2HZ7A

Crystal structure of the glutaminyl-trna synthetase from deinococcus radiodurans
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
590
structure length
556
Chain Sequence
b'AAPLVAPNFITEIIERDLEAGKYPRVVTRFPPDPSGYAHLGHVFASLLDFNTARQYGGQFNLRMDDTNPELARQEYVDSIADDLKWLGLDWGEHFYYASDYFDRYYAYAEQLIRQGDAYVESVSPEELSRLRGNATTPGTPSPYRDRSVEENLDLLRRMKAGEFADGEHVLRAKIDLTAPNMKLRDPVLYRIVNKPHFRTSDEWHIYPAYDFEHPLQDAIEGVTHSMCSLEFVDNRAIYDWLMEKLNFDPRPHQYEFGRRGLEYTITSKRKLRELVQAGRVSGWDDPRMPTLRAQRRLGVTPEAVRAFAAQIGVSRTNRTVDIAVYENAVRDDLNHRAPRVMAVLDPVKVTLTNLDGEKTLSLPYWPHDVVRDSPDGLVGMPGGGRVAPEEAVRDVPLTRELYIERDDFSPAPPKGFKRLTPGGTVRLRGAGIIRADDFGTDEAGQVTHIRATLLGEDAKAAGVIHWVSAERALPAEFRLYDRLFRVPHPEGENGFMRYLTPDSLRVLRGYVEPSVAGDPADTRYQFERQGYFWRDPVELERVLVFGRIITLKDTW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutaminyl-tRNA synthetase
molecule tags Ligase
source organism Deinococcus radiodurans
publication title Deinococcus glutaminyl-tRNA synthetase is a chimer between proteins from an ancient and the modern pathways of aminoacyl-tRNA formation
pubmed doi rcsb
total genus 175
structure length 556
sequence length 590
ec nomenclature ec 6.1.1.18: Glutamine--tRNA ligase.
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain
A PF02637 GatB_Yqey GatB domain
A PF03950 tRNA-synt_1c_C tRNA synthetases class I (E and Q), anti-codon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1160.10 Mainly Alpha Orthogonal Bundle Glutamyl-tRNA Synthetase; domain 2 Glutamyl-trna Synthetase; Domain 2 2hz7A03
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2hz7A04
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2hz7A05
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2hz7A01
3.90.800.10 Alpha Beta Alpha-Beta Complex Glutamyl-tRNA Synthetase; domain 3 Glutamyl-tRNA Synthetase; Domain 3 2hz7A02
2J5BA 4U7JA 3COYA 5JBNA 3DLAA 3DPIA 2D54A 2PG3A 4X0EA 3IMEA 1IQ0A 1LI5A 4PBSA 3FNRA 3LOQA 2ZJQS 1WXHA 3TZLA 2O5RA 2A88A 2PIDA 4AQ7A 2A1TS 3TQIA 3KT3A 1OWPA 3CLSD 1YUMA 1VL2A 3H9BA 2OV4A 1MC1A 1IQRA 3KT6A 1Q77A 1N78A 4JYZA 1OWNA 3IH5A 1U0BB 2YWBA 2WB2A 1ZJWA 1KQOA 3IOBA 1VBNA 1N3LA 2C5SA 2NSYA 3G59A 3KFLA 3PXUA 4EG3A 4WF9S 4CDNA 3K9WA 2GOYA 1T6ZA 3RK0A 2X3FA 4XFJA 1KAMA 2X0KA 1RQGA 1PG0A 3COZA 4MW6A 1NI5A 1QRSA 1X6VA 4MW1A 2PFSA 3CVUA 1FFYA 3FG9A 2QJFA 1HYBA 1PFWA 4EG5A 2QUHA 3RHSA 1QJCA 1H1TA 3HZRA 1OBCA 2CFOA 1T9GS 5KCMA 2HZ7A 1K4KA 1WXGA 1Q15A 1GLNA 2Z08A 2RD2A 1YI8A 2BYTA 1PFUA 1TYDE 4I6EA 1EE1A 4L2IB 2RE8A 4XFDA 3AG5A 1T6YA 2CYAA 1OD6A 1IFXA 3CF5S 4HPWA 4NATA 3PNVA 4F4HA 4OJMX 4ZCRA 2A1UB 5TS2A 3CA8A 3IUBA 5GAGW 2O8VA 5J59A 3VGJA 2TS1A 5GAHW 1EJ2A 1J1UA 4EFKA 4EG8A 1JMVA 3IVXA 4UZFA 3A05A 1J70A 4YP7A 3IMGA 1EFPB 3CLSC 3COVA 3PNBA 1K97A 4MW0A 1GPMA 2AZXA 2J08A 3MLAA 1ULHA 2X1LA 3DLLS 4WNYA 4CT0A 4QREA 1YIAA 1PFVA 4ND6A 3OTWA 1O95C 1GZUA 4RPIA 1NUQA 4DDHA 1MBZA 4WCES 2DETA 2E0IA 2WSIA 4GU5A 4G6ZA 5F23A 1Y42X 5JVGS 2PXHA 1NUSA 3FHJA 1S4MA 4MVYA 4MAFA 4PY2A 1N77A 3ISJA 3IOEA 3NV7A 4P2BA 2QUJA 1GAXA 1R6TA 1K4MA 3X1KA 2IP1A 5TEWA 2GM3A 5JVHS 3MXTA 1O94C 4J76A 3TS1A 2JANA 2VXOA 4ARIA 5H7XA 3GMIA 4WFBS 4JZYA 4KPUB 4QRDA 1O0CA 3AL0C 1GTSA 3AKZA 1Q19A 2H29A 3GUZA 4U8HA 3IDFA 2J07A 1R6UA 4MULA 1N1DA 3ZJUA 1O97D 1NSYA 1QNFA 4HJXA 4XSVA 2WQ6A 1I6KA 5IJXA 2QJTA 4RUKA 2OQ2A 5FNZA 1G59A 2DLCX 4KR7A 1PG2A 3JXEA 4YMIA 3CLRC 4A91A 2DEUA 1TFUA 3Q12A 4PBRA 4OUDB 1TYAE 3J7ZV 2J09A 4ZT2A 1VBKA 1I2DA 3HFJA 4MWCA 2PZ8A 1XNGA 2YWCA 5DM6S 1NURA 4NX2A 1MB2A 1JEDA 3FETA 1N2IA 1WKBA 5TGTA 3P0JA 3HMQA 3FH0A 4QBTA 1IHOA 1JILA 1EFVB 4MVXA 3SZ3A 1QQTA 3MMXA 2VTBA 4K0RA 4MUGA 3TNJA 3KT8A 1N2HA 1IH8A 1D2RA 4MW9A 1WXFA 1O94D 4I6JA 1CT9A 4MUHA 3F3MA 4G5FA 4ZT3A 3VU8A 3ZJTA 2CV0A 1WJGA 3UMVA 1G8HA 3NBKA 1K92A 1KORA 3SEQA 5FO1A 1NP7A 2A1TR 2ZUFA 1M8KA 1N2OA 3LE8A 4R2LA 1GTRA 3MLBA 2E18A 4MW5A 4ZT4A 4KR9A 2H2AA 4UY88 3L93A 1WZ2A 1J20A 3DO8A 3M5WA 1XNJA 2B7LA 3IODA 1DFUP 1M83A 3FY4A 5IZNA 1JHDA 3HGMA 1G8GA 4ZCSA 3SYTA 5GADW 4MWBA 1WQ3A 1KQNA 2NZ2A 1KAQA 3COWA 1EUYA 1LI7A 3CVWA 1H3NA 3I05A 3MUEA 2EL7A 1PFYA 4MUNA 3AIIA 1F4LA 4BWVA 1IRXA 1VBMA 2V0GA 1YIDA 1D6KA 4YP6A 3RJZA 3IVGA 5HL7S 4UZEA 1IVSA 2BTEA 5DM7S 1KH1A 1G8FA 3HL4A 1ILEA 2DR2A 4PBTA 3INNA 4EF6A 4JFAA 4YP5A 5H16A 5GAEW 2HGZA 1WXEA 4NDAA 3PNYA 3Q10A 4CDMA 4ZCQA 2ZUEA 1QU2A 3OP1A 4ZCPA 4GRIA 3CLUC 1YULA 4E1AA 1ZH0A 3C8ZA 2AG6A 2DUMA 5EKDA 3H99A 3L92A 4G5YA 4MWDA 2G36A 4TS1A 2ZJRS 1OBHA 1O0BA 5IHXA 4KKVA 1BS2A 3SP1A 5BNZA 1X8XA 2PZBA 3ND5A 2ZP1A 4EG7A 2XRZA 4U67S 5K0TA 1JGTA 2QUKA 2Z3VA 3K32A 4L2IA 3ND6A 3N2YA 3U1VA 3VRHA 3UY4A 2EJCA 4J75A 1M1ZA 4YBRA 4KR6A 4Q16A 1XJQA 2CUZA 1JIJA 3CVXA 2VTBB 4R2MA 3TQOA 3H9CA 4MQ6A 4IOCS 1U3CA 3PIPS 1QRUA 3X1JA 4HK4A 3UOWA 1JZQA 2CT8A 4MW7A 1V47A 4MUEA 4MWEA 3X1MA 2QJOA 3QTBA 1EFVA 1NZJA 1O5TA 2YY5A 3CVVA 4JXZA 4DE5A 1J09A 4S1OA 4NAHA 2AKEA 2V0CA 4ZT7A 4EGAA 1NUUA 1T6XA 1VLHA 1MB9A 4ZCTA 2DERA 4MVCA 1U7DA 3IVCA 1O96B 2JA2A 1LW7A 4DDMA 2PZAA 3SDBA 1J1ZA 4WFAS 1NUTA 1ZH6A 1M8FA 1N75A 1NUPA 1FYDA 4MUKA 2DXIA 1TEZA 4Q93A 1R6XA 2R5WA 1M8JA 2ZJPS 3AFHA 3QE4A 1EXDA 3A04A 3CLUD 3G5AA 5DASA 4DJAA 1J21A 3N05A 4R0NA 1JIKA 1COZA 2A1UA 4NAUA 5DK4A 1H3EA 3NBAA 1WOYA 2E21A 3P52A 3PRHA 5DEOA 1H3FA 3ZIUA 1KH2A 2X1MA 4FZJA 5DB4A 1F9AA 2HMAA 3N9IA 3S3TA 3AG6A 3CR8A 4ZT5A 4DNXA 1QTQA 3ILVA 3D6UA 1B75A 1N2BA 3UK2A 1JZSA 2IELA 3KT0A 2JAXA 1O96A 2CYCA 2A7XA 4DLPA 1KP2A 5FO0A 3FOCA 1T9GR 1ZUNA 2XRYA 1WXIA 3FDXA 2WQ7A 1O95D 1U7XA 1M8PA 1OWOA 4MUJA 2GKSA 3A2KA 4MUFA 4IO9S 2I1LA 1QU3A 3IUEA 4ZT6A 1MAUA 1MOPA 2A4MA 3ZJVA 4CQNA 3CLTC 5LM3A 5LFAA 3IMCA 1KR2A 1IQUA 1JIIA 4ARCA 1Q11A 3UC5A 4AS1A 3A4IA 3H05A 3LCJA 1MRZA 1KH3A 2CV2A 4U63A 3ZUGA 4MUIA 1MAWA 2CSXA 1V8FA 1N2JA 3G6KA 5HUJA 3QTTA 2D5BA 4MW4A 1I6LA 3RFFA 2YXNA 4HJRA 3ZGZA 4DDKA 1P7PA 1EUQA 1O97C 3P0IA 1M8GA 4IOAS 2J4DA 2CYBA 1OWLA 4OUDA 1DNPA 5KHAA 3FWKA 3ZXSA 4K03A 1KP3A 1O6BA 1EFPA 1TYBE 1XNHA 4MVWA 3RK1A 4F3RA 5KWVA 1JEEA 3GLVA 5AHWA 3SZGA 1N2EA 4MW2A 4JXXA 1B6TA 5J58A 2D13A 3P0HA 5HG0A 4EG4A 1UFVA 2QTMA 1JECA 2QUIA 3CLRD 3BL5A 4MLPA 2QTNA 4ND7A 3ELBA 4WFNS 3DV2A 1KKUA 3IOCA 1GN8A 3CLTD 1SURA 1YUNA 2Z09A 3SEZA 2IJGX 1MJHA 1QRTA 3D6VA 1TYCA 1TQ8A 3FIUA 4EG1A 1OWMA 2A84A 5K0SA 1F7UA 3E27A 3FI0A 1A8HA 4KPUA 3ZXIA 3ND7A 1FEUA 2CV1A 4EG6A 5LLTA 1NYLA 1WQ4A 3TZEA 4H3SA 3RBAA 1KQPA 2QTRA 3HV0A 3Q4GA 5J5AA 3CVYA 1I6MA 4WSOA 4NZPA 5HUHA 1U3DA 4I6GA 2DPLA 1WY5A 3H97A 2A86A 2E89A 5TEVA 1F7VA 1N2GA 3N8HA 3PIOS
chains in the Genus database with same CATH superfamily
5AOCA 1G5QA 1FQWA 3NHMA 4BLSA 2QNRA 5EKXA 1XN4A 5K01A 3ZK7A 5JBNA 1XRQA 4I1SA 4Q9KA 5F2KA 2HJRA 2W83A 4ZJYA 3DCNA 2AN3A 2YNMD 4BU1A 1W5TA 3OQVA 9ATCA 4LISA 2JI6A 2C3OA 4LYDA 5I9MA 5A7FA 5FOQA 3HR4A 1G20A 3M5CA 4FOPA 2VWHA 4GSYA 1SZPA 3FFXA 1YVPA 4JELA 1CRPA 1N8SA 3L46A 4D56A 3NIGB 3VX3A 1TVMA 3W2TA 3R0XA 5HZMA 1OREA 3RRBA 2YDXA 3OO1A 1DDGA 1SAYA 1NJGA 1KC3A 1VBNA 1A9OA 1EM6A 1G8JA 1FTQA 3AHGA 3GMTA 4RCVA 4FGZA 5JQGF 4IUYA 1BHO1 1JQBA 4YTEA 3FMFA 4JJFA 2GOYA 5K4AA 3RSLA 3WLOA 1P45A 4RZ3A 2X3FA 3TUIC 4KRXA 4XFJA 1ENPA 1Z0JA 2GF0A 4KWEA 4B6OA 4Q34A 1ES9A 3EGEA 5BVGB 4JENA 2VRCA 1LNQA 2W2OA 3COJA 2DWQA 4XW2A 3QFFA 2R8BA 5DM2A 2FN8A 1QK3A 1PFWA 4ZOLB 3S55A 4JDPA 5LU8A 4Z9XA 1DXOA 2Y1CA 2FN4A 3KTOA 4U0JA 3Q7EA 4CCAA 1Y8RA 1PUIA 1DO8A 3DXZA 4OLAA 3GGJA 4BVEA 4LRWA 5CH5A 4IJVA 1XLTA 4FZ5A 4I6EA 4REQA 5DM60 3CVJA 3T38A 5FV4A 3B1VA 5EWLB 3K1ZA 2GPJA 1LV7A 2JJ1A 4IIYA 3CF5S 3TLYA 1FVOA 2PZGA 3GOQA 3VI4B 4C7BA 5AVRA 1NQUA 5FULA 4DSTA 1LF5A 1UFOA 1A4IA 5A5GA 3M6LA 3HY6A 5LYJA 3NP7A 2XCSB 1O87A 3E9NA 3KQTA 4I55A 4OA8A 1YAHA 1F2DA 2GHQA 3DMRA 4LOJA 4CMEA 1OH8A 3NTUA 4A6PA 2YIDA 5DLYA 4AZ3B 2P4HX 2OD7A 4MVJA 3Q87B 1Q0TA 4ENQA 3GJ8A 2QS9A 2O0HA 3M34A 4HXYA 3PIDA 4PX2A 2J08A 3BD6A 3UXHA 4KL8S 4CBVA 4OHCA 1YFLA 5KYUA 1NBOA 1P73A 2PZKA 5JWOA 2PGOA 3AESB 5KVCA 3AI7A 1V95A 2BM0A 4FCTA 4U3JA 3ROZA 3ZQKA 1GNLA 2L18A 4FHFA 3WB2A 2F4NA 2QMZA 5EHNA 5KHOC 2WSIA 2R7MA 3GVHA 4K28A 1U0JA 3NCHA 5JVGS 1XYGA 3EGDB 2F43A 2Y76A 3FHJA 3IESA 4Z3KA 1T13A 3MINA 3KYIB 4L6CA 4X1OA 3AI2A 1YBAA 3IOMA 3PUVA 4MQFB 4EVIA 4JX8A 1M2GA 5K3AA 1MEOA 1XXHA 2ZUWA 3AEKB 3W79A 1ZJZA 4P34A 1GGKA 3H8JA 5H81A 4OI0A 4NFLA 2HF7A 2HH9A 3GJ5A 3R5HA 2V7QA 2WT8A 4GOKA 3ZCRA 1OX4A 2VXOA 4AY2A 3IAEA 1KI4A 3QV2A 2ZRJA 2JW5A 1I1OA 1MV8A 4HXFB 1RNLA 3OZ7A 2WJ6A 3FLMA 1ULBA 3BD7A 4RVUA 4YCDA 4EL5A 2JAOA 1CVLA 1AQUA 1V9SA 2QT9A 5EP1A 5GPBA 2HMUA 3VPDA 2C9OA 1JI3A 3AGPA 4IW3B 1T6BY 1MO2A 2IHVA 5FADA 4ZEMA 2P6UA 2W2QA 4CM8B 3JAMA 1E5LA 2G70A 1PGOA 3GEEA 4HYQA 4U7TB 3ONNA 4BX0A 4FTWA 5B1YA 3P45A 2PGNA 3PKJA 4RK7A 5M7EA 2DLCX 3KE9A 2WIBA 3CEAA 4O2AA 1HNNA 4C08A 4Z86A 2BUCA 1DKUA 2OILA 2XDQB 4UBIA 3I9OA 1VBKA 3SS9X 2WWVD 4AUMA 1W85A 3W78A 2B30A 3LTNC 4OMUA 1BQ3A 2G88A 3N7TA 1SG0A 4HLQB 4NYIR 5CYOA 5TGTA 4G0VA 3I6QA 3NJ4A 4ZQFA 2NVWA 1PF7E 2X4GA 2FF7A 4XI9A 1RCUA 1UWLA 4X3PA 3GCXA 1U0HC 4HUJA 4IHJB 5EEHA 2OM6A 4W1QA 4D26A 2VTBA 1JG1A 4P8RA 2PD4A 4IGFA 1RHMA 4KQHA 4M0PA 4H31A 1KK3A 1CZHA 5AHKA 3AFGA 4AAYA 5TLSA 4Y30A 5A03A 5B1SA 1FS6A 1UK8A 4IH9A 1VPDA 2GK6A 3GR6A 3WDKA 4CTKA 5EE1A 2VJNA 2V7QD 3SYNA 3V55A 3EX7C 3ZJTA 1R9GA 1TD1A 4O4IF 2O2SA 5DOZA 3LOPA 2AUNA 3GLKA 1AUQA 4KO1S 4ZZ3A 1OXBB 1V25A 5G2OA 4P3PA 4CKBB 3AVXA 3Q9UA 1QKKA 3MC1A 4W4TA 2BDTA 1Q0PA 4XASA 4LRUA 5DX8A 2WAMA 1Z39A 2P9HA 4KSYA 2HCFA 4N9WA 4LCBA 4WGFA 4ZT4A 3HNPA 3JASB 1L1EA 3L1UA 3FOWA 2LDXA 2ACWA 4IVNA 4DV1B 1VJGA 5TVGA 3OCCA 3TW6A 1PZNA 1UBKS 2BHRA 5JBIA 5BMOA 3R7WB 5EWJB 2OC9A 2GPSA 2CXRA 3M5WA 4BKMA 1UPCA 2ID4A 5KQPA 1THTA 3U19A 3OMXA 1JHDA 2L19A 1G8GA 3FCOA 1NFQA 2A7QA 4ZCSA 3IUMA 3R7SA 4JS0A 1L5WA 2Z5GA 3OMWA 2R8PA 1OVMA 3KAPA 1UQRA 1P5HA 1ZL0A 2GK7A 4DKJA 1XWFA 1TUBB 2QYTA 2JBAA 3AB8A 2AR0A 2D74A 4J0EA 2X5XA 3CRZA 1CWUA 2YC4C 2QN2A 3OFJA 1L3BA 1C30B 5KNLA 4U39A 3KD2A 3VU9A 3A1DA 4OXXA 5CB0A 4B3SB 1T3GA 3TCKA 3NNSA 2YR0A 5H82A 1CUVA 3QSYA 1MW8X 3SJUA 4URXR 1RLUA 4KYUA 5KVQA 1US8A 3QU5A 1XX6A 1DT3A 4US1R 4EA8A 5IKMA 1N6HA 1TD9A 1JHUA 2TMDA 3TGPA 3ROQA 3KU4A 2BFPA 4Q05A 1JFRA 4E07A 4B0OA 2DR2A 2YWFA 2OCIA 1C50A 2AVDA 1VE9A 3C6YA 1G3MA 3OU6A 4REOA 2GZMA 2B8EA 1E7QA 3BFKA 4D81A 3OZBA 2GJSA 2P9QA 1K7YA 1IJEA 2XLBA 4LPKA 3DEYX 4OMDA 1SUCA 4W6ZA 2PX6A 2Q27A 4DA4A 2YZ2A 2OZLA 2EF1A 2AKAB 4H1UA 5H70A 2AG6A 4B3XA 1EG2A 3L5KA 5ADUS 1RZRD 2HO4A 4DMKA 1W1IA 1C5KA 4UOEA 5DCWA 2C5AA 4G5YA 2CNKA 2C9MA 4TTQA 5AKXA 2I03A 3P9ZA 4KXMA 3UAVA 3E03A 2X3UA 3F9IA 3R0JA 5C35A 3GJYA 1NQ5A 3TM4A 2XADA 4WK0B 2Y71A 2P3LA 1FSSA 3PGLA 1V3UA 2QK4A 4QTXA 2GWRA 4D8WA 1GG5A 1UIRA 2R6AA 4EG7A 3KV1A 3WR5A 3ZY6A 3ZHOA 1M7HA 3GAMA 2VATA 5CIYA 1FZQA 4L2IA 4WOKA 1L0BA 4WMLA 4OB6A 2P41A 3E3MA 2Q6VA 4K6CA 1A3CA 4M8NE 2WKQA 3N2YA 3ZHCA 4DUGD 1BKDR 1GDTA 3WYCA 3I8XA 1F1BA 3DOFA 4C43A 4EB6B 3BKWA 3GLFA 1XB2A 1DARA 4Y6RA 2OFFA 1YC5A 1YZQA 1N8TA 2WLTA 3G6WA 4P53A 1G16A 5AVOA 3RVQA 1RXVA 5HYVA 3NUGA 1OASA 2A9QA 5F76A 2VK2A 3JYPA 1U3CA 4W9NA 2PBFA 4WLEA 5KSWB 3ZHZA 2NPIA 4ENSA 1JMKC 3SOPA 3TZ6A 2I9KA 4MUEA 3HCFA 4YAUA 3PFWO 4FSXA 3QTBA 2W43A 4NL4H 5AXAA 1P75A 2EKBA 4XWYA 2ENUA 5IARA 4TRRA 3WO1A 2WW8A 4M6WA 4ZAVA 5MHTA 1LRLA 1Q7RA 1G18A 2ZVPX 3F6SA 4M1SA 5FUBA 4ZT7A 1SCUA 1V7CA 4WESB 3AI1A 3PA6A 4UNNA 1YRYE 2Y92A 3L7NA 4M1WA 5EIHA 4UEQA 3WJ2A 4O4HB 3DBIA 4IDCA 5IVDA 1E3JA 4ZOLA 2OXIA 2EJTA 3Q40A 1CUCA 1FNMA 1GUBA 1YB4A 3OQPA 2A9VA 5FLXA 3JARB 1XPUA 2O0LA 2YFKA 1T1IA 1M6NA 3EZNA 4JVNA 4GVXA 5ADHA 1LBSA 1Z5WA 2UYQA 5JZVA 5AUPB 3ITEA 4PFSA 1P80A 1VZ2A 1WA5A 4F93B 5IAEA 2FK8A 2XEXA 3L8ZA 5BN4B 4AZWA 2EFDB 1C7IA 4DF3A 2NQTA 1GZ7A 4EAAA 1DUVG 5AKYA 4AMGA 4JWTA 3EMBA 3N0WA 3W8FA 2OGWA 1YA8A 4NAUA 3D54D 4RIHA 4FB4A 1H3EA 3MB5A 4DJEC 1WOYA 2GFHA 4YVFA 5E6SB 4R6WA 3TL6A 5JMOA 5CH8A 3EA4A 4OFXA 5IASA 5DP2A 2G0AA 2VDQB 2XGOA 1H5NA 4AMZA 4FM9A 3PSHA 2DPGA 2VP5A 2K6GA 2X1MA 2YZNA 3KAKA 4FZJA 2HV8A 3E22A 4HX5A 4Z2YA 4B6JA 2AC4A 4L9RA 1AN9A 2ZRGA 5JCZA 1FW6A 2CL6X 1I10A 3DW1X 3HI6A 2CLMB 5D7NA 5JTUA 3ANSA 1UPTA 4C6TB 4DNXA 5K05A 5KSYA 1GGHA 1YS9A 2JGJA 4RY0A 3KQPA 4PZCA 5IBPA 2I7DA 4Z6KA 3H87A 1S1CA 1GQRA 3QMWA 5JQGA 1P0PA 4N8DA 5L95A 4MIKA 2P0YA 3G2KA 2MCFA 3P2JA 2W5UA 1QF7A 2IZ1A 1C9MA 3HY4A 5BSUA 5J2UF 1A7UA 3BK1A 2NAPA 5KREA 3WMGA 4JIGA 1VGRA 4QBIA 2F9MA 2MJLA 2CDAA 1L5RA 1THMA 2I2DA 2RGEA 3AR9A 1UT8A 4XKJA 3SR4A 3WISA 5IH7A 1OHHA 3H9EO 2YV5A 5L3QA 3EK2A 2IKQA 4N82A 5DXJA 1PZEA 3UENA 3ZDXB 5CA1A 2N75A 1L4KA 2WWIA 4KODA 2BVNA 4U02A 4RTPA 4PVDA 3AUAA 3E8XA 4LV8B 3NYRA 2PMEA 3HR8A 1YU9A 3IUYA 3KCNA 2VHCA 4PSKA 1DADA 1WZUA 3VGPA 5LFAA 2WZCA 5ALSA 3MB8A 4GMGA 2XXJA 3SJ7A 5AM3A 3M70A 1HDZA 3DZFA 5DTQA 3RJTA 4YAIA 3F3YA 1OLUA 3UC5A 1VLQA 3CT6A 3DS8A 1AS3A 2YS7A 1ZZEA 5BSTA 4PNHA 3OZAA 1E32A 3LP8A 3QVTA 3B53X 3RC2A 3WFZA 3T6KA 4F84A 5K8LA 3EPLA 2XA1A 2WF9A 2Y9MB 4MEJA 5EJGA 3K6RA 1P2UA 4BWGA 1KY5A 1W87A 2H0AA 3CT4A 1E9EA 1WCWA 4RIIA 5JCOC 3K71B 4LAFA 1D1PA 1R6DA 3WMFA 2Y2UA 1NW7A 1OZ0A 2EFJA 2GZ3A 1DB3A 3FCYA 3L82B 4OIFA 1H4QA 1I9CA 2AFRA 2XCUA 3DTVA 1X7ZB 4AYXA 1TZJA 1Y1RA 4RHEA 4AJKA 1L5SA 5DM70 1PP4A 3G89A 1FTYA 2I87A 3GBVA 3DTTA 1PYOA 4CEIB 4X85A 4AZSA 4Q7LA 4MPPA 1ZUNB 3QXCA 1O6BA 3SICE 3Q8XB 3DDOA 3IE0A 4IKEA 4OM7A 4RENA 2D1SA 1S3IA 1YR2A 2R85A 4KV9A 3TX2A 3VC7A 3GLVA 1F2TB 4HDNB 4ZQGA 3TSZA 2NXWA 3TTWA 2VHTA 5I7WA 1UBJS 3TO5A 4GPZA 3BKXA 3HEMA 4BPBA 4DLVA 2A94A 2O07A 3P0HA 4QRIA 1ENZA 2H7CA 2DG2A 4DLUA 3V00A 4R83A 3VVMA 2EX0A 5EPOA 1FYXA 1NA5A 4GMDA 4AZ3A 1P81A 2K2QB 3KKEA 4BLQA 1K98A 4MVJD 2AFHB 3GWZA 1GCIA 4XX1A 1N0WA 4Y6OA 5C2JB 1Z6GA 4RTLA 4P4GA 2QGFA 2I4RA 2MSDB 2XXAA 1URPA 1OA0A 1VJRA 2C04A 4MGKR 5KYYA 5K1ZA 4MYSA 5C46F 1HTTA 3CRQA 3OF2A 1YL6A 2QTCA 4HQFA 1SURA 4A92A 5A2GA 3UJ3X 1PFGA 1J7KA 1QIJA 2FLVA 3L49A 1QAQA 1MA3A 3TTXA 4LHEA 4E4YA 1NKSA 1UBOS 4IDNA 1EVEA 1QG2A 1MDBA 5ICCA 1WIWA 3RAFC 4CL2A 1AF7A 1E2BA 1G7SA 1VKZA 3HWRA 3OY2A 2OGZA 4OK6A 4PZ0A 4Z51A 2LVBA 1P4JA 5LQMA 2XA9A 4EYSA 1GCGA 1Y5MA 1R4MB 2Q21A 2GEKA 4NIMA 3AEKA 4CR6A 3MWGA 2QN3A 5CDYA 2J5KA 4UNSA 4ASUD 4CEHB 4K6FA 2KX7A 1EUCB 4HDRA 2ATXA 2V6IA 1NN3A 2ETVA 1GQFA 5JZOA 3EPKA 3FTEA 3HVUA 4Q3CA 2WWFA 1NRIA 4WVLA 1Y7TA 1KPGA 1Y9JA 2DJ5A 1HQCA 2WDZA 4NE9A 4KDRA 5CNMA 3GT7A 2CDRA 1RXEA 3DL7A 2W4QA 1RFGE 4I4TF 4LDNA 3H2BA 1E1KA 3N58A 1M2OB 1YZTA 2XJ4A 5G0SA 2GHTA 2YXLA 4YXFA 4BNKA 4AU1A 1AHHA 1FTNA 1FQOA 2O8BA 1CEXA 5AKHA 2EFHB 3CEHA 2PG3A 2V7UA 3BXZA 3QF7A 4D9NA 2UVPB 1FDUA 1SIOA 1RLOA 3IMEA 4F7DA 2BGWA 1OLXA 1LI5A 1WL8A 2VS1A 3TFQA 4BZZA 1L6RA 2XV1A 3FNRA 4FJ1A 1ABFA 3O4RA 2EW1A 1O4VA 1FFAA 1US8B 3CEMA 5FI5A 3CPHA 3TZLA 2C4MA 2Z8ZA 3D4OA 3CZRA 4K6HA 3TJRA 1NJ1A 3UK1A 4GP7A 3IELA 3S28A 2IS2A 3DT9A 2PH5A 5A7GA 3IH5A 2XDQA 1R8XA 4ETWA 4RKRA 4B45A 4EHIA 4L6AA 3GDOA 1J8VA 2ZTVA 4UCQA 3UMSA 3WA7A 1FNDA 2H17A 4DT1B 4JSRA 3ZI7A 3RARA 4PAWA 3TG2A 5DN9A 1RRCA 1OAOC 4BMYA 1QH9A 5EWMB 2NU8B 3DBHA 5ICSA 1DIAA 3WLQA 4EY8A 2IPLA 4L57A 5JT1A 2PBLA 5FT9A 4DLTA 4XB1A 4BLUA 1ZJJA 5JD6A 4PIVA 1PT9A 3HSYA 3C8MA 2JCXA 4XZ3A 3PDWA 3UAOA 2WAAA 2HLHA 2LBPA 1Y4AE 4JL6A 1QJCA 2YHSA 1D4FA 4TKMA 4UCWA 5GIPE 4CIYA 1AIPA 1E5QA 4S24A 3ZDAA 1VSBA 1XIVA 3ANLA 4NVRA 1MT3A 4PX3A 3W0LB 2E49A 1GLNA 2PSEA 4XA8A 4YROA 3L7IA 1NNSA 5EZ6B 1AS0A 1SOMA 2H2GA 5L4SA 1XZLA 4L2IB 4XFDA 3A1UA 3MAJA 1HDXA 5DIFA 4KYIB 3A8TA 3EQ8A 2VL7A 1IN8A 2J1LA 2B1RA 4AG6A 4FMCF 1U8AA 2ZRKA 4DIEA 4LF8B 1LWNA 2A1UB 1FDIA 1RHQA 1YO6A 2VBFA 3HEBA 3R5FA 3TR6A 1CXZA 1BCSA 4IRXA 4TS9A 3G1UA 3I0NA 1P9RA 2AK2A 2VTVA 1M2FA 4XWTA 4XVQA 5FWNA 4N3BA 3A6KA 3MMSA 4OI2A 5CB4B 2I3AA 2J3IA 3K16A 2HSGA 1CKEA 2RBEA 1JE0A 3D2BA 2WVJA 4K9MA 4YJ3F 3R5XA 2DP4E 3PUWA 1EGQA 4TYMA 1ISHA 4JI4B 1L9XA 1YRQA 2FPPB 2XHEA 1A9YA 1MCZA 2AEFA 2OCBA 4K1LA 4MYDA 4WCES 2E4YA 2WB4A 1ECJA 4IRUB 5KU1A 1MTOA 2XMZA 2DETA 1XJ0A 2O59A 1TMGE 2Z98A 2DBVO 4HWSA 1SHUX 2WA1A 3S2EA 3X1XA 4F46A 2VHEA 4TXJA 1V3QE 5I47A 2NWAA 5HJ5A 4E33A 4B3MB 2EEZA 3GMSA 3NPAA 2HK9A 4UPDA 4WEQA 5HP4A 1GQ2A 1FLVA 1U0TA 1MO4A 2QUJA 4GYKA 4YMSA 3IAHA 1K7CA 4L07A 5AW1A 2JD2A 2XZPA 4V0NA 3TS1A 5F1YA 3Q9NA 2HRZA 3NCTA 5FNVA 3U49A 1KI3A 1Q0RA 5BN4A 1NQVA 1O54A 4FHDA 4ZPXA 2G07A 2BI7A 3C5HA 1S2MA 3AKZA 2M6SA 4W9NC 1JU4A 1SG6A 2HA3A 4IIJF 2PGJA 4JJGA 3BFXA 1G1MA 1I36A 4ALKA 2ZRLA 1N1DA 1UC9A 2YVLA 2XNCA 1YZKA 4HVLA 5IUJC 1G9TA 1UXHA 4JBYA 1OT5A 4Q3EA 3RSQA 4KYTA 1WDKA 5JNWA 5AVXA 3A6PC 1AG9A 2C2BA 3HN6A 2WY2D 2R6CA 2N1MA 1MLDA 2FW6A 4RE5A 3G2QA 2AT1A 2ZIEA 3OQIA 2AS0A 1JA1A 4Y1RA 3HLYA 1EA5A 5CPFA 4GXTA 4BO5A 3K6KA 6PFKA 2B5OA 1HZJA 3KXPA 5M29A 3I64A 4ZI7B 1RWPA 1TMYA 3VZPA 4B2YA 3C1TA 1PO7A 1Y1LA 3SEFA 2E4WA 2JFXA 4E2WA 3AZPA 5LMCA 3GDHA 1Y1KE 3TLEA 3ZGOA 1EX6A 2ADMA 2WG0A 5T57A 3T12A 4HPJB 3X1DA 3GCWA 3C7AA 3HA7A 4FFDA 2MMGA 2FZEA 1P2FA 2CX8A 4WZAA 3GT4A 5JI2E 1DG1G 3NIBA 3PIIA 3BSFA 4KPFC 3W8DA 4JJ6A 4BEWA 4QJ3A 4IHKA 3FZNA 3AHJA 3U4AA 4P4TA 3DMDA 1O5OA 3P0RA 2O57A 3N2EA 4FFBA 3T5MA 4ZICA 1Y4ZA 3KT8A 2IZOA 5FOSA 4KQXA 4O2BB 3ZU6A 1X15A 4DWWA 3EARA 4X41A 3NHYA 2A9PA 3EFBA 3KELA 4OH1A 5FI3A 5KJFA 4MLCA 2JFHA 4X6YA 1IN4A 3ORYA 3VU8A 4NQRA 1WU8A 1A0OA 1JAZA 4QHSA 1OLSA 3GJTA 5DRYA 4KGZA 5D87A 3S7TA 1W5BA 3TN7A 2WD7B 4BRWA 1UR5A 5H68A 1IY2A 3HY3A 1RJ9A 2WU4A 3QXJA 3DAHA 4G5RA 1Z2AA 3GH3A 4RF2A 1RQXA 3RUFA 2UKDA 4ZV9A 3FDFA 2ONZA 4PLTA 3GEIA 3BXPA 1EFCA 1G21A 5I4KA 3QF4A 1I13A 4UFNA 4EUKA 1J42A 3K5WA 1AKNA 4DS3A 4JJ8A 3DO5A 4LYHA 5EJIA 3DL0A 4G8JA 3FY4A 1T1SA 2B8TA 1C3LA 2CE7A 4TRMA 1F8UA 4XCVA 2DGDA 3KJZA 1NFFA 1FXWA 2A5DA 3AR8A 3KEFA 3C3XA 5JAPA 1EGHA 4MV1A 1OPXA 2IXBA 4ZP1A 1G6Q1 1UL1X 4LZJA 5EEGA 3DMYA 2G0TA 3ZE7A 4BX2A 4W63A 1DC4A 3HVJA 3V2HA 1G2PA 2WHQA 3BERA 4FMCB 4R8RA 4X61A 3QI2A 4ZWNA 1RBZA 2F67A 3DAGA 4M9SA 4H59A 1LXCA 1GSAA 1TM2A 1ZHHA 4GLOA 3L8FA 2GVZC 2EKQA 4TMWA 1CE8B 4HP8A 2QMEA 3LP6A 4QX6A 4YRFA 1NW9B 2EZTA 1T9HA 2GJAA 4X7BA 5ALKA 2FPRA 5HDQA 3UJCA 2XDYA 4Z1OA 3OEWA 1AE1A 1M5UA 1S2GA 2O2HA 1V1RB 2XUAA 3FUXA 4BGDA 9LDBA 1Z3CA 2FHSA 1XTQA 5JZSA 2PL1A 4Y7CA 3HFSA 1KH1A 4I66A 3EUAA 1R5NA 4JLOA 3RAJA 4ETNA 1KGDA 4RHTA 2ZRBA 5EXSA 1JTFA 1BA2A 1N5MA 3CH4B 3DZCA 3GC6A 2GBFA 1BO6A 4HNUA 2GHRA 2JVKA 1K4YA 4GBMA 2FWMX 4HEA6 1KYYA 2APJA 5DM4A 3TIVA 5HKKD 2XQVA 1NF9A 4XUCA 4ZEWA 4IXTA 5L3QB 3QBVA 5MFZA 5KOIA 3MCZA 2POQX 3X3HA 3ZQ4A 5IH3A 4XGRA 4NLLA 4JLBA 2DPMA 2OORA 4KMSA 5KTOA 4MWDA 2X8AA 4JQCA 5DCLA 2PUGA 3AM4A 5E1MA 3FHTA 4UVIA 3ROXA 5KQMA 5I8ZA 3O8LA 3AP3A 3S44A 2CGEA 1SBQA 2AR7A 3QPVA 4FP9A 4NJMA 3TJZA 3TD6A 1GT91 5JMTA 3RKRA 4PZZA 1C3EA 4IHAA 3ZWYA 5DLDA 3U56A 4EARA 3QW2A 3WIOA 3AH8A 4L4UA 1G2IA 4W8OA 2CMGA 1P8JA 2BJWA 5FRDA 2BN4A 5K0JA 3DKPA 4R3NA 4D4LA 2OVBA 2OQIA 3DMPA 4O4IB 4NI5A 3GB9A 3RWMB 1B93A 4KMRA 4J3NA 2CMKA 4P7GA 1Y7HA 4EO4A 2I66A 3P9CA 4RCZA 1V9CA 2ZTLA 4KJZA 3EXFB 4DXDA 2P62A 2A9JA 4YCSA 5CA1F 2CK3A 5CGQB 3TQOA 3I32A 3NGXA 4FXOA 4D9KA 4Z4HA 3QPDA 3TR5A 4CQMD 1KZGB 2QYSA 3PYXA 1QRUA 5EIBD 1J8YF 1X1CA 1D9XA 3DDSA 3IO3A 2JIDA 3FMVA 4JK3A 4AJOA 1JZQA 4DT1A 1E2FA 1BVUA 3P97A 5EQTA 4EVRA 1F2TA 2CDCA 1NMZA 3MBIA 4ATNA 1CQIB 4UVHA 1D8AA 2DQZA 1YC2A 2FDCA 3PT5A 3LC1O 3RGGA 3EIOA 3MQ2A 5BWMA 5C5DA 1GNRA 1CRQA 2W6QA 3BAZA 3KQVA 3E05A 4R7TA 2YWJA 3VR2D 1MB9A 7YASA 2C00A 2Q99A 4ZXFA 4E7PA 3FHCB 1QF6A 4G56A 1ZW6A 3QKSB 4MVCA 4G5QA 1ZCJA 2JI8A 2NU7A 2H1HA 3CC8A 3DM9B 3GPBA 4I46A 2XUIA 3HB7A 4E5MA 2PZAA 3TNDA 3GVCA 3R6GA 1OXXK 2I3BA 1JVBA 4R1TA 1GKYA 2HF9A 4WW0A 5TJHA 2J3EA 1OIWA 1FX0A 3CZAA 2IZ0A 4WK6A 3N8KA 4B2PA 2QTVA 4IH4A 1X1RA 3F4BA 3K70C 2QY9A 2FVXA 4IEIA 1DQYA 2IZ6A 2P67A 2PWAA 3JQ8B 3PC3A 1DWOA 4H16A 3IB3A 4DY4A 3ON5A 1PNVA 2NVUB 3UTDA 2A1UA 3DV0A 1HURA 3D3EA 3I92A 2OHIA 5HKAA 3OQNA 1YNSA 4UAUA 3O94A 3TRKA 1ZKDA 4NCAA 3FBTA 3EF3A 3GPIA 2DCUA 2OV6A 3LO5A 3OPXA 3PD0A 2EQ5A 1E18A 5IDYA 1FP4B 5DHRA 1R50A 2F6RA 1RPAA 5BT9A 3M6WA 4MIYA 6GPBA 4OO3A 5CHYA 3UGJA 4BP1A 1XR3A 1II9A 1RABA 1E0KA 1PJZA 1BGXT 5AW9A 3K96A 3UJPA 2IGBA 1RI3A 1FVFA 3ROKA 5JY6A 3FYUB 1E1NA 1ZVJA 2CL0X 3X1LB 4WZ6A 1NWHA 4IILA 1HT2E 3MIIA 5CG2A 4JKYA 1YKSA 5BP7A 4TMYA 4FMDF 5CUQA 1IN1A 2BPOA 2MHCA 3BE4A 3ZZUA 1W35A 4YT5A 3ENVA 2EV9A 3SIPA 2O8DA 1R4NB 2BF4A 2GKSA 1J23A 2I2WA 1ZI9A 2CDBA 3CKLA 1ZK4A 2VZLA 2OCXA 3IUEA 2X7JA 4GLLA 2XVZA 1ETUA 1UH5A 3CG4A 4N3CA 4TYYA 5BVGA 1FVHA 3D4NA 3H4IA 3KXLA 3U2QA 4EZBA 3BZBA 3EEBA 3CLHA 3FNBA 1Z4KA 1IJFA 2WYOA 1I4EB 2VJBA 2XYVA 1AOXA 4D2IA 5JH7A 5EWMA 2WJVA 1U1CA 2QMHA 1D2EA 3DAOA 1W30A 1GTVA 1E94E 3CZ4A 4ZZ0A 4CR8A 2HBZA 3I12A 4D42A 1OAAA 2Z4TA 4CF4A 1UK6A 3IP3A 3PPIA 1QKJA 3DOCA 3IDSA 3W4KA 4XTCS 5IKEA 3IL2A 2F8SA 3B82A 5FIUA 2R4TA 3C15C 5AVVA 3HBJA 5EFZA 3GFGA 1BG6A 1GZDA 4MO2A 2Z0YA 4RIEA 1RQ7A 1UWKA 1BD3A 1RKQA 2NV0A 2ZB2A 3GT3A 3PV0A 4TWJA 3ZY3A 5GJVC 5ELLA 3L8EA 2XBUA 2QT0A 2Z6UA 2DKOA 4KPYA 2IEGA 4GGMX 1L6IA 2WV9A 4HGQA 5JALA 3M7IA 1FYWA 2XT9A 3Q8KA 4WZAB 4KE8A 3PFFA 1QE5A 3DOUA 1YDEA 3GPDG 3VNRA 1F51E 4JXXA 3BGDA 4ZVMA 3BH7A 3VR4D 1AKUA 2FWAA 3EVDA 4HGZA 2BTQB 2WSMA 3A1TA 3FCUB 3AVQA 2CF6A 1QDEA 2CXNA 4M0DA 4BQIA 3RAPR 1PR9A 4FKBA 4CTOA 1FP6A 1TOAA 4P5PA 3WWYA 5IWAB 1YQ9A 1WW8A 3HM9A 3QV1A 5LSAA 5FWXA 2FR0A 2REXB 3A6EA 4O2BF 2B2NA 2DBZA 4ZVRA 3SD7A 4MR7B 3RIEA 1HX7A 3CE9A 4TZ6A 1H2BA 5T3YA 1YTLA 4U9IS 3EZXA 1TQ8A 1F6BA 4QUHA 1I32A 2QVLA 3LWNA 1T1EA 3HV2A 2PUJA 3ETCA 3WLNA 3Q2IA 2ORVA 4GEKA 1PWZA 1QR6A 2HU5A 2R84A 4CUKA 4C14A 3D81A 2KPOA 4Y2TA 2ZW9A 5HF9A 4H3SA 3RBAA 3JQDA 1H1DA 5KU7A 1DPGA 4CG0A 1KQPA 3I0MA 4OLBA 5CDUA 2PYZA 5EUMA 4ZI7F 4F9TA 5EIXA 3Q4GA 1PZFA 4GLJA 3IKTA 2RGAA 1Q0QA 3VDNB 1KL7A 5IAAA 2HRDA 5JBQA 2X5JO 5AKIA 4PS1A 1IY1A 1I2ZA 4ZKEA 4U2FA 3K8ZA 5KUTA 2J7PA 5AW2A 3OBIA 2CK3D 5HKLA 5F2NA 3FWPA 2HPZA 2ZCUA 2NYVA 3IKVA 1I2MA 1CQJB 1VIVA 3BWEA 2HU7A 1C4WA 2ZQYA 1XL0A 3JRWA 3NHPA 4L27A 4PGAA 4OMFG 4QGHA 5AJWA 1LLQA 2QW1A 3EZGA 4GX2A 3C3EA 4PX9A 2R8ZA 4YRAA 2ODAA 4ER5A 1W85B 3WQHA 2B6HA 3A2MA 1ZINA 3OEHA 2I33A 2ZUUA 4JYCA 1WTCA 4Z0HO 5HQ3A 2NP7A 1E3WB 1DUIA 4QQFA 3UG6A 3EGIA 2Y77A 2JGDB 3MMPA 2EL9A 2NUPA 5BPHA 5J63A 1IQRA 5CLHA 4NICA 2D5LA 1N78A 1KFKB 1NJ5A 4IQGA 4V0SA 5CK4A 2PUDA 1ISGA 1VIYA 2NUAA 4U2KA 1F0KA 4D57A 4ALNA 4S05A 5B1HA 4C7MA 1TKAA 1QV9A 3O73A 2J9XB 5FBHA 2RB5A 4EKIA 1WABA 3PCRB 1AQNA 3OAAD 3PNOA 5KZMB 3N8IA 3PXGA 4WNIA 5F35A 1RAHA 5BW8A 1XTRA 2WT4A 2O50A 3OUZA 3SQXA 3OZUA 5TMBA 2PR7A 1E7RA 1JHPA 2X6QA 2XKJE 1ZN9A 3IQDB 4NCNA 3CCBA 3L6EA 1KMCA 5ALPA 1RYZA 1SG9A 5HBRA 3V8NA 3V4SA 3AM1A 1OFVA 3RU7A 5CVVA 3HZRA 5EE9A 3WBFA 4DTCA 2PEYA 3D2CA 2DSTA 3M6FA 4C1BA 4OPMA 3NDRA 5IC5A 2JBWA 3K6JA 4ENWA 4P4SA 5A02A 1J24A 1NQAO 2WZBA 2BFBA 2XPCA 1UJ4A 3DVRX 3I73A 3OCVA 3T5GA 5L4LA 2O3SA 4X65B 4RLQA 1TCBA 2YJTD 1NVBA 3ESDA 1A9XB 3N3BC 1B3BA 3H17A 4RKYA 3EOBI 4YCBA 3CLKA 3SKYA 1D4OA 3FPGA 4L5CA 4UOQA 3BB3A 4WFJA 1SVWA 2NX2A 3LGXA 4OJMX 4ZCRA 5LQUA 1R3DA 3BJMA 3GLSA 5FWYA 4W5OA 2WUVA 3A1SA 4DCPA 3PC6A 4HX2A 4CLEA 3F3SA 1ZD9A 2WAYA 4AYTA 1O6GA 5DT9A 1J70A 4TQUS 3TB6A 3SOZA 3HJRA 3JWHA 4GLFA 3NT4A 1SA0A 3DXXA 1U3UA 1YOVB 3BS4A 5DGTA 3SQLA 3MLAA 4DR7B 3DW3X 2J6BA 1C8BA 3NKLA 1TPYA 3X1ZA 2JI9A 2WFLB 3HJBA 3KR9A 1G64A 4INZA 4CIXA 2BD0A 4KQFA 2RHHA 4YMGA 1E96A 5MF6A 3QFCA 3ADOA 4NARA 2VK4A 2WWWA 4KGXA 1R74A 5AM0A 1FP1D 5JHHB 1KTIA 1O7JA 4E7OA 2E0IA 4GPIB 4MLZA 3LX5A 3ZNOA 1AZSC 1WU7A 1XLVA 2RGBA 4B87A 1K9VF 1XWWA 4EPTA 1BE8A 1VDMA 2PT5A 2XYPA 2ORYA 4X20A 5G0WA 3P9NA 5B6PA 1T0UA 1SHTX 3MCWA 2ZI4A 3TZHA 2FMTA 1GP2A 5H3CA 3OT4A 3RSCA 2OZLB 2ZBGA 4PYQA 2P78A 2P2DA 3LWBA 2AX3A 1O94C 1QRRA 4J76A 3TYXA 3CX3A 3VO1A 1VP3A 4ARIA 4LYAA 3D3NA 4YMHA 1LK0A 5K5EA 3E9QA 1CUZA 1VKHA 1I7QB 1F8XA 1JXMA 2Y05A 1KMHA 1MABB 5AUNB 1V1MB 1XDDA 3EISA 2HMVA 3DV0B 1Q19A 2B8NA 3HTXA 4I1RA 2CNBA 3SLGA 4N8SA 1YH3A 3EG9B 4UTXA 4IDEA 3WJAA 4YMUA 4C7OB 3F97A 1GL7A 2ZIUB 3L6BA 1YR9A 4MULA 3RS9A 4BRZA 1J5XA 4CW7A 2GDZA 2C4TA 3V8EA 1ZNWA 1ONBA 3A4LA 1E1RD 1PR2A 1SWVA 1ZVKA 5DPMA 3VYVA 4EMBA 2KWIA 4FFPA 2R7AA 1JR3E 2HK7A 2P9EA 2AN1A 2R1TB 3NHBA 3O83A 4MPTA 3HVIA 3FNEA 4QOJA 3DEHA 5M3BA 4DJDC 1S3SA 3M4JA 5K3OA 2HEGA 1YWGO 3MRSA 1W48A 1N3IA 2WIGA 1W25A 3CLRC 3JASA 3JVIA 3WQRA 1ZMOA 1S96A 2VDWA 3UNXA 5K6AC 4CIBA 3EE6A 2WE8A 3PPWA 4ED9A 4EA6A 4KR2A 2C5FA 1PJ4A 4JI7B 1I5RA 1YI1A 3V33A 1QGAA 1NQOA 3AOEA 1PZMA 1AS2A 1RJFA 1L8LA 3HCRA 4F06A 2QQ0A 2GZDA 3I1IA 4OAPA 3HP7A 4O1MA 3N28A 1O8CA 4DB4A 5IXJA 1WKBA 1SKBA 1X7GA 4RVOA 4O4IA 4W7IA 2XWSA 3RB8A 3QHQA 4O4JB 4CFZA 3WLPA 5CFMA 3PC8C 3PQ8A 5J47A 4C87A 2KBEA 1TUBA 2X6RA 3BCHA 3B8EA 1JPNA 2ATIA 4GWLA 4LVUA 1WXQA 2C3MA 2VPYA 2XMRA 1ORHA 3KEOA 4MWZA 2VSNA 3TDNA 4B8YA 3CJTA 3ER9A 3TNJA 1T34A 3B6MA 3G0DA 4W1RA 1DJOA 3OD5A 5KS2A 1ZZGA 1TTQB 2ZSFA 2JGIA 3RRYA 1YHNA 3IILA 4CF6A 1T1JA 1S2LA 2DHDA 3OIDA 3QVMA 4AIIA 1PZHA 5IVKA 3HXOA 2O7NA 2J67A 3P4XA 1X7HA 5G0TA 2FZLA 3NRJA 3NDPA 3ELDA 3L7AA 3V7UA 4F4UA 1HETA 5ENZA 3VTKA 5ARCA 1NBHA 4LX0A 1Y1TA 1WMAA 3NC1C 4NMXB 4AI6A 4G65A 3DYIA 4CJXA 3VR2A 2RGYA 1TFRA 3H65A 4HI0E 1YDMA 5JAHA 5LD2B 5CEEA 4KNYA 1DWQA 1XL1A 2ZANA 3FCCA 3G5TA 5FEUA 1B3RA 4NEHB 4CTJA 2ZJ7A 1FX0B 1OBOA 2ISQA 1EX9A 3F96A 1YS7A 4Q3BA 3AZOA 4RDCA 4TV8A 2V7PA 4DQVA 2X9VA 3C3DA 3NTQA 3DBLB 3BCUA 3SZOA 1KSJA 2GPAA 4DCSA 1Q7EA 3A3PA 3G2NA 3FLAA 2XB2A 1LRKA 3NRBA 2ZGVA 1V2GA 2G9RA 1OFUA 2BMAA 1IN5A 3L7OA 4G24A 4JCOA 4N12A 3RDPA 3UANA 3UMMA 5FDFA 3GVIA 4ILKA 4BGEA 5L3SA 4KQJA 4WLNA 4UCFA 4WY5A 1QGUA 1R0CA 1XKXA 1ZNYA 3BN3A 1BX0A 1JDZA 4IFBA 4RKWA 3DFFA 4MYRA 5EZYA 1EAMA 3I9MA 4BIMA 1FP4A 4I1PA 3IVAA 3QKTA 1P77A 1GQOA 3GNSA 3NWJA 2GERA 2QVBA 2FQXA 1KZ4A 1UKYA 5CNKA 3UB2A 2CSUA 1UDAA 3C14C 3E82A 1B74A 3NFYA 1MO5A 1TK9A 1MHPA 3K35A 4M46A 1WBJB 3C5EA 2O7SA 5JANA 4DIBA 3K1TA 4TMXA 3F5DA 4D5GA 3ZHRA 3P27A 2HK6A 3IRVA 3UJDA 3KJEA 3FKJA 2R6HA 4GQIA 1B8NA 3C8HA 4BNJA 5JAMA 5BQFA 2OCLA 1LQTA 4DMUB 5G3ZA 1M3SA 4YXWA 1IOLA 5AOBA 2I1WA 2GAEA 3V4PB 1USGA 4A8JC 2V55B 1HR0B 3C8ZA 3OOEA 4XGNA 2AC7A 2GO1A 4AO7A 3KHTA 3H4TA 1OLUB 5GONB 4QUKA 1B2RA 1FW8A 1P9LA 1ZK2A 2A6PA 2R2AA 4B2IA 1OI7A 5LMUB 2M1ZA 5F21A 1ST3A 1BHSA 3PNMA 3A3NA 4OHXA 3FTNA 4QQNA 2VYVD 2EZUA 4XJXA 2OBLA 4US0R 1JAYA 4WA7A 4FB5A 4DVJA 1E9RA 2CNLA 4NQZA 4XIGS 4ZTZB 1L7VC 3GRPA 5FD8A 4FYIA 4X90A 1KWGA 3HJAA 1IWBB 3GLQA 3GRFA 2GF9A 5EJ7A 3OZWA 2WMNB 2CBZA 5HZHA 1E3TA 4L73A 3I37X 4X8MA 1NV8A 1SHKA 2O0MA 3C87A 3CUKA 3PFGA 1IE3A 3PTLA 2I65A 3BWBA 3I62A 2P27A 3GEHA 4J75A 4ZDWA 2XAUA 3STUA 2NSHA 2P3QA 2G04A 3C3PA 2KS6A 2YJZA 4FCWA 4Z0NA 3R4VA 5H9VA 1TX4B 4YIKA 4BQNA 2HGSA 4HDNA 4BQSA 4D9EA 4E5KA 5K7SA 4B3TB 1YZGA 3SM3A 3U7QA 2XGSA 4KIJA 4XSHA 5ED0A 3RSFA 1GKKA 1L4LA 4R2MA 4MARA 3NYQA 3SS7X 2BV3A 1PR0A 4A8PA 4ADSG 4BVAA 4R3WA 1SU7A 2IIBA 4ICIA 3FOBA 3CBGA 3QVGA 5E3JA 1MG5A 1W9HA 1Y7LA 2G5GX 3AXTA 3GLHE 1X70A 1V47A 2AFHA 2FWBA 2VLIA 3DZIA 4MB0A 2VJPA 4QUEA 4ZVPA 4ENUA 3ME5A 3CVVA 3KXKA 3VSAA 4Q9LA 1T3TA 3X2EA 2G82A 2EP5A 3ACBA 4GT1A 2Z0MA 5B4TA 1G38A 1A82A 3V8MA 2OYSA 1YS1X 1FU4A 1K2VN 2J3LA 3LHSA 4FVTA 3DL2A 4BNWA 4IJMA 4PHFA 3RV3A 2QSZA 1JWBB 3SIWA 4GM0A 4IF6A 1U7DA 4Q9NA 4UREA 2OFOA 2FFQA 4GH5A 4H9GA 3PFHA 5B64A 1OYWA 5IYZA 5EGNA 1N2CA 1QH1B 1J39A 1VIAA 1U04A 4AF8A 1P3JA 3D5EA 1XMPA 3PCXA 5FUVA 2BFWA 1JDBC 2NYUA 3EFOB 3LT1A 2JIZA 3OUTA 4C3VA 3PGKA 1L7EA 4Q93A 2NLOA 3EJWA 3HXPA 4HDRB 3DWEX 4M1ZA 5JECA 2QF7A 3ABIA 4NYIQ 3AEXA 4E6PA 3O5AA 3K53A 1V39A 3PXCX 4MDEA 1J21A 4LMPA 4C0BA 2JHCA 2OOKA 4R0NA 1E77A 1E20A 4XE5A 4QELA 4YMLA 3L8YA 2JLQA 1MX1A 1FUEA 3CNHA 1A8PA 4RDXA 2O8BB 1WOMA 5ECWA 5KQGA 4YLEA 4ZTUB 2H2DA 4F4IA 3VO9A 1E5DA 2UVPA 3BTUA 5TVKA 3FTCA 1CERA 3HKDA 2GYUA 4ONEA 1NDQA 3NKVA 4DCNA 1Y8QA 2FV8A 4E5PA 4BMCA 3LKZA 4C01A 3EZ2A 1UBEA 2WV7A 2Y1OA 3DLHA 3B3JA 2Z5LA 3L7CA 1QE3A 2WJAA 3BM5A 4OK5A 4DQDA 5SYAA 2FQYA 1DJPA 1TK3A 5TRTA 2YW9A 3N2LA 1PQWA 4N8EA 5IFLA 4ZI3A 5EJ2A 2FEWB 3LCCA 1GXSA 1RBMA 4RGBA 2OL4A 5KPDA 2BFOA 5DYNA 4BGVA 4DILA 1C3XA 4JP8A 16PKA 1Y5NA 4DLPA 1LPBB 1ZUNA 2JLAA 3FDXA 2V8BA 4UULA 4M9CA 1PWYE 3B7PA 1O95D 4CCYB 1U2QA 2BGKA 3ORQA 4M7WA 3TB4A 2H2FA 2NU8A 3SYMA 4LC9A 1TM4E 1EFTA 3A2NA 2LDBA 1EXMA 2JGEA 3SX2A 3PBKA 2VAMA 1MZVA 1HQYE 1NXOA 2HA4A 5ITVA 1NR5A 2A4MA 3AETB 3OICA 2W0SA 4CQNA 4WKBA 4MKFA 3LL4A 4IWNA 1RC1A 2GETA 5IEJA 3ZNNA 2O20A 1Z6PA 4KXLA 4P80A 4RORA 5U4XA 2K7ZA 4AJNA 2KBFA 3BSSA 1Q11A 2IXGA 3OOYA 2PV0A 5TMDA 4C7OA 3TTTA 1TVCA 4IPTA 5IKOA 4M1EA 5K3BA 1YQUA 4L9AA 1MAWA 2HQBA 2PWZA 1H4VB 1XEWX 1XZEA 3DHYA 2XCQA 4FN4A 4E08A 1W36C 3ERCA 3VH2A 3LL7A 3D02A 1C4XA 1W8DA 2R7LA 1PCXA 5H0IA 3A4TA 4PCUA 2UYYA 5AVQA 4EY5A 1GAQA 1XDSA 2DC1A 3LWDA 1ZUD1 3OPVA 3EQ7A 4M49A 4PEVA 3VVLA 4QFBA 3GZNB 5EYPB 3TD9A 2Z5FA 4R7GA 3ZWCA 4A0QA 4OUDA 4I4IA 4MKIA 2R3SA 4MS4A 4ZVSA 1R4MA 1RLTA 1JX6A 1UPXA 2C78A 1N3BA 5CB4A 4LY6A 3C41J 5IABA 2I2CA 4R81A 4P9NA 2QYHA 5LNK1 2X8JA 3GJ6A 3U80A 1XZNA 1EWVA 4JV5B 4EY4A 1T0BA 2FZWA 2ZAOA 2ONKA 1YZVA 3LIPA 3U1TA 4LSMA 2A58A 1BC5A 1ID1A 4S1WA 1KQFA 3OTOB 3SYKA 3V4RA 3EWSA 4GBED 3T7EA 3WLLA 1L4YA 1YZUA 1NIPA 3LM8A 3NORA 3FKQA 4NU8X 1Z25A 3L04A 2C0CA 4CE6A 4JBNA 2QUAA 3E5NA 3MFYA 4LFBB 3ET4A 1ZWKA 4ZAFA 2OYCA 3QYFA 3PPYA 2M98A 3D0QA 4ZI5A 4Z7JA 4GE0A 5FUYA 5KTPA 1YUNA 2FR1A 3TG8A 3O7MA 2QLFA 2ZQ5A 4OQMA 4U4AA 4MQBA 3LKBA 1SKYE 4E0BA 4FFMA 1ESEA 3K2BA 4KFCA 2H1SA 3DZJA 4RADA 2QU8A 5BMVB 4OOFA 2R62A 3WWZA 2G1PA 3NIFB 2HIMA 5CDTA 1GRQA 1A8HA 2M32A 1XJWA 4L8WB 4XDGA 4MRMA 4EG6A 5B4VA 2FF5A 3QHPA 1WD5A 1YCHA 3A6LA 3S0JA 1C7RA 3UK6A 3JZIA 2I4NA 3MJSA 4QXMA 1XZIA 4F0JA 1IVNA 1EMDA 3RUIA 3ZKWB 2HD4A 3L0CA 3CVYA 4KUHA 4AN1A 4WSOA 4GMXA 3SHTA 3V1UA 1FPMA 4K8OA 4YQFA 2EG5A 3Q11A 4Q1CA 4G0OA 4C6HA 1F7VA 4HQOA 3UK7A 4CNBA 5TMPA 3OQIB 5J9FA 3KB8A 3P9YA 3O47A 4W1PA 4UHBA 2BM9A 2OXFA 3OP4A 4ILEA 1PHPA 4NHOA 4IZIA 1VLZA 4HDSB 1SPBS 4JBLA 2FE4A 1Y1PA 3PLNA 4Q9AA 2AFVA 1ZMTA 1EUZA 2GWHA 1GRRA 4J4TA 4BN0A 2ZROA 3O4HA 3QOYA 1QGZA 1SBYA 3RU3A 5KYGA 5ALMA 1DCFA 4BAUA 3VNSA 3JRNA 2ZS9A 1JW9B 3HH8A 1HQKA 2V4MA 1XN1A 4YWJA 2CLDX 5C7OO 2XKBA 4GVLA 1MNAA 4YRKA 3JQRA 5FQOA 3KZKA 2V5VA 1CP2A 4LRSB 1ZXLA 4FONA 1N6IA 2AGVA 4QZVA 2P5YA 1H94A 3LD9A 4CI9A 2X6TA 3WLKX 4CDNA 2ZE5A 3M83A 3OIUA 4QLAA 1T6ZA 1WLSA 3EDMA 3RK0A 3FJYA 2CFCA 1LLUA 3FSGD 3VNUA 1H2HA 1P2SA 2VRBA 4E8BA 2JFGA 1PG0A 2OCKA 2QD3A 1VLJA 2UYGA 1P5RA 3AU8A 1QZTA 4OU4A 5ITSA 3G2IA 1B41A 4ON9A 4BEVA 3H75A 4IDGA 3T9BA 2BSXA 3AHEA 1YONA 5L7WA 5LLDA 2QHXA 5AVKA 1BDBA 3HNRA 1ZD2P 3JQEA 5TMEA 3VR5A 3HRIA 1UANA 1OBCA 1VI6A 1VGQA 1QCYA 2ZSJA 3IT0A 2OV8A 1H0SA 1LFDB 2VH2A 3GYBA 3PVSA 4X7PA 3U13A 3WVNA 2M6KA 2FX3A 4ZO4A 2B0JA 1L7AA 3LDFA 2OXRA 4JJZA 3KUCA 4QC2A 2Y9PB 4I7EA 3DDNA 3RYHB 3V7NA 1B14A 2QL7A 2EGGA 1I5OA 1BOFA 1CY0A 1WPQA 3DLPX 4AF6A 3LGSA 4HGRA 1Z5ZA 3HYSA 1PBTA 1IY9A 3DDWA 1ZH4A 2TS1A 5GAHW 2W71A 2R66A 5CVEA 3WP1B 2EYQA 3DMHA 3FIJA 4X92A 5AI9A 2CFIA 5CDGA 1KY3A 1U8UA 4Q4AB 5B1EA 1WDMA 5IWCA 3M8KA 2J3QA 2QN6A 4NE2A 4XQ0A 4F2HA 2P9FA 2R6JA 1HNXB 5BW6B 4HAVA 4MW0A 3QVGB 4X6XA 1GFSA 1CDEA 5AM1A 4YRJA 3VOBA 1WMSA 5JSQA 3FJ1A 3K0CC 1NBMD 4Q3AA 5CCXA 4AUKA 1Q92A 5B37A 1V1RA 1YIAA 1WDWB 2O9JA 3DKRA 1FFWA 3E3OA 4A2QA 4C7KA 5BUZA 4UUBA 1MG0A 2QPOA 1EBFA 3C3AA 3FRIA 4RPIA 4KN6A 3LA6A 4Q9HA 2A3NA 3SHQA 4LV5B 4DDHA 4D9FA 1QZ3A 4YLGA 4JVMA 3RC1A 1T8SA 2WUEA 2PKWA 3NWOA 3AUTA 2HAEA 2P5TB 2JARA 3BGVA 3CR3C 4GU5A 5F23A 3IAM1 4LJLA 1UCFA 1PNRA 1JVNA 4YACA 5HHTA 1OI2A 3AONB 1MX9A 1R1DA 3ISJA 3OE5A 3OTGA 5LCXA 1U7ZA 5FH9A 1DS6A 4H1HA 1UBCA 2FRXA 4M37A 5A4KA 2AXEA 2A5GA 4L8YA 4CN8A 4OLHA 3VZSA 2VZEA 3OKPA 3A27A 2YYSA 1B6GA 3L0PA 4I4NA 4Y1FA 3RS7A 4QPNA 4FYXA 4O4JF 3X2SA 2CNWA 3DDZX 3LK6A 3D59A 1TQDA 3R09A 1SHLA 1ECPA 1SXJA 1OZGA 2PGXA 2RIRA 1JVSA 3W2GA 1O9GA 2BKXA 2J0UB 2VDOB 3KLPX 4PO1A 4Y18A 1KEKA 1NBWB 1VYUA 3GP3A 4YS6A 3D8NA 2QRVA 2QJTA 1KDVA 2FRDC 1NVKA 4DLWA 4XR4A 4R01A 3NS7A 2R6FA 5CXSA 5EI5A 4KR7A 3N74A 5C3UA 1U3VA 5EZYF 4LWPA 4YMIA 1EKXA 2DEUA 2BE9A 1T9ZA 2JCYA 1JDNA 1N4AA 1S7GA 3FZQA 3OIFA 2VLBA 1QTRA 1K06A 1I2DA 1RRPA 2H7YA 3IP7A 2MIIA 4OQFA 1XTPA 5JSFA 1NURA 4KH0A 1S89A 2PTGA 1SFRA 4PC6A 4DMFA 1YL5A 4CCYA 2M9MA 1XKLA 1P2TA 1LZLA 1ZOLA 2AOUA 3TXXA 2IP2A 4D4MA 2I4OA 5BR8B 1LTKA 5HIAA 5JWRA 1S3FA 2EXXA 3KO8A 4BQQA 3LH5A 3NPMA 3U7QB 2WTUA 1OLOA 4UDYX 2QY6A 5ETJA 4YDRA 2QVXX 3I6ZA 1EK0A 3VHLB 4C0QC 4MRNA 1L5YA 2YV1A 1AQYA 1LU9A 4G5FA 5ALZA 5DM0A 2FFAA 3AJAA 3K30A 2W4MA 4QBKA 2NMVA 1M6EX 1YASA 4XD2A 2TSYB 2XMDA 4LGVA 1MF7A 1CUYA 2FPKA 2YIVX 1QHFA 2PE5A 1DIHA 3V2GA 1O2DA 1YDGA 4JL5A 4M83A 3BD8A 1N2OA 2BH9A 2H9YA 4E30A 1C3OA 5AIBA 3MLBA 2H65A 5DHTA 3H19A 4U00A 4B4DA 2C1EA 2W2XA 2HQOA 3HB9A 3S40A 3BAFA 1EVLA 2OFWA 3QELA 4IICA 4RTOA 4PG8A 4E4TA 1RE1A 4QOIA 3DZBA 1QH1A 3R0VA 5K0FA 3SYTA 3AKDA 3A6HA 2WYWA 3MUOA 1PVOA 3HWSA 1Z6TA 1W88B 4YECA 5MGBA 3C4JA 3I1YA 1VFNA 5KINB 3U3MA 2JLBA 4DIKA 1KJJA 2GTIA 3DUWA 3W5BA 5HKBA 3ZCXA 4OKIA 2HJVA 2EL7A 3EGXB 4WN3A 2ZYUX 1DRVA 5F51A 3QK7A 1NPYA 2JS7A 2ZSIA 3LVBA 4M8IA 3O93A 1EX1A 1S8AA 4KDCA 2GSWA 4MX8A 1RHUA 5AI0A 3DT6A 3SC4A 4O8CA 5J43A 4FS8A 4EZIA 3LYUA 1D4AA 1JJIA 3Q0IA 1PR6A 2BW0A 2CNWD 3H5NA 4X1YB 1O8BA 5DTMA 1IN7A 1Z0ZA 1R10A 1DRWA 1JLMA 2JEOA 2Q2QA 5EKTA 1PEYA 1ADGA 3IVGA 4B75A 1DAMA 5GAJA 1NN5A 4A23A 3NEAA 4GGPA 4X8LA 4AJ2A 1AHPA 1USIA 4QU5A 2PUAA 5B58C 1JHMA 5D51S 3WHKA 1OUMA 5A4AA 3F74A 2AHRA 1ILEA 3WGUA 4JHLA 3SF0A 1Z85A 1M10A 5H16A 1GXSB 1T4GA 1SVMA 3QI7A 1BE0A 3HXQA 5CCEA 2QVZX 1T15A 4K6KA 1XF1A 1QBGA 4OKSA 4CTMA 1YB2A 1M1YE 4K5QA 4YJGB 1MN6A 4E1AA 1X7WB 4OGKA 3S4YA 3TRJA 4UQOA 2PZFA 4NCIA 4XWGA 1UMDB 1RWBA 4Y67A 1HE2A 4FHCA 1JHRA 2INGX 3OOJA 4NK4A 3SFTA 1H2WA 1T36B 4B1FA 2VWQA 3ZDRA 4PICA 3QPCA 2SCUA 1U2EA 4G89A 3C5WP 1RYNA 2P9BA 6REQA 4U7DA 2ZSAA 1TF7A 4C78A 2FAXA 4EYOA 3PVCA 1U2TA 2AR9A 3E35A 2FYTA 4URZR 3VZRA 5BSHA 3GYGA 1J5EB 4DA9A 3C85A 1HDGO 3PR1A 3ESCA 2PSFA 3FUUA 2H4XA 2WMDA 3A6ZA 4WUVA 1JN0A 1Z63A 1G42A 1U2GC 2CVZA 4WHMA 5BWLA 2D3TA 1E0DA 2ICAA 1U2DC 5JQWA 1RQ2A 4HDSA 4EW2A 4L95C 1V5GA 1L5VA 2R25B 4JEHA 2OGUA 3RJ9A 3PQFA 1NASA 1XC7A 3ZC3A 3B3QA 3QEBZ 1FZTA 4DCOA 4UXIA 4YUZA 2JJYA 3HLKA 1GWNA 3K5IA 1RKVA 4MCIA 5EYPA 2F1OA 2YYYA 4HNQA 4JDUA 4R31A 1IZ9A 1TLTA 1DOAA 3IEUA 3RSHA 1NR7A 3TX6A 3IUPA 2PS0A 2Q7OE 2IYFA 5A4MS 3ESZA 2BTQA 4BNMA 1YD7A 3E53A 5CVUA 3PR2B 1FSFA 1ZGHA 1K08A 5I5GA 3X44A 3MBKA 1ODJA 4D96A 4MWEA 1H65A 1SR8A 1LSJA 1Y82A 2ZSHA 4QASA 2CMHA 3K6SA 5LIPA 2J0VA 2QX8A 3GJ4A 4NAHA 2AKEA 5EJ6A 1GL6A 5B2ZA 4C29A 2BSAA 3DE3X 3FSGA 4JEMA 2PL3A 2GLTA 3C3JA 4UHDA 4DLRA 4R8MA 3SHOA 3HABA 4HUQA 4NPHA 1IOZA 2Z2XA 5AYVA 1HLDA 3KLNA 4WJKB 4CDRA 2IXFA 1Y5LA 1W47A 2FA9A 1KDRA 3ESQA 4QT0A 1JHVA 4A5OA 2B0CA 4FD2A 3UA3A 4BDSA 4MZXA 5JXJA 4AJEA 4IJ6A 4KQKA 3PQ3A 1ESNA 1CS0B 1EE2A 4R3UC 1W9MA 4ZIRA 5HK8A 3UW1A 4GL4A 4NR0A 1P62B 2XBLA 5C32A 4OIMA 5FORA 4PSVA 2EZ4A 4DNQA 4G81A 1K5HA 1ACJA 1K6JA 2FEAA 2YDYA 4ITUA 1CNMA 2FXIA 2JLCA 3CLUD 5BMVA 3N2IA 1N4DA 3W05A 1BJTA 1Q0SA 1SUPA 3H3XA 4EA7A 3BWYA 3UJ9A 4DV4B 4JBXA 4X45A 3ZZ0A 4JY7A 3R3YA 2BZ1A 3RBXA 5TXGA 5JNTA 3OURA 3RTAA 4OQLA 5FOWA 3ZTYA 4FYWA 3GRKA 4QXOA 1FRQA 1QONA 1QWOA 2WKRA 4EFNA 4G85A 2I80A 2JFWA 2VYFA 5F64A 1BWRA 5LYYA 2JVJA 3N6VA 3W7AA 3IAXA 1YQGA 5ECDA 1UM8A 4Y0VA 3BIXA 3TBFA 3CR8A 2C7OA 2IEIA 1ONSA 4IDHA 5GOZA 4DWJA 4FSHA 3PYMA 3HBNA 1LB1B 4TSFA 2HLDD 3AERB 4BNVA 1I30A 4P35A 2Z4SA 4C21A 3FYDA 13PKA 1EM8A 3PQ4A 4E15A 5JISA 2Z2KA 5KDDA 1MFZA 1QFMA 3F4KA 1A95A 1AUVA 4KPGA 3UT5A 1VKRA 2W4IA 3JRXA 5D01A 2Z57A 4TL7A 3FOCA 4PIPA 2V7BA 1PV2A 3TIGA 5BSFA 5ADVA 4S04A 3U3JA 4C1NA 2WHXA 4MMXB 4KIFA 1CUXA 3VR6H 3VDRA 2ZAGA 1OW3B 3K8YA 1UOQA 4TTTS 1XCMA 3GUCA 4UMDA 1RC0A 2QVCA 3L6OO 2BR4A 1KDOA 3RS0A 4EGQA 1ISFA 1CFZA 2JCGA 2QLBA 2X42A 3ZBQA 5CYGA 1CZLA 3NUQA 1FU8A 1ZM2A 1HZZC 3GGDA 3QVWA 4B4KA 1V5IA 3JZFA 3UW3A 2R6DA 2VT3A 3BILA 1XZJA 1KHHA 4N5LA 3T35A 3B85A 2PN1A 1WVGA 2FKAA 3WYNA 4J7CA 1GUAA 3HCPA 3C5CA 4NMMA 1U9IC 2FPGA 4HDOB 3UUEA 3OD1A 5JI3E 5EP2A 2H0QA 4BRUA 3L7KA 1ZG3A 3CUVA 2IUSA 5K3CA 1EI9A 1UF9A 2ZUVA 3UOGA 4BE9A 1I3LA 1VRVA 1IXKA 4IOAS 4B17A 4OK3A 2J4DA 1OWLA 4Y2VA 1DNPA 2WABA 4HLUA 2FEPA 1NX6A 1FYVA 5JYCA 1M1XB 1W4RA 1FK8A 2E4VA 2C92A 2H1FA 4K05A 3S2FA 1RM0A 1KU0A 4KU4A 4MV0A 1XNHA 4DLXA 3Q9LA 2XF2A 3WGKA 1YDWA 4IV5A 3H5IA 5JD5A 3MAAC 2HBRA 3O21A 5KTTA 2OOSA 3BMQB 4MW2A 1UP4A 2TMKA 1CHDA 1SD1A 1ZGBA 2C59A 1W0JA 5JROA 1OIXA 1AU9A 1RYMA 1JPJA 2CHGA 1SXPA 1ZUHA 1JKJB 1JMYA 1FB5A 1E2EA 5FTWA 1L8OA 5HS6A 4MDYA 4R1OA 3Q72A 1Z4NA 3BL5A 3QFHA 2HR1A 3Q98A 5ALEA 1FIUA 2W6ZA 4LQDA 4XAQA 4F21A 3SBDA 5A6VA 2GBLA 1T8YA 4KTVE 1LS1A 1RWQA 1OGYA 3SSOA 1CBUA 4E4RA 1XV5A 1E3WA 1JBQA 2WR8A 2G17A 1XYVA 2XB8A 3MEQA 4COKA 5BWNA 1XQ9A 4CEJA 2R00A 3RYFA 3GUHA 2C2KA 3K31A 4DREA 1BRTA 3OFSA 4EPYA 4RZ2A 2RKBA 4MA4A 5JPCA 2JLVA 3DKIA 1U65A 1X77A 3RNLA 5I7OA 1OX6A 1ZRMA 2VRWA 2JDIA 5JY1A 1PBNA 2IEDA 4OQNA 2W37A 2ZZNA 5DV9A 3SHFA 2GNOA 1GZVA 1N2ZA 3RIMA 2O8CA 1M66A 2YBDA 2QTRA 2YWGA 1GTL1 3Q3GE 1L5GB 4QG3A 4MR8B 5CG1A 5I45A 5J4HA 1P0IA 4H18A 4C5AA 5KC9A 1U99A 3OETA 1BCRA 2EJUA 2VP6A 3CQ9A 3IBSA 2PUTA 4JC4A 1VYVA 4YDSA 1W52X 3C4QA 3ZIAA 3ZJ4A 5IBQA 4FX5A 4MJLA 2VA9A 4DSOA 1F8GA 3G5UA 1DPFA 1ZONA 2J32A 1XDWA 2AV6A 3DZGA 3E48A 2OPBA 3O0TA 4CM9A 1OJ7A 1E2JA 1G4AE 3G0GA 2W58A 4KXQA 5I9IA 1A5ZA 2HHCA 2C31A 1H0RA 4YA6A 2RJNA 4EL0A 2GEFA 5B55A 4BCDA 3BF7A 4MUMA 2OBFA 1HI9A 1PR3A 1QHGA 3ZNQA 1DJLA 5IPFA 1D7OA 2XCTB 2QXTA 2UVDA 5AMXA 3TQIA 4F1JA 2EFGA 1C4OA 2VJAA 3PA8A 4LZLA 4UFOA 3S7ZA 1EIWA 2W9XA 3CPEA 3VR5H 1XZCA 1BFUA 2H5IA 2HUPA 4GUDA 1V35A 3KB2A 4OQEA 4R1QA 1U0BB 4LFCB 3VC2A 2RGNC 1C7EA 1YZYA 1BOOA 2EWVA 3EW9A 4YRLA 2NSYA 4EI7A 3MTEA 2IRWA 3PKIA 1V8DA 1RMQA 4M2LA 2AJBA 1PD1A 3H1TA 5THXA 3GLIA 1SXHA 4JUDX 5IM4F 1SZJG 2Y0CA 3AVUA 1J8FA 3ZIDA 3TZBA 4KAXA 4UFPA 3HO8A 4Z7OB 4NSNA 1DX6A 2FI1A 5EAIA 1U94A 3E9CA 2PGAA 1W2HA 3P0EA 4CKXA 5T67A 4XQ9A 4C22A 2IODA 5KOHA 1KWKA 1T2DA 4OX9Y 4HOYA 2LD4A 2QUHA 1MPTA 4U7PB 2V7EA 4V0MA 2K7FA 1G7TA 1SIWA 4DB2A 3NDBB 4L7QA 4O29A 3ND8A 3B6JA 3JYQA 2FW8A 3V9AA 5JFOA 1IEWA 1CUDA 3HCBA 3RWOA 4WXYB 1RM4A 3G7SA 4RWZA 3LFHA 2O0JA 1LBTA 1IEXA 4TV8B 5LP6B 4PN7A 1M1NB 1DQPA 1FUYB 2FVYA 2E37A 4KVZA 4B9EA 1KJQA 2IHZA 5TT1A 4CLOB 3NHKA 1V1MA 1UODA 5C7YA 1PJBA 3I2GA 3L0SA 1XRMA 1QSGA 1ZOIA 2EW8A 2GJ9A 3OCJA 4FOOA 4IFEA 1MC4A 1UMCB 1IPEA 2HTEA 4KIGA 3W9YA 2L17A 1EFPB 1QH8A 1YR8A 3GD5A 3STVA 4CM3A 4Z3OA 2DULA 3HBFA 3T1TA 3HGQA 1K97A 2FPUA 2GAJA 3RD5A 2A30A 2DFNA 1AKYA 2O2GA 4LZOA 4PYKA 1ULHA 1SUSA 1G1AA 1PNOA 1G2QA 2GRUA 3IV7A 3MT7A 4H7JA 3RIXA 4Q4CA 3EGXA 5ICMA 4RVCA 3RYCA 4PZ9A 4JBWA 3BGOS 4CV0A 4HXGA 2L0XA 5DBOA 3SN6A 4ZJZA 2BDEA 2W2LA 1E1YA 1NUQA 2BJHA 2XQKA 3K9NA 2X40A 4OHZA 1ZGJA 4YRDA 1P60A 2NTJA 5KVSA 1MAVA 1KJNA 3FM9A 1XJCA 1QRAA 3K9CA 1U0RA 5HF5A 5EGSA 2KW5A 2WSYB 1M5RA 4I4LA 2QRUA 3R3HA 2OB1A 4MVYA 2AEEA 2ATVA 4DAEA 4IQ0A 2HF8A 4F6RB 3ZLJA 3HRHA 2PUBA 1LDEA 3B12A 3MZ0A 4D44A 3D8RA 4MGHA 3S2YA 4AY4A 4QTYA 1GAXA 4V02A 4HXEB 3SXJA 4ESOA 5BSVA 4CQLA 4L4YA 1IDOA 2N1BA 4PZDA 1OKKA 4FR2A 4HZGA 2XMPA 1FSZA 4QRDA 3RHTA 4YCMA 1H6BA 4I9NA 2AFIB 4B8WA 2YQ4A 3IAAA 3U5TA 2P40A 3AL0C 3MERA 3FMIA 3HKCB 4TKZA 3KUDA 3I5YA 4ZAZA 1V3TA 2GRAA 1NNLA 4ENTA 4PSDA 2ASVA 2OHFA 4NU6A 1W1UA 1YRHA 1ZNXA 5K8VA 1ZHOA 1HEUA 5JZBA 4ZQCB 3KPVA 1DQZA 4ABYA 1I33A 3UEOA 1SOWA 2QVYX 1GSIA 4MA0A 2JFNA 3P9RA 2OQ2A 5IM4A 3V5NA 4F5WA 4AKTA 2IYEA 3AB7A 3FMOB 2B5VA 3WL7A 3QMPA 3O3CA 4FGWA 4NCHA 1NXQA 4DIUA 1QPGA 2O7RA 4F5ZA 5COAA 2PAFA 3RQSA 5KKNB 3SSNA 2VJDA 3NYIA 1J0XO 1FC0A 2NYAA 3ANMA 2PJUA 1QR2A 3MRXA 4CGZA 3GN2A 4IGIA 5CT4A 1MT0A 1NLYA 3M1AA 1P5JA 4RULA 4LF5B 2ZI3A 1R6AA 1GLVA 1XK7A 3KR2A 3QU4A 5L3ZA 3R7LA 4LYYA 4JQZA 5DM6S 3PU6A 1HTBA 5AJYA 2VDKB 3RRMA 3B1WA 3QWIA 4XB2A 1L5FA 3P0JA 3CUYA 1XZQA 1Y8CA 2HMSA 3DGFC 3I04M 3TKLA 3IP9A 4MR9B 3GRRA 3PSAA 3OPYA 4H2DA 2HXSA 4XGQA 5LMNB 1TA4A 2PH1A 3SC2A 4BFZA 3CWZA 4HX9A 2C58A 4HFNA 4UTVA 2JHAA 3FOFC 1TXGA 2PO7A 1Z0SA 4R9RA 1OFTA 3CW2A 2J3JA 1Z83A 3CWQA 5C31A 2OV1A 5EN4A 1QF9A 4AO8A 1QGUB 1UZNA 2PXXA 3NNDA 1G9SA 2A78A 3L79A 4PYMA 5D3QA 1OH7A 4MV7A 4BN5A 2DBYA 4P3NA 2YQZA 3SXUB 4F5YA 3TGLA 2I71A 4OOEA 1ZJYA 1EUDA 1GTJ1 3VDXA 4EMTA 2VQFB 4K9LA 2OPHA 1BIFA 2IU6A 4JLPA 3T1QA 1IJBA 1VPWA 4P54A 1M8KA 1E4EA 4P82A 3UT0A 3QP9A 5FBKA 4RACA 4XPIA 3B3FA 4D02A 4N03A 3EFEA 1H2XA 2O2EA 2B2CA 1P9WA 3EVGA 3KFXA 4MW5A 4P31A 4Q4HA 4TV9B 4DZRA 3PEUA 1D7AA 1U7TA 1W75A 4RO0A 4QSMA 4TVSA 2G1UA 4M89A 2R1VB 2QLMA 3HSSA 4OL0A 2RGWA 1NW5A 1O1YA 1T2VA 3OPQA 2YVQA 2Q3FA 2J9GA 2QORA 4M98A 4XD7A 5ERXA 1CUGA 1XNJA 2KQUA 4DWOA 3IODA 1T2AA 5CT9A 4QDJA 1XRSB 3IHTA 4KO2S 3WFIA 3IAUA 4TTVA 3W5VA 1BVYF 3BPSA 4FE4A 4IL5A 4LV6A 2A33A 1J90A 5DMXA 1QHHA 1W4CA 2VT7A 3BXFA 1Y8QB 1JZTA 2H0RA 3GFSA 1YZLA 3RTBA 2P9TA 4MUNA 2C9CA 5ITZB 5ALXA 1KF0A 4B33A 4QBHA 5LPNA 3GFBA 1Y63A 3QVOA 1GDDA 2QD1A 1GNVA 1C1HA 2FNAA 4BMZA 2GCPA 2WYVA 3FYUC 2JAUA 2PT9A 3ZLBA 4G0MA 4OAOA 3NEPX 4YB8A 1E2QA 3I76A 2JGKA 2W8BB 3CO5A 4ARZB 1D6KA 1T2EA 2C29D 2ZIFA 3MTQA 5EHGA 5SYMA 3S1AA 2PSHA 3AESA 2OAEA 8LDHA 3G8CA 2G72A 2WPNA 4C4ZA 3TQQA 5BSEA 3B13B 1Z75A 1WZNA 2NO5A 4MUBA 4LQLA 4LK2A 1IL0A 1HPLA 1SC4A 3TOCA 4BXOA 4B3JA 4YK7A 3INNA 4AY6A 3EGDA 1S02A 1XDGA 1JV2B 4GRDA 4NZNA 5FBWB 4PRLA 4C4PA 4HB3A 3FXAA 4HWTA 3CLUC 1JR4A 3B1FA 1L5ZA 3CUTA 3HUDA 3WGOA 2O2JA 4RFSA 1ZI6A 2FSVC 2FSFA 2WKSA 1J6UA 2H1VA 1R4ZA 1SUBA 4FEEA 1J00A 4MINA 4QD3A 1QVAA 1J33A 4MR8A 2ISSD 3GZ4A 4YRZA 2Q0SA 3TW8B 3HK2A 1IK4A 1RRFA 3IPYA 2XB6A 4JJ7A 1RZVA 2QXYA 1VDZA 4TS1A 1JEYB 2I8AA 1OBHA 5FPTA 2P7IA 4Y8VA 5L7YA 5LZ9A 2NNLD 5IM5A 2J8ZA 2JRLA 2P2YA 3F6EX 3NANA 2BFCA 3HJUA 3PVZA 3F1LA 4H3KB 4HAUA 3WSWA 4B7CA 4B9AA 4V1CA 5F4BA 1O5IA 2AZMA 3A6DA 2XUGA 5E9WA 3KRTA 3BSYA 4AJJA 1DKNA 1H1LB 3LCUA 5HIMA 3TINA 3QPAA 2P0AA 3T0GA 1QVVA 1I3NA 4CCSA 1KP9A 2GEUA 1ZESA 3U1VA 3GRZA 4KSBA 3ZD8A 1YJQA 1TYZA 2DECA 2JIZD 1HBJA 4O1HA 1ILWA 5TE9A 2AQ8A 2JIBA 4YBRA 2WIFA 3ZW9A 3PJRA 1RQLA 8OHMA 1MB0A 3QUBA 4QPZA 1N5RA 2DZDA 1FXWF 1WM1A 3FI9A 3Q1LA 4X66B 2BT4A 3ZS8A 2V7GA 2IBMA 4S3MA 2ENWA 2CVQA 3M3PA 2IYPA 5FLEX 1W5FA 3HKDB 5FBZA 4I9UA 5KTNA 3RAEC 1HMYA 1KMNA 4JCCA 3D4IA 3G0IA 2H5JA 1GEEA 3DAFA 1NW3A 3LLCA 4IX1A 3RIGA 2TRSB 3X1MA 5JW6A 3G7NA 3T54A 1TA0A 2O7VA 2TECE 4EKEA 4L76A 4TRJA 1R5OA 3ETLA 3VPSA 4GE3A 5TIIA 1MQAA 1J49A 2BZSA 3CUSA 1R66A 2W6NA 1G3QA 3PFKA 3PHBE 1Z8DA 2XSZD 3LHIA 3P20A 3Q3VA 4Q0MA 5EP4A 4EHLA 5D1HA 2E85A 4YRPA 2XOKA 4DYVA 2JA2A 3AUXA 3FOAA 2DKNA