The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
175
|
sequence length |
590
|
structure length |
556
|
Chain Sequence |
b'AAPLVAPNFITEIIERDLEAGKYPRVVTRFPPDPSGYAHLGHVFASLLDFNTARQYGGQFNLRMDDTNPELARQEYVDSIADDLKWLGLDWGEHFYYASDYFDRYYAYAEQLIRQGDAYVESVSPEELSRLRGNATTPGTPSPYRDRSVEENLDLLRRMKAGEFADGEHVLRAKIDLTAPNMKLRDPVLYRIVNKPHFRTSDEWHIYPAYDFEHPLQDAIEGVTHSMCSLEFVDNRAIYDWLMEKLNFDPRPHQYEFGRRGLEYTITSKRKLRELVQAGRVSGWDDPRMPTLRAQRRLGVTPEAVRAFAAQIGVSRTNRTVDIAVYENAVRDDLNHRAPRVMAVLDPVKVTLTNLDGEKTLSLPYWPHDVVRDSPDGLVGMPGGGRVAPEEAVRDVPLTRELYIERDDFSPAPPKGFKRLTPGGTVRLRGAGIIRADDFGTDEAGQVTHIRATLLGEDAKAAGVIHWVSAERALPAEFRLYDRLFRVPHPEGENGFMRYLTPDSLRVLRGYVEPSVAGDPADTRYQFERQGYFWRDPVELERVLVFGRIITLKDTW'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Deinococcus glutaminyl-tRNA synthetase is a chimer between proteins from an ancient and the modern pathways of aminoacyl-tRNA formation
pubmed doi rcsb |
molecule keywords |
Glutaminyl-tRNA synthetase
|
source organism |
Deinococcus radiodurans
|
molecule tags |
Ligase
|
total genus |
175
|
structure length |
556
|
sequence length |
590
|
ec nomenclature |
ec
6.1.1.18: Glutamine--tRNA ligase. |
pdb deposition date | 2006-08-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00749 | tRNA-synt_1c | tRNA synthetases class I (E and Q), catalytic domain |
A | PF02637 | GatB_Yqey | GatB domain |
A | PF03950 | tRNA-synt_1c_C | tRNA synthetases class I (E and Q), anti-codon binding domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Glutamyl-tRNA Synthetase; domain 2 | Glutamyl-trna Synthetase; Domain 2 | ||
Mainly Beta | Beta Barrel | Ribosomal Protein L25; Chain P | Ribosomal Protein L25; Chain P | ||
Mainly Beta | Beta Barrel | Ribosomal Protein L25; Chain P | Ribosomal Protein L25; Chain P | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | HUPs | ||
Alpha Beta | Alpha-Beta Complex | Glutamyl-tRNA Synthetase; domain 3 | Glutamyl-tRNA Synthetase; Domain 3 |