2HZ7A

Crystal structure of the glutaminyl-trna synthetase from deinococcus radiodurans
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
590
structure length
556
Chain Sequence
AAPLVAPNFITEIIERDLEAGKYPRVVTRFPPDPSGYAHLGHVFASLLDFNTARQYGGQFNLRMDDTNPELARQEYVDSIADDLKWLGLDWGEHFYYASDYFDRYYAYAEQLIRQGDAYVESVSPEELSRLRGNATTPGTPSPYRDRSVEENLDLLRRMKAGEFADGEHVLRAKIDLTAPNMKLRDPVLYRIVNKPHFRTSDEWHIYPAYDFEHPLQDAIEGVTHSMCSLEFVDNRAIYDWLMEKLNFDPRPHQYEFGRRGLEYTITSKRKLRELVQAGRVSGWDDPRMPTLRAQRRLGVTPEAVRAFAAQIGVSRTNRTVDIAVYENAVRDDLNHRAPRVMAVLDPVKVTLTNLDGEKTLSLPYWPHDVVRDSPDGLVGMPGGGRVAPEEAVRDVPLTRELYIERDDFSPAPPKGFKRLTPGGTVRLRGAGIIRADDFGTDEAGQVTHIRATLLGEDAKAAGVIHWVSAERALPAEFRLYDRLFRVPHPEGENGFMRYLTPDSLRVLRGYVEPSVAGDPADTRYQFERQGYFWRDPVELERVLVFGRIITLKDTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Deinococcus glutaminyl-tRNA synthetase is a chimer between proteins from an ancient and the modern pathways of aminoacyl-tRNA formation
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
molecule keywords Glutaminyl-tRNA synthetase
total genus 175
structure length 556
sequence length 590
ec nomenclature ec 6.1.1.18: Glutamine--tRNA ligase.
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain
A PF02637 GatB_Yqey GatB domain
A PF03950 tRNA-synt_1c_C tRNA synthetases class I (E and Q), anti-codon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1160.10 Mainly Alpha Orthogonal Bundle Glutamyl-tRNA Synthetase; domain 2 Glutamyl-trna Synthetase; Domain 2 2hz7A03
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2hz7A04
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2hz7A05
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2hz7A01
3.90.800.10 Alpha Beta Alpha-Beta Complex Glutamyl-tRNA Synthetase; domain 3 Glutamyl-tRNA Synthetase; Domain 3 2hz7A02
2O5RA 2A4MA 3IMCA 3E27A 2ZUEA 4L2IB 5JVHS 3CVUA 1YUMA 1KAMA 2BTEA 2E89A 4TS1A 3A04A 1NUPA 1U7XA 3OTWA 2AZXA 3TQOA 1WXHA 2R5WA 3P52A 1GTRA 4KR7A 4KR9A 3PNBA 1R6UA 1TFUA 1VL2A 1T6ZA 2DETA 3FI0A 2E0IA 1J20A 3FETA 2AKEA 1ZH6A 3HL4A 1H3EA 1O5TA 2DPLA 3NV7A 3KT8A 5DM6S 1Y42X 3ND5A 1T9GS 1XNJA 4I6GA 5K0SA 3CLSC 2D54A 3RBAA 3ND7A 4JXXA 2ZJPS 2OV4A 3LOQA 2PFSA 4DDMA 2QUJA 1Q77A 3RK1A 2YWBA 4ZCQA 3UC5A 3ZJVA 4JZYA 2DEUA 4MULA 3FDXA 4ZT7A 2Z08A 3CLRC 3H9BA 1G8FA 1VBKA 2J4DA 3H9CA 3MLBA 4QREA 3GUZA 3DLAA 2X1MA 4H3SA 3Q10A 4NATA 4XFDA 3IVCA 2CYCA 4WSOA 1MB9A 2GOYA 2QTNA 4MW4A 3IUEA 3FIUA 4IOCS 1T9GR 1X6VA 2D5BA 4S1OA 5KCMA 3X1KA 4K0RA 4G5FA 5J58A 1NYLA 1D2RA 3CLUC 1N1DA 1WXGA 1J21A 4MUJA 3CVYA 4ZT4A 3PNYA 4JYZA 1SURA 4ZT6A 3IUBA 3TZEA 4QRDA 1NSYA 2X0KA 4ZCPA 3KT6A 1M8PA 2B7LA 1OWMA 2QUHA 1JZSA 1U3DA 1JMVA 1EFPB 3PXUA 1XNHA 2PG3A 4NAUA 1EJ2A 1KQNA 4AQ7A 5KWVA 1WXFA 4EF6A 4NX2A 1O94C 1QRSA 1N2HA 3G6KA 1A8HA 2ZUFA 3ISJA 1O0BA 3AFHA 1ILEA 3CR8A 5FNZA 3DV2A 3MLAA 5FO1A 4OUDA 5IJXA 1O96B 5GAEW 1FEUA 1NUTA 3IDFA 4Q16A 3BL5A 4YBRA 4DDKA 1MAWA 3N8HA 3RJZA 4BWVA 3X1JA 2G36A 1O95C 3N9IA 4PBSA 1J1UA 3VU8A 4HK4A 1EFPA 1OBHA 4JXZA 1JIKA 1O94D 4XSVA 1VLHA 4NDAA 4PBRA 4EG4A 1JEEA 2CT8A 3SP1A 4MW2A 1EFVA 2Z3VA 2ZJQS 3N2YA 4PBTA 1NURA 4J75A 4L2IA 3P0HA 4EG8A 1IQUA 5HUJA 1PFVA 2A84A 3FWKA 4PY2A 4KR6A 2CUZA 3K32A 3SZGA 3D6VA 2QJFA 1FYDA 3GLVA 1M8GA 3K9WA 3MMXA 2EL7A 3QE4A 4G6ZA 3AG5A 2A88A 4MUNA 1N2JA 5J59A 1TEZA 1KQOA 1JECA 3FH0A 1IQ0A 3PNVA 4HJRA 3VRHA 1R6TA 1EE1A 1GZUA 1J70A 3NBKA 4UZEA 1ZJWA 4ZCSA 1PFYA 1K97A 3QTTA 1VBNA 2WB2A 3AG6A 3IMGA 1O0CA 5TEVA 4OJMX 1PFWA 3PRHA 4DDHA 2DR2A 1N2OA 1KH2A 3COWA 3FY4A 3N05A 1IHOA 1JIIA 4CDNA 2PIDA 3KT0A 5IZNA 1T6YA 1G59A 3IOBA 3TZLA 4K03A 4ARIA 1WZ2A 4ZT3A 3COZA 1YIDA 4QBTA 2PZAA 5DK4A 1KQPA 2A1UA 1DFUP 1IVSA 3IH5A 1PG2A 4MUHA 2A1TR 5F23A 1QJCA 3COVA 1QRUA 1KORA 1NI5A 3TS1A 2HZ7A 1TYBE 1GPMA 1LI5A 4NAHA 3X1MA 3UK2A 1MJHA 1WKBA 1NZJA 2Z09A 3M5WA 3UOWA 4WF9S 1YIAA 1DNPA 1GN8A 1Q15A 4NZPA 3TQIA 5TEWA 1S4MA 4MLPA 1CT9A 1N2BA 3TNJA 1V47A 3F3MA 2H2AA 1IH8A 3P0JA 2J5BA 2WSIA 2NSYA 1ULHA 5JVGS 3AL0C 2IJGX 5H16A 2VXOA 1N77A 5EKDA 1KP2A 4MVWA 3J7ZV 1XNGA 3HFJA 1K4KA 2CYAA 1RQGA 1JHDA 3CLTC 4U8HA 1M8JA 2QJOA 3A05A 3A4IA 1TYAE 4CT0A 4MW7A 2CV1A 2A1TS 1OWNA 3L92A 1I6KA 1JZQA 3FG9A 1NUSA 2QUKA 2DLCX 1WXIA 5LM3A 2QJTA 3Q12A 1COZA 2PZ8A 3CA8A 1LW7A 1MAUA 3UMVA 3CLUD 2H29A 3ELBA 3PIPS 2AG6A 3COYA 1WY5A 4DNXA 1WOYA 4YMIA 4MW1A 4I6JA 3G59A 2ZJRS 2RE8A 1I2DA 3SZ3A 4MW9A 1KH3A 1O97C 2WQ6A 1K4MA 4MQ6A 1H3FA 4MAFA 1M8FA 1MC1A 2O8VA 1GAXA 1QRTA 1N78A 5TS2A 1U0BB 4U7JA 3IOCA 4MUKA 3ILVA 4MWDA 5DEOA 3SEZA 4RUKA 4ZT2A 4EG1A 1QQTA 3PIOS 3CLRD 1TYCA 3DO8A 3FNRA 1H3NA 2J07A 1MBZA 2D13A 3IVXA 2V0CA 3H97A 5DB4A 4UZFA 2BYTA 2C5SA 1K92A 1TYDE 3IVGA 1O95D 3ZGZA 4E1AA 1PG0A 2CYBA 1OWOA 3D6UA 4ZCRA 3IODA 5IHXA 4YP5A 4WFBS 4ARCA 1ZH0A 4MWEA 5KHAA 3ZXIA 3MUEA 1O6BA 4MWBA 3FOCA 4EGAA 1GTSA 3AKZA 3HMQA 4RPIA 3CVVA 1F4LA 3CLSD 1HYBA 1KH1A 1KP3A 5TGTA 4ZCTA 1X8XA 1WQ4A 3OP1A 3CF5S 1EUYA 4G5YA 5HL7S 2CSXA 1N2EA 1PFUA 1GLNA 1B75A 4MWCA 5DASA 5J5AA 3S3TA 1QU3A 1F7VA 4P2BA 4OUDB 4I6EA 3DLLS 1EFVB 4MW6A 4A91A 4F4HA 4HPWA 1B6TA 2RD2A 3Q4GA 1MRZA 4IO9S 4WFNS 1ZUNA 4FZJA 2CFOA 2QTRA 1V8FA 1I6MA 1M83A 1IFXA 2GKSA 3H99A 4WCES 1JEDA 5HUHA 1J09A 1IQRA 4X0EA 2J09A 2YWCA 4U67S 1BS2A 3C8ZA 3ZJUA 3KFLA 5GAGW 4F3RA 1N3LA 2DUMA 5AHWA 2E18A 3INNA 1H1TA 4EG7A 2E21A 3HV0A 1VBMA 4U63A 5HG0A 3HZRA 3VGJA 3LE8A 4EFKA 2WQ7A 2V0GA 3ZJTA 4ND7A 3CVWA 1M1ZA 2A7XA 4KPUA 3JXEA 4XFJA 4MUFA 2HGZA 4AS1A 3A2KA 1N2IA 3U1VA 1LI7A 1YI8A 4UY88 1F9AA 2VTBA 1QTQA 1U3CA 1MOPA 1NUUA 2YY5A 4DE5A 2DXIA 1P7PA 4DJAA 4EG3A 1J1ZA 2DERA 4YP6A 1KAQA 3GMIA 1T6XA 1N75A 1R6XA 2PXHA 2CV2A 4GU5A 4J76A 1OWPA 4GRIA 2JANA 1IRXA 2J08A 3P0IA 3IMEA 1O96A 5H7XA 4R0NA 3HGMA 5FO0A 2EJCA 3ZIUA 2TS1A 3I05A 1KKUA 5LLTA 3RK0A 5BNZA 1UFVA 4WFAS 4R2LA 4DLPA 5JBNA 3RHSA 3CLTD 4IOAS 4MVYA 1G8HA 2XRYA 1NUQA 3ZUGA 2X1LA 3H05A 1JILA 4EG6A 4ND6A 2VTBB 2CV0A 1MB2A 1EXDA 1Q11A 1F7UA 1WJGA 4MW5A 3RFFA 2OQ2A 2QUIA 2PZBA 5DM7S 1U7DA 3IOEA 4MUIA 1Q19A 4MUGA 3LCJA 3DPIA 4ZT5A 3SYTA 2JAXA 2YXNA 1OWLA 4CDMA 1WQ3A 2A1UB 1D6KA 5GAHW 1XJQA 3FHJA 3G5AA 3ND6A 4Q93A 1QU2A 2NZ2A 2IELA 2QTMA 4HJXA 2JA2A 3KT3A 4EG5A 1YULA 3SEQA 1M8KA 1O97D 4JFAA 1FFYA 4KKVA 3NBAA 1OBCA 3CVXA 3QTBA 4MUEA 3UY4A 2A86A 1TQ8A 4CQNA 1OD6A 2I1LA 1KR2A 1WXEA 3MXTA 1I6LA 5LFAA 5GADW 4MVCA 1EUQA 4WNYA 4MW0A 2XRZA 1YUNA 2HMAA 1NP7A 2X3FA 2GM3A 3SDBA 5K0TA 4R2MA 3L93A 3ZXSA 1QNFA 1JIJA 1G8GA 1JGTA 2IP1A 4KPUB 4YP7A 3AIIA 4MVXA 1N2GA 2ZP1A
chains in the Genus database with same CATH superfamily
4QUBA 4EW1A 2GJ9A 1ZJ5A 2O5VA 3PFGA 3KZCA 5DJ5A 3MAJA 5JARA 5A9SB 5ALRA 3NCHA 4V0LA 5K6TA 1TRHA 2XDYA 3BK7A 4PEVA 4PXYA 5JRDS 1XZAA 1NUPA 3OQJA 5IAKA 2OYCA 3EAGA 4PO9A 3U7IA 1NOIA 2BY4A 1JIUA 2H2WA 3QX9A 3TQOA 2AI1A 4FCVA 1EP9A 5CX1A 4EQ6B 4FYMA 1KP9A 5JSYA 1OHHA 2DJ5A 2YRWA 2GN1A 3FDZB 1AV6A 4D02A 1PYDA 1A95A 4LXHA 1E3QA 5LBTA 1IATA 3EQZA 4NNOA 1JQKA 1K89A 2G0TA 2JARA 2YBEA 5F7ZA 4IF4A 6REQA 1LK7A 1OA0A 2CFIA 2VH2A 3CH7A 1AX9A 1YR9A 3I9JA 3IIKA 4BTEA 4IS2A 4S24A 3TPFA 4LXUA 3C1TA 1XP5A 4ZC1A 1YK1A 1GNTA 1RC0A 3HSYA 3OX4A 2PKYX 3LUKA 3N1UA 4JXXA 2DULA 2P4SA 4M9UA 4AP6A 5DNUA 1MAHA 1V4NA 2F9FA 4DDMA 2XWPA 4IZIA 4XI9A 4BE4A 3IXLA 4IVPA 7GPBA 2IH5A 4CKXA 2WKSA 3CX4A 4Z53A 1UFQA 4AD8A 3R3WA 1SUIA 3DONA 4PCLA 4TLCA 3LX4A 5I9NA 3AJAA 1BU5A 1HDCA 4NE9A 1ABBA 5K8LA 1CWUA 1AN9A 3RS9A 1MG5A 4UNNA 4EI8A 4AXBA 3R3VA 4P53A 2QZPA 5ALYA 5FJJA 3RUDA 3UG6A 1Y4SA 3QU9A 3LLMA 4CMCA 1ZOSA 2GNAA 1Z8FA 1UZNA 4EA7A 3ACCA 3K30A 4WJLA 2W6CX 2GCOA 1JA9A 1QAQA 5FOVA 2K6GA 2FVYA 3TJZA 4MI6A 4QUKA 1P2VA 3MD9A 4XTRA 4GL2A 2VJBA 1YQWA 4R2HA 3KWMA 5EP3A 2FEWB 3QEMB 4DZRA 5CM2Z 3SM3A 4EMTA 3GLRA 3D02A 2PRYA 1PWEA 2GPTA 1W0JA 2ECFA 2VDVE 1MT3A 3K0EA 4OEHA 2OHJA 1ODJA 4LXQA 1A97A 1L4NA 2JCVA 3GJ4A 1II9A 3WHIA 4IQGA 4J9VA 1XMSA 4IG9A 4MVJI 5FF9A 3UGJA 2W8BB 5G1NA 1XMQB 1P75A 1U4SA 4X44A 1H2RS 4YJDA 2F8TA 3PUKA 4XA8A 4CL3A 4DIKA 1VHYA 4F4UA 1WZIA 4M38A 2QP3A 3O95A 1FU7A 2QUHA 4PPYA 4GC9A 4AYXA 1IN7A 1IXYA 1XZGA 1UBLS 1U4NA 4UHBA 4WZAA 2BP7A 2XYRA 4ZZ2A 1DIGA 4BLQA 1CP3A 3RK4A 1CRQA 3DE1X 4MCJA 3UHPA 3WGHA 2PD3A 4LMPA 4U00A 5CA1A 1IXSB 3OHMA 3LXXA 1DG9A 1IEWA 1XQ6A 2C92A 2G80A 3S2IA 3LU1A 1ANKA 3GZ4A 1V1RB 4N5LA 1I1NA 1ZN7A 2Q5JA 4LHWA 4ZGGA 2VF2A 3MJHA 1S2MA 2BM1A 3DT8A 4ZVPA 2QW1A 3C7DB 4D3DA 2QTFA 4HEQA 3SKYA 3UBMA 3QPDA 3RS7A 3NUQA 4N0MA 3KOUA 3T4XA 5FLXA 2JKZA 3GV0A 4F7DA 4C7XA 5FWNA 2NTVA 3B60A 2A5LA 2GN0A 3A3OA 4INAA 2H1CA 5KU7A 4GGPA 5JYDA 1X1EA 1WSDA 2FW0A 4D1YA 4YR7A 4W8OA 1CZLA 4HDCA 5LQNA 4NH4A 5BMOA 3QU4A 1AMNA 3HCFA 3AHFA 3GVHA 4G0UA 1EFPA 1N7IA 2K7ZA 3K5HA 3D8BA 3AGQA 1OASA 2BUCA 4OHCA 3RUCA 3WL6A 1RDFA 3ND9A 3E7XA 3OQ6A 4ZOLA 4MYRA 1OX4B 1FTQA 3WGJA 4IV5A 3TR6A 4WKCA 2CNLA 1E7MA 2AZMA 2CEKA 5BUQA 4LYEA 3GJ7A 4RA6B 3EE6A 1J4AA 3TINA 4JQZA 2ZYTX 4D6YA 4IYJA 4PY2A 3N2IA 4J90A 3PPIA 1W7AA 3V7YA 4MUAA 5CMLA 4GKVA 5FI1B 3O2SB 3ZHYA 5BURA 1YZLA 2BEWB 4BQOA 1Z25A 2IP2A 1JTVA 4DV7B 3BG5A 4TRMA 3G88A 1GAJA 2OUKA 1JLHA 1KY4A 2XYQA 2Z2YA 5JLAA 3LUCA 4DWWA 1LH0A 4NZ9A 1QQ7A 1TEZA 5ENDA 1T10A 1YZNA 3NP7A 2WIAA 5G0SA 3ONEA 2P5TB 1G3UA 2BMAA 4RQTA 4D7AA 1YQDA 2D0IA 2P7IA 3DCYA 3JRXA 4N8DA 1F51E 4PQEA 3FPEA 1YQXA 5HE9A 1CIVA 2RHOA 3L7JA 4LECA 4A03A 1RWMA 5HXAA 2KBEA 2PWZA 1T35A 1ZJWA 2RBKA 5TMBA 2ZSKA 1K97A 1KZ7B 2P9QA 2FK8A 3G1UA 3P2JA 3URMA 3LHSA 4NXMB 5TQVA 4TZ6A 1LPBB 4DQXA 3ZHVA 1XO1A 2WWIA 4YP0A 1ISFA 2IDJA 1ODTC 1ENPA 2ZJ3A 3OJLA 3R5SA 5B3LA 1AA6A 5K4GA 2BR4A 1JG1A 3VM6A 4K6OA 2QD4A 2WW8A 3N8DA 3FCYA 4TWAA 3CY6A 3S1SA 2QI9C 1J5PA 2CBXA 2FHSA 5FPQA 5I4CA 1YZKA 3IUSA 4L5CA 1FTGA 2I71A 1DAEA 4MV6A 2M9MA 2OILA 5DGHA 3ML1A 1DIRA 3HABA 1J7JA 4R9NA 1B16A 2VR1A 2J9RA 4LBYA 5FBKA 2CDAA 3ROPA 1NF9A 2XTJA 3DLBA 1R5OA 4EMBA 3OJWA 3EZNA 4ALMA 1GL7A 2KM1A 1TTPB 1DS6A 2NT3A 4F7WA 1DFUP 3L0OA 1Y33E 4DYHA 5TIIA 1NN3A 1NBMA 3J81k 2IS6A 3JCZA 3I53A 2VT2A 5D00A 2SCUA 1XXLA 2WIKA 2WYHA 3FCOA 5H80A 2P2LA 3NAMA 4PAWA 4JX8A 1PKXA 3PICA 1PNOA 3DEIA 1DNPA 2IT1A 2R5NA 3CUVA 4JT2A 1K3FA 3OZDA 4RDCA 3T9EA 4BGDA 1LDYA 1N2BA 4UNRA 4TS3A 5FR2A 1HE1C 2DZDA 4HDAA 1SNYA 2L18A 4CGZA 1KIFA 4W63A 1UKZA 2XJ4A 4N6GA 4WWHA 2IJGX 4KWEA 4MYCA 5CNMA 4D97A 4LSGA 2VXOA 1DBQA 5KYGA 4RLQA 3I61A 3P0RA 2OHVA 1Y4UA 3KJHA 4MVWA 1L1QA 5T4HA 1XXHA 1YL6A 1M73E 3WDMA 4BJ5A 3HCRA 2YHBA 2JGJA 3PWZA 2IU4A 1E98A 4BVHA 1X3LA 2OGUA 4D8VA 3MD0A 3WQHA 3QIVA 1XZMA 3UAZA 5MGBA 2V1UA 5FPTA 1NW7A 1PJBA 4NU0A 3UPTA 3OUTA 1OJ7A 4PYQA 5AYVA 3FG9A 3TLJA 4DM3A 1C1YA 1L6RA 3NVKI 4D43A 4EG0A 4UQOA 3HKEA 1ZEMA 4RKQA 4WKOA 1FY2A 3GDGA 6YASA 3HVIA 4PO1A 1QYRA 1ZUNB 2PH1A 4I2VA 1FTNA 2CFRA 4URVR 1W581 3LLCA 2YV4A 4S35A 3PEWA 4FHCA 4KFRA 3GDFA 3TM4A 4D3XA 1U1EA 3B3QA 4JVSB 5C8XA 1ZMOA 1HR0B 3IRUA 5K20A 2YTZA 5E2BA 1KH3A 3VHRA 1FK8A 1SU7A 1YJBA 2UZ1B 4IJWA 4OF4A 3W3AD 6PFKA 1TZ2A 2ID9A 5AKYA 1U0NA 4H15A 3QKRA 5ELXA 4P80A 5MGNA 1DO2A 4XD2A 1MC1A 4EEXA 1I1HA 3L0BA 2Q21A 2VNHA 3EUAA 1MD9A 2B4YA 3RIYA 5TS2A 3B89A 5H3CA 3AF4A 4EUSA 4R3NA 4TMVA 3T15A 5ALGA 4CBVA 1QRAA 3E61A 5J43A 1PR3A 3GMSA 5KYYA 3ABRB 5J9FA 4KIGA 3ZOKA 2GX6A 2VK1A 3GG2A 4EG1A 4X7BA 1GR0A 1X2BA 1Y63A 2BKVA 2GMWA 2I0FA 1L8XA 2ZSAA 3HU5A 4N65A 1JU4A 1N0VC 3A9WA 3LDHA 3EXHA 3R40A 4RXMA 3JQFA 5JXJA 2CCGA 2P2YA 3W9SA 1EEHA 2Y6UA 4Y2YA 3UV6A 5KWSA 3AVUA 4HUQB 4DR3B 2YWFA 3FYDA 3ID6C 3W5HA 4ZYYA 2BYTA 3IR7A 5JJIA 4TYQA 4ZYZA 1Y9ZA 4UUBA 3HI4A 1Z5NA 2XVXA 1TPYA 3LHDA 4E1AA 4HQ0A 4IIUA 5J4KA 2G5DA 3PDJA 3ZJ4A 4BKOA 2Q3LA 4Q37A 4Q7EA 5JASA 3P4XA 4NYMQ 3EGXA 3P9SA 1E5DA 3HP4A 1XVVA 4HH1A 3S8MA 3LIIA 3ZHOA 3U37A 4MR8B 2ACEA 3B70A 2JJQA 2FZGA 2XT9A 3F5DA 3MIZA 2DGDA 1IC6A 3EZGA 4K6HA 5HS6A 5EUCA 4ZEMA 2BGRA 4X3CA 1KH1A 5TGTA 1T4GA 2ERYA 3OP1A 1OGYA 4A6DA 3UMMA 5KKNB 1O3YA 3FGOA 3V4PB 2GZHA 4MITA 2J0VA 2AD1A 4FGJA 3RREA 3D8RA 4X7PA 1NM5A 1ZOLA 2JFGA 4XASA 2OE2A 2EFEB 3F4KA 2O3UA 4N5DA 3VZBA 2I1WA 3TJRA 1EBBA 4F4HA 4BEWA 3DE4X 1JLLA 4FINA 4MVJP 4R9UC 4U7WA 2BZSA 1SQ0A 1NLUA 2RH9B 4AW9A 1TMYA 3GBVA 4FYPA 2UXBB 4YJ3B 3A6PC 4NU5A 5B1DA 2IDKA 1FYFA 1E3IA 5I9SA 4NFHA 4XARA 2AJDA 1G60A 4JDPA 2B3TA 3B1YA 1JEYA 3FGNA 2PNJA 2OFFA 1NWHA 1ZJJA 4OU4A 2J9XB 1JTFA 5DP2A 1AKQA 4BO5A 2E18A 1Q0LA 4B9EA 1JKIA 5I9IA 1U8CB 2NVOA 5BOVA 3TK1A 3TLCA 2B4RO 4EG7A 4TRJA 1CHDA 2DWPA 3ZJTA 4DW8A 4L9SA 2ZB4A 4MJ3A 1M1ZA 3G2MA 2BF7A 3HLYA 1HYQA 4DLLA 2J7PA 3HV2A 1CP2A 2PUWA 3W8DA 3K0CA 5JMPA 5EFOA 3UMBA 4XDYA 5KYWB 3AF6A 4AS1A 3U3RA 3QE9Y 1A5ZA 1JEJA 5JECA 1GRRA 1C7FA 2IHVA 3G0DA 3R0IA 4MICA 3S44A 5KYNA 1E3MA 1NUUA 3IX7A 2A0XA 4GI5A 5KVSA 1W5EA 2H51A 3GLIB 2H5JA 3DYIA 3LCCA 2H3EA 1T36B 3E5RA 1CQJA 4QBFA 2A7QA 5CG2A 3AHIA 3LWDA 4IRXA 5GWXA 4CLOB 2FP4B 5JQGA 1ZL0A 4IZOA 5KYTA 1FTYA 3G85A 1OAAA 3H1GA 1RZRD 4BTVA 3SJAA 1O96A 3KQTA 1O95A 3QY9A 4FN4A 4NV1A 4KE7A 3FCCA 5IJ9A 1U6JA 3IEMA 2Y0BA 2ZTVA 3L8EA 1Y8CA 1FUUA 2UVQA 3K2BA 2P68A 1J25A 4I55A 4PFKA 5DPMA 4C89A 2P8SA 4RO0A 2Q5CA 4WN3A 4YMGA 2XZLA 4BVGA 3ZNNA 4GBJA 4YECA 2WU8A 3N76A 4CF7A 2WJWA 3KOWA 5DHUA 1V39A 3JQQA 4AO7A 1Z4JA 3DZKA 3QP9A 4AJPA 4L72A 4OLBA 2G5TA 2WLTA 1UC8A 5IM4A 4LXTA 5I7HA 1EQ2A 4Q1BA 3JW8A 1B26A 1N8TA 1GA1A 2R7LA 3DQPA 4ADSG 4C4AA 3S8EA 1PQYA 5EJ2A 4DWVA 4XVCA 4MHOA 4QLOA 1FSSA 5IC5A 4BNZA 5G3ZA 1XLVA 2CKMA 3CF4G 1DO0A 3NKLA 2Y67A 1C1XA 4ASUA 1RACA 2FW9A 2YQ4A 4AG3A 2ECPA 4BQEA 4TLMB 5KX5F 3ND6A 1QQ6A 3AH8A 4YWJA 3JAMA 3KG2A 3VVLA 4HWKA 1ZW6A 3IULA 1F14A 3EARA 4MLZA 4D25A 3FYUC 4AJJA 2LR0A 4XXHA 3ABOB 1QTNA 5EHQA 3THSA 4CIVA 4YUWA 6LDHA 1CQZA 4RJTA 2QOEA 2ZRPA 3CRNA 1QVRA 1QWSA 2AEJA 4BZZA 1P2UA 4KX5A 4LJ6A 4FFOA 1NMXA 1PUIA 2A94A 4OMCA 1FPQA 5JJ5A 3OECA 3WYDA 2ZAMA 1RKBA 2ZJ5A 1DX6A 4NG5A 2HNAA 3TVYA 4RL6A 1I6LA 3DGEC 1YS6A 4LX8A 4YREA 2ZM5A 4UVEA 2XUAA 1STOA 5IWCA 3LYUA 3DDUA 3OI7A 4MW0A 3QJGA 3I5XA 5ALDA 5HS4A 1PAUA 2YHIA 1GDDA 4WLUA 4INZA 1BGXT 4Q0MA 1GZ6A 3HYLA 1U65A 2C59A 1GT91 2GB4A 1IDOA 2IYVA 3A6LA 4MJXA 4DG9A 2BT4A 1U04A 2JHPA 3FYHA 2F4VB 9ABPA 1RTTA 2RGDA 4N3NA 5TC4A 3L3BA 1OBVA 2QLMA 1M1UA 4DCGA 1QIDA 3KJQA 1N5RA 2J3DA 1MXHA 3H9UA 4B31A 3M4JA 3D0OA 3KLMX 1C7JA 5LDGA 1OZFA 2BHSA 1USGA 721PA 1GKUB 2XMSA 4BEJA 2IU3A 3SFTA 4BLVA 1VBFA 4QGFA 5G0TA 5I9BA 2C00A 3FZEA 3SYKA 4C0QC 4OJQA 4LRYA 3A6JA 3JZAA 2PUDA 5CLJA 5LJIA 4YYEA 3K35A 1X7WA 2FRDA 5C7YA 2X9NA 4LDPA 1P0FA 4Q6BA 3DKIA 1CR1A 3PLNA 5DM1A 1N1MA 4QYXA 2PEYA 2XXJA 3RYCB 5IG2A 5B5SA 1QF6A 5DM6S 3HEAA 4N9WA 1UBCA 4MRVA 1T0PA 5D01A 2IQIA 1RXIA 1I9GA 4QHYA 4CTNA 2RMKA 1AGYA 1EK5A 2FEOA 3OESA 4GRDA 1Q3HA 4HXEB 4PZ0A 4GFDA 1DJPA 2WTBA 4IEFB 4DZTA 5CVTA 5H4GA 1UBFA 5CB6A 2GAOA 4PE5B 4E09A 5SYMA 2RC6A 4ZYLA 1TO1E 3JVUA 4K2HA 4JJAA 3DEKA 4WBXC 5K1ZA 1ITZA 1ECBA 1NMEA 4HXFB 3D3EA 2R6ZA 2NT4A 1YC2A 3UAYA 3LY8A 4LA4A 5BW4A 1G16A 2CHUA 4E5PA 2IHTA 2WTAA 5IVHA 3ASVA 4PC1A 3GU3A 4CLEA 2IIPA 5P8WA 1WIWA 3EXEA 5B2FA 2AYYA 4DR7B 3GJ3A 3H1FA 1SG9A 4OQZA 3ZH9B 2PWAA 1M2WA 4WSOA 2C78A 4O4JB 5F5LA 4RTOA 3U44A 2FMTA 2BEKA 4HNVA 4ARSA 1JQBA 3G2NA 3SR0A 2R6DA 4BIMA 3HKBB 3VZCA 3I32A 4HSEA 4B0PA 4CEIB 2AEMA 1XL0A 5TPZA 3WQRA 1MPTA 4QDXA 3CLUC 3DEFA 2TYSB 1W8DA 4PXSA 2Y1DA 3GYGA 4REQB 2YFKA 4TMZA 5CM8B 2WZDA 1L7XA 4OB7A 5L3VA 2IYNA 3HCPA 3QXHA 2QX4A 1KI6A 2VDOB 2WM3A 5HILA 3IUNA 3UHFA 2XKKA 1Q7EA 1C0IA 1JL3A 3WGYA 2IYFA 4C0LA 3VR3A 1CDZA 4UE3S 1JXAA 2Q8PA 4OK6A 1ZRNA 2Y71A 3BXPA 2AKAB 3IP8A 5HKLA 1KQNA 1CEQA 3T5PA 3UFXB 1NZFA 3EWIA 4QJ3A 3TQCA 1LC0A 4LZZA 4PYNA 1DRVA 1I9CA 3HN6A 2AZTA 3KYIB 2X0DA 1U7HA 4IP0A 3G6KA 2IYWA 5EE5B 1GCGA 1Z5WA 1ZXXA 3EISA 3BE8A 3HR4A 3GA0A 3LPAA 1F38A 1P7VA 1NN0A 4BYMA 4EUHA 5LZ9A 1T3TA 1Q16A 1KHTA 3OC6A 4REMA 2R8RA 2RAUA 3KP1A 2GJ4A 3ECCA 4MINA 4P7KA 1L9XA 2UU9B 4II2A 1II8B 1UDCA 2NO0A 2OM6A 1BIFA 1FDTA 1RZVA 2FF5A 1DAPA 2YZ7A 3X44A 3I9V1 5JQGB 2QSJA 3UUWA 2CFTA 3DE5X 4XSHA 1CUIA 3OKFA 1O96B 2AOWA 5GAEW 1KU6A 3LUGA 3OO1A 2C4NA 1JE1A 3ZLVA 5CT8A 3VNUA 1U8ZA 5D7NA 3C8MA 3EGXB 3B38A 3K1YA 5C80A 2DE0X 3DAOA 1THGA 3UAWA 3A1UA 2YWJA 1DKLA 4RHXA 3W1EA 1Z85A 5JAQA 3W2TA 1E69A 4E03A 3LHIA 3MUOA 3U7JA 3I62A 2I3BA 1PG5A 1UK9A 2EGGA 3LPCA 1Z17A 1FFCA 2C9YA 2YV3A 3O4VA 4Q21A 4EHHA 1SKBA 3RRBA 1RBYA 4UTZA 3MTBA 4PBRA 1BDIA 4CLHA 3QMPA 2CUKA 2CT8A 4IRMA 4KRGA 4U9HS 1FOEB 5K0CA 1Q95A 1QOQB 3LPNA 2HA6A 1GTL1 4J3JA 4QXQA 5E1DA 3F3SA 4J75A 1E5VA 4ESHA 1GNVA 4EG8A 5FADA 3RCBA 2A2ZA 4BRZA 1VC2A 3GJ5A 1RIFA 4KVZA 3RAEC 4RMIA 4G4JA 5H83A 1X0XA 1Z6AA 3I1JA 2PWPA 2QTWB 2Z1MA 2YDYA 1NHWA 5JXHA 2JIOA 3K9WA 1NVEA 1O87A 2D1SA 5GPBA 2VDJA 3M6WA 3Q2KA 4F93B 4TM7A 4IOJA 2QTGA 3EMKA 1SKQA 4HX2A 4X92A 4HWPA 1X3SA 4QWMA 5JRJA 1BKYA 1TUBA 2Q6IA 1V35A 1E64A 3VSBA 3RADC 1GA6A 1B8NA 3ZOZA 1EE1A 1TM4E 5EJIA 1OXSC 3O8LA 2E48A 1C41A 3OIFA 4JBIA 5DBEX 3NOVA 4Y2SA 4GVXA 4UUAA 4N01A 3FVWA 4YFVA 1CYDA 4WCFA 3N2GA 1ZQ1A 1IN8A 2EZUA 4OP3A 5EWLA 4YMVA 1QFZA 1NBEA 3PG5A 1RYDA 1VHTA 4YGYA 1Z0KA 3K73O 3COWA 3PQCA 1N0UA 2V7VA 2I2BA 2G1UA 5FBHA 1U3UA 3O8DA 4QDTA 1QF7A 2X58A 1JIIA 2ZBDA 1MGOA 2HTFA 4YJ3F 5HIKA 1IN4A 1Z4OA 1SVOA 4M9RA 4C7VA 2RGNA 3N39C 4XLTA 3IOBA 3D6AA 2JBWA 3BWEA 5BXQC 3AIKA 4L5AA 1SH7A 1CRZA 3PE4A 2VS1A 2MSCB 1O6GA 1N0IA 3O9VA 5FBVB 3HTXA 1K2WA 3KLBA 1WDTA 4X3OA 4BKPA 2CLCX 2A1UA 3F7TA 5LMCA 3LRPA 1VLZA 3EX7C 2OL4A 5KJ6A 4NAVA 1QRUA 4D8TA 2VDNB 3HFGA 4S12A 1QFJA 2XUOA 5BYBA 5C1DA 4DV1B 3AR9A 2ZUCA 1C3JA 4D6PA 2IXDA 1GUFA 3KC2A 4ACAA 2H65A 3CZMA 3EBOA 3GJSA 3VU9B 5KWEA 4UDYX 4C7JA 1WX1A 1E6CA 2FW7A 1FFHA 1FDOA 2V58A 1NE2A 4HXGA 4L5JA 1G21B 4PRYA 4WZBA 3L8ZA 1TT7A 2VHCA 1QGZA 2GWRA 2WSIA 4TTVA 3C85A 1KZGB 2ATEA 4XIGS 5JSQA 1K9SA 5EKDA 4EBFA 1CUEA 1TKAA 2XIQA 3LKDA 5I6DA 5DN9A 1AQNA 1VKHA 2QRNA 1U5CA 3WS7A 2PUVA 3CO0S 3V7FA 3DD5A 4AKTA 1EVIA 2OOKA 1UEJA 4Q03A 1XPRA 2QGNA 4I1PA 5H1YA 1G4AE 3NIBA 4XCVA 2VATA 2NUAB 2QUZA 1OLXA 3DDZX 1AS2A 1XCLA 3D64A 2BGKA 1TO6A 1DWOA 1P73A 2LZ0A 3AOGA 3HPRA 3JAWB 3PPWA 3FW1A 4JLSA 4MZDA 3S70A 4K6MA 2DLCX 3KIPA 3J7AC 1XTBA 1SB9A 3OJ0A 1FP6A 2VUSA 1G5IA 4AIIA 4HDNA 5BMVA 4IUBS 3IEPA 1WXQA 1IBKB 1GGKA 4MP6A 3RTDA 3Q5GA 2XMCA 3BDVA 4BUJA 2X2PA 4H17A 3PEUA 5JH7F 3BMXA 4Z9YA 3M9WA 4ENSA 1QIEA 2O2GA 1JVBA 4QQNA 1RQ2A 2PNWA 1DFHA 1OR8A 3BICA 4TMXA 4YWHA 1Z2CA 2P4EA 2WM9B 2J3HA 3NNSA 1HLGA 3ACBA 5CYFA 5A9TA 1SFRA 2AXEA 3B6JA 1N33B 1MJGM 4Z0HO 2AWOA 2IYLD 2OC9A 4ZAYA 3T95A 3C6ZA 1P5HA 1ULAA 3DHEA 5C5EA 1EZ1A 2JAPA 3LK6A 4UQLA 5JSZA 4FBMA 1F9EA 4F0JA 3LY7A 3SD7A 3UMGA 4O29A 4MR7B 4B17A 4WKNA 4DXDA 2VYVD 5B7QA 1PS8A 1CUFA 2R3SA 3IQWA 5AI0A 3V9PA 3QOYA 1QB7A 4EHJA 4X61A 2P2SA 3AM1A 2C29D 3SVLA 2LUOA 1VCHA 2IVFA 3QKWA 4MWDA 3S1AA 1USVA 1EX7A 1IEXA 4RH0A 4TWBA 4BLOA 5EIHA 2AG8A 2IP4A 4L50A 1UPCA 4FFMA 4YTEA 1PJ4A 3MRTA 4G1UC 2ZSBA 1G8KA 3HR7A 1GGHA 3KVVA 3M4YA 4GYYA 2PBRA 1ZPDA 3UK7A 3OBIA 3TBKA 2ZIXB 4I5IA 3NJ8A 4C01A 2J3IA 1BA2A 1ODFA 5ADHA 4K05A 4QUAA 1MW8X 3H5RA 3ZWOA 1JT2A 1UR5A 4LEIA 2ZJ2A 1KNXA 1LBSA 3PRYA 5LYJB 4UM8B 2QN6A 1QONA 3DWGA 3ZGZA 4DGQA 1QGAA 2DLDA 2ZRAA 4YV0A 3DO5A 4LYYA 2WJ4A 4YHBA 4FFDA 3LZ6A 4ZU1X 5AW9A 1ADGA 3IODA 4O2AB 4PLPA 3ICEA 2R25B 4YRNA 5IEBA 3BWXA 5J4LA 3C6MA 1MFPA 5JQWA 2OWEA 5DP1A 3RUPA 5JWRA 2O0HA 2ZPUA 4PAOA 1MJNA 4E3WA 3TRDA 4H7PA 3FMIA 2AW5A 4AKEA 4JSYA 3U13A 1U0RA 4HDMA 5I7RA 3UCFA 4KFSA 3WLKX 4BDSA 5B4UA 1N6NA 1GPDG 2VNIA 2UVPA 3D0RA 3X1LB 3O4JA 4PC3A 3KOOA 3S1AB 3WDLA 2FQWA 2PKWA 1L0BA 3MWGA 3S3TA 1E7RA 2FPGA 1X1SA 4UVGA 4EZBA 4JL8A 3HDHA 2DUNA 1DT5A 4IDPA 1U7ZA 1P7CA 3RT1A 1EAMA 2L2QA 3NKVA 2RD2A 1THTA 1XKXA 2OBFA 2V7XA 4TLAA 3UK6A 4HGOA 5DHAA 5KTOA 4KSYA 2SKEA 4CEHA 2D5CA 2NOAA 1FXUA 2EKPA 3DVQX 4LY6A 4UPDA 5AUNB 3B8HA 1JI0A 4ND5A 2CNKA 5EGNA 3PIDA 2W2TA 1ZGJA 1XD2B 5F21A 4DR4B 1UMKA 2FZLA 1COWA 3NP9A 4L8FA 4HQRA 2DTDA 1FDRA 2FV8A 3AFOA 3LGSA 3WP1B 1D1PA 1ICIA 2DBYA 2A14A 2H85A 2V9ZA 1X1QA 3MFQA 3PHIA 5HEKA 4CCWA 2JCXA 3JAKA 2AFHB 1J99A 3WGGA 5LNK1 3QFFA 2EZ9A 1QX4A 3WK6A 4WBSA 5F1PA 5UKDA 2P67A 4AXXA 4Z4FA 1PDWA 2I62A 1BQ3A 4RIHA 4MRMA 5TQJA 1JR3E 3H42B 2H4ZA 3U4QB 1SWWA 1UKBA 2Q3HA 4MR9A 2NZUG 4WN9A 5E8JA 1VP3A 2CNOA 4EUEA 4CETA 3TAUA 4E2YA 4L9WA 3U56A 1B8PA 3L2OB 3EMVA 1YO6A 3UWSA 1Y6ZA 1XLTA 3KB2A 1KSFX 2OAP1 1DRJA 1VE1A 1BS1A 4BBZA 4NMWA 1HRKA 1XCOA 1ZC3A 3BA6A 2QL5A 3DMGA 3GFSA 1E1KA 3EIOA 3IDAA 4LJKA 4GU5A 3L5OA 3WLAA 1JZTA 1HF3A 1HDRA 4GRIA 2WUEA 4J76A 4BXOB 3R5FA 4RA9A 1OYVA 1A7JA 2J08A 4I46A 2CLHB 3M1IA 2Y0DA 3BCSA 4RZQA 1C7RA 1G6KA 5AHOA 3HGMA 4IHJB 4XIIA 3ZIUA 1ZZEA 4KXWA 4V39A 1QR6A 1GU0A 3OQVA 2BL4A 3SC4A 2R60A 4R31A 1NHGA 2VHVA 4HQFA 3ZV4A 4O33A 4UHHA 4R2LA 1F17A 2WWTA 5JG7A 3UHOA 1YJ8A 4P58A 3A11A 2XRYA 3KTDA 1Q2XA 5C9ZA 2QW0X 4TKVA 4CLRA 3QG1A 1RKXA 4I36A 3MWDA 5EJFA 5BYJA 1I2ZA 2D5LA 2P8JA 2CBZA 3IAHA 3A1CA 3N2GB 4RNCA 5M04A 2J9FA 5DLEA 2QD5A 2VTBB 4R2JA 1N6OA 4BP1A 2DG2A 1XCPA 3OIUA 5JQGF 2HWXA 1TQ2A 1AKTA 3M0EA 5CDHA 5I4IA 3U2QA 3WBJA 3NAZA 3JQEA 2ASVA 2H31A 2JW5A 2W6OA 3O83A 1XJWA 3H13A 1Z0AA 3KSZO 4UMFA 4GZ6A 1Z8HA 1CIPA 2CNBA 2IPMA 4LK2A 4CWAA 3TWOA 4BCDA 3FHJA 4ONEA 2Q62A 1E66A 1J9GA 2IELA 4K8OA 1OREA 3U9LA 3KT3A 1G9SA 3MMPA 4HMPA 1FIUA 3U7QA 1JLMA 1O89A 3KTAA 3WSVA 3TFQA 2FK7A 5EQTA 3AXTA 1H6AA 1K1EA 3HYNA 5MDHA 4PS1A 3SC2A 1RPZA 3GN2A 3DULA 1MNQA 4IDCA 3VHLB 3UJBA 5BNIA 1YE3A 4IXTA 3AVXA 1R2QA 1KJZA 2HSZA 2YXBA 3LCRA 1DBSA 1W19A 4GOJA 4RFLA 4ENWA 2BEUB 1QHHA 1V0JA 1SHTX 1XKLA 4MDYA 3UB3A 1IK6A 4ZQGA 2Q4OA 2H1VA 4LFBB 2WT9A 3I2KA 1G8JA 4KXUA 1N5MA 4DANA 5C37A 4AKIA 7REQB 3GRAA 5FX2A 4K86A 1PT5A 3WZMA 3ZXSA 1YHYA 1JGTA 1WO8A 4M9SA 5FPKA 5T7BA 2IOHA 4IGEA 4B6QA 4HFNA 4QM6A 1DHRA 4LJ8A 3FUXA 5DYGA 1ML3A 1L7MA 1TF5A 3WL3A 3NQ41 3P9QA 5FYDA 1BFKA 3HY3A 4KN9S 3VVCA 3UV7A 3A1DA 1ZR4A 4P5PA 5JAUA 1AO0A 4N1AA 2C8JA 1RBZA 3TN7A 4I9NA 4EI7A 2C8VA 1BC5A 5AIBA 5M29A 2VAWA 2VKTA 3NB0A 1FNNA 5DXFA 4C4ZA 2ZOSA 4RK5A 1ULBA 1XHFA 1XYGA 5L45A 5E6RA 3M4ZA 2HY7A 4Q12A 4EF4A 1MX3A 3U4MA 3PQ5A 3M6FA 2N47A 3RVLA 3P2MA 3BH0A 3DAGA 3B9BA 2WU1A 5CRIA 3FI0A 3RD5A 1U90A 1P7ZA 1P29A 1W29A 3L4BC 5THQA 1K5HA 1ZH6A 4DDUA 1PO7A 1ISMA 1DAOA 1SUEA 3I0MA 4UVDA 1ADCA 1DJLA 1DE0A 1TK9A 3G49A 1UBJS 3KXKA 4KVGA 4LXXA 5CLQA 2JFVA 4HNGA 2W8BA 1YFJA 2F6RA 5A4DA 1X42A 5K2OA 4HUJA 1GARA 4Q4AB 3CLSC 4Q3CA 2ZS8A 2VNKA 1XTPA 1LV7A 4FSXA 4OHFA 4D0GA 3P26A 4YRAA 1T0JB 4X71A 5LD2B 1BHSA 4X64B 3RQSA 5B57C 1OI2A 1J07A 2BUAA 4MV5A 2WJVA 4NU6A 5CT9A 1Y9AA 2RI1A 4QL3A 3NS7A 4X1KA 1DFIA 3KEGA 3TQSA 2R66A 3A31A 5A3RA 3ELWA 5HK8A 1V37A 2IOFA 5J2UF 2Z6AA 4KU4A 4YASA 1QLWA 3HJNA 1BVYF 2ALJA 3MLBA 4JBLA 1XZPA 3PUHA 3TSWA 2DQKA 2W2OA 2QRKA 3HVJA 4OLJA 5AOAA 3H1EA 5F1YA 4QJ4A 3AKCA 4L1KA 4OQLA 4C0SA 4YP9A 3FDZA 1YDHA 2ZWIA 4M7WA 4UASA 1AMUA 1PEYA 3AYXB 3KJNA 3UT5B 2G9NA 3YASA 1O9GA 5K0BA 2B5WA 2LDXA 3I9NA 1NI4B 1DI0A 3W2VB 1NJ6A 2WMOB 3NOQA 4KTTE 4B3JA 5JRZA 2BTQA 3IPLA 4HLUA 1P18A 5JOQA 5B7GA 3QV1A 1BCRA 2GEBA 1IMJA 1M7GA 4G5FA 4ENTA 4YRKA 2WAMA 4ALLA 1GTJ1 4UEWA 4ZVLA 1JJ7A 4G07A 1Y7HA 5I8WA 1B74A 1X2EA 3VVBA 3IPRA 5FLEX 2P5UA 4PNEA 3WRWA 3MJDA 3GT3A 4MLCA 4HNUA 4B5KA 2XGOA 4YRBA 2FEMA 3DQZA 4OOEA 2E55A 3AI2A 4Y6LA 5IM5A 4JT8A 2A5FA 4LBVA 4R1SA 2IYQA 1Q50A 1CNMA 1G8SA 3OCXA 4YMSA 3DHYA 3H7IA 3GPBA 2BFCA 5DO9A 5GY7A 1XELA 1EJ2A 2P6PA 2WB4A 4XQGA 2J85A 1BW9A 3RBZA 3SGLA 4I3FA 3VC2A 1L8OA 4QOGA 4G1CA 2QTVB 1LSUA 4JUBA 1IOZA 1TC2A 3FRHA 1Z2EA 3QMWA 2E1PA 1M76A 1HDIA 1SC6A 2O8NA 5KVCA 1HYHA 2GM5A 4MH0R 5FNZA 3WLTA 5EWJA 3G2OA 3BE4A 4BX9A 4R0MA 2XXAB 1YI0A 1KDTA 4NS4A 4BFYA 1EJ6A 1X1CA 1Y7TA 2FRXA 4OUDA 1NJ1A 4XIJA 2OGZA 3SQXA 2LWIA 4LQ4A 1E4YA 1FFSA 3DCIA 2OQVA 2SICE 4IH9A 4YRQA 3A1TA 3HZZA 2XMRA 2GWHA 2BEVA 2VT7A 3PUJA 4L8WB 3KXDA 3CKMA 1E9BA 2PLNA 2P7HA 1CY8A 2RHCA 5LL6P 1M6WA 2IUFA 2VDKB 4OXKA 1MV5A 3O47A 4OY3A 1GUDA 1XAIA 1CUDA 3LVBA 5E3IA 4HK4A 4Y0NA 4OYHA 1EM8B 5L4LA 1NL3A 2YMLA 4N5NA 1I1OA 2HM7A 1O94D 1CUXA 3COPA 5EHXA 4O3FA 2GN8A 3T3NA 2GN6A 2BONA 5F1OA 1X92A 1VHWA 4DLXA 2YJTD 3E9NA 2B36A 5A3QA 3W7AA 4RTJA 1EFRA 1ORIA 1KQ3A 1S1CA 3OT1B 2FFJA 5SY4A 5IFLA 2A8YA 2XCLA 1R0CA 5CDYA 3M70A 3KUCA 1E5TA 3QLJA 5LP6A 1BE1A 1OXXK 1E1QD 3HYSA 2R1VB 3NR2A 4PZLA 4XYEA 3RSFA 4AWXA 4MI3A 2UUBB 1D6NA 1L5FA 4YUYA 1SQGA 5K3SA 3ZWCA 1M75A 1EEXB 2DJIA 4FWBA 3H11B 5ALSA 1YAHA 3T3PB 4FW9A 3CEJA 1AQLA 2AXNA 2SCUB 4QUEA 1OB2A 3RVKA 1WPXA 5AKKA 1RWOA 3UQZA 2OKGA 1HOXA 2EP7A 2HEIA 3B51X 3QVWA 5IN5A 5B1IA 2N42A 4KCGA 1JEYB 1CEYA 2DPHA 3VRHA 1KARA 2P90A 1NU8A 1U0OC 1W73A 1Z4PX 2PI8A 3F6BX 4LRSB 5H5JA 4GPBA 3SBEA 4UTPA 3R7NA 1WTCA 2PKQP 2G09A 4BECA 4LOKA 1MENA 4RZUA 1CBUA 3THOA 4EGSA 4R9SA 1QIGA 1M5TA 3DEJA 2P0AA 2DR2A 4HVCA 4DSUA 2G4VA 5JPIA 1P77A 1SEPA 3GVXA 3P2IA 4NHEA 3VO8A 4LYAA 4NJMA 1P9OA 2CFCA 1ADFA 4GZMA 4YAEA 4RPJA 4IDHA 4CDNA 1IPEA 5BN5A 4CKBA 3K0AA 4W7IA 2GAAA 2WG2A 2FKNA 5JAOA 3UCXA 1ZM7A 1KMIY 3FNGA 3IE2A 4D4GA 5JSUA 4HLCA 3RS2A 1C8LA 2JFYA 3PCTA 3ZK8A 3H3FA 1CZRA 1KI4A 3QEOA 1QV6A 3RB8A 3LLVA 3ZQ4A 1M6NA 4GSYA 3LGAA 4MGZR 1E1CA 1XYVA 4X7RA 3FFXA 3KWLA 5CM9C 3E5MA 4WOJA 2QM3A 2WAYA 1HQCA 1HI9A 3AX6A 4IIYA 3IH5A 2VJMB 1UAAA 1YR2A 1JIXA 4GXNA 2IH4A 1QJCA 1KORA 1XU4A 5BSVA 2VNAA 1H93A 3PDCA 3PR3A 1W75A 4CF3A 3SVZA 2XX3A 1D5WA 2OGWA 1A82A 1PJ2A 3AY0A 3Q0IA 2IHKA 2ZJAA 4QVGA 2E1RA 2EFHB 1FNMA 3OEHA 4QG3A 4WF9S 2PS0A 3BZUA 3BYZA 5TARA 2Z5VA 4N8SA 4BQRA 4POOA 1BROA 4OH1A 4C87A 4LF8B 5CIWA 3BWMA 3GFBA 1FTSA 1X19A 2PU5A 4FT2A 2V5UA 3WYBA 4ENQA 2X4IA 5FEUA 2X8WA 2O1WA 4BUZA 3AVWA 3PC3A 1KJ9A 1VRVA 3VPAA 2J0SA 4ZQFA 1RM5A 4MA5A 4BNMA 4E88A 4NSNA 4QGAA 3P4YA 2C88A 3NM6B 4V0MA 4IKEA 5HFAA 3PXGA 1LLDA 3VPXA 4BQPA 1JDPA 3WB9A 4UU0A 1XMXA 2GAIA 4IHJF 5B64A 3KKKA 3T1NA 2DT8A 1EBUA 1KVRA 1TVKB 3Q9SA 4IWXA 1RRFA 1GA4A 2VSYA 3ICWA 1W5SA 3BFJA 3Q6MA 4M0DA 2QPTA 1U11A 3QELA 3TRKA 8MHTA 2PZ8A 3JZIA 3ZKWA 4NCXA 4CIXA 1Y89A 2J41A 4MKFA 1M2HA 3COSA 4UU1A 2QNRA 3TLGB 4LVCA 4BCCA 2X22A 1RYZA 2JBAA 3HXTA 4FIDA 2HZBA 4H0FA 2FJ0A 1USKA 2Q1WA 2QL6A 4P4LA 2P65A 3PGVA 4HN2A 5JNSA 3PSHA 5EI5A 1I01A 1XRMA 3P2OA 4X60A 2QSUA 5KAMA 4FDVA 2JFUA 4DLTA 1Z22A 5JSKA 1G4UR 4I6JA 2DWUA 3OJEA 4L78A 1TW3A 1U8UA 1YD7A 5AI6A 1O97C 1V6SA 3EHEA 2QRLA 2C1ZA 1WUYA 3SZ3A 4R71A 2GM9A 3N2EA 4WV3A 5DYTA 2BISA 2IYSA 5E9JA 4MV9A 1PQUA 3R6DA 5REQA 4F38A 5M7EA 2Z0YA 3OZTA 4ZIRA 5CX4A 4OYYA 4W5WA 5D85A 3IQHX 1CF2O 2BMFA 3B3FA 4C14A 1XJ0A 4P3NA 4BZWA 1VXOA 1YWGO 3KAKA 3KKZA 4GE0A 3AGPA 1F12A 4G2TA 1T8UA 2AV6A 4K5QA 5EMHA 3ZHXA 4A8JB 3OQOA 2DC1A 2GRAA 1VL8A 3EIQA 1GFIA 2BJHA 3ZGVA 5L3QB 3ADPA 3GJQA 1Y6GA 1FFBA 2X13A 3BXFA 4LW8A 3ZG6A 4YMHA 2RHRA 3ZY3A 3QKSB 4G5GA 5C1OA 3SY8A 2OAGA 1RCTE 2GHIA 2VSQA 4C4RA 5FT9A 4PC7A 3N8NA 2VPTA 2ODEA 1XGKA 1UP7A 1UDBA 4KE9A 4XX0B 1LRJA 4CMBA 4AZ3B 5L7YA 3UJ6A 3HCWA 2IIBA 1LBTA 4MMYB 4F3NA 3JYOA 4ZV4A 2ECKA 3PL1A 3TZQA 1J7KA 2X2OA 2Y66A 4NCKA 2N46A 4DL9A 2BM9A 5BR7A 1Y3AA 3WRVA 2QDXA 4WFBS 1LPSA 3QJ5A 5CFZA 1C9JA 4N3AA 4WBNA 4ZVMA 2H4XA 2QT9A 1YBMA 4HY3A 4N0DA 1LDMA 2I4RA 4DRZA 4DRXA 2UYCA 1CJBA 1MR3F 1S8OA 1SPXA 3HCBA 3DBIA 4DCNA 4OHZA 3CKLA 2YICA 4EYSA 2ZI6A 4MV1A 4DUGD 1PW5A 4EGAA 1TADA 3I01A 3ULKA 1W4ZA 1ZI8A 5HIAA 1JEQA 3EEYA 3U1BA 5JCOC 4NBWA 1YB6A 3MNFA 4RPIA 2XE4A 3AUFA 1F4LA 3A14A 3QVXA 4R2IA 1GYQA 4TMYA 3ZV3A 4HNTA 1DCTA 3H2ZA 1FXWA 3TMAA 4AJ9A 1PJCA 4PC6A 4KPFC 4XOUA 5KOHA 1EUYA 2C9ZA 4RFSB 3KZOA 4X8HA 3SHTA 2WFAA 4LOIA 1A04A 1JRLA 3HU3A 4LMAA 2NGRA 1TCUA 4OI0A 1IM8A 3MIIA 1J9ZA 3V6MA 2R4TA 4A82A 4B3DA 1OFGA 1KYQA 3IIEA 1RNLA 2AR0A 4ESVA 4CL8A 4X1IB 4MVJH 4QLAA 4O4JA 1HZJA 4WCES 1EX1A 3H99A 1AVTA 4KBYA 1G6OA 2GSDA 3MTGA 2GBLA 2WILA 1CKEA 5TJ9A 2ZETA 1CC1S 2ZAIA 3LNCA 1DXHA 3QWBA 4IFIA 2ZI7A 4LHXA 1C9KA 4JENA 1EB8A 3SBDA 4CKZA 3DZIA 3ZI4A 5LA6A 2EW2A 5B1SA 4ZVQA 1YE8A 2VN8A 4LHYA 4I4TF 2CZGA 4IVNA 5NULA 5KOJA 4A5SA 2ZR8A 2QW8A 3FCUB 3QM1A 4MRAA 4P5EA 3DD1A 5C8ZA 3DB2A 4LQLA 2QYHA 3VTZA 3DXFA 3AVVA 1JFLA 1QCZA 2NPFA 3ZE7A 3U16A 3JXEA 2H8GA 3QPBA 4E3ZA 4MQBA 3TTYA 2GH1A 5ISMA 1YHNA 2GA8A 2WAXA 1VL0A 1MFZA 5ESXA 5CA0B 2EGWA 2I66A 1K8RA 4CQMB 4BB6A 4E08A 5FAXA 5J2TB 3W2WB 1QO0A 1EVYA 3RC7A 1PEDA 3GRYA 4IIHA 1KJWA 3JYLA 4I1RA 4N5IX 1OY1A 3M6MD 5LZ7A 4OMUA 3FFTA 1E1CB 2O1SA 2OV3A 4UU8A 1S4QA 2GSWA 4LISA 1C7QA 3OVMA 5CTJA 3BPSA 4RSMA 3FDFA 4EHNA 3FCEA 3QA9A 4UATA 3W6PA 3A3KA 3BGVA 3LA6A 3CPJB 5IX8A 1JEAA 2CE7A 2M6SA 5CVVA 3WMWA 3WNZA 1NW5A 4B85A 3CIFA 4IQ8A 1P5ZB 3PITA 4L74A 3L82B 1NA5A 5T3YA 3RNOA 5EXPA 3L4SO 3F7NA 3Q88A 2PYDA 2CD9A 4RTQA 2J4FA 4UEOA 4IFTA 2RHWA 3QI2A 1SXHA 2B8JA 1SKYB 4BNKA 3IE0A 2DWCA 1AS3A 2JGMA 3R6TA 4XTCS 4ZVSA 1W0CA 3P32A 5AJZA 4R8VA 3TBHA 2E6UX 2E2WA 4JBHA 1EDBA 3KDPA 4CU5A 4WL0A 4KN6A 2XNDA 3D81A 1CD5A 3B6MA 3T06B 4A10A 1K4YA 2QQGA 4OAPA 1FX1A 4O1IA 1A9SA 5AW2A 5ITSA 2I7CA 4JYBA 4ZZ0A 4TQ9A 3IAM1 1PJ3A 5CW2A 1I3NA 2PH3A 3VTKA 1T3HA 4EYQA 5CA0A 1GT6A 3LVFO 4F9GA 4N47A 1Q0PA 1ZLYA 2W0MA 1ZOIA 2WG1A 3FTCA 1CS4C 2QNIA 3IAUA 1OWLA 3CZ9A 2PUJA 1XDSA 2I7DA 2DCMA 3RAPR 2QN7A 3DFIA 4M53A 3G5AA 4PLCA 2O2HA 2OVBA 2VSOA 4CV3A 3GGJA 2XUDA 2FPSA 1ABEA 2AC2A 4KQCA 4KGDA 4LTDA 3MWKA 4R01A 2JD0A 1C8KA 5FOTA 1Z0FA 2PR7A 2WBLC 1Q3TA 3R75A 4NMLA 5DGDA 1UP4A 1AUXA 5JSFA 3CVXA 3BXZA 3UJDA 2YASA 2C2BA 2LKCA 4HV4A 1M6EX 1AT1A 1NVKA 3DP7A 4MUEA 4Z9AA 4MS4A 2C95A 2VZEA 1WM1A 3KZVA 2JLUA 2ODPA 3IS3A 5JS6A 1T9AA 2XMPA 4LFAB 4RZ3A 4L7VA 4HWSA 2I65A 2WUGA 2ET6A 3DNMA 4RKEA 5F33A 1ZKMA 2F3QA 1NP7A 3WGQA 1MO3A 1KTVA 4OQYA 5F76A 1FRNA 1R3UA 4A16A 3L43A 5CH3A 4DCPA 1SZDA 2D1YA 3KR2A 1RVDA 3K0AB 4LE0A 3TIVA 4Z3OA 1V11B 4J49A 1UXJA 1YB7A 2HF9A 3LOUA 4LRTB 3TE6A 3WRYC 1POXA 3ZJYA 3L4KA 3B7GA 1MX9A 4Q47A 1NBMD 2EG5A 2P1DA 2ZYHA 3BE6A 2G9ZA 2Y2UA 3KSRA 3TNFA 3QVLA 3E27A 3F74A 4PGHA 1ZITA 1KK1A 4Z51A 1R4ZA 1YDMA 2FN4A 4R84A 2FGKA 3V8MA 1TT5B 2VYVA 3F5MA 2BGLA 3VX3A 3WO1A 5AW6A 4M0UA 2KW5A 4CKYA 1T4BA 1U7XA 3TI9A 2H00A 1XL1A 4HRXA 4QFBA 2I03A 1Q1QA 1C4OA 2NADA 3MZ0A 2B78A 3QELB 4LSMA 3FRJA 1JG2A 4O0MA 4PHTA 2ZPAA 1R15A 5LZ5A 4B83A 3TL6A 2ZTUA 2REOA 3R3XA 4N4AA 3QENA 1LRKA 3VNBA 4AJOA 2R47A 4YAJA 4DCSA 5H9VA 2B61A 1IJFA 1NFFA 2PJRA 5LYYA 2W2NA 4BGEA 5DHQA 1R9NA 2W2LA 2X7JA 3Q9LA 4LWQA 3U09A 3K09C 2W42A 2VEOA 3H4VA 1G291 1R50A 4IEIA 1ISSA 3KBOA 5I3ZA 1DC4A 5LQMA 3KSMA 3H5WA 3D4BA 1PK8A 4RSHA 2G72A 3FPBA 5DXJA 3LWBA 3RTBA 3TRIA 3WJAA 5JI3E 1JP7A 2JVIA 4RABA 4Z9XA 3UGQA 1E32A 3ZS8A 2PJDA 4X00A 1KWGA 4CF5A 1RYHA 2H1FA 3ZD9A 1TB4A 2VTKA 3DBLB 4EB8A 3JD2A 3S8YA 1IY1A 4NFLA 2YWBA 4QOJA 2XADA 3RI3A 1K3UB 4N3GA 2OC4A 4CIWA 4HOYA 4Y6SA 3DLTA 3LQ1A 4H0NA 3EIHA 1HUQA 3UQYS 3CNHA 4LNUA 1Z4KA 2HXYA 1HURA 1VKNA 1P1BA 2J4DA 2OR3A 3OCWA 3TLGA 4NICA 1IXZA 5BWOA 1L5QA 2JIMA 2ZANA 5DCLA 2BSQA 5EMNA 2RHDA 1UMCA 1P2GA 1N92A 2FN7A 2FW6A 2XQFA 2HJGA 3FAKA 4RVFA 4TV9A 2GPYA 1AXEA 3GAAA 3IUYA 4V2IA 3ZY5A 9GPBA 4OXXA 1SVWA 1GQOA 2J6BA 2G5GX 1BXRA 2W2VA 3H9QA 3P9RA 2AZ4A 1YRLA 3BERA 5DNCA 4G26A 1V8OA 3RTEA 4KW7A 4K0RA 2AOXA 1KFBB 2QXTA 2J0UA 3ONWA 2QX9A 3ZLUA 3A7EA 1N1DA 3OPNA 2JLYA 2RARA 4TX1A 4LQDA 1DQSA 4AO8A 3OO0A 4EABA 4OSEA 1C7ZA 1VHDA 3HVKA 4PS0A 4YJGB 3OPXA 5CVUA 1MAVA 4ARZA 1OHHD 3HUEA 2BGUA 2WVHA 4BFUA 4ZP1A 3TOVA 4JD5A 1OWMA 2ZZMA 3PHJA 1NVVR 4F4FA 1RYFA 1SXPA 1BKDR 2IXGA 4XVUA 2DYKA 4KN5A 2VRCA 4K9QA 1ARZA 3NETA 2PBLA 4D56A 1O94C 4R41A 4OHUA 5EJ8A 4R8KA 2FZCA 3T3EA 4WFIA 3WSTA 4K46A 5DI9A 1C29B 1E96A 1UM9B 5E4YA 2BE9A 3TE7A 1DUSA 4H08A 3VU3A 3C41J 3QOXA 4HT3B 3IR5A 1Q92A 1CW2B 4NENB 2NUPA 5AOCA 1YJXA 3ZEAA 2R8YA 4QTUB 5DULA 3ZWVA 5B7NA 1F0PA 4JYCA 3I9V6 2F4NA 3B36A 2G4LA 1KFCB 1SVLA 2QYSA 4FD3A 3CBGA 1BJKA 1WD5A 1E94E 1FEUA 1DEXA 1HGXA 1WZNA 2R4QA 3ASZA 2Q4RA 3IDFA 4PW0A 1ADBA 5HKOA 1YONA 1BCSB 3TW4A 1F2DA 4LZNA 1A50B 1FMLA 1UK6A 2J0UB 3MOGA 4NBUA 1OJLA 1P3JA 5ALKA 4Z4IA 1FVOA 4YUXA 2UAGA 4Y9DA 5EQDA 3DOCA 5CTAA 3LFTA 3CB4A 1DGQA 1KO1A 2IPNA 2R7AA 3GBPA 4L07A 3RU9A 3HXPA 3L9WA 4FONA 2ZIGA 3MT8A 4JB2A 3T4PA 2WSLA 2JAWA 4NDAA 1GJRA 2VDLB 2XF8A 4QT0A 3FWZA 5EPUA 4E8BA 3EY4A 4CQLA 4M76B 2P6OA 1LLUA 3B78A 4KHPB 1EDOA 1ZUIA 1EFVA 3M34A 1MEOA 1JFVA 3MBOA 4WACA 5FWDA 4DSOA 2QVZX 4C6RA 2BZ0A 1G5PA 3E9YA 3JX9A 1CFJA 2FPGB 4G85A 1F1JA 4JLMA 4IJKA 1Z4NA 1EK1A 1P9LA 3HNRA 4YQYA 3EF0A 1UM9A 2C20A 3M49A 5KNBD 4J2TA 5F78A 3U7RA 3QE3A 1SVIA 3D5QA 3WI7A 1Z7GA 4YRSA 2GA9A 3IAXA 3C5WP 3E5NA 2EL7A 1ZU5A 5DH9A 3RV4A 3AG5A 1TPZA 1B15A 3H2HA 3VAYA 4E51A 1DHTA 3PFBA 2JLBA 4GZ5A 5EJ4A 3CGWA 1KHHA 1CY2A 1VI6A 1ZW1A 3JWIA 2IHYA 3JYNA 5BSHA 4H27A 5LU9A 3Q8XB 1Z63A 5AM5A 4F5EA 3FOZA 1JQAA 1SZCA 2AOUA 3DE2X 3R6LA 5AVZA 3TOXA 1SEVA 1H0KA 1T26A 3ISVA 1NXOA 4Y7CA 2RGRA 1DJMA 1Z06A 1GKKA 2HDWA 4JB3A 3DTVD 1QH8A 1U0LA 2WTUA 3PRHA 3RARA 2X0RA 3WA6A 3D2BA 2XVAA 1NVBA 4KPGA 4LJRA 3OT4A 1FU8A 2GO1A 3WK7A 1GUAA 3DM9B 4C0XA 1ZGGA 3OU6A 1FFGA 1OV4A 5K4AA 1F48A 1BXGA 1IBRA 4BE7B 2N9UA 4KYVA 1VQ1A 1PJZA 5EAIA 4MYHA 4GLOA 5CURA 2F1IA 1QX3A 1IZ7A 1J8DA 2ZTLA 1RYYA 4F3TA 1T15A 1N3IA 3INGA 8OHMA 2GBIA 1WCV1 2Q0XA 4JI6B 2LCIA 2V5AA 5IUNC 3C3BA 4JK3A 2K5UA 1I80A 3BOSA 3NEJA 2GBCA 4FLEA 4I55F 4UBIA 5HCIA 5TXGA 4Q7JB 4D8XA 2QU8A 1LKZA 3K6RA 1FDWA 5FKJA 1GG9A 1H22A 1GPMA 1CQPA 3Q3VA 3ST7A 3M81A 3VJRA 2V98A 4RE5A 3UOWA 3V4OA 1MT0A 1SUAA 1P19A 4Y9TA 2CB0A 3E9EA 4N3BA 4MLPA 3PF9A 5CYGA 2Y3IA 1GAEO 4OM8A 4DDVA 1BYIA 1A9YA 3BJEA 1G1AA 4O4IB 3RS5A 2GEDA 2OFWA 4PO8A 5JIBA 3T94A 3WLJA 5DLYA 1V9CA 1ZFNA 2NSYA 2WHXA 3JARA 4I4IA 4WXYB 2B35A 1FX0B 4EZEA 1ZGCA 3D4LA 1TEHA 1A5SB 4D9CA 2OCAA 1FFDA 3GRRA 3E0QA 1K27A 2DBQA 3GH1A 4PCAA 5ADUS 2YWHA 3LM8A 1N4DA 4HNSA 1XJ5A 2AG1A 4PYKA 4PX5A 4OREX 4XOIA 1DUIA 1VCOA 3NFYA 1EI9A 1SCKA 3OA2A 4MKHA 5J1SB 2NO9A 4KZKA 5KPDA 1EDEA 2JFOA 1T2CA 2HMTA 3ETEA 3TZBA 1NUSA 4Q1AA 3RVNA 2J7PD 2M98A 3Q12A 4FI3F 4TMWA 1XKTA 1C50A 4EA9A 2C4UA 2Y1KA 2PSDA 3IP5A 1TT5A 4GHWA 4KC0A 3EVDA 3WAGA 1E2PA 2FLWA 2NVUA 1V3QE 1L8QA 3C1UA 3RDPA 3U1TA 3ZVMA 4I4NA 2IGTA 4BJ6A 4ZAVA 3WGNA 2GEFA 2H29A 3ELBA 4GO1A 3MAAC 4YPFA 1AB5A 3GAMA 3IQDB 3LDFA 3TCKA 1RI4A 1VSTA 2I78A 3DVSX 3EHDA 4CKEB 4DNXA 5F3WB 4KRFA 2FRDC 3O0DA 4MW1A 1NVXQ 2FSGA 1SPBS 2PX2A 4U7HA 4YJHA 3H2GA 2PMWB 4Z7QB 2DR3A 1QC5B 2EX0A 2VQEB 1QDUA 2HPVA 1B1CA 1T25A 2R6FA 2IPAB 4N7RA 1EH5A 4RVNA 3R9XB 3P7MA 5DRTA 1OC2A 2D06A 1SG0A 3ZDXB 7REQA 2E9SA 4X6XA 5FBQB 3RVOA 5G41A 2O8FA 4EFLA 2O8VA 5G53C 3I73A 3BRWD 1K08A 3VO2A 4YONB 3OZCA 1KFKB 3DKPA 3WOHA 1I2CA 4EJ6A 4HTFA 2A1IA 2FMXA 2PLWA 2J5KA 4DIEA 1E0SA 1KVUA 1XMOB 3LBAA 3I5AA 3MWEA 4QDOA 1R0XA 1B2RA 4TTRA 1OAKA 4CLDA 1S6YA 4UCQA 1WXXA 4YO7A 1AKNA 1TECE 3MLEA 1L4HA 3NT5A 4DVGA 4JT9A 1EUZA 4LDRA 3FNRA 3HB0A 4YR9A 1D09A 2QN3A 2Z1DA 2WZQA 3PKJA 4FBLA 5LLDA 1CVLA 4IXMA 2I7VA 4I5FA 2VOEA 4DWOA 5JZMA 2ZRGA 3HCCA 5IULC 2F7SA 2OCPA 1RHQA 3O8CA 3D6JA 1IHYA 5CVJA 4EVRA 2XWSA 1V5EA 3S1LA 1G5RA 1DADA 3BAFA 1K92A 2IZOA 4F4DA 1WHSB 2KS6A 1I3LA 2C2OA 4HQKA 3QPAA 5AJXA 3UKOA 1GFWA 3G0HA 4PR3A 3VZDA 3W9YA 1U2GA 5BSGA 1XG5A 4ABYA 1WPRA 3L6UA 4FR0A 3KPWA 3CV3A 4OB8A 4U4AA 5C5DA 5A0TA 4EKGA 2PUAA 1K6IA 3FPGA 5AVRA 3SHWA 4L8GA 5MFPA 2Q5OA 4LWOA 4YRLA 2JGLA 3PTLA 4FR5A 4RLFA 5I01A 2Q29A 2NU7A 5A4KA 4PYRA 4RD6A 1YV9A 5FBWB 3BT7A 2BI8A 5B3JC 3AW8A 2QG6A 1UZLA 4A26A 3U7GA 2ZRBA 4KIFA 3EGDB 4UVHA 4UD2A 4YQFA 1SBHA 4FT4A 1YBVA 4CG1A 5AM3A 1EIWA 4ETIA 1FS5A 1KE2A 1EVKA 2OM2A 2NQ2C 4ZN6A 3PXDA 3THWB 3LCMA 3AOEA 1M34A 5CB4F 1SGWA 3EPHA 3SZLA 1BDHA 1MRZA 3ANSA 4U6NA 4DQVA 3LF2A 3ZBPA 1AUOA 5JH7A 4FHZA 2GPBA 2CJWA 1TZBA 2FQ1A 3NO4A 1ST3A 1UPAA 1SK8A 2Q9UA 2ZRLA 1XFDA 2D0DA 3MCZA 1NKVA 4A0SA 1KC3A 3C8ZA 1RPNA 1OI3A 3NOOA 3WJ1A 5T64A 3GCGA 2XOKA 4ARZB 1XEXA 2B6HA 4RMNA 2AHRA 4OXYA 4G1BA 1ZS9A 1QLJA 1XDZA 3MPOA 1RP1A 3OIVA 5D2CA 1H1TA 4U5XA 3HV0A 1G38A 4C6TB 1QHYA 2E4VA 3G5UA 3VGJA 4CR8A 3Q8WA 3WLOA 2QGZA 2BSAA 1Y34E 5IYZA 3DBLA 1WCIA 2YMMA 2FG6C 2NU7B 2BFMA 2JEZA 2JLXA 3HY6A 4RPLA 4XM1A 4C5BA 1E1NA 2RCYA 4F2WA 1J2RA 3IDOA 3MELA 2GHTA 3EJWA 3VPHA 4MV8A 1H5UA 2IITA 4DYDA 4BNGA 1KBQA 1PW7A 3ESXA 1MOPA 1VA4A 1AV7A 3T5BA 3V97A 1F5NA 1TKCA 3G5TA 3Q2IA 1TW2A 1J1ZA 3HKEB 4C30A 2C4MA 1M34B 1T6XA 2FCRA 1U63A 2WPDA 3FLAA 1XTQA 2CL0X 2ZXFA 5BVHA 2V65A 3ILSA 3A1EA 3B3GA 4UUNA 1GGEA 2JANA 4UD6A 4ZYUA 1BCSA 3F6YA 1L7EA 5T4BA 3T4EA 3PP8A 2JFZA 1ZSNA 1ORVA 1UOPA 3SC2B 3TD9A 5BY2A 2WWFA 4ID3A 3AO0B 1RPJA 4RMJA 5C4IA 1KETA 1RBMA 1GUZA 3H1PA 4ALIA 3FGPA 3I0ZA 5CU7A 2VPXA 3ZCSA 2XTNA 3VQTA 5AOVA 4WFAS 4UAGA 4YJGA 4W7SA 4QFMA 5K3BA 1EU1A 4Q02A 1NUQA 1U5BA 2ZWPA 4Q7LA 4RCVA 2ZAOA 4TN1A 2PQMA 4HAZA 3LECA 4J16A 3RSCA 4A73A 4DNOA 5K8IA 3D6TB 2LP4Y 2Q7XA 3H5OA 3L1JA 4JCCA 2DWQA 2ZWAA 1SXGA 5ECWA 4B76A 2CV0A 5ESWA 3STYA 4AN0A 4G5HA 1IZ8A 2C1XA 3RFFA 4AJHA 2Z04A 3WTCA 3WYCA 3ZV5A 2H9YA 4MYUA 3H5NA 3GCXA 1KVTA 4KACA 4Y2XA 1A96A 4PRZA 5YASA 2CVPA 2X6QA 2VWHA 1W2WB 1H2BA 1LCIA 2P30A 3ETLA 3WP0A 2YKGA 3E7DA 1LD3A 2IEAA 3IQZA 3LI2A 3LK7A 2NZ2A 5C4GB 4CDRA 2GCEA 4CIDA 2Q5QA 2JA2A 1Y3IA 1QIFA 3K9GA 2OA0A 1CVRA 1M2NA 4H6VA 4H18A 3ZGNA 2X6TA 3DYVA 4P4SA 2A86A 1E7SA 2R6CA 2XWQA 4FR2A 3TZKA 1IHUA 1VJ0A 1GVHA 2PQ6A 1A9ZA 4IJQA 2WVAA 5ALMA 1EXWA 2QZJA 3K5IA 3M1LA 4W1SA 2J9FB 1V1MA 4OX9Y 3AUAA 4FFBB 2GXUA 1RHJA 2VXYA 4XW2A 5LDDC 2O8FB 1K8XB 1W2GA 1T4CA 1D2AA 2FPIB 3T99A 4AS2A 4YP7A 3QHAA 4JZKA 1U4OA 1LK0A 5TQ2B 1TD9A 3MJRA 2ZJ1A 3GA5A 3CLRC 1XVTA 3F71A 1YRHA 2GJSA 3PU6A 4KPYA 3S99A 4LY0A 3AV3A 5KJCA 4YCNA 3NJ4A 3A37A 4RGYA 4EWLA 3KM0A 3I1IA 3NTRA 4JLDA 3D4NA 3A8TA 4XYMA 3IP6A 4ZQEA 4CHGA 3T5TA 1WDKA 2FQXA 2HMWA 4DCMA 3CC8A 4ZOLF 3K0SA 1BMQA 4X91A 3V3TA 1H2XA 4CCYB 1WE2A 1U7OA 4FOTA 3P52A 2VJMA 4DA4A 2J33A 2EKDA 1P91A 3KVOA 2J3LA 3T1TA 2E0IA 4TXJA 2FSPA 3U3XA 1C8BA 3IELA 1EE9A 4EVQA 5M34A 1EUCB 2DAPA 3BORA 1G9TA 4MGIR 4OMFG 3NBXX 3N86A 4DMFA 2QRGA 4DSAA 3AF0A 4CE6A 4HZGA 1E3SA 1QG2A 1NNEA 3ZBUA 2AMYA 5DTQA 1SC3A 3BMQA 1XNJA 4TXHA 1E6WA 3AY6A 2PRKA 1X39A 5DFAA 4I50A 1UFOA 2PGLA 4WJZA 1RI3A 1TRKA 1UADA 1V7CA 3K2EA 4EA6A 1OYYA 1M7BA 1RM0A 1H4TA 2RGXA 2ZSFA 3FWPA 1I0ZA 1ZDMA 3NZEA 2A5DA 2QN9A 2XF2A 2C7VA 2R8PA 2ZCUA 5CA1F 1TM2A 2V6IA 2WWXA 2HSWA 4AJ4A 4M88A 3R3HA 4ND4A 4TYMA 3Q15C 1NMZA 4JOCA 2CXUA 1PFKA 4FC6A 4II7A 5D1HA 1ESEA 1JDNA 1XZKA 4AQYB 4AWBA 4I1YA 1FNSA 2FPWA 4H3SA 2XYGA 2ZYSA 3L6BA 4MYDA 4IDFA 5I7SA 3C3PA 3VZPA 1N2CE 1ZH4A 2I7TA 2QRZA 4URZR 4XDGA 3M1YA 1UPXA 4EEKA 4ZQIA 5SZJA 1T5HX 2ODBA 3F67A 3IHLA 2YVQA 3DJFA 2H0AA 4QQFA 5M3BA 4F6CA 2L19A 1G63A 3FIUA 4YFYA 1GFSA 4D4IA 3X1KA 2V9CA 2G9UA 3G82C 4UKDA 2Q3JA 1LJLA 3T0FA 3W90A 2YR0A 1E7YA 5IT5A 4B3GA 1NYLA 1D2RA 4ITRC 3KV3O 3L05A 4PZAA 3K6SB 3TSZA 1GZ5A 3Q5DA 3F49S 4X85A 3I2GA 1QPBA 1NYTA 4ZT6A 5GVSA 1ODIA 2EBWA 2JEYA 3GJRA 1Q7TA 1UT5A 2JZCA 4W7HA 5IF3A 4HLNA 1XU7A 3KYBA 1JZSA 3GQBA 5E6SA 3R3JA 2I91A 1PP4A 2HD4A 2IPXA 3WDKA 2OCLA 4I4TA 1QDLB 2X5XA 3EXG2 3TVDA 5K0NA 2QTAA 5PNTA 1AK2A 2R87A 2W2MA 2X3UA 2QLLA 4G4SP 4RD0A 2QMOA 2YJ5A 1KYTA 2XKBA 2BKEA 2G9VA 1LPNA 4C0HA 1JHPA 1QUEA 2OV1A 3H11A 2B21A 2HR1A 4L3VA 2JJ2A 4YIKA 4N12A 1T9KA 3SICE 2IHBA 1NVMB 2Z98A 1JAZA 2DSTA 1YIOA 2FFBA 4ZOCA 2YHAA 2ZUWA 3E9MA 4EB3A 3U5ZB 2P4HX 3FVVA 2WY2D 2GPWA 3F78A 3E7WA 3LQKA 2J0QA 2DBRA 2AG5A 5AJUA 2VO1A 1DTWA 3BL5A 3RRYA 3VR4H 1HLFA 4QATA 4R83A 2E4WA 4TSFD 2HRRA 1XEXB 3GFRA 1L5VA 1UXKA 3QSGA 3ZVNA 1ZK0A 4YRGA 4FMCB 3TTUA 1Z6TA 2BFCB 4MARA 4NS1A 4UAJA 1PN3A 3A3YA 4RHEA 1S3FA 3NIWA 3UJ8A 4XSVA 5AMXA 2XZPA 5CD9A 3T7AA 3ESQA 1GKLA 4GUDA 3KEQA 4N03A 2JFBA 2QK4A 3B1FA 3N2NA 4P35A 4F2GA 2NSDA 2BSXA 3SIPA 1WCYA 5M5BA 2WFLA 5DN6A 5K6RA 3QPVA 5EZ5A 4G0WA 1T29A 5GONA 1B6RA 3THXA 2FWJA 1DEAA 2CD7A 4JAVC 1V1RA 1YFLA 1QOZA 1MTZA 4ZJZA 1EGHA 3NWBA 5EZYF 3X1YA 2XGSA 5CXXA 1OBFO 3NTXA 4PR0A 2WYUA 5CA0F 2Y92A 2C5EA 4FOOA 1QZ3A 4HN4B 3VYVA 4GPAA 2IIVA 4IHAA 3RGGA 3S2YA 2B7BA 2OCGA 4M0FA 2IX9A 3FH0A 1EHYA 2ERXA 2H9AA 1JH9A 4OYLA 3RFVA 4B35A 3U17A 3OZIA 1JWBB 1N9GB 3K9CA 3PQ6A 1JJFA 2WTNA 4LOLA 4PCUA 2WSYB 1NSFA 5CHEA 2UYHA 4RV4A 3I09A 3QF4B 1H94A 3SS8A 4CW7A 3C98A 1WV0A 1G20B 1M1YA 4UM7A 3HBJA 5BV8A 3DLPX 2X5NA 1HORA 2WYIA 5GJBA 3BF8A 1ZXLA 4AF6A 3T3GA 1UOOA 3A9CA 1GWNA 3GNSA 5CBPA 3EA5A 2FPPB 2WMYA 2QVYX 4JBGA 1YVPA 4F12A 4WOPA 3NXKA 1F06A 1SBIA 3IESA 4RVCA 5J2TF 5C31A 2WZBA 4JMPA 1SXJA 3NG1A 4RZSA 1JPVA 2BFWA 3CIOA 1ESZA 2HX1A 4PU0A 2P4QA 1JAHA 4GMFA 4QBTA 4RF3A 3WNBA 1VMIA 3IFSA 4WGGA 4A8TA 2A1TR 3WIEA 1GTG1 1PZFA 1JWAB 2CJWB 2OD2A 1Z5UA 4EGCB 3PZBA 5DCYA 10MHA 4RMHA 2YV2A 4YJFA 3VR0A 5LZ2A 3TUZC 2BGIA 3I3SR 4QASA 1WKBA 5H59A 3VR6H 1D0VA 1Z15A 4W1QA 1BA3A 2EBUA 1YZVA 2I4MA 2PDAA 1MIOB 3KFVA 2BFFB 4RTRA 3IP3A 3DS8A 4YCAA 2H9IA 3TLMA 2L69A 5GV8A 5GGXA 4WA7A 4OIMA 2IWRA 1R0RE 4RELA 3UJHA 3PSAA 4J6FA 4C6TA 4GOLD 3TKAA 4OAOA 3F6CA 2EWVA 2JCSA 3O7MA 5EP4A 4IRUB 4LY3A 2AS0A 1TMOA 4Q66C 1XMPA 4UHKA 1XUOA 4R51A 1EESA 5TQ0A 2C9MA 3D7NA 4PRKA 1JG4A 3NHWA 3OJFA 1ZD5A 2QJOA 1D6MA 3QBDA 1B43A 1H2EA 1Z36A 2I3ZA 3V4FA 2ASEA 1U0EA 4CT0A 3UFXA 3USZA 3DO6A 1RHKA 1U3TA 1QGDA 3B6IA 3CSSA 1NBWB 2A1TS 2H63A 3RVSA 5KVAA 1GAWA 3A4VA 4CM8A 5FTJA 2ES4A 5KTRA 2QUKA 1BVUA 1FW8A 1Y80A 3MCWA 3GT7A 4KIJA 4JWTA 1CV2A 5SV2A 1CEEA 4QM7A 2BRUC 3C8UA 1YE5A 3NYWA 3L0CA 2P9TA 3PNSA 4KX3A 3RS3A 2A30A 5IVPA 3MWFA 3W3AH 4CEJA 1P2TA 4H4DA 3CLUD 1NG9A 1M2OA 1R10A 1CJVC 4DBZA 4TSFA 4RTSA 3LBIA 2R1TA 3TOZA 1TL7C 3NBUA 4YMIA 4EKEA 1LX6A 2BKXA 4FGZA 1G3QA 3DYBA 4Q3LA 1SXJE 3WGOA 1M0EA 1GG2A 3FLEA 1MIOA 3L7MA 2V9PA 1E2FA 2B2NA 2HIAA 2QMHA 4HAXA 4MAMA 4G01B 3WYGA 4ZYWA 3BTVA 4JGBA 5L7TA 3O4FA 2R0QC 5FOXA 1GP2A 4HFMA 1EINA 1WZUA 1R8SA 1DIBA 1YRQA 3R5XA 4C5CA 5BSKA 5KS2A 1ZMXA 3DBVO 3HUTA 2QR5A 3CTPA 2Q1SA 4CTOA 4EVIA 5HBGA 1QRTA 4OXRA 1CY1A 3E03A 3M9XA 2E5LB 2HWYA 4I4TB 3UF0A 4MUKA 2AQHA 2PGJA 3ILVA 4LDNA 2PR2A 3R1IA 2CFSA 2HOQA 2Y68A 3L8HA 4WY8A 5DX8A 5I48A 1UQRA 1QQ5A 3OOSA 1C3OB 2CXSA 3SEZA 1P1IA 1UFKA 4FI3C 1VL6A 4L4ZA 2ORED 4NH0A 4DMHA 5KUTA 2G63A 1IPFA 3TW8B 1WP9A 4K1LA 3ZHQA 1L5MA 1R18A 1XDBA 1VZ2A 1K7SN 3QUBA 4BU0A 2GCIA 3V5NA 3HMKA 2C2XA 2HMVA 1S8NA 2AI2A 2YRXA 3M9LA 3UYKA 3I01M 2D13A 2D4HA 2GRUA 5DB4A 5ITZB 1W88A 2BELA 2NUBA 2GEKA 4QFDA 3O90A 2FMFA 4TYWA 1CUHA 2OO3A 2ZBGA 1DPFA 2Y76A 2ZZKA 1JKMA 3NHBA 2PBFA 3G7NA 4PLTA 3C7KA 1IWPB 4PPQA 4V2UA 5D5QA 1XTIA 3DWIA 3SR3A 2O05A 3VH3A 3HSSA 5GTDA 1LNSA 1W6RA 1YTLA 1ZK2A 3FSJX 4PC2A 2HBZA 2PGAA 5EQFA 3S29A 4JEMA 1ZAKA 2CK3D 5CCEA 4XWKA 4TZKA 4WHMA 4EHFA 2CXRA 1NKSA 4H6WA 1FRZA 1O6BA 3L1VA 4ZVVA 1VMKA 4B84A 5HP4A 5LXTF 3KQHA 5DTMA 2C7PA 1YVUA 1L7DA 2F9MA 2VJKA 4XPZA 1S5PA 2ZBRA 2BEJA 1EZ4A 2ENWA 4W9NC 3OZVA 2WPDD 4TTQA 3P2KA 3A4NA 4F4CA 4RY0A 2QQ5A 4INOA