2HZ7A

Crystal structure of the glutaminyl-trna synthetase from deinococcus radiodurans
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
590
structure length
556
Chain Sequence
AAPLVAPNFITEIIERDLEAGKYPRVVTRFPPDPSGYAHLGHVFASLLDFNTARQYGGQFNLRMDDTNPELARQEYVDSIADDLKWLGLDWGEHFYYASDYFDRYYAYAEQLIRQGDAYVESVSPEELSRLRGNATTPGTPSPYRDRSVEENLDLLRRMKAGEFADGEHVLRAKIDLTAPNMKLRDPVLYRIVNKPHFRTSDEWHIYPAYDFEHPLQDAIEGVTHSMCSLEFVDNRAIYDWLMEKLNFDPRPHQYEFGRRGLEYTITSKRKLRELVQAGRVSGWDDPRMPTLRAQRRLGVTPEAVRAFAAQIGVSRTNRTVDIAVYENAVRDDLNHRAPRVMAVLDPVKVTLTNLDGEKTLSLPYWPHDVVRDSPDGLVGMPGGGRVAPEEAVRDVPLTRELYIERDDFSPAPPKGFKRLTPGGTVRLRGAGIIRADDFGTDEAGQVTHIRATLLGEDAKAAGVIHWVSAERALPAEFRLYDRLFRVPHPEGENGFMRYLTPDSLRVLRGYVEPSVAGDPADTRYQFERQGYFWRDPVELERVLVFGRIITLKDTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutaminyl-tRNA synthetase
publication title Deinococcus glutaminyl-tRNA synthetase is a chimer between proteins from an ancient and the modern pathways of aminoacyl-tRNA formation
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
total genus 175
structure length 556
sequence length 590
ec nomenclature ec 6.1.1.18: Glutamine--tRNA ligase.
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain
A PF02637 GatB_Yqey GatB domain
A PF03950 tRNA-synt_1c_C tRNA synthetases class I (E and Q), anti-codon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1160.10 Mainly Alpha Orthogonal Bundle Glutamyl-tRNA Synthetase; domain 2 Glutamyl-trna Synthetase; Domain 2 2hz7A03
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2hz7A04
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2hz7A05
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2hz7A01
3.90.800.10 Alpha Beta Alpha-Beta Complex Glutamyl-tRNA Synthetase; domain 3 Glutamyl-tRNA Synthetase; Domain 3 2hz7A02
1FFYA 1QRSA 2EJCA 4YP5A 4I6GA 2QUJA 4ND6A 2CV0A 1GZUA 5IHXA 1J20A 3KT8A 5HUJA 3AKZA 1D6KA 4YBRA 1I2DA 3IOBA 3IMCA 5GAEW 4KR7A 3TQIA 1WXFA 4ZT3A 1OWLA 4U63A 5LLTA 2CYBA 1XNHA 1JEEA 1GN8A 3LCJA 3IUBA 3KT6A 4XFJA 1TYBE 3QE4A 5FO1A 1OBHA 2E21A 5JBNA 1M8GA 4JZYA 2CFOA 3SP1A 3AG5A 3PXUA 1XNJA 2QUHA 4DDHA 3G6KA 2YXNA 2X1MA 2J09A 3IVXA 2ZUFA 3TZLA 3E27A 2PIDA 2BTEA 3IH5A 4MW5A 1U0BB 2A1TR 2QUKA 4NDAA 2H2AA 2BYTA 2OQ2A 1QRUA 2O5RA 1PG0A 3A2KA 2ZJPS 4DDKA 5GAGW 3Q10A 3GUZA 3RK1A 2VTBA 3PIOS 4CDNA 4EG6A 4H3SA 2YWBA 2QTMA 5KCMA 2A1UB 5H16A 1KH2A 2CUZA 1O0BA 3HL4A 1KQOA 3PNVA 5HG0A 1K92A 3HFJA 3KT0A 2D54A 2CV2A 3MUEA 3MMXA 1JHDA 4JXXA 5AHWA 3A4IA 4EG5A 1NP7A 1U7DA 3K32A 2V0GA 4J76A 1EFPA 4MWBA 1KH3A 4KPUA 5IJXA 3SYTA 2A1TS 4HJRA 1NZJA 3Q12A 1YIAA 1F7UA 4EG7A 5LM3A 3CLRD 1H3FA 1OWNA 3SEZA 3KT3A 2XRYA 1NUQA 3RBAA 4QBTA 1WJGA 1ZH0A 4ZCTA 1VBNA 4YP7A 3N05A 2CYAA 3RJZA 5FNZA 2AKEA 1OD6A 2WSIA 3MLAA 4IOAS 1KP2A 4K0RA 1N2GA 1N2JA 3H05A 2IJGX 4MLPA 1WQ4A 5DK4A 3DO8A 4DLPA 2J07A 5BNZA 1A8HA 1V8FA 2RE8A 2JANA 4Q93A 1N2EA 4WNYA 5IZNA 1TYCA 5KWVA 3HZRA 1M83A 1QJCA 4L2IA 1Q11A 2E89A 5J58A 4JXZA 5K0SA 1IFXA 2O8VA 3X1JA 3P52A 1GPMA 4MW0A 4IOCS 1T6XA 3COVA 4WSOA 2XRZA 4DJAA 3ZJTA 3COWA 1Q15A 5DM6S 3L93A 4R2LA 1R6TA 3SEQA 1KQNA 4EG4A 2PZAA 1B75A 3G5AA 4P2BA 1V47A 4DE5A 3TS1A 1KR2A 3ND5A 4MUGA 4EF6A 2E0IA 4S1OA 1J1UA 1R6XA 2DEUA 1WXHA 4MUNA 3CF5S 3CVXA 2CV1A 1MBZA 1PFUA 4RUKA 1M8PA 4WCES 1IH8A 4XFDA 4A91A 1DFUP 1WXIA 3CVYA 1YULA 2X3FA 1O0CA 1OBCA 2J4DA 3A04A 2WQ6A 3TNJA 1H3NA 3L92A 3AL0C 1QU3A 1N77A 4MW9A 2GKSA 1VL2A 5F23A 2A1UA 1RQGA 4PBTA 1GAXA 1NYLA 3LE8A 2IELA 3A05A 4EFKA 3FOCA 4DDMA 3FETA 1H3EA 3H99A 4NAHA 1MC1A 1VBMA 3GMIA 1PFYA 4CT0A 3PRHA 3G59A 2A88A 3QTBA 1IQUA 1KKUA 2JAXA 4AS1A 1K4KA 2GM3A 3FIUA 5TS2A 1D2RA 4MVCA 1U3CA 4ARIA 4IO9S 2V0CA 3TQOA 5JVHS 4Q16A 3C8ZA 1G8GA 5DM7S 2D5BA 3UOWA 1JILA 4MULA 4ZCPA 3RHSA 4HK4A 3ZJVA 1KQPA 1I6LA 3CR8A 4MW1A 3P0HA 3CLTD 3CLTC 3OTWA 2DPLA 3U1VA 2E18A 5GAHW 1JZQA 1WY5A 1WXGA 1Q77A 3CLUD 2ZJQS 3CLUC 2DUMA 4JFAA 4U8HA 4CDMA 1NSYA 4OUDB 1BS2A 3DLLS 4OJMX 1F9AA 1YUMA 2OV4A 4F3RA 3JXEA 2Z09A 3VU8A 2QTNA 4KR9A 3IDFA 2X0KA 3N8HA 2ZUEA 1I6KA 5HUHA 3IOEA 3IVGA 5GADW 2I1LA 3VRHA 1JIIA 1T6YA 4MQ6A 4NX2A 4PBRA 4U7JA 2PXHA 1ZH6A 1HYBA 3FDXA 2TS1A 3D6UA 4MW2A 1TQ8A 5TGTA 1GTSA 1LI7A 4UZEA 2DR2A 3IMGA 4KKVA 1IQRA 1TYAE 3FY4A 4I6EA 1YIDA 3ZXSA 1CT9A 3CLRC 1QNFA 1EUYA 2PFSA 2WQ7A 4MWCA 3S3TA 4MVYA 1COZA 4WFAS 1O96B 3UC5A 4MAFA 4G5FA 4YP6A 3PNYA 1IVSA 1F4LA 3MXTA 1PG2A 3CVVA 4R2MA 1NUUA 1VBKA 2YY5A 4MW6A 1M8FA 4EG8A 3MLBA 1N2HA 2H29A 1JECA 1KORA 3AIIA 3SZ3A 1U7XA 2DLCX 2ZJRS 1ULHA 1IRXA 4HPWA 3IMEA 3NBKA 4ZCSA 4K03A 2VTBB 3TZEA 4MUJA 1MB9A 4UY88 1R6UA 4KR6A 1LI5A 4QRDA 1ZUNA 1JZSA 5TEVA 4MUIA 4ND7A 1T9GR 4RPIA 1IQ0A 1PFWA 1QQTA 5FO0A 1QTQA 4YMIA 2PG3A 4G5YA 3CLSD 3CLSC 4PBSA 1T6ZA 4CQNA 3DLAA 1N78A 3X1KA 1N75A 2HGZA 4I6JA 3FNRA 4GRIA 1H1TA 1EFPB 4KPUB 4JYZA 3J7ZV 1NUTA 4XSVA 3ELBA 4ARCA 4MVXA 1NURA 3COZA 1SURA 3ZIUA 5DB4A 1LW7A 3H9CA 3IVCA 4ZT4A 3X1MA 1Y42X 2A7XA 1VLHA 4WF9S 3I05A 3Q4GA 2DXIA 3ZXIA 1O95D 1O95C 1KP3A 1JMVA 1XJQA 1MOPA 2EL7A 1P7PA 2IP1A 1B6TA 1JIJA 4ZCRA 4MWEA 4MW4A 3ZUGA 4MW7A 1EFVB 3BL5A 4HJXA 1J21A 3PNBA 4L2IB 4U67S 4MUFA 4UZFA 3N9IA 2AZXA 1J09A 1M8KA 2B7LA 3F3MA 3N2YA 3FH0A 4NAUA 1MRZA 2A86A 1TEZA 1OWOA 1EJ2A 4EGAA 1WQ3A 3DPIA 3FWKA 1GTRA 1XNGA 2DERA 4ZCQA 1PFVA 1F7VA 1O96A 5DEOA 1KH1A 4GU5A 1JIKA 1O97D 1O97C 2DETA 2RD2A 3ND7A 3RFFA 1FEUA 4EG3A 3IUEA 1N3LA 3AFHA 3COYA 5JVGS 2HZ7A 2NZ2A 1YUNA 3AG6A 3RK0A 1JGTA 2QTRA 1OWMA 1GLNA 3DV2A 4R0NA 3FI0A 4ZT5A 3VGJA 3FHJA 5H7XA 3D6VA 2A84A 4ZT7A 1WXEA 3ZJUA 2CYCA 4MVWA 1M1ZA 1N2IA 4QREA 5J5AA 1N2BA 2PZ8A 1DNPA 4BWVA 1NUSA 1O6BA 2VXOA 3HMQA 3UY4A 3IOCA 3LOQA 4F4HA 3NBAA 3ND6A 3INNA 3CVUA 1K4MA 4NATA 2G36A 3FG9A 5LFAA 1M8JA 1NUPA 1G59A 5HL7S 2X1LA 5J59A 2NSYA 2ZP1A 4PY2A 1MJHA 4ZT6A 1O5TA 1X6VA 3QTTA 3H9BA 1IHOA 5EKDA 3UK2A 5TEWA 1MAUA 4NZPA 3NV7A 3SDBA 1ILEA 4MUEA 4WFNS 3KFLA 2J5BA 2A4MA 1N2OA 3HGMA 1KAMA 1O94D 1O94C 2D13A 2YWCA 4G6ZA 1I6MA 1OWPA 3CA8A 5KHAA 1J1ZA 3OP1A 3K9WA 4TS1A 2JA2A 1N1DA 1U3DA 1QU2A 2PZBA 1EFVA 1S4MA 2C5SA 4EG1A 4WFBS 3ISJA 4X0EA 1K97A 1EE1A 1ZJWA 2CT8A 2AG6A 2J08A 5K0TA 1NI5A 1FYDA 1X8XA 1KAQA 3GLVA 2CSXA 1WZ2A 4ZT2A 4J75A 1G8HA 2Z3VA 1EUQA 2GOYA 4MUKA 1MB2A 3HV0A 3PIPS 3UMVA 2WB2A 5DASA 2QUIA 4MWDA 1QRTA 1Q19A 2R5WA 3M5WA 2QJOA 1J70A 1WKBA 4OUDA 1G8FA 1TYDE 2QJFA 3IODA 1YI8A 2QJTA 1MAWA 1TFUA 1UFVA 4AQ7A 3ZGZA 3ILVA 3P0JA 1T9GS 3H97A 4E1AA 2HMAA 4FZJA 4MUHA 3SZGA 1EXDA 4DNXA 2Z08A 3CVWA 1WOYA 1JEDA 3P0IA
chains in the Genus database with same CATH superfamily
4QGFA 4BMZA 2MMCA 4YP5A 1JHAA 5FP0A 3WNVA 4KNWA 4EZBA 1KEEA 4MYTA 4HV4A 2JLZA 1LEHA 1NVKA 4AZWA 1E69A 3OJXA 3I37X 5HUJA 1QFYA 3WWDA 1NOJA 2C5FA 1AKQA 3OEED 2WOJA 2Y2UA 4GRAA 1QIHA 1M0WA 2BCJQ 4O4IA 3N5CA 3ZGNA 3O8OB 2O8BA 1P0CA 3EDYA 4WN9B 1MRSA 3PQ3A 2YJ4A 3D6NB 2B4QA 4MV1A 3QJ5A 2FPRA 1L4GA 1Y5IA 3CNNA 1KO4A 3M4YA 4UXIA 1HI9A 1ULAA 4NS1A 4ZIRA 3M1YA 3T7TA 5JBNA 1RSZA 1RXVA 4Z4EA 1EJ6A 3GQBA 1E4OA 4U7DA 3LBAA 2VJDA 5KWSA 5CTJA 1VLLA 4OAOA 4CGYA 1SZDA 3G6KA 2FQYA 4H15A 1ZH8A 2C8JA 5A0VA 4XWOA 3MS2A 3R76A 2IHBA 2X9LA 3IIMA 4M8IA 3TIFA 3PXXA 1Z4NA 1INLA 2OGZA 3AR5A 1V7CA 5TARA 3WMRA 4BGIA 4B33A 1QRUA 1N3BA 1GSOA 2EU8A 1V2GA 3BEDA 4E2FA 1OLSA 3PF8A 5BURA 4CIXA 3SHVA 5JRJA 2P2LA 4J7AA 2IXTA 2J0UA 4CDNA 4P22A 3X2SA 3SIRA 1G20E 2YWBA 4AKTA 4BATA 1XYVA 3ACDA 4KQGA 5HS4A 1QOZA 4W5JA 3CNHA 1D8TA 1PR0A 4AJ2A 5H0IA 4KVGA 3RF6A 3AHEA 1UINA 2MINB 1R4NA 1LI4A 2GBPA 2PT9A 5IK2A 5GIPE 2R1ZA 1AVTA 1GNLA 2D54A 2QZJA 2W6MA 3PQFA 1WMSA 4KQ1A 1ONNA 2WT4A 3DVRX 1N2CE 2HRRA 4MQEA 4BLWA 2IX3A 1Y3AA 3U0BA 4L51A 4XE5A 3ELUA 1CR2A 2G9UA 4WQMA 3ESAA 5AFSA 4AVYA 2RHHA 4HQ0A 8ADHA 2ORWA 4DC9A 1VE1A 4MHSA 5K5EA 1KFCB 3NAMA 4XB1A 2WW8A 5C4IA 1DS6A 1FCJA 4IHAA 4OP2A 4ZKDA 4ANFA 1LF5A 3QBDA 1TA0A 4M1YA 3WYAA 5K8VA 3C7AA 1RWQA 1SIBE 3QKSB 5C18A 4RY2A 1XVLA 4NXNB 1F60A 2NQ2C 3M3HA 4MLCA 1IMOA 1QIIA 3G7NA 2PE5A 2ZBEA 4RELA 3H5NA 3WIBA 2OYRA 2E4ZA 5CD1A 3OTGA 3RCBA 1YNSA 3O8RA 1CUVA 3C5CA 3FBWA 3HKBA 3GGDA 1N2GA 3ZDRA 3IUJA 4BZPA 3QA3E 1HQYE 1MX5A 4C7OA 1YRHA 4RSHA 1Q7CA 1N6PA 1VCIA 4XX0A 5IAKA 4A0FA 3PIRA 2OXFA 2CL7X 4BKRA 3U39A 3K2BA 2HK7A 4LSWA 4ZI3A 1C9DB 5KNBH 4HMPA 1RYZA 3K0AA 3W7VA 1PUIA 1D2HA 2G1AA 3A1UA 1HUQA 1PCXA 3D8UA 3S2YA 5KO2A 1Z0SA 1A9SA 2BM1A 1LK0A 4OXQA 1XQVA 3OPVA 1JXAA 2B2NA 3JVUA 2BR3A 3H7AA 3U4QB 2KLBA 3B51X 2G25A 3KKNA 2G9VA 2W70A 1NNLA 4GE0A 3TQCA 1MJ5A 1ZAYA 2YJ3A 2VYQA 4I1PA 3HDHA 2JDIA 4C5BA 1V1MA 1ESNA 1U3GA 4JBIA 3KQYA 4X20A 1GQ2A 1G8JA 2MYPA 3ZI0A 1Y63A 2Z0MA 4A10A 4GSYA 4RTLA 2D2VA 5B3AA 4PHCA 5CYGA 5CT9A 5JW6A 3GRPA 1A71A 5DN6A 4WCES 2PMEA 1NV9A 3PVSA 5HZHA 2YKGA 1VHWA 2JD2A 5A9RA 3BWDD 3DUFA 4C7KA 1J2RA 4YROA 4DCNA 1M0EA 3AVYA 4IFBA 3WWYA 1VE9A 1M0TA 4LHXA 3JARB 3Q2OA 3U7QA 4UW9A 2DFNA 3PNQA 4J0CA 3H83A 4JJIA 621PA 1X9GA 4AY2A 4JS0A 5KOJB 1ZOOA 1E1RA 3IP8A 1L7AA 4UHDA 4PRKA 3OMXA 1E3QA 4R68A 1EVIA 4QSHA 4CMGA 1TRKA 2IU0A 2BKUA 1SJ9A 4AG5A 1QF6A 3OIYA 2GT1A 2QAJA 5I7AA 4XYLA 5EXDA 2P9GA 5CX1A 3VR3A 1BXRA 5TB5A 1FDRA 1PFYA 1XJ5A 4CT0A 1SCIA 3AB8A 4I9UA 3N6XA 3LXUX 1NLFA 3L8CA 1XD9A 4AN4A 2UUOA 2IOQA 3WX0A 4KOEC 5HF9A 3C41J 5E4YA 4JI5B 2NO4A 3WISA 1G41A 1UJ6A 4HBZA 1ADJA 3RTEA 3T7EA 2O1WA 1PX2A 3CBQA 5DM7S 2AD1A 2V7EA 1GVHA 3NM5A 3FHTA 4U2GA 1LPNA 3PS9A 2QORA 3DZCA 3KV1A 1VB3A 2D62A 4HN2A 1SHJA 3H5LA 1W36B 4OSOA 5HCNA 4C6TA 1Y6FA 4PFSA 1DAKA 5IUJC 2Y67A 1TU4A 5E6SB 2ZI4A 1QH8A 4AJ4A 3NW9A 1WY5A 1EIZA 3N58A 1WXGA 1VL1A 5KYTA 1OFTA 1TZCA 3NFRA 3CLUC 1XU9A 4TSKA 2FFHA 4PG8A 2EKZA 3Q3HA 4EMBA 1HNZB 1K7CA 3QXXA 2GZSA 5CDHA 3D8TA 2ZXFA 2G3YA 1MABA 3GZJA 4OUDB 1L5SA 1BS2A 1MXHA 5AI5A 1K2WA 3GCWA 2PKCA 3A6GA 3IQHX 6REQB 3AVTA 5KJEA 2GF2A 3CLKA 4PZYA 5BOSB 1CUFA 1QORA 2J3EA 1KEUA 1O89A 3JR7A 4C22A 1CYDA 1DEKA 4HDOB 5HIAA 4KWTA 4K7JA 1NLZA 1BC5A 1FZQA 4BU0A 4LY3A 2HQ1A 2QZZA 3R74A 3RSSA 1K89A 2BP7A 1PP4A 2XXBA 3IEIA 3NIDB 3UW1A 3I76A 3SSMA 4OQPA 2PUFA 3R09A 4NV3A 1UPTA 4V02A 1EI9A 1HYBA 1KEVA 4PCAA 4WNAB 2YOHA 3L7BA 4B5LA 1XZCA 1E1QD 4M7WA 3BUSA 1KEEB 1R0ZA 3HO8A 1L7QA 3RJTA 4LUCA 2Q5IA 2WWTA 3QF4A 4OKIA 3ZBQA 2WHRA 3BXGA 3EZ7A 4B0OA 2P9BA 4ITRC 3CQ9A 4YP9A 4M9SA 4IXTA 4O4IB 1Q95A 2BTOA 3WL6A 3ZS9A 3U3XA 4K88A 4EJ6A 3G8YA 1Z0JA 4YV7A 2QG4A 4QAJA 3THYA 3ZVMA 1Z0IA 4QTTB 2OLEA 2Q8NA 3NOVA 4JJZA 5NULA 3WYGA 1JHMA 4ER0A 4ZIRB 3M2TA 3PEYA 2QYTA 3GQBB 2GAEA 3PDIA 1Y3HA 4H9GA 1TTPB 4TWIA 4HLNA 5LZ7A 5DHQA 4CF7A 5AW4A 4HN4B 3O4IA 5AW1A 2WM8A 3C3YA 3RV4A 1WLYA 4KW7A 4ETMA 1C14A 5ENZA 2X9GA 1CUZA 1YOBA 2EW8A 4PE5B 3V4RA 2A3RA 2DBQA 2NSHA 4IDAA 5JRDS 3SZ3A 3PHCA 1M67A 5LYJF 4AJ1A 2FZWA 1QYWA 2CVHA 2DLCX 4HPWA 3OA2A 4JEIA 4QXQA 1CZLA 1OLSB 2YZKA 1QIJA 2WF7A 4Y6QA 3UCXA 3TL2A 1T35A 3ANTA 3RUPA 2J0UB 3B1ZA 3ZX4A 4JHXA 2J9YB 3T35A 1BFDA 1QHHA 4M60A 3N2GA 2X3YA 1FMJA 2O8NA 5AVYA 3VSAA 2F8LA 4ZI7F 1O6ZA 3TJMA 1R4NB 4MO9A 5L45A 2O8EA 2KBEA 5C2JB 1PFWA 1IPFA 3PHIA 2D6FA 4BRZA 1Y3DE 2EXXA 2N75A 4YMIA 1BHSA 2C42A 5JSKA 5SZKB 4MQEB 4ZHSA 1FQJA 4IUBS 3PU6A 3EK2A 2CEKA 4HEHA 1JB1A 4O4LF 3LVQE 4YUXA 5JZBA 1SEVA 2AYXA 2HGZA 3EBPA 5FDFA 1JJBA 2HQRA 1X2EA 2PH5A 2ZS7A 2Q4OA 3A6JA 3FNRA 4IINA 4L0DA 4L5YA 4P81A 3ZQJA 4CLXA 4OGWA 1XUOA 4JYZA 3J7ZV 2AFHE 3HJUA 3PUVA 3GQVA 2WD9A 2CLDX 3FHLA 3CJTA 2H8KA 4J43A 5BQ3A 4MA0A 4IDFA 3QHPA 1H94A 2V9CA 1D5CA 2V97A 4PONA 3BWXA 5E8JA 4NEHB 1KAEA 4FIDA 4LJ7A 4NS4A 1JDTA 4V2IA 4JV5B 3Q3GE 1SC3A 1U8XX 1R0RE 4YJFA 4UTZA 3V8QA 5DNEA 5A06A 4RMHA 1YRYE 1T0UA 3HKBB 3ST7A 4NLLA 3WWPA 4B7AA 4C7OB 3L5KA 4XX0B 4YQYA 2O48X 5DISB 1E5VA 3VGPA 2OD7A 3F9RA 4F06A 2K4MA 3CF2A 1REQA 4MAAA 2YMLA 1WD7A 1QFSA 3BL5A 1UXGA 2OMEA 1ZVKA 3TZBA 4BPBA 3K0AB 4CTMA 2EIHA 3A9UA 4MWZA 4ARSA 5AXBA 3B82A 2DKNA 4K6MA 4HVTA 3N2YA 2NO9A 2BHTA 1OYVA 2OAP1 4ZYVA 5M2QA 2DH5A 3ZI7A 1FVXA 1RLOA 2V7XA 4PPYA 2QI9C 2VPPA 3P9XA 3CSSA 1OH5A 1GAEO 2FSVC 3QVJA 3V4OA 5EHIA 3P9SA 2WIGA 1K5DA 1V1MB 2HF7A 5AK3A 3WSVA 2Y9PB 2BCEA 4MVJH 1PKXA 2RD2A 1Z16A 1WAMA 1FEUA 2AR7A 3IUEA 4MV3A 4Y2XA 3DLBA 4LZJA 2EJTA 2XE6A 4JCCA 4IFTA 4LOIA 1O5OA 5ICFA 2Y0EA 3NT2A 3FPHA 3TNLA 1YUNA 3HA2A 3RK0A 5B1DA 2ENWA 3BE8A 3DUFB 2GZ1A 1D2CA 3G17A 2QTCA 4OO3A 1XZ8A 2B8EA 4F86A 4YRMA 5J23A 1F38A 1WMAA 2OHOA 4WJKB 1D0VA 3EXAA 1NASA 2JJ1A 4QO7A 3U7QB 4Y9DA 2XUGA 3KVOA 4H1TA 2XIQA 1V96A 3AUXA 2HB6A 4WY8A 4MICA 5H7XA 2ZUUA 2ZJ8A 4R0MA 2GPWA 2EAUA 3ORQA 4IZOA 4NZYA 3BK1A 1GUAA 2I29A 4K3UA 2QHXA 4RMJA 4BQNA 2IF0A 2NQ8A 1IJEA 1KU6A 2RHRA 5BUQA 1PNRA 3AUSA 2EKLA 1BXRB 4ON9A 2Q29A 3QG5A 4NHOA 4I46A 4S0XA 2QDKA 2IDKA 4NBWA 5K3EA 4JLDA 3OE7A 4EUHA 2B7BA 1HA3A 4DOMA 5KYYA 2FW6A 2GLTA 2HDNB 4C4ZA 1UJ2A 1V6SA 4DMKA 4YRNA 5BR4A 1WQ1R 5JY6A 3M83A 5DFAA 2XVYA 3FG9A 1UT8A 5FPPA 3ZCSA 1XMVA 2GCIA 2IXGA 1J42A 2PKQP 3DO5A 5EL0A 3DOEA 4WFIA 2IU6A 4O33A 5AXAA 2HSEA 3L5OA 3WSWA 3Q9LA 3E9ZA 5THXA 3W06A 3IIIA 4OQMA 3EQ6A 2AC2A 2Q2NA 2VHCA 4HBGA 5KX5A 4PLYA 1KMMA 4C6TB 2AFRA 5REQA 7REQA 2ASVA 1X6VA 2X86A 3JU3A 1I5EA 3EGCA 4ZQIA 3PCTA 1LWOA 2NTNA 1QH8B 1RXWA 1BHO1 4GMDA 4RSGA 4IJ5A 4WH0A 4MITA 2VWHA 4OIFA 4EFMA 3KFLA 2JLQA 3F1LA 1OXBB 1W25A 4FFOA 4S2UA 1RZRA 3EGEA 4UARA 5KKAA 3PHBE 3VYWA 2O2GA 2C57A 1MABB 2J9ZB 2VJLA 3LK7A 2BBOA 4H3VA 2NP6A 3AF2A 1KAMA 3OPMA 2WWYA 3DOIA 4BC0A 3DMPA 5C53B 3GGJA 1BU8A 5D00A 1FUEA 1Y7PA 2DUUA 1N1DA 5EIWA 4DHWA 2PZBA 4JA2A 4FU0A 4YS6A 5F7OA 2HJWA 5JUWA 5AHKA 1HT2E 1T4BA 2CY0A 5CURA 4M9UA 2EC5A 5ALLA 4YAKA 5HX7A 5M04A 2CT8A 1Q17A 1Z4MA 1ZR4A 1O6CA 5CHYA 1KDRA 4NQZA 1GILA 3RTAA 4TXHA 4BECA 2C3YA 4P4NA 5HKOA 1PT7A 3HJHA 3BXOA 4E08A 4J94A 3HE3A 4ZU6X 3TLEA 2CNOA 3A06A 2VP5A 4PYQA 1EUQA 1Y6RA 4LTNA 5AH0A 4EGQA 3GUHA 2DHQA 4XARA 5HDBB 1G16A 1WF3A 1K08A 1EFDN 3KQTA 4KQEA 1GRQA 1NBME 4MKZA 2WZQA 3QF4B 3PUWA 2Q6OA 4KFUA 2QA5A 4UDNA 3U17A 1O9HA 1KRWA 1X77A 3PP8A 3KLBA 1FS4A 4AJPA 1C8BA 4N5LA 2HNAA 1DIOB 3QE2A 4PZLA 1V1RA 4G9GA 4PHFA 3THYB 3U48A 2QGNA 1U9IC 1WEKA 1WXDA 3P0JA 3V2IA 1K9SA 1ZLYA 4QQKA 1DPFA 4KQ9A 1EX9A 1I9GA 4UQOA 3BYZA 4F9FA 3QX7A 3I23A 3K09A 1T0HB 5CT6A 4ZANA 2D1QA 1YBHA 2J5QA 2H54A 3HYNA 3PDIB 4IJ6A 4X71A 4F56A 2HFJA 1R0WA 2XGMA 3L7JA 3K2QA 1W0KD 4DPMA 2FN4A 5DBFA 4DADA 2QRPA 1E1CA 5K8CA 3Q0TA 4G85A 4I6GA 4AT1A 3H2ZA 1DB3A 4NCJA 5BNTA 1C3EA 1TADA 4FE4A 3A7DA 4P0QB 2YJ5A 3S2ZA 3HM9A 2YV2A 5DM60 4Z4IA 3Q3JB 3PR3A 1UDCA 221PA 2A94A 4D4GA 3DKKA 3DVAA 1SU7A 3EVFA 2CKDA 4NMXB 1PKEA 2A9VA 2OFOA 1A7KA 4U63A 5AJYA 3QKTA 1CJMA 1JEEA 1QHHB 3H42B 3N2GB 2P0AA 3PCRB 4RK4A 3HZZA 1UJCA 4DJEC 5ICMA 1R9JA 1CUDA 1TYBE 3QEJA 1LRKA 2E37A 4J7XA 2PSFA 1EYZA 1Z38A 2O8EB 4MCIA 4EA6A 5AW5A 2XKJE 4P3XA 3SIPA 1ZNQO 2X4IA 3AV0B 4RZQA 1UMCA 2NV6A 3GLKA 4WIAA 3O8DA 2WWGA 1Y9ZA 1COWD 2D3WA 1A0OA 2C0PA 2AOXA 2VSXA 4IWNA 1KZ7B 4NDAA 3KB8A 2E4YA 3DOJA 1JEAA 4H4CA 3E1SA 4URFA 2CF6A 3FYDA 3LPLA 1KETA 1M34A 3ZHQA 2NUPB 5CVDA 1I4LD 4HNRA 3RV3A 3UMCA 1XA0A 3M9LA 1XTUA 5DTIA 1MP0A 3EQ7A 5FBHA 4B73A 1F2VA 4RFSB 3W0LB 3FPBA 2HRDA 5FI5A 4LYEA 4YJFB 4LPSA 1XDWA 2VHUA 3MMNA 3KQMA 3QELA 5E8RA 2PGOA 3SPXA 3ZWXA 4AN1A 4AX4A 2GAJA 4V0NA 4QKQA 3PC8C 3DPSA 2WD8A 3SF0A 4Q3AA 2ZE7A 2J41A 1E58A 4BEJA 1PNTA 1RBMA 1V9SA 2VYVA 3HYLA 3O7WA 3AB7A 3TM5A 4K0KB 2VRCD 3I5XA 2FAXA 4H16A 3CBGA 1REQB 3V1TC 1YCGA 1ORRA 3OZFA 5AJUA 3RIEA 3GJ7A 2XCRB 4HMOA 1ZDMA 3Q12A 5AIAA 3WP1B 1ADBA 3EARA 4GNKA 5CNKA 3M33A 1CZRA 2PMDA 1F2DA 4R0VA 5E3HA 2Z58A 2UV8A 1P1RA 4O4IF 2VSOA 1UP7A 3H4TA 1UPUA 4XJTA 1DUIA 1GUBA 3L79A 1TU0A 5EE3A 2Y1KA 1FMTA 3CB2A 4FNGA 4C0HA 4E4RA 3JASA 2OZLA 2FMUA 2I67A 1KS2A 4NEQA 2CNDA 3TDKA 4QFCA 3GRFA 3OHMA 1GPBA 3GGSA 1USUA 3HCFA 4KACA 2QL9A 2OO3A 3X1WA 2ZK7A 5IF9A 2OXEA 2BBSA 5B3LA 3JTMA 4YEDA 1ISMA 5T8KA 5J47A 4ID9A 2H9YA 4ZQEA 5F4ZA 4BUCA 5IU6A 1EUCA 2VK8A 1M83A 1TQHA 4V2UA 3IV9A 2IS6A 2GARA 2AJ8A 2C0CA 1QLJA 3J80A 1Z5VA 2JHFA 5ICSA 3P52A 4LA4A 4QL3A 1UQRA 3QX3A 5L6LB 1NV8A 5EJ8A 2JHCA 5CDTA 4TV8A 4DQVA 3NVDA 4JR0A 4A2PA 4Z4GA 3AF1A 4RPCA 4TX1A 2JPDA 4U2BA 3SEQA 1E3WA 1FL9A 4Q3CA 5DX0A 1CDDA 1XYYA 2G9ZA 2JCVA 1OV4A 2WNSA 1Q2UA 1TVCA 2JD1A 2ZDGA 1QZZA 4LMBA 4S1OA 4BO8A 1R6XA 5J2TA 3SE7A 2WP8J 1I2CA 3PQ7A 3LTEA 2GVDC 3L8EA 1R8YA 3RLFA 5C80A 4FYXA 1PFUA 5KYYB 2P0YA 1FMCA 2XDAA 3DDHA 1TA9A 2R7AA 3QVWA 4FFPA 1IBCA 2JL1A 3WLFA 1CIPA 4B32A 1SIOA 1FDOA 2VK4A 3L18A 4D9GA 4E51A 4XRGA 5JS6A 3ONNA 4Q7LA 3R9WA 2Q21A 5EMMA 1PJ3A 3S29A 1ZO8A 2LIVA 2FF5A 2IYWA 1EK2A 4OQDA 2GHIA 2CNWA 3NVMB 4LZZA 1NFQA 5KX5B 2X0IA 1O4WA 1JW9B 5KNDD 1RQGA 1IHPA 5REQB 3LCUA 3TEFA 5B4UA 7REQB 3A4LA 5JCZA 2LDXA 3ZN2A 3I30X 3P1JA 4BO4A 4QQ8A 5GTDA 1YVPA 2BBWA 5T4EA 3Q9UA 5C8XA 3FDZA 4PSVA 1I4TD 2KI5A 1HFWA 5GVRA 1DQPA 2MSWA 1D6SA 3WIEA 4G0PA 4UVEA 2JKYA 4PZAA 1NVBA 2P2SA 1UPCA 4EECA 3EISA 4MH0R 1IAVA 3HN2A 3ZJ5A 5CIYA 1HDGO 3AXSA 1W4CA 4GPBA 4MVCA 2NAFA 3Q7QA 1VPWA 3ESZA 3QW2A 4ARIA 1OAKA 2YBDA 3VTFA 4NARA 2OAEA 4QNRA 1Q2XA 3TO5A 2EW1A 2D5BA 3ABOB 5A3QA 3VV2A 3VJKA 3P4YA 3IDQA 1J9ZA 4EJ2A 4FMBB 1ZNWA 4KO3S 1KWKA 2X40A 1VHTA 3CLHA 3TGLA 1JDSA 3ADOA 3C1AA 1GQRA 2PSJA 1N9GA 2VIIA 1AM4D 2DPLA 3LPAA 1ZRNA 3AZPA 3V5NA 3AHFA 3L02A 2NZYA 5JFOA 1D9ZA 1A5TA 1JZQA 2IYEA 5BYBA 1MO2A 4QRIA 3LBHA 4I1UA 9GPBA 4G4IA 4DVJA 1HE1C 4M49A 5LUBA 3FJOA 4Z6KA 5F9FA 1CV2A 3QXCA 4OLFA 1OXVA 3UKDA 1KDVA 2VCHA 3WLRA 3E7XA 1RQ7A 2Q7OE 2LIPA 1GA4A 1F9AA 1W9HA 2PZEA 3PNKA 4RZXA 4CV2A 5DRYA 4LBZA 3VI4B 1I7LA 1K9VF 1E3EA 5AESA 1U6IA 2M6KA 1EP1B 3OMLA 1RLUA 3P9NA 1V1RB 3KE9A 3IDFA 4NZ9A 1X8LA 4FT2A 4EDHA 3N8HA 2VDRB 1B26A 1E2IA 1QBGA 2YZGA 3ZU3A 2PH7A 1PWXA 2OESA 4OM8A 4HDNA 1E5XA 5E7JA 5IVIA 1VMIA 4X64B 4OXRA 4CV0A 2PVPA 4K2HA 4YBZA 5KDLA 4ENQA 4ZHQB 2ZAYA 3WOHA 1Z34A 3IIKA 4IYJA 2ZRKA 4CWAA 2NU9A 2LVBA 3FDXA 1W34A 1P6XA 1E1CB 2BGNA 4MW2A 3Q98A 1T1GA 1YGYA 4R2IA 1L8XA 3OX3A 1EZZA 1W1WA 4H6PA 5FL7D 3AHCA 1TVEA 3IMGA 2RDMA 3VNRA 3TRHA 4BE7B 1KJNA 1SMKA 4I6EA 3ZXSA 5B7QA 5BMOA 3QEOA 1NLUA 4CODB 4JWTA 4GOMD 3O03A 1V11A 1L7BA 5ARDA 3DVAB 4FVTA 4MWCA 2OC9A 3HBLA 3C4VA 1C4OA 2A9JA 2QM3A 3CX6A 4IXDA 4LCJA 3V8PA 4DG8A 1GU1A 5I9MA 4ESHA 2WVHA 4UOEA 4OJKA 3K16A 3HQ4O 2XXAA 3HB7A 1DEXA 1KVRA 4FFRA 5TIIA 2ZI9A 3JZMA 2G9QA 4FYYA 1QVAA 3GBVA 2C2KA 3KHKA 1BKDR 1UMCB 4H1VA 3JVVA 2MCFA 2Q9BA 2ERYA 1CHNA 1AA9A 1E61A 1ZGHA 4AKIA 2WK1A 1WPGA 4GX0A 5AK4A 4YUVA 3GROA 4ZI5A 3RYIA 1E9DA 4KDFA 1OC2A 1CIVA 1R0KA 5LWQA 4NULA 2NYVA 5C1PA 2PSEA 3GLHE 4QDJA 1C29B 3M4ZA 2BJHA 3LDUA 2J1LA 4KYTA 3WMXA 1Y3IA 2RC5A 5K8LA 2HUNA 1M34B 2QOEA 3T1OA 1VFNA 3MS7A 2YMPA 2AR9A 3F7OA 3FOAA 3HO6A 1TQ4A 3KTAA 3OPNA 4PPFA 5B7NA 4A6PA 1CUBA 1E89A 2HJRA 3BF7A 3LHSA 1A82A 4E32A 1Z13A 3B6ZA 1X7HA 1NYQA 4JI6B 5I4KA 2WZBA 4F12A 1T2VA 3QELB 4BNYA 1CDZA 2FJUA 2QU8A 5G4KB 1LBIA 4AO8A 1NJ1A 1QC5A 1MPXA 2RBKA 3DCYA 4FWIB 4GR9A 3TWOA 1P7ZA 1VKRA 2EWVA 5C3MA 2ONJA 3P9KA 2HSWA 1OH8A 3ZW7A 2RHCA 5I9TA 4BNZA 1U31A 5L40A 1C3VA 4OK6A 2NVWA 3JTEA 3LCVB 5EZ6B 2B9EA 3BPSA 3EOZA 4HH3C 1OJ7A 3OLCX 1X3LA 4HH4A 1U2TA 1LPPA 2WTAA 5JWRA 3GP5A 5HIIA 1TMGE 3ETHA 3IXMA 1JI0A 2BHRA 3IT2A 4KQ6A 3VV3A 3K96A 3U19A 1QZ3A 1T3HA 1X7DA 1XTKA 5D5QA 3QEAZ 5CVUA 4JDPA 5K0LA 4WF9S 2ABWA 1CUYA 1KYWA 2AXQA 1Q57A 1SVLA 3DFZA 3NDBB 2DXIA 1RXYA 1O95D 1BMTA 3D59A 4H7EA 4GWLA 4ZARA 2W8BA 3JASB 2XCQA 4Y3UA 2NSJA 4UVHA 3B6JA 3HL0A 2IUFA 1H1LA 2JFXA 1EG7A 3RT1A 1ZUWA 2Z9CA 3N0RA 2BGKA 2W22A 3L8ZA 4RKEA 3WMEA 4YRSA 3ZQUA 1FNBA 4DIOA 4QLOA 3VMFA 2E85A 2PYZA 2R2GA 3QFCA 1EFVB 1EUCB 4OB6A 1GPKA 2VPIA 1BVYF 1DWPA 3EPRA 1T15A 2QRHA 2XYHA 4OK3A 3UA3A 4DARA 1PLJA 4LVNA 4W5RA 1D6MA 2Y1FA 5AQEA 2G77B 4G8DA 4BOYA 4UNRA 1RRGA 1Y1RA 3BT7A 1JDNA 3WICA 4EABA 4NAUA 2P7IA 4DLLA 1OFIA 2QQFA 3CUVA 2XTZA 3JYLA 2MR6A 3IP5A 3R5JA 5KQLA 4TV8B 1XNGA 2QVXX 1I4DD 5FOXA 3WGGA 4B4WA 1QWOA 5JHGB 3D8NA 1E3WB 1GCGA 2IZOA 2VCEA 4UCQA 5DULA 1GRCA 1UL1X 3E15A 4M1QA 3TX2A 1Z0FA 1W5SA 4OXNA 2J3QA 4GI7A 1MG5A 4LVCA 3D2AA 3F67A 5ITZA 2BFNA 5TLSA 5J2TB 2IBSA 3GFBA 1RD4A 3S99A 1E2MA 5LBUA 3BJRA 1WUIS 1L3IA 6ADHA 1UMDA 5DYYA 3AYZB 3FOBA 5IDYA 1KYXA 2C5HA 3RSLA 3W5UA 4PR0A 4BDSA 4RD2A 1L1EA 3QU4A 2HNBA 5A5GA 1OCEA 3IVMA 3HRIA 1WB5A 1XC7A 2YWRA 3JZDA 4NI5A 4PLTA 5DLPA 2WF6A 5G0WA 5LL6P 1UEJA 1BVHA 1VKNA 5T4FA 2R85A 3L4KA 1FP2A 3FHJA 3EULA 3TSWA 1E3IA 2O50A 3I62A 5HEKA 3DE2X 1ZD9A 2VUUA 3CPSA 3DEFA 1P19A 3RDPA 2VSFA 1G4HA 5TF0A 4BO1A 1OBVA 1NC3A 4LJLA 1M5RA 4GOXA 2PBFA 4HKTA 1AC5A 3OI7A 3FJ1A 4X60A 4TQAA 4UBOA 3UWSA 1A4RA 1ZUIA 4D9NA 3YASA 1ZIDA 3FDZB 2EGHA 2BR5A 4KL8S 4ZYZA 1ESMA 4H60A 1L5ZA 3KR9A 4N12A 1SCBA 1P3DA 2XVAA 4TRNA 1DQZA 2W93A 1DBPA 1F48A 5A03A 1TYZA 4EKNB 1DU4A 3KEFA 3NUZA 1NA5A 1R3DA 2D8AA 3SC2A 2YIJA 5K9ZA 4FMDB 1YAJA 3HP1A 1RKXA 3REGA 1E96A 4HFMA 1Z2PX 2C59A 3WSTA 4R2KA 4GPD1 5ITVA 4YRKA 2X0JA 2BDTA 2ONYA 4DCVA 3Q9NA 2VAMA 3DVLA 5F1KA 1FFSA 4MDYA 2XQVA 1HKHA 1N9GB 1U9YA 3UGTA 1ZM9A 4UHBA 3GRUA 3H9BA 3LWDA 2H07A 4FHDA 1RWNA 2Q3EA 2ZRDA 3FPFA 4F71A 1SC9A 3K0HA 4G2NA 2R6HA 5IBQA 5HE9A 1R66A 3G9UA 3G9ZA 3PWSA 2WUDA 5L3SA 2RJ3A 4D4LA 4TT3A 4JOCA 5CUQA 4RTMA 4RTKA 1JALA 1SUPA 1UDBA 4G6ZA 2AEJA 2AUNA 1PYOA 1Y9DA 1ZIXA 3FCXA 3QWFA 2BDEA 3WDMA 4C87A 4DDWA 2RB4A 4FFVA 4KVZA 4BV2A 1DOZA 4CM4A 3NUGA 5J4VA 4O6VA 2Z5LA 4NL4H 4QUGA 2QLJA 3WNBA 2GYVA 4B2PA 3PJFA 3RIGA 4OYRA 5IPFA 2LBPA 2BKVA 3NB0A 5CFQA 2Y1OA 4HDNB 3UBMA 4B2IA 2ZYUX 2CDCA 4HGOA 1YZGA 2QLFA 1OXKB 1FUUA 4TMFA 1X8XA 1VMDA 2NU9B 2QN7A 3WGHA 1EFUA 1PK9A 1V3QE 2VUIB 2P2DA 4XLZA 3QBVA 4QLAA 3MAGA 1M2HA 3NTXA 1XL0A 4QAQA 4R6WA 4E5KA 3CZQA 4RTJA 4IGAA 4ZZ2A 1J70A 3BXZA 1ISRA 1FTGA 2PRIA 2CZCA 3TE7A 4CN8A 4D0NA 4ESVA 4AW9A 1OI4A 4XYEA 1V11B 5IVKA 1EWKA 4HGPA 5K45A 1SWWA 5IXJA 721PA 3L7MA 4TS3A 1X1AA 2Y4OA 1PHPA 1RMTA 1R6DA 1JQ3A 1Z7YA 4M9XA 4L5JA 4GBJA 1GITA 1C9KA 4HEA1 4GPIB 4LRQA 4LSZA 3TRFA 2XXAB 5EE1A 4ZEWA 2FWBA 4O02B 4IOMA 2Y77A 3ZU2A 1SUSA 4G0VA 4S24A 2GEJA 2BIFA 1GNTA 2PUJA 1XXLA 3DWIA 3CVWA 1XBTA 3V1NA 2YMMA 1QGYA 2FZCA 5KX5F 1FFYA 3BMOA 2KSQA 3PFKA 1N5DA 1XMPA 2FMTA 4PHHA 3RYIB 3E5MA 1XZEA 3PGMA 2Q46A 2X4GA 2IH5A 3I6BA 5H82A 2WA2A 4IIFA 5GAEW 3F4KA 3QLUC 1OXUA 3WK4A 1WVIA 1U2SA 1WXFA 4H17A 4XUEA 4UNPA 3KTAB 4LC9A 1YE3A 4RGBA 3H0EA 3KETA 5AOAA 4EVSA 3RS2A 4CMIA 2J48A 3A3PA 1VYHA 1A4UA 3HJTA 5H4GA 4JBNA 1IOVA 3FDIA 4TRJA 2FQWA 3G5TA 3A9VA 4FTWA 3P96A 3T8YA 2QYOA 4KE6A 4NPHA 2B99A 3MJHA 2ZQYA 4KFTA 1XAIA 4KBYA 5KINB 3IAUA 1QC5B 3O0TA 1Z4OA 5ULLA 2I1WA 1NRIA 3F97A 1NJ6A 1DAFA 3RS0A 1GR1A 4KLAA 4AZTA 3QZUA 3MXOA 4P5DA 5DPMA 2CVOA 2BGRA 3MJ4A 1N2ZA 4MW5A 1PQ4A 1X1RA 2RAPA 4TTIA 5SZJA 4GZMA 3BAFA 1SCQA 1MLDA 5I7HA 4F5YA 3PQ5A 1IXKA 2QL6A 4ZVRA 3FCSB 2A1UB 3BD9A 2H0QA 3WG9A 4FQ5A 1NWCA 2C2ZA 3DKVA 3LXXA 1R27A 4FYJA 4XTRA 3ES9A 3T4XA 4JELA 1YF3A 3HCCA 2QAIA 4UBNA 4A6XA 4BNUA 2WTEA 3MT7A 3VH1A 4M83A 4R98A 4YN3A 1WE2A 4IIGA 1X1SA 3P2MA 2CV2A 2XA9A 1C1DA 1UIMA 2XW6A 2W8BB 5CVJA 2H1VA 2HMUA 2WHEA 1DIHA 2O3JA 3KPUA 1CUSA 1JHDA 1H1LB 3L0CA 2RHBA 4JXXA 1ETHA 1QO0A 1QO9A 3MD9A 1WW8A 3N7AA 3NIFB 2HO5A 4XGNA 5A5VA 1PDVA 4ZHQF 1CF2O 2ZJBA 1QOQB 4KDEA 5CDFA 1NWHA 1FX0A 2VYNA 3CU5A 4J3NA 2JGLA 4YGXB 4HDQB 4R5HA 2IYTA 3O3NB 1NT2A 2PS0A 5JAUA 4QE3A 2JJYA 3B1JA 4Y7CA 4YQZA 1X19A 4KIFA 4LDZA 5AI6A 3NWPA 3I9FA 2ZI6A 1CP2A 1V7ZA 2OHXA 3LS2A 3MTIA 4IIEA 3EXIB 4JLPA 3QOXA 2A9QA 3ZLVA 3GPDG 2J9RA 3MB5A 3K4HA 4QOGA 5IC4A 3I6ZA 4PWZA 1KVQA 1F20A 2GO1A 2Q28A 2XWQA 1TLFA 2FOLA 2GBLC 2HC9A 3DC7A 4H7PA 2X5OA 5ITZB 3U5ZB 3ICVA 1X8KA 3KD3A 4N5DA 3ZTTA 2J07A 2HXGA 2H48A 4EPVA 4LZAA 1DDOA 1E4EA 1UK9A 1W59A 3VBCA 1JHQA 1UMDB 4UXHA 3FCOA 3RSQA 1BFKA 4L4YA 2OFFA 1AZWA 3LXMA 1PTJA 3L43A 1M1NA 1ZWKA 2B1JA 5KYWA 4X6YA 4GMFA 3U5TA 3NOXA 5I7OA 1GYRA 4UU1A 1DIAA 2XT0A 2O7QA 3NEPX 4KE8A 3EMDA 2F17A 3IAS1 3IMFA 3VHQA 4B17A 5BV0A 1T6XA 3IB3A 1CBUA 4N8SA 2NYUA 4CKZA 5DM6S 2FN3A 3L93A 2GLXA 4IZIA 1BDBA 2R25B 3O5AA 3QUSA 5ALDA 1FFHA 1KQNA 3O1LA 2R8YA 4B5KA 2XNSA 2YFYA 1A8UA 3MMSA 2FVXA 3ZK9A 5I51A 4CKXA 2ZSJA 3VO9A 1FSSA 1YUBA 1DAOA 1CVIA 2BL4A 4QYMA 1I0LA 1PFKA 2DAPA 2ENUA 1MO4A 2VI5A 3LBYA 5C8YB 5JZOA 4BFLA 3B3QA 4IVNA 1HSZA 4D4MA 4LRTB 2DBZA 3TMKA 3CVYA 3U1BA 4FQ8A 2Z2IA 3PQEA 3SC2B 3BEOA 2HWXA 4D9EA 4EJSC 5LLDA 4EY4A 2M6SA 4NONA 1OA0A 2CKMA 4IHJA 4V0LA 4E2XA 4YCMA 1N77A 2HM7A 4FDTA 3VVMA 2FF7A 1VL2A 1WCXA 4G26A 1WDTA 4PBTA 1GTMA 5DNVA 3GVCA 3QH4A 4OBBA 4E0BA 3OX1A 1DXYA 1N3IA 3R44A 1W5EA 5ALXA 1K8YB 1E2QA 1H6AA 4BQQA 1XE3A 1OVMA 2V4ZA 3T41A 2Q3MA 3TW4A 2YQZA 4KQXA 3DA8A 4QRHA 5L3SB 1BQ4A 5B12A 1CB0A 2A33A 3USCS 1Y7TA 4W5QA 5KNCD 4IEFB 2ID7A 3P2KA 3MINA 2LP4Y 3OHPA 4MB2A 2NUTB 3C98A 4IVPA 1WXWA 5DJ5A 1E7MA 1LNSA 4Y6SA 2R44A 4EARA 3M5DA 2JH9A 4CM4B 4E2YA 4WJLA 3O7MA 2Y2VA 3N8GA 1TC1A 1AK1A 1ZUD1 3QRWA 4DCCA 4JT8A 5EMJA 1GZ4A 2X4DA 1E6LA 4M1SA 3MEQA 4Z5XA 2SKCA 1JQDA 2O2HA 3HRKA 5ILOA 1ABFA 4FYIA 4KQFA 4ESEA 1VSVA 3U1VA 1GNQA 2B5VA 3BREA 5GAHW 4M22A 1VTKA 5JSQA 3W3ZB 1SZCA 3IAFA 5K2OA 2ZR9A 2PTHA 4CIYA 3Q3CA 1C7ZA 2PBLA 2PGJA 4FONA 2FCRA 2VEDA 5JHHB 1XP5A 1E6EA 1TZBA 4U8HA 1THGA 3C3PA 2ADMA 5AKXA 2BUBA 1KAGA 3ZKAA 1DO8A 1EE2A 5J2TF 1Q14A 2ZT8A 2CE2X 4U3JA 5DU2A 1K75A 2L18A 1R1DA 3JXEA 1SQ6A 3UYKA 2UZIR 2CK3A 4EX7A 1NYRA 4DR6B 1TO1E 3PEFA 3N2KA 9MHTA 4PYJA 1ZONA 5B5SA 3QQPA 1FTYA 2YCLA 3I5MA 3OCUA 5F76A 3GRCA 5HA5A 3FNEA 2IU4A 1FU4A 3HZOA 1HPLA 4G8CA 3VRHA 1JIIA 1DP4A 1M2WA 3JZFA 3PE4A 1ND5A 4FZ3A 3PHLA 5D7NA 3V1MA 2HTEA 1EQUA 4B9EA 1P1KA 2VQ6A 3JR3A 5LXTB 3L8DA 1DJLA 1HDEA 4ZO6A 5FWDA 1PIWA 2TS1A 1HEIA 4OQZA 1ZA2A 5CA0A 3VH2A 3BMOB 1M0SA 3CE6A 2R8EA 3PFBA 1BTOA 1PNOA 1YCHA 4CKWA 3FRHA 2ZSDA 3OZVA 5JYCA 1ZXLA 4J7UA 4OM7A 3ILXA 3CLRC 5BYJA 1P2FA 3OKAA 4GECA 4IDPA 5JMOA 2MR5A 4FN5A 3LPMA 2PX5A 4XB6B 2GN4A 4YMHA 1U7TA 2OORA 3BOSA 3KKLA 3ZLBA 1FUIA 2R2AA 4PCUA 4Q3LA 4QGGA 3LDHA 4XASA 3QYJA 3SU8A 1YRAA 2P9HA 3R40A 4BNVA 2BGJA 2ZRQA 2R7LA 4KWCA 1T43A 2ALJA 4HWRA 5EERA 1A2QA 4OMDA 1NULA 1PEKE 4WUVA 5D6NA 2G1UA 1WDMA 1SB9A 4INJA 2HEGA 2R4QA 4UCWA 3DS8A 4X66B 1RACA 1L6IA 3IEKA 5DF1A 3WKBA 3W04A 1NW4A 4G0NA 3A3OA 1EXMA 2W4IA 3G9QA 4O29A 3EGWA 1UFRA 3E03A 5SV2A 3BA6A 3RANA 3UT6A 1GOTA 1HQDA 4CM9A 3C7DB 4MUXA 5F1PA 4D02A 4G89A 3DKIA 5HQTA 4AKSA 4UHJA 4C6HA 1PJAA 2Q50A 3T38A 4WZ6A 5LOVF 3IP9A 4PEVA 5CXSA 1DAMA 1FNCA 1MB9A 3KE8A 4BLQA 5KOHB 1QK3A 3U4CA 5EJ6A 3HVJA 3V48A 1J4AA 1Z07A 3G9XA 4CMEC 2O2JA 3AHGA 4OP1A 1GGMA 1RXEA 2ATEA 2JLCA 2PX6A 4W4TA 3SYKA 4DQ0A 5B7PA 3H9GA 5LA6A 3AJ8A 4KGZA 2ZDHA 1CQJA 1DC3A 3IERA 2E3JA 4G1EB 4NOJA 4LBVA 5EWJB 1F1JA 3T3HA 3F6CA 3OFVA 2ZRGA 4DLKA 1C1DB 1ETUA 1OVGA 5C8DA 2IXDA 2PG3A 3D2CA 3MZ0A 4KLZA 4M9CA 4C1NA 1DGQA 5HRAA 2PM8A 1STOA 3WK7A 1PUXA 3B1YA 4O2BB 3VYRB 1NM5C 3BWCA 4HSGA 3Q11A 2X41A 3I01M 1S3FA 1X7ZA 1W49A 1JTVA 2DQKA 2SCUA 3RS3A 2ZSAA 1FX0B 3GD5A 5BRAA 3KJIA 1CS4C 2HCJB 1RRVA 2XZDA 4M4SA 4YJDA 2Y92A 4ZOEA 3ORHA 2P6MA 1W30A 1X86B 3QFSA 3ZE6A 4AG6A 2OHHA 3LKBA 3I58A 1P2DA 1LW7A 1X7XA 5BSEA 3MF4A 4O1IA 4BQPA 2YV4A 1H69A 1QGAA 1RAAA 1Z8FA 2FFJA 3E22A 1Q12A 2JF0A 3AFGA 2FE4A 2P3QA 2A9KA 2I3DA 2DKFA 4D99A 4DIMA 1XFDA 4LE0A 4Y2QA 3B5IA 3TI9A 4MIEA 2UXBB 2Q6TA 2DWOA 2AI2A 4OD0A 1ZHHA 3BJZA 4NBNA 3MWLA 4NSNA 2YY7A 4FT4A 4D3XA 4UM5A 1FBTA 1RAFA 3N0VA 4HEQA 4TMZA 1E4EB 2WKRA 4IJKA 4G5RA 3DZIA 2H63A 1PWEA 3PFWO 1M1NB 5G3ZA 5KYWB 1JAHA 3DBOB 3I52A 1EAMA 2F9LA 1O0SA 4HG2A 4MUFA 4UZFA 4ZCLA 1L5HA 3ZCQA 1U2QA 4J1TA 4AWXA 2UZ4A 1UWKA 1F0NA 3JS5A 1GADO 2D7JA 5EP3A 3ZH9B 3DPIA 4WK6A 3BORA 1N7HA 4UMFA 2Q5JA 3SD7A 2Z1DA 2C2XA 4D82A 1O96A 1JDUA 4L9WA 3U3OA 4QBGB 1LZLA 4NKRA 1Q84A 1W29A 1Z4QA 2ODBA 3GF4A 4GU5A 3G49A 3VNUA 1DT5A 1Y6GA 1BGVA 4DMLA 3LZCA 2LCFA 3P26A 2QVCA 3ND7A 1E8DA 1L5FA 3KQHA 1Z0UA 3OLYA 1YS2X 3FZNA 3IKMB 1Z18A 3OZBA 1G38A 2HCFA 3ASUA 4KR0A 1MVLA 3GLSA 1ODIA 4R1OA 2WFAA 3RAEC 1T1SA 1YDMA 5K3OA 3TXYA 3WGQA 3K4PA 4XWTA 2C7PA 2REOA 2XYVA 1GVNB 4J16C 3CRNA 4UATA 4Z2AA 2ZROA 4AI6A 4JQSA 2W9XA 4RWEA 3I53A 4IHJB 4Q1VA 4M0FA 2RI1A 3SIWA 4UCFA 2R6R1 3V7UA 1UEIA 1IEXA 3B13B 3GG9A 4ZZ3A 3KFXA 1NHWA 1CZUA 5C5EA 2E4WA 4BWVA 3K8ZA 1N1GA 1SKBA 3K5WA 4JB3A 3OJCA 4GF5A 1P5HA 4KUHA 3NGMA 1QP0A 2OWDA 4LJSA 3T1QA 1R0XA 1YJQA 1JKMA 3INNA 2I7TA 1X1EA 4PTZA 3EVTA 3V4PB 1W581 3GN1A 3WK6A 4B40A 4YV2A 3I61A 2Z6QA 3LC1O 3WKDA 4U6SA 2FZEA 3MINB 3PNOA 2H2HA 2D2XA 3MJCA 4X91A 4X1IA 1M8JA 4Z7OB 1EBBA 4P4GA 2FX2A 2HCRA 5DHRA 3SR4A 5JDIA 4ACBA 2FJPA 3ET4A 1YVDA 2BF7A 2EV9A 3CRQA 4X5OA 1ATZA 3V8NA 3HNRA 4EEXA 3NOQA 4OFWA 2BFDA 4EKEA 3TUZC 1N0UA 4RMNA 4OGGA 5I3CA 2GHQA 2PXCA 2VCYA 3DD1A 1L4BA 4CHTA 5EKDA 1G3UA 1HLDA 3GVPA 4ZZ0A 3TAUA 2JG3A 1JG1A 3KQSA 4ZEXA 1XTIA 4A8TA 3BWVA 3O2NA 1XROA 4WD3A 5K6RA 2EGWA 1QAQA 4U3JB 4L8FA 3VQTA 1SA0A 1TCVA 5I9LA 1Q5PA 2N3ZA 3AQIA 2QU7A 5BWNA 2G0TA 3OJFA 3VPFA 4I3HA 3ZEAA 3LPDA 1S4MA 1VPTA 1ISSA 1Y1PA 2ZE5A 3N2KB 4FW9A 4AIRA 3P5SA 5JJCA 1SXQA 1QZXA 3JQQA 4Z4QA 3E3AA 3TLXA 1SUAA 1ZK1A 5DHPA 3WLAA 1OE0A 1S8AA 1VB5A 2VZ8A 1EK5A 2QENA 2J08A 3A1TA 3V8EA 4DIBA 1V9LA 3DDNA 1WKVA 2AR0A 2VDOB 2ZR8A 4ZWNA 3CV3A 5KYUA 2D7DA 2P2NA 3L0YA 4R01A 4X7RA 3NFYA 4II2A 1XJCA 1QZUA 2DTEA 1J8YF 1W85A 4BQEA 4BLVA 4U7TB 1E1DA 2P1RA 1ZGJA 1FVFA 1A9RA 1RXCA 1Z82A 3OLQA 3QJGA 3ZLJA 2AD5A 1ACLA 4FLMA 1NE7A 3KKEA 4N5MA 1HXHA 1J49A 5F78A 1HLPA 3N07A 4L85A 5C8YF 1TFUA 1GZ5A 3CM0A 5EC8A 2H85A 2IC5A 3VI3B 4N48A 1AGRA 2WU1A 2MU1A 4WZZA 4E2WA 4MGEA 3V1UA 5AKYA 3EVNA 1QNLA 4MROA 2DULA 2FSVA 3G8AA 4PRYA 4TTTS 3WNCA 1PR1A 3ZC3A 1VJRA 2NQTA 1YJBA 2HMAA 2Z2ZA 3OWHA 1P74A 1NIJA 4QVGA 5C37A 3N6VA 3LW8A 2ZYWX 3JYOA 2QYSA 3ZK7A 2ZJ5A 4BP9A 1A8PA 4QGSA 2BTEA 1WOYA 1B8OA 4GI3A 4HR7A 5GADl 3C3XA 1UOEA 5AVRA 5ALQA 1FLDA 1ZOLA 2OHGA 2XYRA 4D0RA 3P97A 4DLRA 3KU1A 1DJNA 1SCUA 4MA4A 4F1KA 2YV5A 1SQ0A 3LMKA 5HZKA 5LKRA 4M8LA 4ZRMA 2VP2A 2EHDA 4ARZA 5KWJA 5LLTA 5KCZA 1MGOA 4H31A 1S8OA 4Y6OA 4J2TA 4Y2JA 3AM4A 5LA6B 2YYYA 2QZ9A 3V9PA 1MNQA 4C88A 1CQJB 3NHZA 2BEUA 2HKIA 3IPLA 3P9ZA 5EP2A 5C7IO 3PC7A 1Z56C 3DP7A 3PXUA 3Q9SA 3BMNA 3OFNA 4FYKA 4HZIA 5JAQA 2Z6AA 4WZBA 1ONSA 2W6ZA 1U80A 3TSYA 3HVIA 2PY6A 1IC6A 1U0BB 2A1TR 2H2AA 1X7ZB 4IIXA 2IGBA 2SCUB 4DYVA 4B7CA 6PFKA 3MCZA 5JATA 2HU8A 1G7SA 2FLWA 1F8FA 2P5YA 2WWWA 3UWMA 2BFCB 5KB3A 1ZRSA 2B4YA 5K4AA 3ZIAA 4BO6A 4Z8YA 4LRUA 1XG5A 4KMSA 4TM7A 3EYWA 2WJHA 3RFXA 4GX2A 3E22B 4WY2A 4R3WA 4RTRA 1YR9A 4ND5A 1D07A 3PNVA 1R74A 4E7OA 4BP3A 3HR8A 3U7RA 4EHHA 2I8CA 5HJEA 1UPFA 4LQDA 3HKDA 5JCJA 5KVSA 3UWDA 3FLAA 1Y7IA 4XJSA 1MW8X 3MHTA 2PHZA 4JYBA 4NENA 5AT1A 3GGOA 3MAAC 5AM1A 1PWHA 1U0FA 3SOPA 3A4IA 5LXTF 4MHOA 3WTCA 2PPLA 4CF6A 1FDUA 4F4CA 1ECPA 4GO1A 3K70D 3AY7A 1GNPA 3UMMA 1NNSA 5GIOE 3OLXA 1UJNA 1ZNYA 4CG2A 3K6JA 1L5HB 1TD1A 2OZPA 4JJEA 3DTVD 5DBIA 1TLLA 2G09A 4J2HA 4DR3B 3VFDA 2P4SA 2XMCA 3NXKA 3ETCA 1F12A 1FP6A 2OK7A 1ODKA 2C92A 4I9GA 4NG4A 4JI3B 2XNKA 3AUYA 2I4MA 3PKIA 4OXXA 1K0UA 2FPPB 3N3AC 4JC0A 2FEOA 1ULSA 4MQMA 5SYMA 1IN5A 1G6Q1 1VDMA 1CY2A 4ZVMA 4AZVA 4YCSA 4F9GA 2FGKA 3KAQA 4AYTA 3E23A 4RZHA 1D4ZA 1NSTA 3U3RA 2CB9A 2NYAA 3DO8A 1AQ6A 1E64A 1VRVA 2W7TA 2PK3A 3D5TA 3VU9A 4LF4B 3KOZA 3CS3A 4XQ0A 2YDXA 3PNPA 1P9OA 4RNDB 1WP9A 2GBIA 3K4QA 1JJIA 3U31A 5JO9A 4KYVA 4J3JA 2DQ4A 3OQHA 4BMYA 2WUWE 1NBMA 1USKA 4IOCS 3COVA 1TUEA 3S70A 4GW3A 3WRVA 4RTNA 1FU8A 3COWA 2PRYA 3CUTA 3SR0A 3TVYA 4AJHA 2V7PA 1YC2A 2KWIA 2XB8A 3Q0EA 4JLNA 4XA8A 1XP8A 4G8JA 4HDMA 2E6KA 3JQ9A 4KAFA 4D9JA 3FCAA 1YJ5A 3A6FA 4QO8A 1V47A 2IDZA 3TS1A 3VOAA 2YXPX 5IAAA 3FOFC 2PLRA 5T64A 3R0XA 1QTNA 4W7IA 3KYJB 5DNYB 1G3IA 2XVXA 1DCTA 3A9WA 1GGEA 4MUNA 2E55A 4LJYA 2F3QA 1MBZA 4B2LA 4OXIA 1G0NA 1TQ6A 4M0DA 1V5IA 1XEAA 2R00A 4E3WA 1DFUP 1NY6A 2V3CC 4MQ4A 4UHHA 4X1IB 2HZBA 2AZMA 1USWA 3A04A 5HK8A 1YI1A 3PXCX 1Z8NA 4LDPA 3H2JA 5IX8A 1KYQA 2OY0A 3FM9A 3LUBA 4BNLA 1H2XA 2BJWA 2CHUA 2OGUA 4Q9AA 2PUHA 5T5QA 2BFDB 3NWOA 3OZEA 3ND9A 3PRKE 3QXSA 2R68A 1UK7A 4FR5A 4GQBA 1XO1A 3EIWA 5EJMA 4GGMX 1UH5A 1NMQA 1VCNA 2GWHA 1G2IA 2PGXA 1C7JA 2VL7A 3H19A 2OO7A 2VRNA 1AKYA 3NT4A 3GRVA 1PF7E 1DRKA 3HMKA 4FEYA 4ZAXA 2J5RA 4Q6BA 2FCAA 3IILA 5EIEA 3DBRA 5LKAA 3PPYA 2ZIAA 4TLAA 2A5FA 3WZMA 3R0ZA 3DMHA 4UPDA 1SA0B 3PEVA 4M38A 3FPSA 1OT5A 1A7JA 3GD7A 3TQOA 3ROXA 2HLDD 5FYDA 4YRFA 4GH5A 3KLMX 3W78A 2DUWA 3R4VA 3UOWA 3U9TA 1XCPA 5UKDA 3OECA 1ADGA 1EINA 2AFHB 3BSFA 3F1KA 4LXGA 1R88A 3EAQA 1OZAA 1YT5A 2YWGA 3EH1A 3CONA 5B6PA 1GPLA 1SPBS 1G9XA 3MERA 3HCRA 1QFXA 4D9IA 1S2LA 5AHXA 5H68A 5KYUB 3DVQX 1QHFA 1THTA 1AF4A 4HWPA 5IC6A 2BT4A 3JQBC 4DRYA 4MEAA 4LOLA 4C0WA 3CEHA 4B3BA 4HYQA 3V55A 1XU4A 3AKCA 5A6VA 2DBVO 2FEAA 2FWPA 4BNNA 1KAOA 5L3ZA 5FHRA 2A5JA 3U4GA 1Z35A 2JFNA 3T12A 3BKWA 2W2KA 4WCDA 3RUCA 2P35A 3LD9A 1AKMA 1R15A 2JGEA 2GHTA 3GAMA 3J81k 3M4JA 4H4KA 4X6UA 1N2SA 2PDAA 5HKKA 3L8FA 5EIFA 4EOGA 3TECE 2O5CA 4DCOA 3NEJA 1TPZA 2QPLA 3AY6A 4J8PA 4V0QA 1TAUA 3VH3A 1SKMA 1ZC3A 4LG1A 4MI1A 2OMKA 4W5OA 1VDZA 2B4KA 1YDFA 2Q5CA 2IHTA 1TQ8A 3DOOA 5TGTA 3GRRA 4DVGA 4Y0VA 4F2DA 2GXSA 3G2KA 1BN6A 4RD3A 4QLBA 1EFRA 4UNIA 5IZ4A 1ZOIA 4NZNA 5CNIA 4YFVA 1YIDA 2BELA 5HOEA 1CT9A 1FFXA 3TCNA 1EUYA 1SCUB 5GOZA 4G1CA 3EWSA 3NHWA 4HDKA 2D0OB 4S1PA 3TE6A 1KZ9A 3HFGA 4ICIA 1ZQ1A 1KVUA 4HB3A 3NPAA 3GRZA 4BXOA 2FNAA 4ARZB 4RHXA 2FRVA 4AZSA 2GEBA 3HDGA 3UAWA 2VQFB 1GZ3A 3L6BA 4LKOA 2G07A 3M9XA 4D8UA 2VDNB 2GF0A 2FRXA 1A2OA 3BXEA 5KTTA 3FOZA 2IKSA 3P9YA 2O20A 1Q6YA 2WVAA 3F9IA 1SXJD 2BEUB 4IF4A 1I2BA 2ZYAA 3ROPA 1JS1X 3X1DA 1ZK2A 5JS7A 2TMGA 4Q3EA 3VC7A 5ARBA 1A5ZA 4D42A 3DHEA 4WZBB 1M72A 1U11A 1MC5A 1VJ1A 2YNMD 2DBYA 4J6FA 3NYRA 3TZQA 1JECA 1Y4AE 1NLYA 2GD2A 3JZIA 3CISA 4HUQA 1U7XA 1YCDA 3CZRA 3OG9A 2W00A 1Z68A 4H35A 4YAFA 3OC0A 1JFRA 4Q4CA 1BMQA 2PKYX 4FBLA 3S0JA 5A6SB 1Z2CA 3RSCA 4WZAE 5K1ZA 2IZ6A 4R9SA 4KR6A 1AV7A 1SBHA 2VQEB 4K9OA 3AWIA 3FAKA 2UUPA 3V6MA 3VAAA 2O7RA 2GPAA 2IYAA 2YW2A 3E82A 3HN7A 4MRAA 3OQIA 5FTJA 2OP1A 1YU9A 2IZ0A 4CM8A 1FLAA 4URWR 4EMTA 2G28A 3AVOA 4GP7A 1VP9A 3EXG2 1NF2A 3HKDB 3ZE1B 1L0BA 2NVOA 4QXPA 1TJPB 3KLOA 4LDNA 2FSGA 2JLSA 2NXJA 2J3DA 1N4DA 2PPVA 2H92A 3PSAA 1ML4A 4JLVA 2GPNA 2O57A 2L69A 4NENB 1NL3A 4ZYWA 2VLIA 1EBUA 1U7OA 2WDZA 2YC4C 5FBKA 3KV3O 3RG2A 3JQPA 1JDBC 1SG6A 2FEPA 3PWZA 4PGHA 4Q3OA 4Q9KA 1EM6A 3SOZA 4TOIA 1M2NA 4LOKA 4R8LA 2QR3A 4IIHA 2J3JA 5FBRB 1BE0A 1EK1A 3ZOKA 3OU6A 1HE8B 4YWHA 4DDTA 1J8FA 4CW7A 5IS2A 1IN4A 4RETA 1VLHA 4AS3A 3QOFA 2OPHA 3D7NA 5EAIA 2FXVA 5DXJA 3RHTA 1JLMA 3SX0A 4QOJA 4HXGA 2Q1UA 1SOUA 1KP3A 4UEOA 1XPJA 3B3FA 4RACA 4YB8A 5IN5A 3TN7A 4ZP1A 3VYUB 5BSWA 2FZ5A 2DECA 5NLLA 3ZWPA 5JOQA 3PGA1 1M5UA 3H3XA 3I4CA 1XJQA 2O6HA 1AQYA 1NE2A 1SHTX 2FKNA 3CN9A 3T0GA 2EF1A 3ZGOA 2BWJA 3VU9B 4DZRA 1N0VC 3L8GA 5ALHA 1S9DA 3QP9A 4RF3A 4H4DA 2HYIC 1HE5A 3NWEA 3V7NA 3CMCO 4C4RA 1MEEA 4R8KA 1F2TB 2CLHB 2FH5B 2O0HA 4L07A 2JZCA 4NCXA 1DOHA 2LCQA 4D45A 1EHYA 3OLVA 3KQOA 2B7LA 4P34A 4WXHA 3BA1A 2XUJA 3ZHRA 1LW6E 1AXGA 1XTRA 1PZNA 2FB9A 3ROEA 2W4MA 3A2NA 3IB6A 1RHQA 1KMHA 1JAZA 1OC4A 2EWMA 4WOKA 1H4VB 2AQHA 5AVXA 4BP8A 4TMYA 1PZXA 5EY5B 1ZPDA 4M1OA 5IUNC 2JLBA 4JY7A 4BLRA 3DG9A 1ZD2P 3HWX1 1O97C 2WT8A 1M6NA 4WKCA 1TVMA 2WMNB 2YASA 1TK9A 1G3QA 4QPZA 3LY9A 2OECA 3OFSA 4QUDA 4Q00A 3RKRA 2GEDA 4XYGA 1U2ZA 4UKDA 3ZD8A 4WAUA 4Q9IA 2HBQA 4C2AA 1KSHA 4Q18A 3KJGA 2WINI 4ZAGA 1MTZA 2J0QA 1UBHS 1FDIA 3KYIB 4HQ6A 4AJOA 4NZOA 5BSTA 2JD0A 4CIWA 1MG0A 4OSEA 3GP8A 4RIHA 1MORA 2QW1A 1WU8A 1OYYA 3RHFA 1TJNA 1WMEA 2R5NA 5AM0A 4MVWA 3TB4A 3KQNA 1M1ZA 1N2IA 2H18A 2JFQA 3HDYA 5DZSA 4E4YA 4AG3A 2BKLA 4IIBA 1V4VA 2VSNA 4Q03A 2WDPA 3LT2A 2XQGA 3F47A 1NUSA 1O6BA 2GSWA 3I5AA 3MPUA 4TKLA 3G7UA 3T9BA 3HSYA 4UM8B 3UZUA 2O14A 5HZMA 1FDSA 1QYVA 2P0EA 3L7KA 4WCFA 1SIWA 4YJ3F 4FWBA 3FSJX 4IXWA 1X74A 4X3CA 4JMLA 2HY7A 2X2PA 2Q2WA 1NN3A 1LLCA 3CW8X 4CL8A 4E3ZA 3DT6A 2HU7A 4KPFC 4C6RA 4OHFA 2HA4A 2TYSB 3O4FA 5L9AA 2P75A 3GEPA 1OFVA 2P41A 5H80A 4EL0A 3MT0A 5GJWC 5A5FA 1CNMA 3KL4A 2FY8A 4O4HB 1J39A 4HNTA 3I04M 1YSCA 4DRXA 1YZQA 2KQUA 2OD9A 2ZBPA 3OQ6A 4L57A 4UNSA 2WYIA 4KLRA 3M6UA 3SG0A 3I9NA 4BO7A 2PWAA 4F93B 1IHOA 5K8JB 3AGQA 2JFWA 3L0OA 5GWXA 1U1EA 2R5FA 4C29A 5JECA 3MTGA 4BMCA 2GI4A 3OD1A 4IUDS 1UQTA 5LCXA 2J5BA 1H2WA 2ZTUA 4PZDA 1RYYA 3EG9A 3U37A 2RHDA 1OH6A 5TJ9A 4MQFA 5IHPA 1V25A 2AG5A 1FTNA 4MRMA 2PNWA 3WGZA 2WIDA 1GLVA 3OCCA 2V9ZA 1DBWA 1VRWA 2HF8A 4L9SA 2I8LA 2WF9A 4DZZA 1UM8A 3ZUPA 2W2KB 1N32B 1ECFA 1KOGA 1QUEA 2A0KA 2ZVQX 3JD4A 2F4VB 1KXJA 1L3BA 1U7ZA 4GYKA 2WG0A 4JASB 3FHCB 4AUEA 2C2BA 3FF1A 3LL7A 1IZZA 1KJIA 2NW6A 3D3QA 1EE1A 2JGFA 3H9EO 2BGTA 3MM4A 3I0NA 2VJCA 3JD2A 4RPKA 4TYQA 1JNYA 3BGWA 3VBEA 1ZOPA 4QYSA 5F77A 4DMHA 4ER3A 4RL6A 1G8MA 2QL7A 1ZKMA 4J75A 1D7AA 3HV0A 2WB2A 5DGTA 2NXCA 4OHMA 2P1DA 1BKSB 4HDAA 3ACCA 1PJ2A 2NVBA 3WDSA 5AM2A 1U04A 3OM0A 2Q4DA 2V45A 3IODA 4HDKB 5LC1A 2AC7A 1C8KA 5KS2A 4LRXA 3EEBA 2D06A 3UHFA 4BXOB 4MKGA 3Q8LA 2C9OA 4UEWA 1PYGA 2GSDA 4RK0A 1DRJA 1TUIA 2FA9A 4PICA 4Z49A 1LTHR 5KNLA 1FQWA 2VT3A 3F8TA 5J63A 1TEXA 3TD2A 3WQRA 3VR4A 3CZ9A 3ZI4A 3A9SA 2X77A 3L7NA 1ZD5A 3RWBA 2EX4A 4NDZA 2Z08A 4C4OA 3DP9A 3QPUA 6Q21A 1DLIA 1JEDA 2C9ZA 2DUJA 2FUG1 3EJWA 1WTAA 3IQZA 3IYLW 1I3MA 1SK8A 4HN9A 2E1PA 4TKZA 1S96A 2C9YA 16PKA 2VUSA 4HUQB 2CNNA 3AWDA 1P4JA 3GDFA 4I3GA 5IT5A 3AKZA 4ZOAA 1NI4A 1OGYA 3REQA 4XJVA 3QY9A 5BR8B 1E79D 2GVZC 2II6A 3ZD9A 2G71A 3SLKA 3EMBA 2F8TA 3STUA 4R3UC 1P6UA 3W5BA 3TZHA 4ZOBA 3P0FA 1JIQA 3IVRA 3ZXYA 1GSAA 4DWVA 2J7PA 5JYDA 1P62B 1D4FA 3CT6A 3G3EA 3OQIB 1KK3A 2GNPA 4UU0A 1JN0A 3B8HA 5H70A 1BOFA 3EFOA 4Q4HA 1PDWA 1U0HC 1YDWA 5KTNA 4GLBA 1YE5A 3Q5DA 3QVXA 3DMYA 2C03A 5B1YA 1ZX1A 1I33A 1NSFA 1OILA 3D1LA 1DCFA 4OOFA 1UOPA 1U28A 2AMYA 4RTPA 1Y34E 4L7QA 5EWLA 3MCAA 4B85A 3RH0A 3GJ8A 3U3KA 4KNVA 1NW8A 2XZTA 3PB3A 3RU7A 1LZKA 3GHYA 1M3SA 2JJ2D 5KPDA 4JBLA 3OZDA 3GUZA 2GZAA 2XMDA 5HGJA 6YASA 4V1CI 2IS4A 2CZGA 3RYTC 3T5AA 3F2IA 4HAZA 5EKXA 4ZU1X 2QD3A 1CTQA 2JJMA 3NI2A 1UAAA 3CZBA 2EATA 2GS9A 4MV5A 4XQEA 3OPYB 3VHLB 4EFLA 3SKXA 4QDXA 1DXQA 2PS3A 2HFKA 3TTVA 1WM1A 4X95A 1PR3A 5LUAA 3TUIC 2GYYA 1VJTA 2UZ1A 5AHWA 3O95A 3UQYS 4R05A 1R0BA 2QX8A 3IUQA 3QYFA 1FYWA 2YWEA 2WFZA 2QN6A 1NR5A 3QWIA 1PJCA 5EJGA 4XVCA 3U81A 1ZJYA 2X9NA 1OHHD 4LNAA 2Y93A 4C03A 1I51A 2WM9B 4S12A 5DE3A 5DNCA 1HFEL 2HNKA 2OZKA 1IPHA 2XRYA 2W2QA 2FN7A 2PX2A 2UAGA 2FI1A 4XGRA 1F5SA 1YZNA 4P93A 3VSDA 4L08A 1KMHB 2XUDA 5EQTA 3RJZA 3RU2A 4EX6A 1GRRA 3ZE7A 1A9XA 5I45A 4R81A 5JAMA 1N2XA 3EUFA 1EB9A 4GLJA 1Z0KA 2R4TA 4Q15A 4HGYA 4KSBA 1CY8A 1Z63A 1D2NA 2PLWA 1KJQA 1JT9A 5IM4A 4E12A 2NZJA 1N2EA 1FFAA 1QX4A 2BFWA 1ZD1A 3C87A 2DFVA 3K1AA 3ZWWA 3JYHA 1BSVA 1DTWA 1YBVA 5DSXA 4ZMSA 4L2IA 3V80A 1KRHA 4ZQCB 4GI2A 5CYOA 4JXZA 1ID8A 4YRIA 1E7YA 4WLFA 5E3IA 5T7BA 4AJLA 1VFPA 3DV0A 3QENA 2IHVA 1W0JA 1Q16A 3IP3A 3GU3A 4GC5A 4PC3A 3GUUA 4MYHA 2OVBA 2GFIA 4MLDA 4BKPA 1X1CA 2YN0A 3K9HA 2D0PB 4IRXA 2JKZA 1H8EA 3D9QX 5JTUA 4JI8B 3QXHA 4DYDA 1D6NA 3HY3A 4EF6A 1LLUA 2W6IA 3FI9A 5KREA 3I9MA 2AJLI 3QX8A 4LY0A 4E5PA 4G86A 2G17A 2OAQ1 3CF5S 3UEOA 1ZJJA 2XCSB 1AUVA 1KP9A 2ZBFA 4K9NA 4RUKA 4WCFB 3ROKA 1IH8A 1QDEA 4TWZA 4CFZA 1YS9A 1PQYA 2XCIA 1V1JA 1CJCA 1VCMA 2E4AA 4Q9NA 3WJ7A 5EXXA 3RS9A 2RGEA 4Q7EA 2B4AA 3ZLTA 2WQ6A 1D0IA 1IONA 4JU8A 4J0EA 1HLFA 3T7DA 3TNJA 1I3OA 1H3NA 3LVBA 4IM7A 5D86A 3I2GA 1MOQA 4ND3A 3T7KA 3BH6A 3KZCA 4RPGA 3C6YA 3LM8A 2ZULA 4DRXB 4ACAA 3PGLA 2IPAB 4PQRA 3HVRA 3V7YA 1V4NA 4MWTA 521PA 4X8MA 1P91A 1N92A 3EC7A 4U7FA 2PEZA 4J90A 5E9WA 3N8NA 1C9NA 1V8DA 3X0DA 2O4CA 2NP7A 3GMIA 4I55F 5F2OA 2FSSA 4MKHA 1SXIA 1B8PA 3EG9B 4J07A 3W5JA 4BC1A 2D2EA 3OU2A 4MQFB 1ZVVA 2PWBA 1JL3A 1PV1A 4PO3X 1W36C 3QJYA 2CXUA 5LZ2A 3FIUA 1JVNA 1AUQA 1P2VA 2IHUA 3ENNA 1DO2A 2Q0QA 3KJFA 4M1ZA 4UMDA 3LC7O 1VCHA 2RK3A 2JI7A 2BFPA 1Z15A 3H9QA 4HVLA 1L9XA 3MTBA 5CVTA 4E1VA 1PDOA 4UHEA 1XXHE 2ZZKA 3IKVA 3SMVA 2I33A 1KSJA 5A5EA 4DT1A 4JIMA 1KQPA 2BGMA 3CZAA 1B42A 5HHTA 3WKAA 2K7ZA 3B1KA 1CJSA 4ZVUA 1EJBA 4IOKA 2QMOA 3UJ3X 1RWPA 4CNQA 1DAIA 3O2JA 4KN8A 2IODA 3AI1A 3GDOA 5GV8A 3UPUA 4EPWA 4EZIA 3PT5A 1NMEA 2AOTA 4RIGA 3HJRA 4X7PA 3A6KA 1NSYA 4MR8A 5B1HA 3ULKA 1IBMB 2GD6A 5F52A 3G0DA 3N2NA 1DJPA 1N7GA 5I6DA 2CHGA 5B2FA 1HEUA 3B6EA 3VYTB 1U98A 3EZLA 3PBKA 1E32A 3RSGA 4L6CA 4OLHA 3V8MA 5HUHA 5FPTA 1HDCA 4W9RA 1CR1A 1D09A 2VPZA 3IFSA 1JVBA 3WYEA 2OHVA 5BQPA 4CNBA 2X42A 4OK5A 4JWKA 2G40A 2QS9A 4IV8A 2PXHA 1ZH6A 3ZDEA 1Y9EA 1GA1A 2ZTMA 2IOHA 1L2TA 1IHXA 3D0QA 1P29A 5EUBA 3RI3A 1L7NA 3KB2A 1L4HA 2C2OA 1DDIA 3EMVA 4IGFA 4MCAA 1K6IA 4B6FA 3FY4A 4XPZA 4KQJA 1GQOA 5G0UA 4EGCB 1NI4B 3REQB 1Y4SA 4XM0A 5CFZA 5A7FA 3KSAC 3GLFA 1GGVA 5C5IA 4G5SA 1WEHA 1S01A 2PL3A 3E35A 3HCBA 2Z5VA 1WHSA 2XNJA 4PZUA 3N0WA 1WCWA 2QR2A 2NACA 3O3MB 1M7GA 1E2EA 2HLPA 2FEKA 3WIDA 4C4TA 4GKVA 1TT7A 4JLUA 4DG5A 2GUWA 5LZ9A 4URZR 3BMCA 3KALA 4O2AA 4A82A 5IAJA 3FRJA 4NZMA 1R9NA 1AZLA 2F3TA 2HK9A 3CZCA 3EFOB 1QIFA 3T9DA 4Q4HB 4X7BA 2AH5A 4AJJA 1QGZA 4O4HF 2DCUA 2EZ4A 2GAOA 2W0MA 4FD2A 1M8FA 3HZHA 4C5AA 1OI2A 2H29A 1TC2A 4FKZA 5EWLB 3ZS8A 3ZZNA 3B6KA 4DQDA 5C3UA 1KHTA 4PRZA 4EJSA 2FMHA 4BKOA 3S8YA 1JFTA 1WVMA 2OXCA 1P7VA 2OV2A 2W2LD 3KUCA 2R8OA 2QP9X 3OE7D 4Y18A 5DKFA 4MUYA 2O8FA 3EMKA 4P98A 5ALFA 3TLKA 4IMIB 5KTPA 1DMSA 4RH1A 1F17A 2MJLA 2ISCA 3QUCA 2AF3C 4IJMA 3M70A 4CQJA 2R751 3Q8WA 3RWOA 4LYGA 4Q39A 3VR6A 1IOWA 3FOWA 5BQOA 4HQRA 3WLNA 2FOIA 4JP1A 1KNQA 1QG6A 1Z75A 4TKVA 4HXYA 1G8SA 1SEPA 2P4UA 2WILA 5FUXA 4I6JA 2UZ1B 1SQ5A 2PVSA 1GDTA 4GRIA 3FCYA 4KXQA 2RBEA 4IRMA 3TB6A 5K0FA 4O59O 4HRAA 1OXSC 1Y6ZA 4HXFB 4EKGA 4ZV4A 3FYUB 3M3DA 2O5EA 2XY4A 4I4IA 1FQKA 1FRQA 3OCJA 1E2HA 4FDLA 4I4TA 5C35A 3X1MA 5GVSA 2OYCA 4G9EA 4KTTE 1Q0QA 3PUYA 3HBNA 3SZOA 1VPDA 1CUXA 4MYRA 5JQGA 1NHGA 1ABBA 1DEOA 3BILA 4RH3A 3QSGA 5ALYA 3L06A 3C6MA 3TCXB 2COEA 4LF6B 3AM1A 1P0FA 3G8CA 3SHWA 3UJAA 5EHXA 3ETJA 4QM7A 5C1DA 5F1YA 5HCIA 1A9XB 4QQFA 2R87A 3O90A 1E9RA 2Z6UA 1WB4A 3CGGA 4S1WA 5DCWA 4DV4B 1W19A 4HUJA 2RH9B 3C3MA 4J4BA 1XWFA 2ZTSA 1KK1A 3HTXA 1UCFA 4HDSA 3WYDA 5P21A 3TL6A 4CF3A 1RRFA 1P8JA 4PZZA 4ZAYA 3LUDA 3NONA 4PM4A 3K1AB 3R7DA 3ET5A 4UFOA 4X00A 1SD2A 1OBFO 3KSBC 3ZWDA 3R3YA 1ONOA 1DTWB 4QXMA 3EODA 1HR0B 4L2IB 1Z7GA 3GFVA 5LVAA 2JK0A 4KP7A 4OU5A 2H06A 3F6YA 4IDDA 5K0NA 3DV0B 5CIQA 1EESA 3D5QA 5SY6A 5C31A 1ZD4A 3H0CA 5CJPA 3OIGA 4XRRA 3EAFA 2A86A 13PKA 3N3BC 5FEMA 2MSCB 3C8UA 3B89A 5FEUA 2OK8A 4WVFA 1NF8A 1K7FB 4FN4A 4GUDA 1EH5A 4UASA 2O19A 1OAOC 3FZEA 1FFCA 4CUJA 2HN9A 3HS3A 4D1YA 4D8XA 5IVHA 1PNVA 2XITA 5E6UB 4U2FA 1Y6JA 1UK8A 2G5GX 4JJ6A 3G0CA 5DGCA 3T99A 1K3FA 1R7RA 1XD2A 2DY0A 1KGDA 2VPXA 5THQA 3ZEIA 5B6IA 5BRJA 2ZM6B 5JMPA