 5L2WA 3JUHA 2BRGA 4U45A 3PXZA 4A07A 3GNIB 3CY2A 4GCJA 3RZFA 1L3RE 3I79A 4G3FA 4FV7A 3ZM4A 5JMSA 1JBPE 1SNXA 5CY3A 2W9ZB 3BI6A 5KHWA 3PJ8A 3WZUA 5CAOA 5CU6A 4FKTA 2A2AA 2IF8A 2WMTA 3E62A 1XBAA 3UO5A 3ZDIA 5IQDA 2R7BA 5IQHA 2UW0A 2CN5A 3LFCA 3SKCA 3BL9A 4KRCA 5DA3A 1FVTA 5HTCA 4XBUA 4JDHA 2VAGA 4I23A 5KX8A 5IH4A 3G9NA 4WBBB 3QTIA 3M2WA 4OAUC 3NYVA 3E64A 4NM5A 4EK5A 4IZYA 3LFNA 4GU9A 3TTIA 2J0IA 2ONLC 2J50A 2A4LA 2F2CB 3BLHA 3A61A 3KL8A 3PVUA 4X2KA 4LGHA 4D9TA 4JQEA 4XMOA 3KK9A 2X0OA 2GU8A 3GCQA 3H9FA 3LXNA 4G6OA 4L01A 2PVLA 4Q5EA 2X4FA 4TYHA 3QHWA 5A4TA 3R0TA 5L2SA 2RFSA 2NNWB 4YC3A 2PZRA 1YI4A 4D2SA 3KFAA 5C8NA 2BR1A 4JJRA 4OTWA 5DR2A 2QKWB 3H0YA 2OBJA 4RJ6A 4YLLA 1BKXA 4RJ5A 5KCVA 1Q3DA 1PXLA 4PV0A 2ETKA 3EJ1A 3FL4A 2W06A 2UW7A 1ZLTA 4D4RA 3R7OA 4AU8A 4CMUA 3LM5A 3SG8A 4MD8E 3W10A 1WBOA 4QMZA 5M08A 3MTLA 3F66A 2VO6A 3NUSA 5AUXA 4UMUA 2OKRA 4AN3A 2GTNA 5CXHA 3FI8A 5H2UA 3ALOA 3HV6A 4YJOA 1OVEA 2GTMA 5KBRA 4WG4A 4HGLA 2ITPA 5HVJA 4BJJB 2YAAA 5HLWA 1YOJA 1BMKA 2GFSA 4TT7A 4NJDA 2X7GA 5A4QA 3AC8A 1WFCA 4I93A 4RJ3A 4F99A 2W1IA 3MJ2A 3EKNA 1REKA 4AA4A 5M4UA 3PXYA 3RINA 3A4PA 4DAWA 3ORPA 4D58A 2QOQA 5HO7A 4U81A 3EIDA 4YO6A 4F6WA 2A0CX 3BZ3A 2HXQA 2PUIA 3E92A 1G3NA 3O17A 2WFYA 5I9XA 1XH9A 4WKQA 2BZIB 2UZNA 4AOJA 4M66A 2J5FA 2YDIA 5FBNC 4LGGA 4HCUA 2PTKA 5CEIA 1PJKA 1HCKA 3ZYAA 3WYYA 5AAEA 4PL5A 5E8SA 2QOCA 2B54A 5J8IA 2WU7A 3QZFA 5GIOE 2WIPA 2G15A 1PMUA 2WGJA 4L68A 2BAKA 2ZDTA 1H07A 5T6KA 2X9FA 4M69A 4BCNA 4ASDA 5HBEA 4DGGA 1MUOA 4BCPA 4U6RA 4X3FC 2XALA 3ATTA 5AEPA 4RC4A 5AR3A 2XKFA 3NUXA 4FIEA 2ZV9A 5A54A 4P5ZA 5B2MA 2VWWA 3NUUA 4FV0A 4IMYA 5IZFA 4MQ1A 4EC8A 1M7NA 1V0BA 3ZUUA 2VTAA 5HZNA 2YIQA 1XMLA 1Y8GA 2C0IA 2WTKC 2YM5A 4R3RA 5ETIA 5IA5A 3S2PA 4O7TA 2HAKA 2UW3A 2C69A 3QC4A 4FT7A 1XJDA 4D1ZA 4PRJA 3RPVA 5AA9A 3IONA 1GZKA 4EH7A 1DAWA 4FZAB 2ZB1A 4EOPA 5L4QA 1WVXA 4MWIA 3R8UA 3UOHA 2XM9A 1PMEA 3LJ1A 4D9UA 4FK6A 4DTKA 4EWQA 2B9JA 3HMOA 2R0UA 1BI8A 5CU0A 2QCSA 3RPSA 3FMJA 3ROCA 4RPVA 2B7AA 4B4LA 2F4JA 1R78A 3WYXA 2E9UA 4A9SA 4EH9A 1URCA 2YAKA 3EN9A 4PTCA 3BE9A 1Q8TA 4GK3A 3DPKA 4BCJA 3OCTA 2VTJA 3QD0A 4FEXA 2PVRA 3FZSA 1XWSA 4BDAA 4RQVA 3COMA 1J7LA 5F95A 5ANDA 2BRMA 2R5TA 3VC4A 4C8BA 3ZRKA 5HX8A 2ZM1A 1V0OA 1NT2A 4MXXA 3RJCA 5J9YA 2FA2A 3LOKA 4ZJVA 4EQUA 4FV9A 5IMXA 5EKNA 4AAYA 3FLSA 3IDCA 4HZSA 2WMXA 2PY3A 2VWBA 3RK7A 5EW3A 3FDNA 4AA5A 4E73A 5IPJA 2OJGA 3AMYA 3A60A 3BYOA 3PVBA 4I92A 4GIIA 4L8MA 3KKVA 1H28A 3V8WA 2ZOQA 5M44A 4UMPA 3TG1A 4EJ7A 2PE2A 4DEIA 3NW6A 4NFNA 4AUAA 4ONAA 3IS5A 1JSTA 3CKWA 4IWOA 2ITUA 5J9ZA 1CSNA 3LPBA 2FO0A 3R30A 2VRXA 4Y5QA 1KE7A 2HY0A 1NVSA 3MFTA 2J0MB 3AC2A 3AXWA 3PYYA 4O0WA 4QMXA 5C9CA 2ZAZA 2W96B 5DT3A 4FSYA 4GFGA 4BGQA 2PUUA 5GZ9A 1Q8UA 3OY1A 3PRIA 5JH6A 2O3PA 4KBAA 3MS9A 5JZNA 2F7ZE 3W2RA 3UPXA 3PZHA 3OWPA 2HWOA 1WBWA 2OH4A 3IGOA 5AP4A 1OPJA 2OZAA 4O1PA 2OXYA 2PVHA 4KA3A 4F08A 3IQ7A 3WZEA 3BGQA 3F88A 4J99A 3UG1A 4NM3A 2BZHB 4L7SA 2CGUA 1OI9A 4ZTRA 1P5EA 2W99B 1ZYCA 1CMKE 1G8SA 5E1EA 3EOCA 4AT3A 2JLDA 5HO8A 2C3LA 4IWDA 1YWNA 1XH6A 2B52A 2PUPA 3G0EA 3FE3A 5EYCA 4E4NA 2C5NA 2OWBA 1P2AA 3QTUA 4MTAA 2PULA 4JR3A 5L2QA 4IM0A 4J97A 2QLQA 4J98A 5LVNA 4R1VA 3FMNA 4BTMA 5IA1A 4FTNA 1H1WA 3PP0A 3PWYA 4DLJA 2O2UA 1U54B 4I41A 3REPA 1H1SA 1B38A 3SAYA 4QQ5A 5I4NA 3IPHA 2YDKA 1W2DA 3SC1A 1KV1A 4K0YA 4NM0A 4F0FA 4I4EA 3PA3A 2JDTA 5EM7A 3LMIA 5KKRB 4O81A 4YZ9A 3K5UA 3IDPA 4EKKA 1KUTA 1ZYSA 3WI6A 5FLFA 3RNYA 5IQGA 2WHBA 1H08A 4XV3A 5AIRA 1YXUA 2O65A 5C01A 2X9EA 3VS6A 2YCRA 4NKSA 4ZLOA 1T46A 3R9RA 4LV8A 4L45A 3IGGA 3LXLA 5DR6A 3FMEA 3CEKA 2BHEA 2WTCA 3QBNA 4OT6A 5E8ZA 3WIKA 3CJFA 3MVLA 1CM8A 2CDZA 2NYAA 3H9RA 2XNBA 2EXEA 4PL4A 4QQCA 4WNKA 3EQGA 3RAWA 1E9HA 4CFNA 2BILB 2E9VA 3UYTA 4AE9A 4DF3A 3ZSIA 1QPDA 2BTRA 2J0KA 5AUYA 3EQDA 1UA2A 3VBQA 4ZJJA 4NIFA 3KU2A 3Q4CA 4H3BA 1UU7A 3DS6A 4RJ8A 4ZTQA 2QU6A 4MAOA 5CEKA 1CKPA 4ZEGA 3MESA 2IG7A 3RM6A 2CGXA 5ANEA 3HMPA 4BF2A 1NA7A 3H30A 3SRVB 4A4LA 3T8OA 3W55A 3NVKI 3G0FA 4OBPA 4BYIA 1G8AA 3QCYA 4G9RA 4JI9A 5CANA 2FSTX 5IUHA 5A3XA 5CQWA 1LUFA 3R22A 4XRLA 4IBMA 3R1NA 1H25A 3OWKA 3QQLA 4AZTA 3Q52A 4R5SA 2ERZE 3FQEA 3OOMA 2CPKE 2YM4A 4DG3E 3LQ3A 3R9NA 4FTOA 2WQBA 3NS9A 3ORXA 2XARA 4IZ7A 3IO7A 2EXMA 2FSOX 4C4IA 4FGRA 3EFJA 5LCKA 5C8KA 4LUDA 3AC3A 4NT4A 2R3GA 5IDPA 4BZNA 3BCEA 4IAZA 1Q24A 3DKFA 4C2WA 4ZS4A 3EN7A 4U42A 2KTYA 2IVUA 5CAUA 4M12A 4EOOA 2C1BA 1RQQA 4ANNA 3FL5A 4O7SA 4GG5A 3P1AA 3ZLSA 5A46A 4MXZA 4YP8A 2VN9A 3TTJA 4AW2A 4QMWA 5GNKA 4I0TA 3BWFA 4M3QA 5J9LA 3OT8A 2RFNA 2Y7JA 2UUEA 3BQRA 2PVNA 1PXJA 2Q83A 4L3JA 4XCUA 3ANRA 3A7IA 4DEGA 3EN4A 4OTGA 4B8MA 4RFMA 4RIXB 4YZCA 1NXKA 3PLAE 3I60A 3C51A 3GCSA 3V51A 3ENMA 4KKEA 4NTSA 2QR8A 4BR3A 1PKDA 3A4OX 3CIKA