2HZCA

Crystal structure of the n-terminal rrm of the u2af large subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Splicing factor U2AF 65 kDa subunit
publication title Alternative Conformations at the RNA-binding Surface of the N-terminal U2AF(65) RNA Recognition Motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 23
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hzcA00
2RT3A 1SJ4P 1XN9A 3CMES 3CMAS 1SXLA 1YIJS 2VOOA 3CCQS 2MSTA 1VQ4S 1NJIT 4CQ1A 2CPIA 2OSQA 3J7ZT 1HA1A 1U6BA 5IQQA 2GO9A 2KG1A 1PO6A 2ZJRQ 1S72S 2DHAA 3CD6S 1N52B 3VAGA 2A3JA 1SJ3P 3BO3A 1M5PC 3JB9k 3UCGA 4F26A 3CC2S 5CXTA 3TO8A 2MY8A 1DBDA 4YOEA 1JJHA 2MKIA 1H6KX 1SJRA 3VAFA 2MZQA 4V19X 4OZ0A 1OPIA 1FHTA 2BZ2A 2EK1A 4CH1A 1QVFR 1M5KC 2HYIB 2KXNB 2MKCA 1UW4A 1X4HA 4C0OC 2CPFA 2DGSA 5LSOA 1BY9A 3H2UB 1VQOS 4CH0S 1U6FA 2LA6A 2E5IA 5GVQA 2JVRA 5DDRC 4YUDA 2DGUA 1U1NA 2OSRA 3UD3P 4TU7A 2DGVA 5HL7Q 5IFMA 3Q2TC 1ZZNA 1R8PA 3HI9A 1YJ9S 2DISA 1VQMS 1X4CA 3BEGB 4WKRA 3PIPQ 3VF0B 3CULA 2M7SA 2FPHX 1FO1A 2DGTA 2JWNA 3TYTA 4J5OA 2MQLA 4UQTA 1FT8A 2HGMA 1YTYA 2LXUA 4ERDA 1X4EA 1X4AA 2CPJA 1G2EA 2MJNA 1OWXA 3CC7S 1X5OA 2KVIA 3U1LA 1YI2S 1URNA 2KG0A 4C7QA 1DZ5A 2KYXA 2RU3A 2XB2D 4EGLA 1VQ5S 4PR6A 2MSSA 2DIVA 2YKAA 5GMKa 3CCUS 4ED5A 2LECA 2CQIA 2DNGA 4IO9Q 3SMZA 5BJRA 1UAWA 2DNLA 3THPA 4WIIA 2LEBA 4FXWA 3THTA 4WCEQ 2MGZA 2DO4A 1Q81T 1VQ9S 2BOPA 1F9FA 5LXYA 3CCRS 3VAIA 3NS6A 2CPEA 1DHMA 2KXFA 2M88A 1H2TZ 1WHYA 2JVOA 2GHPA 1JMTA 2YH1A 1U1LA 2KI2A 2DH7A 4TLQA 2KXHA 2XNRA 1X4GA 4OZ1A 2M8HA 2FHOB 5CYJA 3MUMP 1VQPS 4M5DB 1W2BR 3CCLS 2KM8C 3EGZA 1OO0B 2DNMA 3U1MA 2J0QD 1DRZA 3VAHA 1U1QA 4RU2A 3R1LA 5LXRA 3US5A 1WHXA 1HD1A 4QU6A 4YB1P 1A9NB 5GAGU 3G4SS 2AYEA 3UCUP 1YJWS 3MXHP 2DHXA 4LIRA 2CQ0A 4Y00A 3I56S 2DNKA 2RUGA 2LA4A 2MQPA 3NS5A 3BS9A 3FEYB 2DH8A 2I2YA 3S6EA 2CPXA 2SXLA 1P1TA 3K0JA 2DNOA 1B7FA 4WFAQ 1WEXA 1X5TA 1NO8A 2MGZB 1U1KA 4F25A 2J0SD 4PKDB 1YHQS 5GAEU 2DH9A 1YWXA 1WF0A 1U1PA 1VQ8S 1M1KT 5DETA 2AD9A 3IRWP 2KM8B 1K73T 1P27B 2MYFA 2F3JA 2ADBA 2PEHA 4A8XA 4IOCQ 2ERRA 2LQ5A 3BO4A 1FJCA 2L9WA 2X1GA 3CC4S 2N3OA 4ZKAA 2DB1A 2KT5A 2CPDA 4FXVA 1VC5A 1Q7YT 3P49B 2RRAA 2YTCA 1VC6A 2XS2A 2FY1A 2CQCA 1UFWA 3EX7B 2O3DA 2XS5A 3CCVS 3EGNA 2VODA 3CCES 2DNPA 2M0GB 3ZZZA 2D9PA 3VAKA 2EK6A 2N3LA 2UP1A 1UP1A 4IUFA 2CQ3A 2QFJA 2DNZA 2CQDA 3MURP 1U1MA 4WFNQ 1SJFA 1YJNS 3OW2R 3PIOQ 1R8HA 2LXIA 1RK8A 2DNQA 2MQNA 1FJ7A 2ADCA 3R27A 2M8DB 1N54B 3UE2A 1VBXA 5JVHQ 3MDFA 3TP2A 3NNAA 2LEAA 1ZZFA 3VALA 4BS2A 3CCJS 2OJ3A 2DNYA 2RS2A 3SDEA 2AYGA 4U67Q 1WI6A 5DDPC 2FC8A 1A7GE 3IWNC 1N8RT 1H2UX 3HHNB 4QU7A 2MPUA 3I55S 2CPYA 1YITS 1IQTA 1X4DA 3G96A 2MZ1A 2DNHA 3Q2SC 1K8AT 5D77A 1FJEB 1RKJA 2CJKA 1WG5A 2K8GA 2KN4A 2D9OA 3LQVA 2FC9A 3SXLA 3S7RA 3MD1A 1VBYA 1QM9A 3D2WA 1WG1A 3V4MA 2E5GA 3UD4P 2I38A 3UCZP 2CQ2A 2E5JA 1O0PA 1KOOA 2U1AA 5MLCV 3CTRA 3P6YC 3P3DA 2CQ1A 5DM7Q 2OIHA 4TU9A 2CPZA 1WHVA 1WEZA 2X1AA 2JX2A 4IOAQ 1VBZA 2F9DA 3SDEB 1HD0A 2CQBA 2PE8A 2KFYA 2HVZA 2AYBA 1WF1A 2MZSA 1X5PA 5LSLA 5GAHU 2LCWA 1AUDA 1VQ7S 2MHNA 3P5TL 1WELA 2RQCA 2HGLA 2DGQA 1NU4A 3CCSS 1KD1T 2DGXA 4W92B 1X5SA 1VQNS 2X1FA 2DNRA 2ZJPQ 3RW7A 2CPHA 1KQSR 3NMRA 3CPWR 3MOJB 3NNCA 2MKHA 1KOHA 1L3KA 3R1HA 5DDQC 2MQOA 2VOPA 1U1RA 2G0CA 1WEYA 2RQ4A 2J8AA 2X1BA 3S8SA 2VONA 2JRSA 3G6ES 1PGZA 4LJMA 3J7YU 4WF9Q 1U2FA 3MUVP 2ZJQQ 1N88A 3BO2A 5IM0A 3G9CA 2OTJS 1WWHA 2M70A 1HL6A 2QA4S 1FNXH 3MI7X 5DM6Q 3S01A 2MKSA 3VAMA 5ITHA 1CVJA 2DO0A 2XNQA 1WF2A 3DXBA 2LMIA 4LMZA 1FXLA 5DDOC 3H2VE 1WI8A 1ZH5A 2AYMA 2L08A 2MQQA 1M5VC 1WTBA 2G4BA 2MJUA 2E44A 5D78A 3VAJA 2KHCA 2F9JA 2B0GA 1U1OA 4C4WA 2MQMA 1JJ2R 1WHWA 2D3OR 4QQBA 2N82B 2Q79A 2E5HA 2KH9A 2CQPA 2HGNA 2V94A 2J76E 2DGOA 1M5OC 3MD3A 2KU7A 2DIUA 2M4MA 5H1SV 4Y0FA 5FJ4A 5EN1A 2RS8A 2MY7A 2MXYA 3G71S 1M90T 2MKJA 2RVJA 2DNNA 3ZZYA 3FEXB 1K9MT 4TU8A 1D9AA 2YWKA 2DITA 2NLWA 2K3KA 1X4FA 2DK2A 2CQGA 2DHSA 1VQ6S 1X4BA 2KRBA 3LPYA 5IM0B 1VQKS 3G8SA 3NNHA 2M52A 2L41A 2KRRA 2WBRA 3DLLQ 5JVGQ 1OIAA 2MZTA 1VC0A 3CXCR 2M9KA 2MB0B 2CQ4A 1Q82T 2RRBA 2HZCA 3N9UC 3RW6A 3G8TA 4P6QA 2EVZA 4W90B 5LJ3Y 3CCMS 4WFBQ 2N7CA 3CUNA 2LKZA 1QVGR 2LYVA 2YH0A 5LJ5Y 4CIOA 2G1DA 4UY8T 2MZJA 1D8ZA 2QEXS 3UWTA 2U2FA 1H2VZ 2DHGA 2MZRA 5CA5A 1S79A 2CQHA 1WG4A 3B4MA 4Z2XA 1SJQA 4F02A 3B4DA 3CF5Q 1JJ4A 5GADU 2RNEA 5HO4A 2OTLS 2M2BA 4PRFA 1KC8T 1X0FA 2XS7A 2XSFA 2MKKA 2DGWA 4QPTA 1Q86T 3MUTP 2MMYA 1VQLS 3ULHA 3L3CA 2NZ4A
chains in the Genus database with same CATH superfamily
4MJKA 3QSYB 4CRJA 1NJIT 1IBLF 3NGKA 3W1YC 3C19A 2V2QA 1YBAA 1HNWJ 5IQQA 6FDRA 2QA2A 4RNHA 1N52B 3SCJE 2CJ9A 2CG4A 2JLFA 2QA4G 1JLCB 1EJ7L 3D67A 1CEZA 4NLTA 3GSIA 3VAFA 1ZOTA 4H4OA 1UMJA 2UVVA 1T9YA 2HLUA 2KXNB 4F4XA 3DMJA 4I6WA 4DLGA 2OSRA 2A2CA 2UUCF 3K2YA 2FQQB 4URSA 1NHUA 3M05A 1FT8A 1X4AA 1I94J 3MAAA 4CLYA 3MM8A 4DL6A 3VTIA 1D9DA 2BVZA 2C2ZB 1SV5A 1H0HB 2RSQA 3THPA 1N5QA 3F44A 1VQ9S 1FF2A 4LRFA 1UEVA 1XR5A 4Z7YA 4ZCLA 4OL8A 4ZIWA 1NRKA 5A6PA 2JEFA 5CYJA 1L3VA 2I6WA 4LF9J 2VBWA 3L7UA 2HBQB 2H65B 3HULA 1EQ0A 4N56A 4FF4A 1KR4A 2F63A 3M30A 4RU2A 3N01A 1MU2A 5G0RB 2CIMA 1SC4B 4MIBA 4NI2A 2C2EA 1HBOA 3CJSA 1M0SA 3K0JA 4KH0B 1X5TA 2YKQA 3HHKA 4C8KA 4F25A 5CD4A 2MDAA 1NSQA 2RAQA 1CJTA 2YWWA 1EETB 3TVKA 2P9EA 3IS9A 1PBUA 2LU2A 5E3RA 2E1MC 2D3O1 2XLKA 1SPBP 2PMZD 1RTJB 1TVRA 4NPOA 4DSLA 3MEEA 4RW9B 4G1QB 2RRAA 2Q6BA 2HQCA 3CJ8A 3ILIA 5A0YA 3ZZZA 5KG3A 1PBAA 2N3LA 3C14B 1XNRJ 2R7RA 4WFNQ 2ILYA 1BQNA 2BMBA 5SUHA 2AX1A 5A2QY 2UUBJ 4FYYB 3R27A 2M8DB 1IKVA 2DRBA 5KG6A 5E3QA 2HWHA 1E6YA 2H4WB 3T1YF 1WI6A 1IJEB 3WBZA 4CYUA 1KFDA 4NLRA 3G96A 5DJBA 5L39A 5C7PA 3D6FB 2IDEA 4X4PA 3DXSX 2IHR1 4EO8A 4NWBA 4I2PB 3UI3A 2VG6A 4IR9A 5FIIA 2QT7A 2HPUA 3IBFB 2CQ2A 3DRPB 3EZOA 2XMTA 3NRBA 5DQIA 5DG9A 2B8QA 1VI7A 3LPEA 4YQWA 4OQJA 2PIIA 1OQ3A 4EBEA 1TAUA 2L48A 3NBPA 4ETXA 4ZVQB 4TKTA 2HVZA 4CO5A 1X5PA 5F0UA 2YVSA 3PJXA 3H59A 4CLLA 3ISZA 1KKHA 5KG5A 5EDWA 2HRTA 4F0KA 5F8NA 1MW7A 2BQ3A 5D3GB 4GVBB 2HNZB 2RQ4A 4URQU 4TXSA 2ZKTA 4WF9Q 1KSPA 4B3RJ 3MPWA 3GP9A 2H54B 2OTJS 2HAFA 1NLKL 4YP3A 4U7CA 5HLFB 1GH8A 3GMGA 2RB7A 1QLNA 1KN6A 1WI8A 5ETPA 4J9VA 1Y0HA 4Q44A 2XYGB 5EX0A 2D3OR 4LBHA 1UZDA 2KU7A 2BDPA 2G9OA 4NYOA 2ZM6J 1HBUA 3BYPA 2QA1A 3ZZYA 5GAGI 5D8HB 4O0NA 3T6JA 2E5LF 2K3IA 4FBUA 3NNHA 1P9YA 2RD5C 3DLKA 2MB0B 3JSMA 5K8PA 3TR5A 5JJBA 2ROEA 2VB6A 2KYZA 4LF6J 1SIZA 2HS3A 1H2VZ 3KK2B 1DQAA 1SBRA 3QBCA 5FDLB 3CF5Q 5GADU 1KTQA 1KQKA 2VQEF 4LSLA 1ZAXA 3G82A 4URGA 4QPTA 4GC6A 4DR7F 3ULHA 2B4VA 5D4NA 5IC4B 1SJ4P 1IUJA 5ADZA 1BQXA 1H98A 1TL1A 2W9CB 2C2MB 3OVSA 2IVYA 3WQPA 3HFZB 4IFYB 1RHRB 2RF2B 1IM4A 4AXIA 3BO3A 3JB9k 4UQGA 4X4TA 1JJHA 5DO2A 3PYDA 3M8YA 4CH1A 1S49A 1SKWA 2E66A 4NLYA 2BW7A 3H2UB 3ZZTA 2DRAA 1X9MA 2DGUA 4LF7J 4P10A 2AJ0A 4RUBA 4DL2A 5HQ8A 2W8KA 4K50A 1NSAA 3UDLA 3ZTPA 1EX8A 3KLEB 3CJ2A 1T94A 4ZLJA 1SH0A 1RTIA 4R8UB 2JEGA 1UW9A 1YI2S 4W4MA 5E3CA 1J2VA 4ITSA 2RJZA 4ED5A 4KKOB 3MWBA 2YXLA 2BE9B 4OYZA 2G2ZA 4WCEQ 4DU8A 3G6XA 1KLNA 3VHQA 2WSCC 2B4UA 3HK2A 2UV8A 3TNVA 2ZNZA 2PC6A 3T1HF 1JXEA 3PZPA 2NPFA 3CD0A 4QZVB 4A8WA 2GQCA 1QSYA 5L1KA 2KM8C 5D15A 2CJBA 4NCAA 4ES2A 3R1LA 2ZH5A 3G6VA 3I0SB 4DUTA 4LF5F 4BCAA 2HRUA 3PV8A 1WC4A 2DH8A 1CC8A 4OZLA 2DR5A 3RGIA 1FKPA 4CLTA 3Q8VA 2VDIA 3BBCA 4RW6A 4ZK7M 2FUG9 5T14A 1JLQA 3BGUA 5B08A 4LREA 1OY9A 4QR1A 2Y9HA 1N36F 3FCWA 2AEFA 4B08A 2PEHA 3NGTA 5KFZA 2Y3YA 3T9ZA 3BN4A 2VFSA 5LSRA 1RWVB 2IRYA 3CC4S 2ZNYA 5HJXA 2YTCA 4IYQA 1KHWA 4CO2A 2QL5B 1G3OA 2WCXA 3Q86A 2N7YA 1C1CA 3AQOA 3B54A 4ZJLA 1FK9A 1FRLA 2UP1A 3ADAC 5D0HA 3UDEA 3LALA 2ZOFA 1RCOB 3GG1A 3NY0A 3K7RA 4DR3F 1RBLA 4IOBA 1S6QA 4H4MB 2BRKA 3C8YA 3D1QA 1YBTA 2XBPA 3EDRB 2MQ8A 2K1RB 1JLAB 2VUGA 4L6V3 1UPMB 2HNYA 4PZVA 3HJVA 3H2LA 2WONB 1T3OA 4LF8J 2MZ1A 3ZNJ1 3MMCB 1KONA 3H8YA 2A1BA 1RLCL 2EFNA 1FNOA 1N6QA 2E5JA 1KOOA 2CNOB 2NXEA 3CD7A 4KGKA 5BR8F 5CH7B 1WHVA 2FGOA 2DCLA 3TOQA 2CJXB 2PMHA 3SDEB 2AYBA 1ZETA 4LR9A 1BHNA 4JI1J 2YNGB 4W92B 3CJKA 4IG3B 3DU5A 1P8GA 3W2VA 3CPWR 1PCAA 1R27B 5BXIA 2EBGA 3QGPA 3A12A 1TMJA 2W2PP 4B3SJ 1U2FA 3IRXA 3U7JA 2OPRB 1VQSA 4FVCA 4QWAA 1SH2A 4IFVB 4P2XA 3BQ1A 2XY7A 4PXCA 2YKMB 5IOLA 4C3LA 4ZVTB 5BYQA 4HLBA 3PJWA 1RWOB 2DIUA 3W61A 5EN1A 3O6QA 4LR7A 4F36A 3FVYA 2YNFA 3FBBA 5RUBA 1XMOJ 3AD7C 1S10A 2NLWA 1R0CB 1Y4ZB 1IQZA 4NLDA 5B7WA 1VRQC 1RAJA 1IR2A 1DTTA 2EKYA 2BQRA 1YZ7A 5KT3A 1U0SA 2G0JA 5F8JA 3UWTA 3J81j 4TVAB 1S57A 5CYMA 1RA7A 2J7WA 2KTQA 3M6UA 2OPPA 4XDCA 4NZ6A 4IG0A 3QNWB 1F5CA 2UXBF 1RT2A 1DTQA 4F4AA 1XN9A 4P75A 3CMAS 1SKRA 2DR6A 5LOQA 2D7SA 4P2MA 1RT1B 2XMMA 1UVJA 2AJ1A 2KO1A 2GO9A 1PO6A 2ZJRQ 4KV8A 2A3JA 1HPZA 2OPSA 2MY8A 4DR4J 1ACMB 1U2CA 2LFVA 3SCLE 2W8LA 5A6WA 3C3LA 4MFBA 1S0VA 4C0OC 2B5JA 4DI6A 2DGSA 4HDGA 1RWMB 2HNDB 1FRIA 2UUAF 3H20A 1WC0A 4O3SA 4YDXA 1RGVA 2IM2A 1R8PA 5C2CA 2RILA 1YJUA 2DISA 2DXDA 4M5MA 2JHEA 3M8RA 2J9DE 2F4FA 1N33J 4QR0A 3R6LB 3N28A 1YTYA 2LXUA 1T8EA 1WJ9A 3H4BA 2KVIA 2J6SA 5C2GA 4DX7A 3V6JA 1AFIA 4NXNJ 4ELVA 2XB2D 2MSSA 5GMKa 3UN5A 4YDDB 1RISA 4ZP7A 2MGZA 2Y0BB 5D0RA 4FYVB 3NS6A 2CPEA 3MMBA 2KI2A 1HMVA 3IP0A 2XNRA 2VBZA 3MM7A 2XMJA 4QIGA 2R8JA 4OHVA 3CE8A 3EGZA 3VAHA 3KLFA 4FF1A 4ZP8A 3SBMA 4FF3A 5A8RA 1TL7A 2KB2A 4O44A 1BQMB 1BC6A 3S6EA 4NA1A 1B7FA 4ZPVR 2OEJA 4AXJA 1VQ8S 4R5PA 3V6DB 2VBXA 4LF4F 3Q0AA 3LP0B 3GR0A 5M2RA 4YR0A 3L09A 4O23A 2X1GA 2GGPB 1U48A 2V6AA 1S6OA 3LWMA 2CPDA 4LRAA 3CDWA 1S7IA 3MEKA 4C3KA 1VHFA 2JEJA 1FA0A 3CDUA 1UP1A 4C8LA 3BPSP 3TUJC 4RKUC 1FEEA 1JLEB 2GX8A 1RK8A 2MQNA 5HP1B 3ZZOA 3QJPA 2QSWA 5JVHQ 2OAUA 4DSIA 4WFZA 2NUUG 4QWBA 4DQIA 2AYGA 5DDPC 5I3PA 1FRHA 2ZHOA 3ENAA 1N8RT 4QU7A 3VZHA 2BJ1A 3IR6B 2I5JA 3Q89A 1U25A 3SXLA 5J2NA 1G4CA 2E5GA 2I38A 1FVSA 2U1AA 1S9GB 3UNYA 4L72B 3EVWA 1N32J 2PEBA 2DXEA 3WC0A 1ZAWA 2F9DA 3FZ2A 3D6MB 3R97A 3MM5B 2XZDB 4DBQA 2R8IA 3GILA 2YX7A 1U7LA 4ZPDA 1IKWA 3RW7A 2B43A 3GTYX 3M4XA 3PW5A 2HHVA 1IBCB 2Y1JA 1RT4A 4U96A 3MR7A 3MUVP 1S1WB 3MCOA 3BGRA 4ECUA 1K44A 1RTZA 3T5LA 5ITHA 1L3UA 3MF5A 3MM6A 4I67A 3C16A 3FCVA 2MJUA 1YZ6A 5KT5A 4JI0F 2HHXA 4LF2A 2KHCA 4QQBA 3O5TB 4E2FB 3CT9A 4NYZA 4QW8A 1F9HA 3QWPA 2NYIA 3PRVA 2PDAA 4IO1A 4P7TA 4U95A 4XK8C 2IJFA 3H25A 1TK5A 1X9SA 2WVBA 4JI5F 3F41A 3FC9A 1Q5VA 3QGGA 3HZGA 1AFJA 1R6YA 5IXUA 2RRBA 1Q79A 3QGHA 2EVZA 4W90B 4LF8F 1XNQJ 4WFBQ 4DL5A 2LYVA 2MZJA 1HBNB 1ZM2A 1RACB 1JLCA 3HSDA 5KT2A 2BX6A 2M2BA 4PRFA 5F8IA 1FE4A 2UV8G 4EZ9A 1CLFA 3GV7B 2OMLA 3A8JA 3POTB 2XO6A 1YIJS 3TAMB 3QRQA 3OR2B 2ZH9A 2CPIA 3TUZC 3MGJA 3FUYA 1S6UA 3A3PB 4OYAA 2XGQA 3CD6S 3AT1B 1F5AA 1QY7A 3UCGA 4F26A 5CXTA 5KFXA 2B4PA 5KG4A 2OUGA 1MN9A 3NKYA 2XHCA 2B6AA 4CLFA 2CPFA 3FBFA 3SZ2A 2M3DA 2YQ0A 1VS3A 5DDRC 1P1LA 3PG9A 2J6TA 3SQOP 3W62A 3HI9A 3WX8A 2JC0A 2YBVA 1FDDA 3BEGB 3QJJA 4WKRA 2HMIB 2FPHX 3RBXA 4Y2MA 2R2UA 1RE1B 2YWEA 1N5SA 4NZ0A 2AU0A 1DURA 1MG7A 4DSJA 3FJ2A 3JSBA 1DZ5A 4B3OB 3EWGA 4WJBA 5HBMB 3CCUS 1AT1B 3NAIA 4IQMA 5B0EA 2A18A 2B9WA 1N34F 1V6HA 4WIIA 4FXWA 5D6GA 4EFAC 5LXYA 1PG5B 1NKEA 4PCQA 2W4PA 3HVAA 5KFCA 5C25B 1TTHB 3RR7A 1H7XA 3IG1B 1EETA 4GVLA 1FD8A 3BQ0A 5E3AA 3TUIC 1NBEB 1RTJA 4A8MP 1B3TA 2W2NP 3K57A 5H9FJ 4NXMJ 2CVEA 4G1QA 4RW9A 1N4LA 1XR6A 2AIRB 5B0AA 2I2YA 3BDEA 4WU3A 2XZWA 1SIWB 3C14A 4QWDA 1TFYA 4L3KA 2DR8A 3NCQA 4QJVA 1R8BA 3OTCA 1NM2A 5KFFA 2GS8A 4A8XA 1NK8A 3JQJA 4CLSA 1K0VA 3PHEA 4DR4F 2ASYA 1KQFB 1YLXA 3T5HA 4DUZJ 1Y00A 3AQPA 2Z2ZA 4LSNB 3GR1A 3CDBA 3FZBA 1ZM3A 4B3TJ 2UVRA 2XS5A 4YY3F 3EGNA 5F0WA 1HKAA 1TKXB 4I2PA 2CYYA 4WZQA 3QRPA 2M0GB 1YX2A 7AT1B 2YKPA 4ZDNA 1YJNS 3DRPA 2QGFB 1R8HA 2QMXA 2V8HA 3RYLA 4UTGA 4PWDB 3NNAA 4BS2A 3Q23A 4LVOP 2GJFA 4X65F 3IBWA 1Q78A 2MPUA 1N0VC 5LMUJ 3AXKA 1PJ5A 2HQ3A 3DRSA 4H54A 5D77A 2OI2A 5J1PA 2V2KA 5D3GA 3VGTA 1SL2A 2ZD1B 1WSRA 2NXUA 4RZRA 2HNZA 4KFBA 3N5BA 1TKZB 3HSZA 4RWXA 3W2WA 5J1EB 3PW7A 4A47A 4U8VA 3BGFA 3HKZD 2C2DA 2CQ1A 1IKYB 3GU0A 1ZTTA 2XEXA 5HLFA 2EBEA 4NA3A 3HKWA 2ILZA 2KFYA 5KFBA 1R0AB 2V69A 3DRYA 3QJLA 1HNIB 1MWZA 1X5SA 4GKJJ 2V0NA 2VASA 2C3PA 3BB5A 3TAPA 1ELOA 1U1RA 1WEYA 4DS5A 1KDNA 2ATCB 1RYRA 1N88A 3BO2A 3PX6A 3EMTA 3HT3A 1REGX 4ZN3A 4NRUA 1VRUB 3G2XA 3HLUA 1M5VC 1U1OA 4LFAJ 2VG7A 1NZAA 1FWPA 3GIRA 3WC2A 3TZZA 4ES1A 3PKMA 3H90A 1R89A 2J76E 2HKEA 3AOCA 5FDLA 4N5SA 4AQYJ 4CT9A 1F2GA 3IWLA 3M6XA 2DY1A 2DHSA 1RWWB 1VQ6S 1X4BA 1VQKS 4OV1A 3W66A 1LWEB 3GJRB 1VC0A 3CXCR 2EW9A 3HZEA 4ZPBA 2W9CA 2EEYA 5CABA 2YH0A 3FRYA 2QEXS 1HHSA 5KFJA 2DHGA 4RL1A 4C6AA 4ZP6A 2GZOA 1QTNB 3D4JA 2OTLS 4G3IA 4DPUA 4KAIA 4FS1A 4DFMA 1NKCA 4YEAA 5A76A 2DGWA 4ZS6A 1UEUA 1Q86T 4J9QA 4G1PA 5F8GA 3WHIA 4OJ1A 2Z30B 4DPXA 3A1YG 4YS2A 3LP1B 4F2RA 4JBCA 4K4VA 3K5MA 3N4WA 2KG1A 3D54A 4XPEA 1SJ3P 5A8WB 1M5PC 3ZC4A 1JB0C 3KLHB 4UOFA 4FYDA 4QYZJ 3K8WA 3BYRA 1XR7A 1OPIA 3I5AA 4KKOA 4TN2A 1UEKA 1B7YB 2LA6A 5L1LA 2ZKUA 1ZPWX 5HVHA 4Q0BA 3OQ2A 3UD3P 2DGVA 1AROP 1ZZNA 2E9RX 1QSLA 4OJGA 2KDOA 4HACB 4FPIA 3FBCA 3GFXA 1NHVA 3TYTA 5KFUA 3EPIA 4A8OA 2MQLA 3NCRA 2VU5A 2ZZTA 1X5OA 1HWKA 1D9FA 3LTOA 3I0SA 3EJMA 4LR8A 4EGLA 4PR6A 1I5OB 1BLUA 2ZBRA 3KLGB 4MMOA 4DR6J 4OZ5A 1VJWA 1G6BA 2M88A 3MM9B 2Q3PA 1TKDA 1S76D 1VCTA 1HHTP 5AXLA 2GV1A 4HVZA 4DX8H 1UTAA 4AYBD 3KKFA 3HX9A 4EO6A 1DJ0A 2E9TA 3P8BB 3G4SS 2B51A 3E51A 2W01A 3DDKA 2GQ2A 1JLBB 2CNKB 4PG5A 3RBEA 3NS5A 4EBCA 1RQ0A 4NLXA 5AXNA 1WEXA 2D74B 3HHDA 1BWEA 4QIEA 2FIUA 2CA9A 2EFPA 1UKUA 2JFKA 5KT7A 1F9EB 2F3JA 5GMEA 3SSRA 4CM2A 4XO0A 2Q6CA 5SZTA 2AT1B 4YB6A 3N6MA 2R7WA 5ETSA 2K1RA 1JLAA 4X64F 2WONA 5H9FK 3GFZA 3M32B 6FD1A 3MMCA 3BSAA 3OTOJ 2VODA 4PPZA 3DLHA 1NDCA 3QO9B 2CQDA 2R3VA 3QYYA 2EG2A 1J5OB 3I4PA 9RUBA 4WTOB 3NMAA 1V9OA 3EM1A 1VBXA 2MEWA 3H5UA 2BKNA 2HHPA 2HBRB 2XMVA 1WC5A 2Y8YA 2K7JA 4CT8A 3PY8A 3SDEA 3OV7A 1RA6A 2K2PA 3MEGB 3PW0A 3KHHA 3F73A 1CBKA 3HHNB 5KT6A 2YNGA 2W7OA 2CPYA 5KFSA 1RBOB 4USKA 1LKZA 2AV5A 4DV2J 3NGDA 3B82A 1HW9A 1W26A 4RW8B 2BQUA 2E7WA 4AT1B 3D2WA 1GXTA 3UVJB 4J7CA 3D3BJ 2OPRA 5MLCV 4IFVA 1D3WA 4YHHF 1PSDA 3UD5A 4ZCKA 4TNOA 3Q8QB 2RUSA 2HQFA 4FZVA 3Q8PB 1JLGB 4DHVA 1S9FA 1URRA 1FDBA 4UOCA 4K0KF 2EI5A 2ZE2B 2Z57B 1TP7A 3K89A 1C0TA 4B17A 3D9BA 1IWAA 3TQ1A 5F3TA 3LGNA 1LFWA 2EFQA 1TKTA 3TUPA 2QLXA 4WKYA 4CO3A 4X4SA 2NYHA 2R7VA 2X1BA 2JRSA 1OPZA 1WUUA 3J7YU 4X62J 4XPCA 2EG1A 4DQSA 3MECB 5KFLA 4LUBA 3CJTA 2WHOA 5CCLA 3M9NB 2Q66A 1HQEA 3EYZA 2A6MA 3DLBA 3TVZA 3TAQA 4MKBA 2B0GA 2OELA 4YN3B 4DXLA 2CQPA 4MK7A 2HGNA 3M2UB 5AE3A 3KJNB 4DU7A 1M1HA 3H5YA 1NJXA 3FRZA 1P9QC 1D9AA 1RZMA 3PXGa 2BJDA 4Q7AA 1LW0B 3PX4A 3G8QA 1Z2ZA 3W64A 1RT1A 4BWJA 4IH7A 5THWA 2W2QP 4DV5F 2MTLA 3ZTQA 1SJQA 4PABA 2ZH2A 3S1TA 5HO4A 2GVZB 1NK0A 2IYIA 3VGVA 3PRBA 4DSFA 4OX8A 3UDVA 3MCNA 2HNDA 3DLEB 4NOHA 3OL8A 3MPYA 2GAGC 4NASA 2MSTA 4KB7A 3KUHA 1R3NA 3VZIA 2FJWA 5HVGA 3C15B 4A4JA 5K8NA 2HS0A 4FS2A 3PR5B 5DLFA 4DL4A 2EKNA 5KFKA 2UXCF 1RTDB 1HNXJ 3IM9A 4NLSA 3Q8SB 2QRRA 4C98A 4I0WA 3QLHB 4NMLA 4TU7A 2DEJA 3JAMU 4UOGA 1YK9A 5ETVA 2YNIB 1T9UA 1YRUA 2VQFJ 3M2VB 1FE0A 3MR6A 1RKIA 3PIPQ 1T3NA 3CULA 5A2QU 2BKPA 1LW2B 3KJVA 1D09B 4X4OA 5B0DA 4P2FA 1EP4A 4QYZK 4ERDA 1FX4A 3IFEA 4N77A 2OMOA 1YSJA 4JI8F 1LWCB 3ENVA 1BQMA 4N8OA 3VWSA 5K5MA 1SB6A 2NR0A 2XTJP 4V1Ak 1G7CB 3DI6B 5K14B 8RUCA 3CJRA 2DNLA 1G1XA 3FBEA 4NLPA 2LEBA 3CCRS 2KXFA 2VA3A 3HVTB 2YH1A 4X66J 1U1LA 1K1SA 3O3LA 4DFKA 2GC8A 4JYAJ 3LP0A 2R8KA 1MMLA 1B0PA 4G65A 3W5ZA 3RB6A 1EIYB 2E29A 2GGPA 2O67A 3GV5B 3HHEA 5CD4H 3MXHP 4NMXA 3RG6A 3EGVA 2A6OA 3W8PA 2XY6A 2DNOA 3PX0A 1VIOA 1KEKA 2R7SA 1U1KA 1IBLJ 1OSDA 2FDNA 1UVIA 1NPRA 2P2CB 4C48A 5HP1A 2C28A 4ID8A 3OSPA 4ZP9A 3C6UA 1RWNB 2GMJA 2CNNB 2IBOA 3PYFA 5F9NA 3K59A 2WK4A 4KGXB 4HH0A 5J2QB 1GNKA 3NWGA 2MHEA 4CNZA 4EWTA 1RAEB 2C3MA 1X8DA 2UUCJ 2FJBB 1Y11A 3R5GA 1S9GA 1KS2A 3GB0A 3MDFA 3TP2A 2OD4A 2DNYA 4BC9A 4I2QB 3MM5A 2CWKA 1U0HB 1NDPA 2L9NA 4ILRA 4ZPCA 2H51B 4A8FA 2K8GA 4F0HA 2FC9A 2B7CB 3NXZA 4CP5A 1S1WA 4CLUA 3CW2C 2WVEA 2OEKA 3BZQA 1UVNA 3KUEA 1N0UA 1U6ZA 4IH5A 2R7OA 4K7QA 1RABB 1FVQA 2LCWA 4KSEB 4CTAB 3FQKA 1PC5A 2X1FA 1RYSA 2FB0A 4M5IA 3KJFB 4Y2KA 1PGZA 5DQGA 1EAYC 4XTTA 4DJBA 3QIPB 1LXJA 2VICA 2YWHA 1S99A 1FXLA 2O5DA 3CCWA 1IBMF 5D78A 4DG1A 1TAQA 2J5AA 2QLFB 1WOPA 1HBNA 2AEMA 1PAEX 1Q8IA 1ROFA 4ZVOB 2RS8A 3PACA 2IY5B 5CYQB 1K9MT 3CO9A 5C24B 1X4FA 2B4OA 2ZZMA 1KLMB 3POTA 3T1YJ 4WPAA 4YMEA 1WDTA 1GMVA 1EB0A 3OR2A 3PTWA 3GJTB 5ETNA 4FYWB 3MAHA 5LJ5Y 1SQFA 3Q83A 3BQ2A 4F02A 3ET6A 2QLWA 1GQEA 4M63A 3M8QB 3OR1B 4WXWA 1RLDA 2MLXA 3KFWX 1S48A 1VQLS 2RT3A 2BV3A 1Q16B 3NEKA 3MZIA 2LDIA 2LDYA 1S4FA 3RU0A 3MEDB 4ZMMA 3DOLB 2BANB 2HMIA 4C8YA 2OSQA 4NE9C 4YB5A 2ATLA 3M9MB 1S6PB 5DRKA 1S72S 1RHKB 2DHAA 4IRKA 3VAGA 1ZAVA 4IDKB 2HHQA 4F3MA 1GMWD 3AXMA 3R7NB 2BM1A 2FLOA 4B3OA 1PJ7A 4USMA 5HBMA 2ABYA 1FNMA 1YKWA 1YVFA 3UFCX 2DR7A 2Q43A 4ANEA 2XI2A 1X60A 1UJ6A 3PKYA 4F8RA 5C25A 5DGBA 2PT0A 1RWKB 3IG1A 2GHVC 3T9NA 3MOZA 2HFNA 4J5OA 4ZA1A 3BSOA 4X84A 5AE2A 4C8ZA 4ED2A 3BKFA 3OJUA 2E5LJ 3EICA 2DIVA 2F8EX 2V8PA 4KHMA 1XIQA 4USHA 4GO7X 1FDAA 4JV5F 4A8YA 4ENOA 4Z7CA 2DO4A 3GCWP 4HHHA 3VAIA 1GX6A 4FN5A 2DH7A 1N48A 3R2CJ 3QMQA 2BE2B 3KHGA 2AJ4A 4JI4F 3CD5A 4IRDA 2NS1B 2KT2A 1OO0B 3OL9A 5M2UA 3I4HX 2HFVA 1T03B 5KFEA 5LXRA 4QU6A 2VQEJ 4LSNA 2OGUA 2RE1A 1KNZA 2CUYA 3G87A 5D0EA 4RU9A 1IKXB 4I7FB 4Y00A 3I56S 3IAS9 4DR7J 2RUGA 3DRRB 1UETA 3N0VA 2DH9A 1FKOB 4DV6F 4OX9F 2FZCB 3IRWP 3LWLA 3AFGA 5KFIA 2FJVA 2ZH6A 4Y6IA 4OYIA 5DG7A 1JKHA 1B70B 1FXDA 3F56A 4HDHA 1Q7LB 5K9FA 2ZH3A 3T1AA 5ETTA 3OL7A 4OYPA 2LQJA 4O3NA 4CLPA 2PI4A 2RHQB 1CG2A 4OHZA 2R8GA 2QMUB 5J1EA 2LQBA 2QMWA 4RUAA 1MMDA 1IKYA 1DY3A 2Y0SD 4HTJA 2RS2A 3D66A 3KYLA 1R0AA 2FC8A 3UR3C 2JOQA 1RT6B 2HK3A 4K4ZA 3KMSA 1HNIA 1FFGB 1RU1A 3RAMA 2OHDA 3FSYA 4CZCA 5AJ3F 5AXMA 1RKJA 3TZWA 2B9XA 1WG5A 1S1XA 5EGYA 5KFWA 4B02A 4EEYA 4ALZA 3EE3A 2OFGX 1DARA 4ZITA 2X7IA 3VVTA 3HP6A 1UZHA 4PYDA 4LRCA 2HHUA 5KG7A 2JX2A 2HHHJ 1CJUB 4F3QA 2FGCA 1WF1A 1UVLA 3K5NA 5E7OB 4LF5J 4OI1A 4JI3F 1A6LA 1R31A 1XMQF 2HGLA 8ATCB 2I0XA 2Z2LA 2AX0A 4PG8A 2CNLB 2XGPA 2MQOA 2G0CA 3K5LA 1N36J 1UL3A 3ETOA 3M30B 2GJ2A 2V67A 4EU0A 1B99A 3QWUA 2ACMA 1NK7A 1DLOB 5E0OA 3DXBA 2LMIA 4LMZA 3RUBL 1Q53A 5H9EJ 2BACA 4DV0F 2X3GA 4AFFA 2AJ2A 2E5HA 4MH8A 2KH9A 5LT5A 2CVIA 1M5OC 1AA1B 5U47A 2ZH4A 2X51A 4DR3J 3IS9B 3AJDA 5HK4A 2ZBQA 4I6YA 4IH6A 2DK2A 3HVWA 2KRBA 4PYAA 1NJYA 5CAAA 4UUWA 1BGXT 4RBTA 2BRLA 3KLHA 3KNAA 2HWTA 2D3ZA 2V4RA 1JLFB 4LT6A 2GIQA 4P9SA 4ZVUB 2R7XA 2R2SA 3BR9A 2OEMA 3QZ7A 5BR8J 3V6HA 2Z0GA 2YWGA 4DR2F 1RHQB 3BREA 4FXDA 4M94A 2W7AA 4G6VB 4X4RA 4ES3A 2W1BA 2GAHC 4OYMA 2C2OB 4HACA 2ZVIA 5FD1A 2UVWA 3IC1A 3UQSA 1R6VA 3ZNUA 1QE1B 4GO5X 1DBDA 3AAWB 4M95A 5ETRA 1WNEA 2XMWA 3DOKB 4V19X 1GTHA 3IR5B 1RDRA 1HLWA 1CULB 3KLGA 1U6FA 4HL9A 5JXSA 4DWIA 4ECVA 1DQ9A 2VFUA 4NEYA 3CMQA 2M7SA 4AL7A 1BD6A 3HJFA 3ITHB 4QBUA 4UQTA 1X4EA 3CC7S 2P5VA 3W7BA 1O51A 3MPVA 4ID5A 1JLBA 1VQ5S 2VV5A 4RW4B 5GAEI 2WZ1A 1NK6A 4KHPF 1F9FA 1S9EB 1NSKL 1S5ZA 4RBUA 2JVOA 2BJ7A 2B3TB 5AXKA 1JQGA 3CCLS 3J7YI 4H4KA 3GJSB 2OFHX 2BM0A 3GIIA 4N41A 3GYXB 4C0HA 2AYEA 2IRXA 2DKOB 3GSDA 4LIRA 3DLKB 2UXBJ 2MQPA 1Y9OA 3JSMB 4WZMA 1NB2A 4TYAA 3QO9A 2YQ3A 2FTRA 4K4WA 1J5OA 2CDRB 4UY85 1M1KT 1Q0NA 5DETA 1C1BB 1K73T 3GYNA 3V4IB 4I6AA 2HVDA 2JDJA 3IA0A 2CADA 1QUPA 1T9TA 2RQMA 4OHWA 4DV1F 3MEGA 2XLJA 2F4VF 3TARA 4Q43A 1Y3KA 3I5BA 2GCFA 1LWFA 2XSJB 1RTHB 3PR4A 3GE9A 1L3SA 3D1OA 4RW8A 2UUAJ 1TK8A 4LF1A 4RWWA 1U1MA 4PUOB 2UXDF 4J9NA 2YKNB 1O8BA 1KRPA 3UE2A 4CO0A 4MYUA 5GAHI 1RB0A 2ZE2A 4PPDA 3D0GE 2ZC3A 1MSWD 1HR0F 1D8YA 4Z37A 1Y5IB 1FJEB 2UVUA 1PAUB 4JI7F 3EGWB 1HNVB 3D5MA 3BM7A 1VGYA 5G4DA 1B64A 4USIA 2D41A 2C3OA 3OXLA 4DS4A 3MECA 2CPZA 4FVMA 4OZ3A 3H42A 1C0UB 4K2XA 1J27A 1HNZJ 2BOAA 2G13A 1XK8A 4OHYA 2DTJA 4HH1A 1UCNA 1AUDA 4Q5VA 2MHNA 5FLXY 3TX0A 1FFSB 3M2UA 4WYWA 4RO0A 3I32A 1H74A 1I1GA 2ASDA 3KTQA 3R1HA 2GIRA 4ZPAA 3ZFVA 3SV4A 1T95A 2Z2MA 5E33A 4LF4J 1T0TV 2OO4A 2XMUA 2PFFB 2J7UA 3LAKA 3H5XA 1HL6A 2C3UA 1FNXH 1LW0A 5DM6Q 3JTOA 4RW7A 4RNFA 4ECYA 2F9JA 1RAOA 2GVDB 1DQ8A 2GJIA 5FJ4A 3I31A 5CZVA 2VF3A 2GVZA 4M5DA 1WKKA 3G71S 1M90T 4ER8A 2WBMA 4KT0C 3DRXA 4TY8B 2KJVA 1RT3A 5IM0B 3DLEA 3DLLQ 3W9IA 2N4DA 4ZJOA 5H9EK 3N9UC 1C1CB 3G8TA 1T9XA 3C6TB 1TFWA 2R7QA 3CCMS 5BYSA 3C15A 2G2YA 2G0IA 4M5NA 3A8IA 2W25A 3FMWA 5LM7E 5MAOA 2N4CA 4LSZB 2MKKA 3R2DJ 1HBMB 3T41A 1GMWA 1HARA 2XM3A 2HHHF 2H9ZA 2NXNA 3QLHA 4ED3A 5IT4A 2QJ3A 2HHTA 3CCQS 4KBIA 2YNIA 3TEHB 3OLBA 3M2VA 3HT0A 5L1IA 4K2JA 1GTEA 2CJQA 3J7ZT 2BA9A 1VR6A 2AF6A 1HYSB 3KHRA 3CDAA 3FDSA 1TL5A 2Y8WA 5K8MA 1SJRA 1LK7A 4DQPA 2BZ2A 2EK1A 4KIAA 3ZZUA 4OZNA 3DI6A 2IM0A 1VQOS 4IQXA 4ED7A 3MMJA 2XMKA 5IV3A 4ZJQA 3H0PA 3HVTA 4JI0J 3W2VB 2BABA 3U1NA 1LFPA 1XEZA 2XWYA 3SCIE 4BHQA 1HQUB 2OH2A 4F2SA 4V19J 5HROA 3R5BA 2LLZA 3IRXB 2CPJA 3DDIA 1OWXA 3HFKA 2ZWOA 2YPYA 4B9LA 3UN2A 5LL6d 2KZZA 3FEZA 3AHPA 2LECA 1XERA 4JI5J 3VGSA 4RBVA 2VKRA 3SQGA 2KVQE 5I3UA 5EWFA 4C8MA 2FVRA 3V2UC 3PJ9A 1S97A 4K5RA 2FZKB 2BXJA 4K8RA 3MPDA 2H5JB 1DRZA 3PO5A 2FVPA 4H4KC 4NYPA 4ZLNA 5J2QA 1PYOB 3M2RB 3JTPA 4Y2CA 1SUQB 1OQ6A 3KK1A 4HR2A 2G2OA 2D69A 4FNHA 3OFGA 2VC1A 4K4XA 3BKUA 5E5NA 1U24A 3QT6A 3D1HA 2R4FA 1QAJA 2OPPB 2IM1A 2AEJA 4WXOA 5KFTA 3BO4A 3ILJA 4I2QA 3KUGA 3N79A 2RKIB 1K0TA 4ELUA 2FVSA 4O4GB 3EZUA 4JB8B 4D3HA 2CZ4A 2IAJB 3OFEA 4O3RA 4AL6A 2CQ3A 4KV8B 4ECTA 2EPIA 1HQ2A 3PIOQ 2ADCA 1RAAB 2EFGA 2NSBA 3LAMA 1ZZFA 3MAQA 4DZDA 1BXNA 3DC2A 1EQMA 4MFBB 1U02A 1VQYA 2B5JB 1FTCA 3FFIB 2GHWA 1HWLA 3L7PA 4CTAA 1N34J 1X4DA 2ALYB 2XLIA 4KPCA 3MCSA 2OPQB 4DR1F 3MR2A 2V50A 3LQVA 3MD1A 5HJYA 1A0OB 3UD4P 2FJXA 3UCZP 4DEZA 3I96A 5DG8A 3FKBA 3I0RB 4RJVA 2X1AA 4IOAQ 4EK2A 4LFBF 5IT0A 4WU2A 3I87A 4X4UA 1WELA 1NU4A 4JUZA 2DNRA 2ZJPQ 1IWGA 3KK3B 4XDDA 3MM7B 2EFVA 3DYAB 1DFDA 4JV1A 1YJRA 2XHWA 5D0GA 5CYQA 1UVMA 3J81Y 1RWPB 3JSYA 1UA0A 4ED4A 4DZ6A 2QA4S 1KLMA 1WOOA 2V9KA 4HI2A 2LP4A 4R0EA 4XAKA 3S01A 1CVJA 2V8VA 3PNIA 1N5VA 2AYMA 1AW0A 2MQQA 3E2EA 2IFXA 1GK8A 4YY3J 2VG5B 3K8VA 2GQQA 4X2BA 5CZXA 4C11A 2O1PA 2B9YA 3OFFA 4DPWA 4LQ9A 4OYBA 3ENQA 2YWKA 1YJVA 3VVUA 3ISNC 1H3DA 5T41A 2KRRA 2L41A 3JYTA 3NWRA 2WOMA 2ZWPA 4X65J 4PXDA 3MEDA 2F8HA 3FNNA 2BANA 3RW6A 4UT4A 5IS2A 1IJFB 1S6PA 2N7CA 4P52A 5DS7A 2BW2A 4PWWA 1LK5A 2UU9F 1VRTB 3Q24A 4CLKA 3OD2A 1JJ4A 2J9EA 5IWAF 5J2MB 3OHBA 4K59A 2BJEA 2B8PA 3WX4A 3H4DA 2V4JB 2LEPA 3UNGC 3MUTP 4YR2A 1NEEA 4PG7A 3ILOA 3M6VA 3C2PA 1VBKA 2HZVA 2JZ5A 1HNZF 3CMES 1QUVA 1J5EF 4DV3F 4B3MF 2KZMA 1PYTA 1RHMB 2HWIA 2I5JB 3DGPB 1SL1A 4KRWA 3TO8A 2WB1D 1XJWB 4HHJA 1S0NA 4YOEA 1K47A 5JUMA 3DNCA 4N7TA 2HIQA 5KTQA 3L9ZA 4N47A 4OJ3A 2V63A 1E6VB 2XI3A 2MKCA 3RRKA 1AZSB 2AQ4A 2WSEC 4B9UA 1U1NA 3VR1A 5HL7Q 2BE2A 1KFSA 3T5KA 3EXCX 4KE5A 2BR0A 1YDLA 1F3VA 3KDNA 3VCDA 1RT4B 2JLEA 3GQCA 1XBWA 1T03A 2P9CA 5KG0A 2IDLA 4OYOA 4Y2AA 4ZVSB 3H40A 3CEDA 3HXMA 2V34A 1IKXA 4I7FA 4WE1A 4CH7A 4KC5A 3QT7A 3DRRA 2DNGA 2GO8A 3THTA 1Q81T 1QAXA 1FKOA 3I9V9 4KO0B 1BMQB 1WHYA 4OX7A 2M8HA 2IA6A 4LRBA 1OSCA 2OP5A 3IO1A 4O0IA 4KY3A 5J2PB 1VDHA 1U1QA 2LVWA 5D4LA 2W2OP 2DHXA 1Q8LA 4U8YA 3SSQA 3DM2B 3P45B 3DLGB 2QLJB 1AB8A 5IT9U 3ICLA 1L5UA 1P27B 2MYFA 3W8GA 2YKOA 3W60A 2DVIA 2BKOA 3M8SA 2PN6A 3EXYA 2VFVA 3BGLA 4UZCA 2NSCA 1RT6A 4C9DA 3OUYA 2E1RA 3J80Y 1RHUB 1R8AA 2IPOB 1RAFB 4USWA 1VC6A 1U47A 1CQNA 3A13A 1UFKA 4FPRA 3M1VB 1MWQA 4DV7F 2R9LA 2IC3B 2IM3A 3MURP 1UWBB 4J9LA 4ICLB 1SC1B 3UO0A 1JJCB 4NRTA 2B6AB 5KFHA 2P8IA 5K8OA 4MKYA 1WSVA 4DR5F 1CJUA 3IGVA 3KLIB 4U67Q 3RRGA 1H38A 5HI7A 1OMSA 2ZOGA 3HD1A 3IXQA 2RDJA 1R7IA 4DFPA 5KFDA 2EFOA 1I6JA 2HIYA 3CCZA 1WG1A 2HQGA 3RRHA 4I68A 3DN9A 3CTRA 1GT8A 3P3DA 3GIKA 1LNQA 5DM7Q 3KLVA 1S0MA 1DLOA 1QTMA 3NGUA 4Q8EA 2IJNA 3SFGA 4OJHA 3P5TL 2OD6A 2DCUB 2DGQA 1B4SA 4USTA 4DPTA 1YG0A 1SL0A 4DUYF 4OX6A 4NZ7A 3HD2A 2D1CA 1LEOA 2NUHA 1WOSA 3ZTOA 2PMWA 2HFZA 1HWJA 1R0BG 4ED6A 4X64J 4NEZA 3DHXA 3VAMA 1FD2A 3MPUB 4I56A 5DDOC 4Y34A 2JNJA 5HQLA 2E44A 3JAMY 4C4WA 1JJ2R 2Q79A 4B9VA 1JLFA 5H1SV 3FGVA 3MR3A 2DY9A 3RAXA 2DITA 5G0RA 2K3KA 4A8QA 2WRMA 4QPXA 3G8SA 4ECSA 1FRMA 3M8WA 4EYIB 4P6QA 2BYCA 4PQUB 4J91A 5LJ3Y 1QVGR 4CIOA 2VJVA 3TZXA 3NG8A 1QE1A 3MCMA 4M8LA 5EUHA 2QL9B 2AP6A 3DOKA 4R25A 2V4QA 2FVCA 4N76A 4YHHJ 4ECRA 1CULA 1TR0A 3L3CA 4OZ2A 2NZ4A 3FQLA 3BPDA 4QIVA 3DRSB 4B9SA 2HEKA 4K0KJ 1TV6B 3M8PB 3OBIA 4CQ1A 2P6TA 2CZ9A 4NCGB 4KFBB 7FD1A 3ITHA 4C3MA 3W2WB 3GG0A 2QZ8A 3CWJA 1S59A 2ZUGA 3OLAA 1D0EA 3BKTA 4C2MA 4DN9A 1FWKA 1QAYA 1JX4A 3MHYA 4RW4A 2EC0A 3PFOA 1BY9A 4AE5A 4YFUA 3SI8A 1S9EA 4YB7A 3LO3A 5KFMA 2AMCB 3D0IE 1VQMS 4JI2F 4LFCF 1JIHA 2VFRA 4QIFA 3LGHA 1IBKF 4F0MA 4F50A 1LXNA 1OY8A 3OJSA 4OI4A 4DF8A 2V2VA 4QOTA 4L75A 2H5EA 5E2QA 1OYDA 3I82A 3AOBA 4QW9A 1RP5A 3QFWA 1RT7B 3PW2A 4MKAA 2VG7B 1C1BA 1YJTA 3HHLB 4CO1A 5F8LA 1C2PA 2P9GA 3V4IA 1SQGA 2ASJA 1MN7A 3HVRA 4GVBA 4DV5J 5KG1A 1EARA 3PW4A 2J0QD 2YX4A 1NK4A 1ZTWA 1OYEA 2FHJD 2BBEA 3US5A 1WHXA 2CXEA 1A9NB 5IC6B 1YJWS 4CWBA 2KT3A 3OHAA 1KVJA 2XSJA 1RTHA 1MROB 2GMHA 1SI9A 3AB2B 1CC7A 4RLEA 2RHSB 3CIZA 3R7BB 4PUOA 2YKNA 4GRSA 2Z8QA 3P4UB 3ETMA 2VFTA 4OYXA 4DL0C 5I42B 2HHSA 1JXLA 3MFHA 1FJGF 2UXCJ 4PAAA 3QQCD 4OLOA 3BBBA 4FXVA 3RJMB 3GIMA 3W9HA 3CCVS 1KVIA 3SCKE 4P72A 1T7PA 4IUFA 1HNVA 2E7XA 4MKVA 3OW2R 3RB0A 3BH7B 3KK2A 1N54B 5DZ7A 4HKQA 2FY8A 4Q2LA 1KQGB 2UZAA 1C0UA 4JI8J 3OTBA 3SIPB 4NLQA 1RCXB 1H2UX 1YITS 4Q0BB 2EXUA 4J9KA 3LP2B 2D9OA 4LBIA 3V4MA 1PYSB 4IFYA 1PC4A 2RF2A 3PHTA 4CLZA 5KOXA 1RT5B 5LMNF 1ICEB 3AY0A 3CDEA 3CJ3A 1T05B 2ZUAA 2WAQD 4CDIA 5F8HA 4DV4F 4HTIA 2F40A 2FJDB 2PE8A 2MZSA 1T9VA 5LSLA 2W4CA 2HS4A 2GVDA 3CCSS 1KD1T 4ZHRB 1CJKB 1RWUA 1HNWF 1KQSR 2D3UA 3KWMA 4MIAA 1L3KA 2F7VA 1R43A 4CO4A 2PA3A 1JXVA 4TY8A 2F1FA 2UUTA 3KLEA 2RDIA 3TJ9A 3E01B 1EKSA 4LJMA 3AD8C 4R8UA 5IM0A 1WC3A 3R9LA 4QYRA 2RH3A 4ZVRB 2MKSA 4WFXA 5KOWA 2DO0A 4Y28C 2YNHB 1N5YB 1WC6A 3C6TA 2G4BA 3VQSA 1TUWA 3LUYA 1ZYQA 1PJ6A 4HT5A 2DXFA 3OXGA 4L73A 4Y0FA 2VJUA 4M5JA 3K17A 4UZBA 2JLGA 1I94F 3M9OB 1T9WA 3H5SA 2MKJA 1HBMA 3PDNA 3O8WA 2CQGA 2A10A 2DD8S 2M52A 2ZH7A 4DCPB 2WBRA 3AA8A 2F5GA 1X9WA 3SEOA 2HZCA 2K7KA 4FKYA 4MT1A 3I9ZA 1FCAA 2HW3A 1BWVA 1HYSA 2FLPA 1D8ZA 2U2FA 4LF9F 5CA5A 3B4DA 1T11A 3R5DA 3RBZA 5JMNA 1TU0B 2HLTA 2XS7A 2HBZB 5AE1A 3TX8A 3R5JB 4FDFA 3VGUA 2NZCA 4S0MA 2IMOA 3SYZA 3NAHA 3HFVA 1S4EA 2J9DA 3MR5A 1JNZB 1NMEB 6AT1B 1HQUA 3WZ0A 3AOAA 3HO1A 4H4MA 2HVHA 1NXIA 3GPAA 4OZJA 3GV8B 3QAUA 1IVZA 1UW4A 3L95X 5LSOA 4CH0S 5T7LB 1IBMJ 5J1NA 1C0TB 4CLWA 3NP5A 1XNRF 1X4CA 3DLJA 2ALZA 1TKTB 3R5AA 3D7SB 1NJWA 2UUBF 2JWNA 3NOCA 1XTZA 4XIUA 2MJNA 1APSA 2F65A 5CCMA 4DX6A 1RAGB 3M2RA 4PQAA 3HHLD 4OV6A 3DU6A 1HFEL 1SUQA 1HQEB 1NKBA 2FVQA 3SMZA 2ROPA 4CNYA 1F2HA 3OTDA 1R8CA 2B7BB 4RNNA 1SCJB 2GHPA 4IG3A 2KXHA 1X4GA 3N6NA 4HI1A 4ILLA 1ULRA 2ZC4A 2WW8A 3MTJA 1TUVA 2LU1A 3U1MA 2QIFA 2RKIA 3GFHA 5IV4A 1VFJA 2VZ9A 4O4GA 2DNKA 3VQTA 5B0GA 4BWMA 2IMWP 3TI0A 2IAJA 2YKMA 1S1TB 4WFAQ 5EHHA 1MLAA 5GAEU 1ZM9A 1VHIA 3D6TB 1WF0A 1ZS6A 1NAQA 4P74A 3MMAB 2HVEA 2AWZA 2ERRA 4B3RF 1WACA 2OLWA 3N5FA 2XO7A 4DF4A 3O1LA 3FFIA 4OI3A 4EYHB 4USJC 1Q8KA 3U02A 3TZYA 2OPQA 5A8KB 1MMNA 1VLOA 2D9PA 2KHDA 4L76A 3NGRA 2QFJA 1SJFA 4P71A 1Z1ZA 2ZM6F 1FJ7A 3I0RA 3LOUA 3VALA 1X0PA 4NL5A 2CJAA 1TQLA 3JXOA 3ZZRA 1TUGB 4JV5J 1KVKA 3DGVA 3Q2SC 5HMYA 1K8AT 3Q8RB 2O01C 3KK3A 1HI0P 4JOUA 4HYKA 3DYAA 4LF6F 5C5JA 4M5KA 2KKHA 4QWCA 3KJVB 4LQ3A 1EP4B 4JI4J 1O0PA 4ANCA 2IRUA 4C8OA 4WTYA 1OS5A 1WEZA 1GAOA 2H5IB 5KFPA 5GAHU 3T5JA 5CQGA 1SQEA 2VG5A 2VPWB 2RQCA 1S1VB 2DGXA 2LQ9A 3MOJB 5I4MA 4DV6J 1KOHA 4TYBA 3LANA 4OX9J 4O3QA 2J8AA 3S8SA 3CGIA 4UW2A 4TQRA 4WYLA 3L7OA 1V5IB 2CWXA 4LBPA 2ZH8A 1GMUA 3R8YA 2XNQA 1WF2A 4F4KA 3SFUA 4LF7F 3J7Z5 3CJQA 5HMXA 1SC6A 1VRTA 2DPJA 4W98A 3MD3A 3HMJG 1Q1KA 3JQMA 2EWHA 5J2MA 4NLWA 3C6UB 4ECWA 1REVB 2V4JA 3DOMB 1Z2LA 4WP8A 4KH1B 1O6XA 1BE4A 2XZTB 2M9KA 2CQ4A 3DGPA 4J9RA 3Q22A 5AJ3J 3BGOP 2I9SA 2Z2YB 1S1UB 3AD9C 3UR0A 3V6DA 3E8OA 5HQMA 4C97A 1WG4A 3B4MA 2WSFC 1GX5A 3GZ7A 5ETMA 2RNEA 3HPOA 2VIHA 4KTQA 2X3DA 5AT1B 1E6VA 1VOMA 2IYGA 4M5HA 4KGVB 1AZSA 2Q1LA 3PO4A 3M6WA 4JI3J 3ILLA 2MLZA 1XMQJ 2C2RA 1HA1A 1TMMA 1U6BA 4C8NA 2R2RA 3NGSA 2Y1LB 4KGMA 4BC7A 4O3PA 4ELTA 1SJ1A 1GEHA 1JLEA 2BE7D 4K4UA 3OPKA 2KL8A 1QJHA 2PD1A 2MZQA 1UFLA 4OZ0A 4GC7A 1FRKA 2H48B 4DFJA 3KJQB 4P2SA 2XULA 3R6GB 2I8EA 3ZZ0A 1LQ9A 3ELHA 1Q4RA 5E41A 3BSNA 3CCTA 3K58A 4YUDA 5L9XA 4KO0A 3GFYA 2W24A 5IFMA 4DV0J 2VL1A 3PYEA 1BUXA 1SKSA 1HI1A 2DR9A 4E0DA 4MAKA 2DGTA 2QE5A 2C3YA 1CJVB 5J2PA 4ED1A 4LRDA 2B9EA 2YKAA 1X31C 3DM2A 3DLGA 2JJ4D 2FHJA 4DG1B 2Y1IA 2IIHA 2W9AA 2PI5A 2RIJA 3GJQB 1F0XA 1O5JA 2GNKA 3D68A 2O66A 4DDFA 2FHOB 3MUMP 1K1QA 1W2BR 5M2PA 4ILMA 1MNEA 4QR2A 2YX1A 7FDRA 2AGOA 2VPXB 4GMKA 5FLXU 3BS9A 4DR2J 4JI1F 1P1TA 3M1VA 3DFEA 2ASLA 2WVDA 2IC3A 3W5XA 1UWBA 4OYWA 1YWXA 1YQHA 4ICLA 1P6TA 2C22A 2ZBIA 3BDPA 1HIYA 2J0WA 2E7VA 3HF5A 4U7UK 3ET6B 4B3SF 1KP6A 4ZN1A 2HFOA 2FHKA 4ETZA 2F8MA 3DHWC 4GKKJ 2GFFA 2L9WA 2RRNA 3KLIA 1RSCA 5C42B 3RAQA 3TJAA 4ECXA 2CQCA 1RU2A 1UJ4A 4L3NA 3IM8A 3GYGA 1NK5A 3NOGA 3M8ZA 1Z4UA 2LXIA 2I1RA 3E3XA 3KNGA 1XMOF 4F04B 3J7A1 1F1BB 3CCJS 2XY5A 2KFZA 3BN7A 1NDKA 3W65A 3QZ8A 3EDQB 2W9BB 1VIXA 2DYAA 3I55S 1C4AA 3DCAA 2VDHA 2ZZNA 4KHPJ 3TAMA 2V2ZA 1NDLA 2KN4A 5KFYA 4MK9A 4D3GA 1S12A 3ZXWA 1VBYA 1QM9A 3ISND 4WIQA 3OXFA 3TANA 3KHLA 3WDOA 3OFHA 2COLA 1FTRA 4ZLPA 2XC9A 2DBBA 1JWWA 3P6YC 1AXQA 1D1UA 3G86A 4OMFG 1VBZA 1FXRA 1Y7PA 4MK8A 5HSPA 4F4YA 5HATA 3RZAA 3K5OA 1TL3B 4ANDA 2AGQA 2VOPA 1CS4B 2RU9A 3V81B 3CIMA 3G6ES 4ECQA 4F3OA 1ZBTA 2ZJQQ 1WD6A 8AT1B 1SC3B 2JC1A 1WWHA 1B0VA 3MFIA 4DV1J 4ZPTR 3EZ5A 2F4VJ 3PCOB 5IQ6A 2V5HG 4PQUA 1NNDA 2B56A 3UDCA 3EVOA 1M5SA 2MQMA 4DCOB 3O44A 1FX2A 2RQKA 2N82B 3DDNA 5GADI 4USVA 3TEGA 4TLRA 1N33F 2UXDJ 5F3ZA 2AW0A 2H4YB 2DNNA 2VD3A 1JKHB 3FMBA 4ZVPB 4OLPA 4NXNF 4IRCA 3LPYA 1WDDA 3H98A 1GXUA 2Y1RI 4DSEA 2VA2A 2ZH1A 1RAHB 1TV6A 3M8PA 3RR8A 2UUWA 1T02A 4K4SA 1JNRB 4RUHA 1HR0J 4NCGA 4OHXA 2E9ZA 2RDDA 4UY8T 4JV2A 2WVCA 4JI7J 2FLLA 4A8SA 4FKXA 4DL3A 2E1PA 1NPKA 1F3FA 1KC8T 1X0FA 2QYGA 1UWAA 4KR0B 4PG6A 2ZFHA 4ZVFA 1SXLA 2VOOA 1V3RA 1NSPA 1S1XB 1TKXA 4I69A 4HHUA 1Y10A 3ZTRA 5HAOA 3CC2S 4X4VA 4PWDA 5EX3A 3EPGA 3AJ1A 4KHRA 2HYIB 3GLJA 1CSJA 1RT7A 2A0FB 2FZGB 3FSXA 2E5IA 2JVRA 4U6PA 2M5YA 4B9MA 3UW1A 3HHLA 4DSKA 5E3PA 3AB4B 2EC2A 3KG0A 4NLUA 1EZZB 3PEJA 1B0TA 2ZD1A 1TKZA 4HT7A 3OSNA 1I51B 3GWCA 1URNA 3U1LA 2XWXA 1YJ7A 2YQ1A 2RU3A 1VK8A 4H4OB 1MROA 3QATA 1KBRA 3DMJB 3PFEA 4FBTA 4C0BA 1VLYA 1H2TZ 3BBFA 4A46A 1HWIA 3IWXA 2ZBCA 3QT8A 5I42A 2CG8A 3QFHA 1H72C 4USUA 3TWZA 3X1LB 3AA9A 2QSFA 1AUSL 1N32F 4NLVA 4YB1P 3MAAB 4ZOSA 3ZTSA 1C4CA 3MM8B 3C66A 2XQCA 3WIUA 3JSRA 2CQ0A 1VRUA 2ZHBA 3B6BA 3FEYB 2GW8A 1SV5B 4X4NA 2HURA 1NH7A 2YY3A 2CAJA 2J0SD 5KFQA 1UJ5A 4Y3CA 2JFDA 4PWUA 4E8UA 2ZDOA 4FNIA 2KM8B 1VJQA 2ADBA 3CSKA 3J81U 3M7VA 1XMBA 2LQ5A 4A48A 4PG4A 4TY9A 4AL5A 1FJCA 2AJQA 2N3OA 4ZKAA 1MU2B 3GCXP 4U7UD 2JL9A 5ETKA 1ZM4A 4JI6J 4DOZA 5L1JA 1Q7YT 3P49B 1LWEA 4NI2B 2HK2A 1HBOB 2XS2A 2HRYA 2FY1A 3LP2A 1TK0A 1UFWA 2ACYA 1V5VA 2DNPA 1IR1A 3VAKA 2DNZA 5ETLA 1WKLA 1NH8A 1U09A 1RT5A 3CB4A 2A2DA 3F0NA 2DNQA 1T05A 1DAXA 2HBYB 1CJTB 4DN0A 2XMAA 4TQSA 1NUEA 4KQZA 1TVRB 4J9SA 2AZ3A 3MEEB 2L3MA 4ZHRA 1CJKA 1XNQF 4BDPA 1WORA 2CJKA 3LP1A 4EMDA 1UA1A 5A0YB 1X7VA 3E01A 1BQNB 5A8WA 3BV8A 2OKQA 2ZITA 2XYHB 4ZLLA 2FHMA 2IJRA 2OIHA 4WWSA 4NLOA 1IKVB 2NCKL 4TU9A 4ID5B 3BF4A 1S77D 2E1CA 1FERA 2YNHA 1N5YA 1E6YB 2CQBA 5EWEA 4CI0B 4CYUB 2APOA 2K06A 1Y5NB 3NMRA 3NNCA 3W63A 2HQIA 4J90A 5DDQC 2VG6B 4RR5A 2POKA 1U49A 2VONA 4DX5A 3IBCB 1YBUA 1FWLA 2QO3A 3TRGA 4GKKF 2DPIA 2M70A 4PXEA 1YRXA 3MI7X 3KG4A 1FKAF 2QL7B 3NBPB 3NLCA 1RADB 1RAIB 5I3QA 4IR1A 1IR0A 1VK3A 1WTBA 2KFNA 3BR8A 3VAJA 2W4DA 4M1KA 4PXBA 1Y5LB 4QCLA 1WTFA 2WVFA 3MM9A 2V94A 2DGOA 4RUCA 2GIFA 3MTKA 5B0CA 2YWFA 3HCXA 2MXYA 4FYXB 3FEXB 3HSGA 3IGNA 2V8GA 2HG4A 4F4ZA 3ZZPA 2VPZB 4ZVHA 3FCHA 1LWFB 4K5SA 4ECZA 4P73A 3W3SA 2NREA 2XCPA 4N8NA 3CUNA 3QRRA 3T6BA 4DR1J 2G1DA 3D6HB 3JQKA 2Z4PA 1U45A 4ED0A 5DLGA 4YR3A 4EI2A 2C2KB 1YRTA 1HBUB 4ZPWR 2XSFA 2YPZA 3G6YA 3OVAA 3HSJA 2GA7A 4WK1A 4NXMF 2MMYA 3CVKA 2VKZG 3PYGA 4LFBJ 1S7HA 5T7LA 2JEIA 2AZ1A 4J9OA 4EBDA 3M32A 1NZ8A 1RXOB 4LVNP 5IT9Y 1VISA 1FESA 2ZDPA 5KFGA 3GONA 4BBYA 2HQDA 3T19A 2PFDA 2DHHA 1AYEA 5KFAA 5HN0A 1FHTA 4DUZF 4LSLB 3J80U 2R7UA 3G82B 1M5KC 1X4HA 1MWYA 4B3TF 1ZA1B 1LOUA 2DRDA 5GVQA 4U9RA 3Q2TC 5HANA 4OI0A 1UPPA 3D28A 5DZ6A 1TL1B 3RBDA 3VF0B 4O3OA 3IR7B 1FO1A 1CQMA 3HHLC 5D4PA 2HGMA 3UVJA 3IN5A 3TA0A 3U27A 4RPFA 1RBAA 4MTPA 2KG0A 3L4BC 2DT9A 3QPIA 1W2IA 2IVMA 3A8KA 2QV6A 1FEHA 2CQIA 1S1TA 4RW7B 1JLGA 5BJRA 5LMUF 2J0XA 1S0OA 1TELA 2VC0A 3BSCA 1DHMA 2QX0A 3SSSA 3MMAA 3A3NB 2VPYB 4OZ1A 2UU9J 2BEFA 1VQPS 4M5DB 4NX9A 1LV5A 3B8HA 2FLNA 2DNMA 1RT3B 3R3TA 2QYCA 5IWAJ 1RTIB 1HD1A 4ATNA 5GAGU 2R8HA 3UCUP 1IXKA 1FRJA 1XQIA 2W2MP 2CDQA 2HFUA 2LA4A 5A8KA 3THVA 2SXLA 1J5EJ 4DV3J 3PRDA 4B3MJ 3QT5A 4K4TA 4B9NA 1NO8A 4GKJF 3WIVA 4PKDB 1Q5YA 1F60B 1U1PA 4QIWD 1ZA2B 2AD9A 3TJ8A 1OJ4A 3W5YA 4IOCQ 4KGZB 4WBFA 4RX6A 4BLGA 3A4TA 5KG2A 2KT5A 1EHWA 4M5GA 9ATCB 4HEA9 5KFOA 3A8EA 2NPIA 3CJ4A 5HMWA 2HAIA 4MYTA 2HFSA 2O3DA 4LFAF 2AGPA 3B78A 1H7WA 4QWEA 1FKPB 1KTVA 2EK6A 1VYAA 1M5HA 4RW6B 1NJZA 2J8SA 4Q2MA 1JLQB 3V6KA 2CRLA 4AQYF 1RI7A 4FP9A 2LEAA 2C42A 1ZPVA 3Q8YA 3BH6B 1XC9A 4O4RA 3KDOA 1Y3JA 5L46A 3Q8UA 2V8DA 5KFNA 4WP3A 4ZVGA 2JSXA 1A7GE 5EWGA 1S1VA 4MIWA 1F5BA 1FFWB 1W7WA 3FK4A 4X4QA 3ENWA 3CO0P 1TL4A 2PO4A 2RMLA 4G1IA 2ZHAA 1FK9B 1NHKL 1F6TA 4Q8FA 4OI2A 3O2IA 1N5TA 4LIWA 5HROB 3OT9A 1GXLA 2AJFE 2AHOB 1S6QB 4I64A 4NCBA 1RTDA 3CNQP 1HD0A 5L9NA 2HNYB 3SQGB 3D0HE 5I3UB 1NB7A 2HSEB 2H3EB 2BJ8A 2MKYA 4ZCMA 4CM0A 2QC3A 2MKHA 1KWMA 1LW2A 1NK9A 1REVA 3DOMA 1N6QB 1HW8A 2W7PA 1QSSA 3DKDA 1LWCA 1U4BA 2IBKA 3P5BP 3D3CJ 2VHGA 1JK9B 2KJWA 3KK1B 5HVFA 4JI6F 5K14A 1SH3A 2NXCA 3QAEA 3NL0A 2IVFB 1HHQA 1S1UA 3R5CA 4DV7J 3CJKB 1L3TA 5B0FA 2M4MA 4J37A 1M1GA 1V3SA 4DPYA 1VMBA 2RVJA 1FDNA 3TVYA 3PEHA 4DR5J 1I3OB 1PKUA 4B9TA 1PILA 2DEIA 3BJYA 3V5RA 3TQEA 1Q82T 4DR6F 3ZO7A 3NCPA 5K20B 4Y65A 3KXDA 4DL7A 2YNFB 4P7VA 2WW4A 5KT4A 3KMQA 3KG1A 1NPPA 3LF0A 3UN3A 5B09A 1QAIA 1IM6A 1VQ4S 1DTTB 3HM9A 3CJ5A 4OFZA 3J7AN 4DUYJ 1CJVA 3QGIA 2BJ9A 3EUNA 4OI6A 5CYMB 4UUXA 4J9MA 2MKIA 1H6KX 2QTWA 3KOAA 2QLBB 1QVFR 4IG0B 2L9DA 3AODA 2CJYB 4DQQA 2CKWA 1U0HA 1RT2B 1DTQB 3OTOF 3OVBA 2PGCA 4EUVA 2IA0A 3UPFA 3LGMA 1LWXA 2LXFA 3LA0A 1YJ9S 2R42A 2G1HA 1HWUA 2CFXA 1QD1A 1HPZB 2OPSB 1G2EA 3I5CA 3P96A 1WC1A 1U26A 5GMDA 3RB4A 4C7QA 3TA1A 2KYXA 4M5LA 2FD2A 2PA8D 2FYXA 4I4BA 4IO9Q 1UAWA 4Y2IA 4R0JA 2LQ8A 4DV2F 2BOPA 4KYZA 1QDUB 4WK3A 4C11B 1JMTA 4TLQA 5B0BA 2P6SA 4DMZA 2NXJA 2HVIA 4JP8A 1RJJA 2ZEJA 5ETOA 3W9JA 3NS7B 3QIPA 2C2NA 5C42A 3PM9A 3AJ2A 4RNMA 3JYTB 4DQRA 2WOMB 1GFWB 4JV0A 4IKAA 3JS9A 4ZIVA 2CPXA 1U8SA 1ITPA 2MGZB 3OTEA 1YHQS 1U2RA 3MMBB 2XCAA 3GIJA 3RB3A 2GMLA 4OIXA 1HMVB 2Z56B 4KJIA 4X62F 1NCLA 2V68A 1N56A 5DGAA 4NLGA 4AUKA 5C24A 3KLFB 2QFIA 2DB1A 1SKUB 5D4OA 2W9BA 1SVDA 1H73A 1YGYA 5A8RB 5ETQA 1VC5A 1TL7B 4O44B 3EX7B 4UOHA 2WB4A 1Q95G 3CCES 3VV2B 4K4YA 3QSIA 4RNOA 2FJEB 4ED8A 4DCJB 4JI2J 4LFCJ 1IBKJ 1W25A 4R5PB 5DQHA 2HZAA 2BJ3A 3M8QA 2QN6B 3OR1A 2OJ3A 5L8RC 1V3ZA 4WFYA 4F4WA 4A8KA 4F67A 3IWNC 3I6PA 1TL3A 1IQTA 4I1TA 2DNHA 5IZHA 5L38A 3DOLA 1Q8BA 5F9LA 4ZCIA 3S7RA 1CS4A 3TA2A 5HMZA 3V81A 2V9WA 1XWLA 3HDSA 4WP9A 4IDKA 4DLEA 3PVXA 1RUSA 4DPOA 4Q45A 3OL6A 1CPZA 4WE1B 1RWXB 5F41A 1FI4A 3EVMA 5KFRA 1VQ7S 4PEOA 1WKJA 1KHVA 1FRXA 1VQNS 1IN0A 2CPHA 4J9PA 2VBYA 1UVKA 4ZVEA 2XG8A 5F8MA 3C46A 4E98A 5J2NB 3N6LA 2CZVC 5BYRA 3H7HB 1TZ0A 3CJ0A 2DJWA 2J9CA 1HNXF 3G9CA 2J7KA 1FJGJ 2VH7A 1U8WA 3H2VE 1ZH5A 2L08A 5CHCB 4FF2A 3IMQJ 3K5PA 1RHJB 2BUNA 1WHWA 2ZBPA 4KPYA 2VQFF 3LH2S 4AD6A 2R7TA 2HHWA 2Z58B 1IKWB 1HI8A 2XYPB 3SV3A 4NA2A 2MLYA 1PIEA 2WTFA 3RTVA 2PSZA 2C1EB 2MY7A 2R2TA 5KFVA 4TU8A 2JH3A 4CCHA 2ROGA 4UF4A 3BGRB 3OUYB 4EZ6A 3X3UA 3IAM9 2ZOMA 3ONQA 3FSIA 1OIAA 5JVGQ 2MZTA 4F7VA 3MM6B 1EKRA 3C16B 3T3FA 2FJAB 3T1HJ 4X66F 2LKZA 2E1AA 1OY6A 3R7SB 2ZVSA 4JYAF 2AKWB 2MZRA 4J9UE 1S79A 2H1YA 2CQHA 4L74A 4Z2XA 3QIDA 5LMNJ 5KAKA 3JTNA 3AH6A 4DV4J 2NQPA 3LW5C 2J6UA 3A3OB 3TW0A 2QG9B
chains in the Genus database with same CATH topology
2H9ZA 2Q1LA 4OJ1A 3QLHA 4ED3A 5IT4A 3PO4A 4MJKA 2HHTA 3M6WA 3CCQS 4KBIA 2YNIA 3A1YG 3OLBA 1NJIT 1IBLF 3M2VA 3LP1B 3NGKA 5L1IA 4F2RA 1GTEA 4JBCA 2C2RA 2CJQA 3J7ZT 1HA1A 2BA9A 1U6BA 4C8NA 2R2RA 4K4VA 1YBAA 5IQQA 6FDRA 3K5MA 3N4WA 2QA2A 4KGMA 2KG1A 3D54A 4BC7A 2AF6A 4O3PA 4RNHA 1N52B 4ELTA 3SCJE 1HYSB 1SJ1A 2CJ9A 4XPEA 1SJ3P 5A8WB 2CG4A 1M5PC 1JLEA 3ZC4A 2JLFA 1JB0C 3KLHB 4FYDA 2QA4G 4K4UA 3KHRA 3CDAA 3FDSA 3K8WA 3OPKA 4QYZJ 1JLCB 1TL5A 1CEZA 1QJHA 4NLTA 2PD1A 5K8MA 1SJRA 1LK7A 2MZQA 3VAFA 4DQPA 1ZOTA 1XR7A 1UFLA 4OZ0A 4GC7A 1OPIA 1FRKA 4H4OA 1UMJA 4DFJA 2UVVA 2BZ2A 2EK1A 4KIAA 4P2SA 3I5AA 2XULA 3ZZUA 4OZNA 2HLUA 3DI6A 2KXNB 4KKOA 4TN2A 4F4XA 2I8EA 3ZZ0A 1LQ9A 3DMJA 2IM0A 4I6WA 1VQOS 4IQXA 4ED7A 3MMJA 2XMKA 4DLGA 2LA6A 5L1LA 1Q4RA 5E41A 2ZKUA 3BSNA 1ZPWX 3CCTA 3K58A 4YUDA 5L9XA 2OSRA 4Q0BA 2A2CA 4KO0A 3OQ2A 3UD3P 2DGVA 3HVTA 3GFYA 2W24A 1AROP 5IFMA 1ZZNA 2VL1A 2UUCF 2E9RX 3W2VB 2BABA 3K2YA 1QSLA 3U1NA 1SKSA 1HI1A 1LFPA 1XEZA 2XWYA 2DR9A 4OJGA 4E0DA 2KDOA 4MAKA 2DGTA 3GFXA 1NHVA 2QE5A 4URSA 3SCIE 2C3YA 3TYTA 5KFUA 4BHQA 1NHUA 3M05A 3EPIA 1HQUB 2MQLA 4A8OA 5J2PA 3NCRA 2OH2A 4F2SA 1FT8A 5HROA 4V19J 3R5BA 2LLZA 3IRXB 4ED1A 2CPJA 1X4AA 1OWXA 1X5OA 1HWKA 3MM8A 4DL6A 1D9FA 3HFKA 3VTIA 1D9DA 3I0SA 2BVZA 4B9LA 4EGLA 4PR6A 2YKAA 5LL6d 2KZZA 3FEZA 3AHPA 1BLUA 1SV5A 1H0HB 2RSQA 2LECA 3DM2A 3DLGA 1XERA 2JJ4D 3THPA 4RBVA 2FHJA 3KLGB 4DG1B 1N5QA 2VKRA 4MMOA 3F44A 3SQGA 2Y1IA 5I3UA 1VQ9S 1FF2A 2W9AA 5EWFA 4OZ5A 1VJWA 4C8MA 2PI5A 2RIJA 2FVRA 1UEVA 1G6BA 2M88A 1F0XA 1XR5A 3MM9B 1O5JA 3V2UC 2Q3PA 1TKDA 4ZCLA 1S76D 2GNKA 4OL8A 1S97A 2O66A 1NRKA 4DDFA 4K5RA 5AXLA 5A6PA 1HHTP 2FHOB 2GV1A 2JEFA 5CYJA 3MUMP 1K1QA 1L3VA 2BXJA 1W2BR 4HVZA 4DX8H 2VBWA 5M2PA 4AYBD 3KKFA 4N56A 4FF4A 4ILMA 1KR4A 3HX9A 1DRZA 1MNEA 3M30A 3N01A 4QR2A 1MU2A 2YX1A 4EO6A 4RU2A 1DJ0A 2E9TA 5G0RB 2CIMA 7FDRA 3G4SS 2B51A 3E51A 2FVPA 3PO5A 2AGOA 4H4KC 4NYPA 4MIBA 5J2QA 3M2RB 3DDKA 2C2EA 2GQ2A 3JTPA 1JLBB 1HBOA 2VPXB 4PG5A 4GMKA 4Y2CA 3RBEA 1SUQB 1OQ6A 3BS9A 3NS5A 3KK1A 1M0SA 4EBCA 1RQ0A 4NLXA 4JI1F 1P1TA 3M1VA 5AXNA 3K0JA 1WEXA 2D74B 3HHDA 1BWEA 4QIEA 1X5TA 2YKQA 3HHKA 3DFEA 4FNHA 2ASLA 2IC3A 2FIUA 4C8KA 3OFGA 2VC1A 4F25A 4K4XA 1UWBA 5E5NA 2EFPA 1YWXA 1YQHA 4ICLA 1P6TA 1U24A 2C22A 2ZBIA 3BDPA 1UKUA 3D1HA 2J0WA 2R4FA 2JFKA 2MDAA 5KT7A 3HF5A 4U7UK 2F3JA 1QAJA 3SSRA 4XO0A 2Q6CA 2OPPB 5SZTA 2IM1A 4B3SF 1EETB 2HFOA 4YB6A 2FHKA 4WXOA 3TVKA 4ETZA 2F8MA 2P9EA 3IS9A 3DHWC 3N6MA 2LU2A 5KFTA 2R7WA 3BO4A 2GFFA 2K1RA 5E3RA 1JLAA 2L9WA 4I2QA 2E1MC 2RRNA 3KLIA 4X64F 2XLKA 3N79A 2RKIB 2PMZD 1RTJB 1TVRA 2WONA 1K0TA 4NPOA 5C42B 3RAQA 4DSLA 4ELUA 2FVSA 3GFZA 3MEEA 4RW9B 4G1QB 2RRAA 2Q6BA 3M32B 4O4GB 3EZUA 6FD1A 4ECXA 3MMCA 2CQCA 1UJ4A 4D3HA 3BSAA 4L3NA 2CZ4A 2IAJB 3OFEA 2VODA 4PPZA 1NK5A 5A0YA 3DLHA 3ZZZA 4O3RA 5KG3A 2N3LA 3QO9B 4AL6A 2CQ3A 2CQDA 2R7RA 3QYYA 4WFNQ 2ILYA 4KV8B 4ECTA 2EPIA 1BQNA 2EG2A 1J5OB 5SUHA 2AX1A 1Z4UA 3I4PA 3PIOQ 2LXIA 5A2QY 2I1RA 2ADCA 3R27A 3NMAA 3E3XA 2M8DB 2EFGA 1V9OA 2NSBA 3KNGA 1VBXA 1XMOF 1IKVA 3H5UA 2DRBA 2HHPA 5KG6A 3LAMA 3J7A1 1ZZFA 2XMVA 3MAQA 2K7JA 3DC2A 5E3QA 3CCJS 4CT8A 3PY8A 2XY5A 2HWHA 4MFBB 3SDEA 3BN7A 2KFZA 1E6YA 1VQYA 2B5JB 3OV7A 3T1YF 1WI6A 1FTCA 3FFIB 1RA6A 2K2PA 2GHWA 3MEGB 3QZ8A 3PW0A 1IJEB 3WBZA 3KHHA 1HWLA 3L7PA 4CTAA 3F73A 2W9BB 1VIXA 3HHNB 5KT6A 2YNGA 1KFDA 2W7OA 3I55S 2CPYA 4NLRA 1C4AA 1X4DA 3DCAA 5DJBA 5KFSA 3G96A 2ZZNA 5L39A 2XLIA 3TAMA 4X4PA 1LKZA 2AV5A 3DXSX 2OPQB 2IHR1 3MCSA 3NGDA 3B82A 4DR1F 1HW9A 3MR2A 4EO8A 4RW8B 2BQUA 2KN4A 5KFYA 4MK9A 4I2PB 4NWBA 3LQVA 4D3GA 3MD1A 2E7WA 3UI3A 1VBYA 2VG6A 1QM9A 3ISND 3D2WA 5FIIA 4IR9A 3OXFA 3TANA 2QT7A 1GXTA 2HPUA 3UD4P 3KHLA 2FJXA 3UCZP 4DEZA 3WDOA 3I96A 3OFHA 2COLA 1FTRA 2CQ2A 4ZLPA 2XC9A 2DBBA 3DRPB 2OPRA 5DG8A 1JWWA 2XMTA 5MLCV 4IFVA 3P6YC 3NRBA 5DQIA 3I0RB 5DG9A 1D3WA 1AXQA 4YHHF 1PSDA 1VI7A 4YQWA 4ZCKA 1D1UA 4OQJA 2X1AA 3G86A 2PIIA 1OQ3A 4OMFG 4TNOA 2L48A 4EBEA 3NBPA 3Q8QB 4IOAQ 1TAUA 4ETXA 1VBZA 4LFBF 4FZVA 4TKTA 2HVZA 5IT0A 1JLGB 3Q8PB 4CO5A 4DHVA 1S9FA 1X5PA 1FXRA 1URRA 1Y7PA 4MK8A 4F4YA 1FDBA 4UOCA 5F0UA 4K0KF 2YVSA 4WU2A 3I87A 2EI5A 2ZE2B 3PJXA 3RZAA 4X4UA 1WELA 1NU4A 3K5OA 1TL3B 3H59A 1TP7A 4JUZA 2DNRA 1C0TA 4B17A 2ZJPQ 3ISZA 3TQ1A 5KG5A 5F3TA 3LGNA 3KK3B 1LFWA 4XDDA 2EFQA 5EDWA 3MM7B 5F8NA 2EFVA 1MW7A 3DYAB 1DFDA 1TKTA 4JV1A 2QLXA 4WKYA 4CO3A 2AGQA 5D3GB 1YJRA 2BQ3A 2VOPA 2XHWA 4X4SA 2HNZB 2RU9A 3V81B 3CIMA 2RQ4A 5CYQA 3SSSA 2R7VA 2X1BA 1UVMA 4URQU 4TXSA 2JRSA 3G6ES 1OPZA 3J81Y 2ZKTA 4ECQA 4F3OA 3J7YU 4WF9Q 1ZBTA 2ZJQQ 1KSPA 1WD6A 3JSYA 1UA0A 3MPWA 4XPCA 2JC1A 2OTJS 2EG1A 4DQSA 1WWHA 3MECB 1B0VA 1KLMA 2V9KA 3MFIA 2QA4S 5KFLA 4ZPTR 4HI2A 4U7CA 4YP3A 5HLFB 4LUBA 4R0EA 3GMGA 4XAKA 2RB7A 3S01A 1GH8A 3EZ5A 2WHOA 5CCLA 1QLNA 1CVJA