2HZCA

Crystal structure of the n-terminal rrm of the u2af large subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alternative Conformations at the RNA-binding Surface of the N-terminal U2AF(65) RNA Recognition Motif.
pubmed doi rcsb
molecule keywords Splicing factor U2AF 65 kDa subunit
source organism Homo sapiens
molecule tags Rna binding protein
total genus 23
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hzcA00
1R8HA 3NNHA 5H1SV 1X4CA 2LXUA 1K8AT 4CH1A 1Q82T 1VQMS 1VQ9S 4LIRA 3EGNA 2CPYA 2F3JA 2N7CA 2RVJA 1QVFR 2M0GB 1U1NA 2B0GA 1F9FA 3R1HA 1X5TA 1DHMA 4YB1P 3BEGB 2NLWA 3TO8A 4FXVA 1X4GA 2YH0A 2HGMA 1X4HA 3VF0B 2RRBA 2GO9A 3CPWR 3BO2A 2KHCA 1WF0A 2RS2A 2CQBA 1XN9A 1FT8A 1PO6A 2MQNA 3SDEA 2DGUA 2DGSA 2VOPA 2RRAA 2X1BA 2YWKA 1U1PA 3CCRS 2E5IA 4QPTA 2ZJQQ 1VQ7S 2Q79A 3SMZA 1L3KA 1WI6A 1X5SA 3MOJB 2MZQA 2RNEA 2I2YA 3ZZYA 4UQTA 2MKJA 3CTRA 1U2FA 3H2UB 4WIIA 2U1AA 2G0CA 1QM9A 1UFWA 3FEXB 2KT5A 2CQHA 3CCUS 5JVHQ 2DITA 2MZSA 2MQPA 2MQMA 3CF5Q 1WHVA 3S01A 2D9OA 1KD1T 3J7ZT 3VAFA 4OZ0A 2MSTA 1RKJA 3EGZA 3Q2SC 3CC7S 3RW7A 2QA4S 5LJ3Y 1X5OA 2KXHA 2HYIB 3SXLA 1SJ3P 3R1LA 4UY8T 2YH1A 3TP2A 4YOEA 5ITHA 1VQLS 2JVRA 2RS8A 1K73T 3LQVA 1H6KX 4IO9Q 1VQPS 3RW6A 2DIVA 3THPA 3NNAA 2CPZA 4WFBQ 5GADU 2M7SA 2O3DA 5GMKa 1WF2A 2FPHX 2DH7A 2DH8A 1VBXA 2VODA 3H2VE 2JRSA 5BJRA 2KN4A 3CCQS 2E5GA 2HGNA 1M90T 2NZ4A 2M9KA 4BS2A 2KXNB 1ZH5A 4Z2XA 2PE8A 1M5PC 5IFMA 3N9UC 2AD9A 4YUDA 4Y0FA 2DNGA 1JJ2R 1OPIA 3FEYB 2N3OA 3BO3A 2DH9A 3P5TL 2DGQA 3S6EA 2DB1A 3UCZP 4IUFA 3PIOQ 2KG0A 3BO4A 2UP1A 1U1LA 1WTBA 3CD6S 1WI8A 2M52A 2OTJS 2HGLA 1OWXA 2KYXA 1WEZA 5CA5A 2QFJA 1WHXA 2KH9A 2AYEA 1VBZA 2WBRA 1N8RT 2XS2A 1D9AA 4PKDB 1AUDA 3G6ES 4WKRA 2LEAA 3UE2A 2OSQA 1KC8T 2DGWA 1FXLA 3VAIA 3SDEB 1KQSR 5CXTA 2J8AA 1X5PA 3UWTA 1YHQS 1DBDA 1WG1A 3V4MA 2MYFA 2CPXA 1YTYA 1X4FA 2MZRA 2MKKA 4QQBA 2FY1A 1X4DA 5GAEU 2MQOA 1H2VZ 1PGZA 2DGXA 3THTA 4C4WA 2CQ0A 1WF1A 3CCJS 5LSLA 1SJRA 1S79A 2MSSA 4OZ1A 2CQ4A 1W2BR 2DNNA 2X1AA 3MDFA 2DNYA 1HD0A 2CPFA 2LA4A 5GAHU 1SJQA 2F9DA 5IM0A 3UCGA 3IRWP 1YJ9S 2MB0B 3NMRA 2RT3A 5DDPC 2LEBA 5JVGQ 3CXCR 2RU3A 1Q81T 1M5OC 2AYBA 2XNQA 1S72S 2OJ3A 5GVQA 3P3DA 4Y00A 4EGLA 4CIOA 3CMES 3UCUP 3CCSS 3CUNA 2DNRA 2GHPA 1CVJA 2KVIA 1BY9A 5D78A 1YJWS 2MZTA 1NO8A 2J76E 1VC5A 4M5DB 4QU6A 3MUVP 5HO4A 2M70A 5CYJA 3CULA 4TLQA 3HHNB 2M4MA 1KOHA 2JX2A 2KI2A 1YI2S 3BS9A 1VQKS 1VQNS 2XB2D 2RQ4A 3Q2TC 2CPHA 1FJEB 4IOAQ 4TU7A 2A3JA 3CCLS 2L08A 3S7RA 1U1KA 2CPDA 1VC6A 1FNXH 2MQQA 5DDRC 3G4SS 2N3LA 2CQ2A 1WEXA 2MGZA 2DISA 1YWXA 2DO4A 2AYGA 3VAGA 5LXRA 1FJCA 1M5KC 4W90B 1OO0B 2CQPA 2E5JA 2KM8C 5LSOA 3NNCA 2YTCA 3CCES 3B4DA 2M8DB 2XSFA 1A9NB 2M88A 2CPEA 1NU4A 2DGTA 2EVZA 4PRFA 1SXLA 1URNA 1OIAA 2D9PA 2KXFA 3I55S 2KU7A 1WHWA 1U6BA 1U1OA 2CQ1A 2DHAA 4LJMA 2EK6A 2MJNA 1X4EA 2DNHA 1N52B 5D77A 1HL6A 3R27A 4TU8A 3EX7B 2BOPA 2DGVA 2BZ2A 2G4BA 1U1RA 2MKIA 2J0QD 5DDQC 1JMTA 2JWNA 2M2BA 3ZZZA 2MKCA 2XS5A 2X1FA 4F26A 2MZ1A 2J0SD 3VAJA 2AYMA 1VQ6S 4WFNQ 2OIHA 4QU7A 1KOOA 2LXIA 4PR6A 2E44A 2DHXA 1JJHA 2OTLS 5DETA 5IM0B 3U1MA 1JJ4A 1DRZA 1FJ7A 2YKAA 3TYTA 5IQQA 3CC4S 4LMZA 2ERRA 2N82B 4P6QA 3MI7X 5LJ5Y 3UD3P 1Q86T 1NJIT 3CCVS 1X4BA 3JB9k 3NS5A 1VQ5S 3G9CA 1O0PA 3P6YC 2XS7A 1M1KT 1DZ5A 2CPIA 4C7QA 1VQOS 3MD1A 1IQTA 3B4MA 1VQ4S 2QEXS 3MURP 1VBYA 2KRBA 2L9WA 2U2FA 2ADCA 1H2UX 1N54B 1FO1A 5DDOC 3MXHP 3J7YU 2HVZA 2VOOA 3PIPQ 1R8PA 2DK2A 3P49B 4J5OA 2DNZA 2E5HA 1N88A 2ZJRQ 2I38A 1U6FA 2LMIA 3D2WA 2MMYA 2CQCA 2MQLA 3G8SA 1A7GE 1SJ4P 1HD1A 2D3OR 1YIJS 3K0JA 2MGZB 1X4AA 3G8TA 1U1MA 1D8ZA 4ED5A 2DIUA 4IOCQ 4ERDA 2MJUA 2JVOA 3MD3A 3CMAS 2F9JA 1WHYA 2G1DA 2EK1A 5EN1A 2FC8A 2FC9A 2DNPA 2DNMA 2DO0A 2DGOA 4F25A 2MKSA 1VQ8S 3G96A 5GAGU 3VAHA 4C0OC 5HL7Q 2DNLA 5DM7Q 2DNOA 2XNRA 2DHGA 2CQDA 3MUMP 1UW4A 2DNQA 2KFYA 1U1QA 3DLLQ 4WF9Q 3CC2S 3CCMS 3VAKA 4WCEQ 4TU9A 3L3CA 3DXBA 3OW2R 1SJFA 1YJNS 2KRRA 4CH0S 2K3KA 1FHTA 3LPYA 1WEYA 1YITS 2V94A 4WFAQ 3I56S 3G71S 1RK8A 3VAMA 2LQ5A 2PEHA 2MXYA 2L41A 2FHOB 2LYVA 2HZCA 2LCWA 3MUTP 2CQIA 3VALA 2DNKA 2MHNA 4RU2A 4W92B 4CQ1A 2KG1A 3U1LA 2CQGA 1QVGR 5MLCV 5FJ4A 1UP1A 2MPUA 1M5VC 2LKZA 4U67Q 1WG4A 1ZZNA 1WG5A 4FXWA 2LECA 1ZZFA 1Q7YT 1K9MT 2CJKA 1P27B 4A8XA 1G2EA 2K8GA 1H2TZ 2RUGA 5LXYA 2MKHA 3NS6A 2DHSA 3IWNC 1B7FA 3S8SA 2VONA 2MZJA 1HA1A 1VC0A 4ZKAA 2LA6A 1X0FA 2SXLA 4F02A 2MY8A 2ZJPQ 3UD4P 1WWHA 2CPJA 1WELA 2X1GA 5DM6Q 2M8HA 3HI9A 3US5A 2KM8B 1UAWA 3ULHA 2ADBA 1P1TA 2MY7A 2OSRA 2CQ3A 2RQCA 4V19X
chains in the Genus database with same CATH superfamily
2CDQA 1H72C 2LXUA 5HI7A 2MDAA 1YJVA 3CDWA 3ZTRA 2CPYA 1FDNA 4K5SA 5LMUF 3GP9A 1TELA 4DR7F 2M0GB 1U1NA 3OTOJ 2KJVA 1VLOA 3CDUA 3VF0B 3IWXA 2RRBA 1XQIA 1EJ7L 2HHQA 4X4QA 3T6JA 3P5BP 4EWTA 4J9MA 3P4UB 1DQAA 3FMWA 2Q79A 4B9SA 3A1YG 2YKMB 3NMAA 4KYZA 4DJBA 1M5SA 3BKTA 3PJXA 1ZM3A 2ZWPA 3A3NB 2MSTA 3TZYA 3M8PB 2RDIA 4DL5A 1MWZA 1A6LA 4M1KA 3IN5A 3TP2A 2G2YA 1FVSA 1K73T 5L8RC 1NB7A 3RRGA 4C8NA 2BJ8A 4F0KA 2IAJA 2F4VJ 5GADU 4IOBA 4CH7A 3HPOA 2VJUA 3GIJA 1GX6A 2ZM6F 2HGNA 2ZNYA 4Q43A 2YNIB 1E6VA 2DNGA 1S9EA 2VF3A 3UN3A 2V2VA 3TRGA 1RTDA 3DLJA 3M2VB 4RW4B 2UUCJ 2PA8D 4WXOA 3PIOQ 3G6YA 4RW9A 2VQFF 1U1LA 1N33J 3S1TA 1L3TA 1XEZA 1UFLA 2G13A 4AQYF 3ZZOA 1TAQA 2AEFA 4NL5A 4JI5F 3V4MA 2CPXA 5GAEU 2BYCA 1J5OA 2KVQE 4KAIA 4QIFA 2MSSA 4A8KA 2LU1A 3M4XA 4ER8A 1HD0A 4J91A 2HSEB 2X3GA 1Q79A 1U24A 2AJ0A 3G2XA 3PFEA 3KWMA 5L1LA 1IBLJ 3D0IE 5A0YA 1FXDA 1RAAB 4ES3A 2HNYB 3MECA 4EGLA 3JQJA 3M2UB 2GGPB 1UTAA 3KOAA 1XTZA 4QU6A 5B0GA 4M5KA 1RYSA 1FNOA 2Q6CA 1OPZA 1Y5NB 4PUOA 2KI2A 6FDRA 5D3GB 1RAIB 1HHQA 2F5GA 1FE0A 1QSSA 1ELOA 4NYPA 1VRUB 1VRTA 4DPXA 3M6WA 5L46A 3FFIB 3VAGA 3UDVA 3OT9A 3WBZA 1TU0B 3ZO7A 1WHWA 5IXUA 4LJMA 4ED7A 1S6QB 4OIXA 1RLDA 2POKA 3AAWB 1LOUA 2DHHA 1LWEA 5F8MA 4RWWA 4MJKA 1HPZB 4F26A 3D6TB 3G8QA 3LP1B 4WE1B 4FNHA 4UF4A 3FQLA 4JYAF 3OV7A 5DLFA 2R7RA 3JB9k 3EUNA 2IDEA 5D0EA 1GT8A 1JLGA 3BGRB 4OYBA 3K8VA 4LR9A 2UUAJ 1VIOA 3QJLA 4J5OA 5KFPA 1H74A 2I38A 4LFCJ 4R0JA 4ZK7M 2CQCA 3GG1A 2NYIA 5HVHA 4DDFA 1YIJS 1X4AA 4DI6A 3H90A 4C48A 2BBEA 2FC8A 3LH2S 1WUUA 2WSCC 2WAQD 3CJTA 4PWWA 2DGOA 2ZZMA 3BBFA 3OVAA 1S12A 1JK9B 3R6GB 3CCMS 2GZOA 2RF2A 4GKKJ 3DXBA 1UPMB 2B9XA 4FYVB 4B17A 5K5MA 1PYSB 2EFNA 2OPRB 1RT6B 3HT0A 4WFAQ 2DEJA 3GR1A 2L41A 1XR5A 3A3OB 3RAXA 3OUYB 3C8YA 2ALZA 2JEFA 4WXWA 4IQXA 1T9YA 4PXCA 4N56A 1RAJA 2GX8A 4IFYB 4FF2A 1NHKL 1HWLA 1HBMA 3HSZA 1A0OB 2XWXA 4NE9C 1P27B 1H2TZ 2DHSA 2HQCA 4UTGA 2GHWA 3QO9B 3OLAA 5KOWA 4DBQA 1RHQB 2FVQA 4NLOA 4PXDA 1FKPA 4ILRA 2G0JA 4ZVTB 3J80U 3GIRA 2NPIA 3E2EA 3M9MB 3NNHA 4NA2A 1X4CA 3QGHA 3ADAC 3IG1A 2HQ3A 5A8KA 1NM2A 3D0GE 1E6YB 1WKLA 5KT4A 2R8JA 4OZNA 2Z2ZA 1X4GA 4BLGA 2E9RX 2AQ4A 1DTQB 1PO6A 5I3QA 2DGSA 3R5CA 2XULA 2E5IA 3JSBA 2GA7A 1HQUA 1X5SA 4WIIA 1S97A 1VLYA 3AY0A 2X3DA 3HD1A 2D9OA 4OZ0A 5LM7E 2NXCA 1REVA 3AQOA 1U8WA 1FRXA 2F8EX 2DR5A 5KFIA 3KUHA 2EI5A 1L3UA 1S1XA 4DUTA 2CPZA 2KB2A 4JV0A 1WF2A 4IKAA 2B5JB 3GTYX 3MCNA 2LP4A 2GIFA 2VBWA 5HLFB 2R8GA 3NGUA 1FDDA 3BKUA 2W7PA 4KFBA 2NZ4A 4WK1A 4F3MA 5CAAA 4ETXA 2QMUB 3N9UC 4YUDA 1HNZF 3T1YJ 3Q8RB 3VGVA 1OPIA 3W66A 2C2DA 1RT5B 4C8LA 3B78A 2YNGA 3GFHA 3CW2C 2HAIA 2XY5A 3L7OA 1FXLA 1UZHA 1YZ6A 2Z2MA 4ED8A 4ED2A 1NK8A 4MK7A 3P96A 2W8KA 1C0TA 1EX8A 2AHOB 4ZP7A 2MTLA 5M2UA 2YXLA 3CMQA 4USMA 1LWXA 1KTVA 2RJZA 1JWWA 2OO4A 1PJ5A 1S1WB 4DU8A 3CVKA 3DHXA 2HFNA 1D0EA 3OXGA 3LANA 4LF6F 4EFAC 3CJQA 2W9AA 2J76E 3MMBB 4QIEA 5CYJA 5J1NA 4E98A 2ZBPA 3THVA 4EBDA 3G86A 4ICLA 4F4WA 3TZZA 2CPHA 1AB8A 4TU7A 4F8RA 2FB0A 4QIWD 2DXFA 2MQQA 1OYEA 3RU0A 1Y11A 1S99A 2G1HA 1T8EA 1TFYA 4UOCA 4AD6A 1OIAA 1Q8KA 4J37A 2UUTA 2IBOA 2MLXA 3WQPA 3AD9C 2DHAA 2QIFA 3NL0A 1X9WA 2DGVA 4Q7AA 1AXQA 1U1RA 4PG6A 5MAOA 4DG1B 4DV2F 1UA1A 4DL7A 2OTLS 3D3CJ 3QQCD 3JQKA 1ZM4A 3J81U 1LKZA 1J5EJ 1WJ9A 2N82B 4A47A 3UD3P 1UMJA 4ETZA 3M2RB 4RLEA 2AWZA 3MURP 4HVZA 1RI7A 4ILLA 1N54B 3Q23A 4CI0B 2HRUA 4LFAF 5K14A 1IR0A 1JLCB 4FKYA 2HMIA 4QZVB 3JSRA 3VHQA 1J27A 4FS1A 1AYEA 4K59A 4MKAA 5KFGA 1VYAA 1M1GA 4X64F 3CJKB 4DEZA 2CADA 2P9CA 1SUQA 3G87A 4B3TJ 1FVQA 4KQZA 3OFFA 2HK3A 4HTJA 2DNLA 3T5KA 3KMQA 4D3GA 2ZD1A 1B7YB 2EBEA 3FZ2A 2JEGA 4WF9Q 2QMWA 4BDPA 1V3ZA 4B9LA 5H9FJ 4FF4A 4ZVEA 4EZ6A 4H54A 3ISNC 2HBYB 4L75A 3VVUA 1SI9A 3EVOA 3U1LA 1M5VC 2V50A 1RUSA 3R2DJ 1SH0A 5L38A 2KKHA 4KIAA 1C4AA 4ZCMA 5CYQA 4NLXA 3KHGA 3NS6A 4Y2IA 1WSRA 2VONA 2YNHA 3EM1A 4H4MA 4NA1A 2C3MA 4NLWA 5CD4A 4I1TA 1K1SA 1KRPA 4LR8A 2XQCA 4DPUA 5DGAA 3NCQA 2W9BA 1S9FA 1FFWB 5RUBA 3GSIA 3VGTA 2Y8YA 2M3DA 3MMJA 4IDKB 1RAFB 4KHRA 4P72A 5T7LB 3NEKA 1FI4A 2O67A 2HGMA 3QMQA 3JS9A 3LP0A 3MMCA 1P8GA 2V67A 2FDNA 3PR4A 2YWEA 4P2XA 3CCRS 4A8WA 3I5AA 1U4BA 4QPTA 3WHIA 3SMZA 4USTA 1RWOB 2RSQA 1UVLA 1VHFA 3WIUA 3K5PA 3FZBA 2CQHA 2FJVA 2V5HG 2FVRA 1KD1T 4C98A 5D8HB 2HHHJ 2W2OP 3KJVB 5A6WA 4C9DA 1JKHB 3AQPA 1RTJB 1T03A 3PY8A 2LQ8A 3W5ZA 4XDDA 5HJXA 5EUHA 3PG9A 3HZEA 3AD8C 2K3IA 1KFDA 4LF9J 5BJRA 3HVRA 4J9OA 4WKYA 1UVIA 4Y2MA 1IKXA 1FRKA 5IOLA 4Y0FA 1VRQC 1VJQA 2VBXA 1WOPA 3P5TL 2CFXA 1TK5A 3UCZP 3T5LA 3QGGA 1LW0A 4NMXA 3MAAA 4NZ0A 1T9XA 2KYXA 3FVYA 4ZDNA 1HWUA 2CJBA 3M32A 1SC3B 4DL0C 1IBMJ 2MYFA 1UKUA 2FY1A 5KTQA 5GADI 4WIQA 5T14A 4L3KA 2R7SA 4K4UA 2XMKA 3CD5A 4K4TA 3OD2A 2Y1RI 2X1AA 2RKIA 3GV7B 2MLZA 5HP1A 3ZTSA 1VK8A 3HJVA 2LA4A 4KPYA 4KR0B 5GAHU 2WBMA 3NKYA 3ILLA 2D74B 3GILA 3NMRA 2XZTB 4LBHA 2CYYA 3LGNA 2BANB 2LXFA 4PQAA 3IBCB 2RU3A 5K8OA 5AXMA 3H98A 2XNQA 4HLBA 1CS4B 4CIOA 1HYSA 1EETA 1CVJA 5HMWA 5D78A 2MZTA 3D5MA 2JL9A 2HNZA 3OR2A 2EW9A 3VGUA 2F4VF 4K5RA 3M05A 2VKZG 4OLPA 5GAEI 1GMVA 1C1CA 4NCAA 3ZC4A 4Q8FA 3WZ0A 4I0WA 3D7SB 3N5BA 2GVZB 3AA8A 2E5JA 4RNFA 4WYLA 2XSFA 4MH8A 2UUCF 1N33F 1F5CA 1RHUB 1MN7A 1RXOB 3Q8YA 1F1BB 4TY8A 3CDEA 4DR1F 5I3UB 4LSNB 3KLGB 1APSA 1NK7A 2J9DE 3H5UA 4ATNA 4C0BA 2G4BA 3EPIA 3BPDA 2IM0A 4ZN3A 4YY3F 3X3UA 3ZZZA 4LVNP 3K8WA 4X66J 2GHVC 3SQGA 3JAMU 1DY3A 4DV1J 3JYTB 1PYTA 2V4JA 3ZTOA 4GC6A 1RU1A 4TKTA 4LREA 3I0SB 2YKAA 4UQGA 1EP4A 4WWSA 3TW0A 3M8QA 3NOGA 2RDJA 3MI7X 3DRRA 4IG0B 3G9CA 2W7OA 1IBLF 2K1RB 4P71A 1FE4A 2AEMA 3HO1A 4ES2A 2U2FA 3J7YU 4JUZA 2DK2A 2WHOA 3IM9A 1RAHB 2JLFA 2D41A 3BF4A 3W3SA 1RLCL 1HBOA 3DOMA 3V6DB 4ERDA 3I0RA 1FKOA 4NX9A 3PO4A 3MAQA 4F25A 4B3SJ 2GQCA 4RW6B 2AW0A 2ZE2A 3HD2A 2BRKA 1M5HA 2WONB 5KFJA 1FWKA 4J9QA 5CYMB 1B70B 1DTTA 2WCXA 4LBPA 4JI4J 4F3QA 2ZZNA 3LALA 2B7CB 5MLCV 5FJ4A 4B3OB 4H4OB 5KFRA 3E01A 1RT7A 2LECA 3OHAA 5AJ3J 1MWYA 1WKJA 2IPOB 2K8GA 5AXLA 1KNZA 1RT3B 3Q86A 3A8EA 1C1BA 3KK1B 2ZJPQ 2UUAF 4C11B 1H98A 2IMWP 2P2CB 5J2PA 1UAWA 5KFWA 1SQEA 3P45B 3R5AA 4LFCF 5KFLA 5I3PA 1I6JA 4B9TA 1T95A 1QVFR 4AUKA 2BJ9A 1X5TA 4ZPDA 4CLSA 2NLWA 1KONA 3J7AN 1JLFA 2YH0A 3EJMA 1N0UA 2RRAA 1BQXA 4GVBB 4I69A 5KG3A 2HBRB 4GKKF 1YGYA 1F5AA 4ECVA 4ZVFA 3OTDA 1BQNB 3R97A 3HSGA 4WPAA 3VAFA 3B82A 4Y3CA 1XK8A 1T7PA 2HHVA 2C3OA 2W4PA 2YKMA 2JVRA 1KVJA 4XAKA 3SSRA 2GFFA 2NS1B 4DV0J 5DQHA 1IKYB 3ISZA 4KHMA 4JV5J 4EBCA 3M8PA 4UUWA 3Q83A 2XCAA 3IWLA 2DR6A 4OYAA 4HHHA 3CGIA 4FZVA 1EZZB 2ABYA 4URGA 3HHLD 2H4YB 5L9XA 3F56A 1BUXA 2FQQB 3TOQA 2R2TA 3BO3A 4X2BA 5G4DA 4QW8A 4OHVA 2DB1A 4HDHA 1RABB 1WTBA 1KSPA 1Q0NA 4J9RA 3TI0A 1D9AA 1PILA 2DCUB 3KK3B 3WIVA 1U48A 3UWTA 2HFZA 4M8LA 1YTYA 2RIJA 2KTQA 2XMAA 2CQ0A 2KL8A 2WW8A 4JI0J 2F7VA 4MIAA 1QSLA 1IBKJ 1WDDA 3RB4A 3TJ8A 3GYGA 4QCLA 4XPEA 1LFPA 1Q81T 3VCDA 4CNYA 4L74A 4TVAB 2OJ3A 1O6XA 2NSBA 4C2MA 4DFKA 3LGMA 1VC5A 4AXIA 4ES1A 2XSJA 4IQMA 1DQ9A 2PD1A 3AA9A 4DSLA 1K1QA 4IFVA 2GS8A 4ZPBA 1KLMA 1U25A 3OJUA 4CLPA 1YI2S 3PM9A 1N6QB 2GMJA 1NZ8A 2R2RA 2KT3A 3MR6A 2HNYA 3M2UA 2N3LA 3MTKA 3T1YF 1M5KC 1NMEB 1VQSA 1MN9A 3WC2A 2XC9A 2BMBA 1MU2A 5C42A 4J9KA 2XY6A 4DZ6A 3W61A 3OHBA 1RWMB 1HL6A 1VRUA 4OZ3A 4TU8A 7AT1B 3QYYA 5E3RA 3QFHA 1QE1A 3BBBA 1JMTA 2M2BA 2JEIA 1TMMA 8RUCA 2J0SD 2DT9A 2N4DA 3EICA 4XK8C 1DRZA 3PV8A 2WVFA 3LO3A 2NXEA 4QWAA 2ERRA 1CC8A 4NYZA 3SCLE 3RB3A 1F9EB 1V6HA 1ZAVA 1HPZA 2ADCA 2IFXA 3AJ1A 4NCGB 2OPQA 3TNVA 2ZBQA 3CD0A 2MQLA 1FX4A 2ROEA 4RNHA 1F5BA 2HQFA 2RU9A 1RTIA 2R7XA 2JVOA 5KFNA 3GZ7A 4Q2MA 2GAGC 2Q43A 1PG5B 2MKSA 2LVWA 3JTNA 5K8MA 2PGCA 2EKYA 2G0IA 4RNNA 3CJSA 3LP2A 2DNQA 4LRAA 2HVDA 3PCOB 1AUSL 2BKOA 2OPPB 3OLBA 4YR3A 2FLOA 1RK8A 4PQUA 2I9SA 2HPUA 4ZP6A 2I5JA 2ZH3A 3J7Z5 3VALA 3NBPA 1TL1A 4C8KA 1URRA 3F44A 1RE1B 4A4JA 1J5EF 3DHWC 3DGPA 1FK9B 2JLEA 2OPRA 1HNVB 3T9ZA 1F3FA 3MR7A 2AV5A 1U2CA 2LA6A 2IVFB 3I4PA 2KZMA 4G1QB 2FLPA 3N01A 1S4EA 1R27B 1VI7A 1N32J 4K4VA 2C2KB 2CJQA 3C6UB 3BDEA 3V4IB 3UVJA 2OPSA 4A8SA 3MTJA 2F3JA 2RVJA 2B0GA 4TLRA 1DHMA 2GIQA 4B3TF 2WOMA 2I8EA 2UV8G 3M6VA 1H38A 4OI2A 3PKYA 1FD2A 1TL5A 3MM7B 4QWBA 1QD1A 3CIMA 4CO2A 2MZQA 1E6YA 2RNEA 1UPPA 5JJBA 5H9EJ 2W2MP 1Y4ZB 1P9QC 2VB6A 1LK5A 3EWGA 1HW9A 1DTQA 4DUYJ 2B4OA 2UXDF 1FDAA 4RX6A 2HYIB 5LT5A 4DFJA 4UY8T 2BJ1A 2YNFA 4NRTA 3KJNB 3GYNA 3C16B 1G6BA 3RBDA 4O0IA 4IO9Q 3TA0A 2APOA 5AE2A 2FJXA 3NNAA 2AKWB 3W64A 5HMYA 4FVCA 3BREA 4J9PA 2ACYA 1S1UB 4DFMA 2QX0A 2PE8A 1LXJA 2Z0GA 4NRUA 4URQU 1U47A 4RU9A 1IWGA 1NXIA 2UP1A 3C14B 2I0XA 5HLFA 3EE3A 1RKIA 4RW8B 4RUCA 4PKDB 3M1VA 4UZBA 3CSKA 2NQPA 5KT5A 1F60B 3R8YA 1NJZA 1DBDA 1GNKA 1WG1A 3IAS9 5DZ7A 1SB6A 1Y10A 5B0FA 3CCJS 2BE2A 1NDKA 3MM6B 3C2PA 2D69A 3C66A 1REGX 2CUYA 2AGOA 2ROPA 4DL2A 2E9ZA 2FLLA 4PCQA 1QLNA 2W1BA 3RYLA 3ZZRA 4OV6A 4P2FA 5GVQA 1JLBB 4USVA 2ZH2A 4FPRA 4HL9A 4TLQA 2IA6A 1VDHA 4OZJA 1S1WA 1VQKS 3MAHA 1Y5LB 2OELA 4LF9F 4IOAQ 5HATA 1JNZB 3EZOA 2LEPA 3OBIA 3CJ4A 3HVWA 2DISA 5E41A 5LXRA 4Y65A 1SKWA 1YBAA 2KM8C 2YTCA 3OSPA 5GAHI 2CPEA 3GIKA 2D9PA 2KU7A 5KG5A 4PYDA 2QLXA 3FBFA 3LTOA 3ZNJ1 1YKWA 1X4EA 4ELVA 4KGVB 3R27A 2K7JA 4R5PA 1IBMF 3OSNA 1TK8A 5I42B 3VWSA 1J2VA 2PIIA 1S6PA 1ROFA 4AT1B 2MZ1A 4WFNQ 4DHVA 4LQ9A 4GC7A 1JJ4A 3GR0A 1Q53A 3DOLB 2IYIA 4KHPJ 4OJ3A 3CJ2A 3OL7A 4DG1A 2V68A 3A12A 1X8DA 3MD1A 3U02A 2DY9A 1H2UX 2QN6B 4G6VB 2HVZA 3EMTA 4DX8H 2Z58B 1QAJA 3MM5A 2EFQA 2ZJRQ 3BSNA 5L1IA 3NGTA 3G8SA 3AOAA 3POTA 2EKNA 1OY9A 2FVCA 1LW2B 4I56A 2G1DA 4DMZA 1JLCA 1SC6A 2JZ5A 5KG1A 2EWHA 3W9IA 3G96A 5GAGU 5LSRA 4ZN1A 3BGUA 2UXCJ 2XNRA 1YBTA 2ZBCA 2OFHX 1S9GB 4OI6A 1YRXA 5A8RB 1YQHA 2KFYA 2ZDOA 3MPYA 1JXVA 2CZVC 2F65A 3AB4B 4MFBB 3SIPB 3IR5B 4WFXA 1UVMA 2LQ5A 4F4XA 4X66F 3PW7A 3TAMA 2UXBJ 4DV1F 4W92B 3BJYA 2DYAA 2RB7A 4HKQA 1D8YA 4FYXB 3UQSA 1RTZA 1X60A 3HZGA 2ZUAA 1ZZNA 3D1OA 2LFVA 1IM6A 3ZFVA 1UWBA 3KLFB 1Q8LA 2CG8A 2YPZA 3V5RA 2Y1JA 1X0FA 4LSLB 2AZ1A 2VFRA 3IS9B 4DQQA 3W63A 3CT9A 1F6TA 2Q1LA 1Y0HA 2OEMA 4KRWA 1K8AT 4CH1A 1VQMS 4YB5A 4TQRA 1CBKA 2VC1A 2WVEA 3ENWA 1CULB 2HRTA 3CEDA 4I7FA 4K2JA 4MT1A 1RBAA 4QYZJ 3SBMA 4CRJA 1R0BG 4B3SF 4C3KA 1GFWB 2BABA 4M95A 4U96A 2ZVIA 3D54A 3DRSA 2L48A 1L3KA 4AE5A 4J9LA 1RT4A 4XO0A 3C6TB 1CJUA 2J7UA 2MKJA 1RB0A 3CTRA 3H4DA 4JI1J 4FYWB 2XMTA 3OPKA 3DU6A 1NSPA 2E66A 3S01A 4JI4F 3TX8A 3MR3A 3F73A 4O4GB 4XDCA 1X5OA 1SJ3P 1JJCB 2ASLA 4CTAB 5AJ3F 4DV7J 3JSMA 3HJFA 3LA0A 1XIQA 4RZRA 5C2GA 2FPHX 3M8WA 3UDEA 5C25A 4KGXB 3T6BA 3QJJA 3ITHA 2AD9A 2GJFA 2G9OA 2XZWA 4X65J 3IFEA 2C2MB 1N5YA 2YX7A 5K9FA 2KG0A 2CNLB 3UD5A 2VFSA 1WI8A 4ZP9A 3QT7A 1VBZA 5L9NA 5DS7A 3ZZ0A 4PWDB 2B56A 1LFWA 5K8NA 2AJ2A 2OD4A 1TMJA 2MKKA 2MQOA 2UU9J 2FJEB 1RJJA 4C4WA 3N79A 3T41A 5A8WA 2XY7A 1W2BR 5H9FK 2DNYA 2NREA 5ETRA 2UZAA 2CJXB 3QT6A 4LT6A 3UCGA 3SSQA 1NJXA 2NXUA 1XMQJ 4M63A 4WP8A 4CT8A 5F0WA 4QW9A 2XLJA 2AX1A 3CCSS 1QAIA 3TZWA 1UETA 3DDNA 4NLYA 4G1PA 4PG4A 4DV0F 5E33A 3PKMA 4JV5F 1LWCB 3IR6B 2R2SA 1CS4A 1R6VA 3JSYA 1IBCB 1HMVA 2AYGA 5CCMA 3W8PA 3D1HA 1L3VA 2IJRA 5D0HA 3Q0AA 2XMJA 1UJ5A 3TA2A 4DCOB 3T3FA 5C24A 1LEOA 4CM0A 4H4KA 5JXSA 2W4CA 3T1HJ 3CWJA 4L73A 2AU0A 3E3XA 4AXJA 1U8SA 4ED0A 4HHJA 2P6TA 4KKOA 5DDQC 4K0KJ 1HBUA 5JUMA 4X4TA 4DX7A 4C0HA 4LF7J 1UJ4A 5HK4A 4NXMJ 3VAJA 1VFJA 4JI0F 2LQ9A 4USHA 1S48A 4LIWA 1S5ZA 1IBKF 1ZAWA 5IQQA 3CC4S 1HNIB 4LMZA 4Q8EA 3Q8VA 2DXEA 3BGLA 5DLGA 1KKHA 2GNKA 4PYAA 1WNEA 1IKVA 1U26A 3NGDA 4OMFG 4I2PB 2RUSA 1VBYA 2KRBA 3DLGA 4EK2A 4P73A 3MXHP 2DTJA 2VOOA 4TN2A 3I0SA 1CJTB 4IG0A 4O3PA 5KOXA 2K1RA 2D3OR 1V3SA 4YB6A 4A8QA 2VBYA 4UOFA 1WC3A 5I4MA 3MOZA 3G82B 2DO0A 1FFSB 2YQ1A 2ASJA 5HL7Q 1UL3A 2OLWA 5AXKA 1SV5A 2KRRA 2V0NA 4I68A 4KGKA 4BWJA 1BQMB 2LQJA 3DXSX 1L3SA 3GJRB 4RW6A 3HMJG 4DLEA 2HZCA 2LU2A 5FD1A 4B08A 3G6XA 3A8KA 1WC6A 3EGVA 4DR2F 2VKRA 2ZVSA 3HCXA 3IA0A 4RW7A 1S1TA 3ILJA 3DDKA 2OFGX 2VFVA 1QUVA 1D09B 4RBUA 1TR0A 4Y6IA 4F04B 2BA9A 5DM6Q 5KFDA 3ULHA 1PC5A 2CWXA 5EDWA 3SSSA 1HQ2A 5F3TA 2RH3A 3R7NB 3PTWA 1VGYA 4ECSA 1UEVA 3BEGB 2FGCA 3RTVA 1T05B 1X4HA 2R7VA 4TQSA 1NSAA 1MROA 2FHMA 1FT8A 4YR0A 2MQNA 3TX0A 3MCSA 1SJ1A 3ZNUA 1U1PA 1VCTA 5A2QU 1P6TA 2RDDA 1XERA 3MHYA 3MEDA 4TY9A 3D1QA 4A8YA 2XYPB 3KLIB 3MR5A 3RBEA 2HG4A 3I31A 4I6WA 2DITA 2N4CA 4ID8A 3IRXB 4GVBA 1MW7A 5LOQA 5DZ6A 3AB2B 2AMCB 2G2OA 4JI3J 3ISND 5KFKA 3QRQA 2YVSA 5IWAJ 3O1LA 1VQPS 4Q2LA 1G4CA 1RWXB 2O3DA 2HS0A 2YWFA 4B02A 4YS2A 4ZS6A 1VS3A 2J6UA 2QL7B 3J80Y 1TZ0A 2Q6BA 1S49A 1MWQA 1N32F 2Q3PA 2W9CA 4YFUA 1Y9OA 4OZLA 2N3OA 4CT9A 4ZVPB 1IKYA 4OYWA 1P9YA 4M94A 5CA5A 4LF8J 3FNNA 2XS2A 2Z2YB 5HANA 3MR2A 3G6ES 4RWXA 2R8HA 2A2CA 4QR1A 2J8SA 4QQBA 3BQ2A 1H2VZ 4CLYA 4HEA9 3NGSA 4C8OA 2V2ZA 1NPKA 2AIRB 3O8WA 2V8DA 1TL7B 3DRYA 1UZDA 1R0AB 4LFBJ 4Q0BA 3R7SB 4B9UA 1JNRB 4NLPA 1IKWB 3PYGA 4DUYF 2HHUA 1RWVB 3A3PB 3SV3A 5DDPC 1JXEA 4KJIA 1TKDA 2P5VA 5KFVA 3UCUP 3ZZPA 2OMLA 2QL5B 2PDAA 3M8RA 4AL5A 4U95A 4FF3A 2IAJB 4GO5X 1R43A 2WW4A 3CULA 2JX2A 1Q5VA 3KTQA 4I6AA 2FTRA 3KLVA 4P7TA 4DPWA 2L08A 1DURA 2DRAA 1E6VB 1S9EB 2Y9HA 1RTDB 2MGZA 3QRRA 3O6QA 4RW9B 2CQPA 1N6QA 4JV1A 5EWGA 1VR6A 3E8OA 1XMOJ 1U6BA 3KK2B 5T41A 1NHUA 3EVMA 1N52B 5D77A 2QO3A 4DS4A 1J5OB 3MWBA 4DR6J 3EDQB 4QR0A 1NAQA 4S0MA 4JI6J 2X1FA 1KQKA 2DHXA 3AJ2A 5L1JA 3W2VA 3R2CJ 1FJ7A 4OYIA 2QLFB 4NZ7A 1AZSA 3TYTA 3MZIA 5A0YB 4X62J 2B9YA 2VG6A 3HK2A 3MECB 1PAEX 1DZ5A 4C7QA 3Q22A 4P2MA 4DXLA 1TKZA 3CJ8A 3SFGA 1VQ4S 4UOGA 3T5JA 5EHHA 4DSFA 4DR4J 2HHXA 4OX9J 1CQMA 1R8PA 5AT1B 4PUOB 1NBEB 5LMNJ 4OJ1A 3HT3A 1VRTB 3G8TA 1D3WA 3PYEA 2MJUA 3ZXWA 1YJUA 2CWKA 2BOAA 4B9NA 7FD1A 4LBIA 1HW8A 1ZPVA 5FLXY 3VGSA 1PAUB 3IXQA 1RZMA 1D9DA 4ZJOA 1W26A 2AGPA 4YDDB 3CC2S 4I67A 1SJFA 1LWEB 5FDLA 4O3NA 3RB0A 4TYBA 1TKXA 3PR5B 2H54B 3H0PA 2UVUA 1RYRA 3I56S 2L9NA 3DLKA 3BR9A 5HROA 1I51B 1NH7A 4Q5VA 4RU2A 2E9TA 2BXJA 2KG1A 2EEYA 3OTCA 3GB0A 4O0NA 4USUA 2FZKB 1WG4A 2ZDPA 1ZZFA 4USWA 4KHPF 5GMEA 1JLGB 3M30B 2B7BB 3FMBA 5B08A 5F8LA 4Y2KA 4ZP8A 1BMQB 3T1AA 2COLA 1BLUA 2BE7D 2BACA 2GMLA 1RISA 3NY0A 2MY7A 2H5EA 4DV3J 2XCPA 1S0OA 3RAQA 1HNVA 1SKUB 4XIUA 1VQ9S 1HHSA 2IRYA 3BR8A 4F50A 2QLBB 4PXBA 2EC2A 3J81j 1F9FA 4G1QA 8ATCB 4IRCA 3PW4A 4PPDA 4MYUA 3LGHA 1YJ7A 4FPIA 2BV3A 4P52A 1CSJA 1UVNA 3EGWB 5AE1A 2YWKA 2UXCF 2ZH1A 2RF2B 4KH1B 4D3HA 4RBVA 4J9NA 2BDPA 3D6FB 4Y34A 1UVKA 4CZCA 3H2UB 1QM9A 1NK5A 2RE1A 2UXBF 5LJ3Y 3DM2B 3SXLA 3R1LA 3FKBA 2NYHA 1HBMB 5ITHA 3CDBA 1UEKA 5KFFA 2Z4PA 3RW6A 2RQMA 1SCJB 4M5DA 1LQ9A 1UCNA 1FKPB 1FA0A 1AFIA 1Q78A 2XG8A 2HK2A 3IG1B 3FEYB 5A8KB 3BO4A 4E2FB 2VQEJ 2CNOB 4N5SA 1AUDA 4A48A 1PBUA 2ZHBA 1CJKA 3K57A 2GV1A 2QRRA 1XR7A 4HTIA 2VQFJ 3BH7B 1SL2A 2MZRA 3D68A 1X4DA 4UT4A 1HQUB 3CE8A 2RHSB 1KTQA 1QSYA 1WF1A 1S79A 3DYAA 2HWTA 4ZCLA 4KGMA 4RW8A 4JI1F 2B43A 1N5TA 2ZOFA 5CZVA 3KHLA 3CB4A 2DNRA 2YX4A 1BY9A 2C3UA 1S1XB 1Y3KA 2PO4A 3NGKA 5E7OB 2DCLA 3B54A 1Z2ZA 3QZ8A 1AROP 4FN5A 4KFBB 2H51B 3W62A 1WORA 5ETNA 3S7RA 2J9DA 3K58A 3H4BA 3ZZUA 3BGFA 2H5JB 4I2QA 2YNGB 4ZIVA 2PSZA 4X65F 2M8DB 2DBBA 3SYZA 2PT0A 5KFBA 4DX6A 2MJNA 4QYRA 1SIWB 1RU2A 2ZOMA 2YX1A 1RTHB 2IM1A 1C0TB 3KNAA 3QATA 2UU9F 3RUBL 3IBWA 2DR8A 5J2MA 2W25A 4QOTA 2LXIA 1I5OB 4R25A 2R7TA 5H9EK 5DETA 3SFUA 3QLHB 2C28A 3TUJC 2MKYA 2DR9A 5LJ5Y 5ETMA 2R7OA 4MMOA 1XMQF 1VQ5S 2Z57B 3R5DA 2DRBA 4I64A 3RAMA 3DCAA 5KG2A 3M7VA 4OL8A 3OXFA 1CEZA 1GTHA 1TVRA 4X4SA 5KT2A 4ICLB 4I4BA 1PYOB 5EWEA 2MMYA 3IM8A 4ILMA 3MM8A 4WYWA 1WKKA 1UVJA 1D8ZA 4B9VA 1WHYA 2EK1A 5EN1A 2H5IB 5JMNA 2VUGA 2O01C 3V6KA 2C2NA 1OMSA 5IT9U 3VAHA 2BJ3A 4IH5A 2XM3A 4W98A 1U1QA 3T1HF 2HQGA 5DJBA 3OW2R 4NLTA 4CH0S 2H3EB 2VFTA 2QJ3A 2V94A 4K0KF 4X4VA 4MIBA 4LF7F 2BM0A 2YKPA 3C19A 4NXMF 1R7IA 4LF5J 1CLFA 2IVMA 1DJ0A 5A8RA 4CCHA 2ZH8A 3JTOA 5F9NA 3GWCA 1AT1B 1Q16B 1RCOB 2GCFA 2Z8QA 3BSCA 4MFBA 2I1RA 3QAEA 1N5QA 3UNYA 4JOUA 4ZKAA 2QYGA 2JOQA 1H7WA 2ADBA 1P1TA 2ROGA 4ZPWR 5E0OA 2GIRA 1VJWA 3UO0A 5H1SV 1SUQB 3EGNA 4KV8A 3MGJA 3TA1A 2UVVA 2Z56B 2HNDB 4LSLA 4HDGA 4O3RA 1FNMA 2IJNA 4QPXA 2KHCA 4DFPA 2ZOGA 3SDEA 5D0RA 4LF4J 4X4NA 2ZD1B 2X1BA 1TV6A 1WI6A 5AXNA 2F8HA 5F3ZA 2UVWA 4OQJA 2U1AA 2ATLA 3CCUS 2RRNA 4L76A 2P9GA 3AXMA 1PCAA 4U8YA 2NUHA 3C6TA 3OTEA 5CYQB 1GXLA 3RGIA 3W2WB 2E1AA 5F41A 2E1CA 2DXDA 2YNHB 3BGOP 3DRPA 1VQYA 3FBCA 3CJ3A 3GIIA 4CLWA 2YKQA 2ZWOA 2W9BB 4CTAA 3HHLC 2V2KA 2JSXA 1FESA 1HR0J 4YP3A 4Z37A 1WHXA 3GG0A 4N47A 3FCVA 3LP0B 1HNXJ 1KN6A 2OSQA 2DGWA 3MMCB 3EZ5A 4Q45A 4KY3A 4LR7A 3HVTB 3D6HB 2CDRB 1RWPB 4GKJJ 3MDFA 3WX4A 3NRBA 1U49A 4PWDA 5IM0A 3IRWP 1JLQA 3TANA 3CD7A 3R5JB 3I9V9 1XNQF 3HHLB 2HRYA 1M5OC 4G65A 4F2SA 1TK0A 3NAHA 2NSCA 3CMES 4JI3F 1ZTTA 4C8YA 2ZC3A 2HHPA 5IWAF 3K5LA 3M8SA 2NZCA 1OSDA 4KPCA 2PMZD 3L4BC 3K2YA 3DKDA 3MCOA 2V4RA 2EG2A 2RQ4A 3Q2TC 1IKXB 1CQNA 3M9NB 1FTCA 2A6OA 1YWXA 3SZ2A 2B6AA 4IR9A 4YHHJ 2OUGA 4EO6A 1OO0B 4DPYA 4IG3B 2ZKUA 3MAAB 4FXDA 2KXFA 4LF8F 1FD8A 3PJ9A 2UUWA 4O4RA 2IRUA 4QYZK 4DQPA 2L9DA 3GSDA 3KUGA 2ALYB 3AOCA 3RZAA 2WTFA 2FZGB 2V9KA 2EFGA 3Q8UA 5DG9A 2RKIB 1JIHA 3VQSA 2AGQA 5HP1B 2IC3A 4LFBF 4N7TA 4HACB 2XMMA 1Q86T 2R3VA 3GJSB 4IRKA 1FFGB 3ZZTA 1HYSB 1EETB 1M0SA 2FGOA 1DAXA 4G1IA 3MMAA 2HNZB 2YKNA 3OR2B 1F9HA 4DCPB 4ZVRB 2R7QA 5ETSA 2Y1IA 4O44A 1L5UA 3GYXB 3BBCA 1C1CB 6AT1B 3D4JA 1S76D 1N5SA 4I2PA 3DFEA 3CMAS 3VZHA 5KFCA 4P9SA 2G2ZA 2HWIA 4N76A 5DQIA 4CNZA 4WK3A 2JNJA 2AT1B 4TY8B 2QG9B 1HNWF 2V34A 4R8UA 2DNOA 4JV2A 2IM3A 1XMOF 1JLAA 2XO7A 4X84A 4FP9A 3DLLQ 4M5IA 3KLHA 2UVRA 3H5SA 1SC1B 2CAJA 4DR6F 4RO0A 2QSWA 1EHWA 3SQGB 3IGNA 4IH6A 3DC2A 4Z7CA 2V4JB 4JI6F 4OFZA 3E51A 2IYGA 2LYVA 1NCLA 3GU0A 2DNKA 2HFUA 4USJC 5THWA 3EXCX 5IC6B 3M8QB 5J1EA 3DRRB 5J2NA 3BB5A 1Z1ZA 1ITPA 3LOUA 4X62F 3QBCA 1GXTA 1YLXA 1K9MT 3NLCA 2OHDA 3HHKA 4YMEA 4WTYA 1FRMA 2OEJA 3GV5B 4KO0B 2OAUA 1QTNB 2C2OB 4DR4F 4F02A 2MY8A 1FXRA 1Q4RA 4OX9F 2ZC4A 4ITSA 3D0HE 1WELA 1U0HA 3OTOF 4M5GA 2M5YA 2OSRA 5LMNF 2HVEA 2CQ3A 5BXIA 2RQCA 3TJ9A 2J5AA 3DOMB 1FKOB 3HSJA 5HN0A 1HQEB 3VQTA 5KFMA 3FEZA 4MK9A 4DS5A 2D7SA 5CZXA 1Y00A 3D28A 2PMHA 2UV8A 3VVTA 1SC4B 1SVDA 4LVOP 2H48B 2C22A 3KHRA 2R7UA 4ECXA 3MEEA 4YEAA 2CRLA 2O1PA 3CNQP 5IT0A 1FRJA 2I2YA 2WK4A 1DTTB 1NLKL 3HKZD 1R31A 2G0CA 1RSCA 3UR0A 1V3RA 5ETKA 3T19A 3KLEB 3NGRA 1TL3A 3DLHA 3ONQA 2VBZA 3GFYA 3ILOA 3FUYA 4CO0A 1EKSA 3PRDA 2ZH4A 1RT7B 4P2SA 1I1GA 1C0UA 3UDCA 1HWKA 3KLIA 1U6ZA 4LF1A 1T11A 2H9ZA 1JLEB 3V6JA 5GMKa 4OI0A 5IQ6A 1C1BB 3IRXA 3M6XA 4PG7A 3H2VE 3IP0A 5J2PB 5IFMA 3IMQJ 4WU3A 3MM9A 2VG7A 4F4AA 4X4RA 4DV3F 4IUFA 4EI2A 4CO3A 2HBQB 1JQGA 1WEZA 1FDBA 1JLFB 5KT7A 4NI2A 1RWUA 1KEKA 2WRMA 5L1KA 2J8AA 3O44A 2B4PA 3ET6A 5KT6A 2DGXA 2HS3A 3EPGA 2YQ3A 4WZMA 1SPBP 4GVLA 2IVYA 2MHEA 3QNWB 1TKTB 2BQUA 4PEOA 4LRCA 1EARA 4JI8J 4HYKA 4ZHRA 3CDAA 2LEBA 3HM9A 5GMDA 2AYBA 4KB7A 4XPCA 3CUNA 2GHPA 3K5OA 1TL7A 5L39A 1R0AA 4DSJA 4ED4A 2C2EA 5HO4A 3NCPA 5KFYA 3UPFA 2VPWB 2M4MA 1KOHA 1IKWA 5KFZA 2IA0A 2LLZA 3BS9A 1VQNS 1TUWA 1NKBA 3LW5C 4ECTA 4DU7A 3GQCA 3P8BB 2JJ4D 3R6LB 4QBUA 2DO4A 3ELHA 3N28A 4F3OA 3NNCA 3LUYA 2ZH9A 2DGTA 2VQEF 1JXLA 3UN5A 1QUPA 2EXUA 5IV3A 3KUEA 2CQ1A 2K7KA 1T9VA 3L09A 1NJYA 5D4LA 3EX7B 4USKA 4WFZA 4F4ZA 3HSDA 4PG5A 3CJ5A 2J0QD 2W24A 4DR1J 1TAUA 3I32A 1BE4A 2C3YA 3OJSA 3KK2A 1EQ0A 5HVGA 1MLAA 4YY3J 3CO0P 1KFSA 3DMJA 1NB2A 2FJAB 1FRHA 3CCWA 3P6YC 1QJHA 3CCTA 3DI6A 3IO1A 2QGFB 1QY7A 5KFXA 2XSJB 4IFVB 3V81B 1KLMB 3H20A 4W4MA 1HWIA 2XGPA 2E5HA 4ZVSB 3MPWA 1NZAA 2VG5A 2R7WA 3C15B 3HHEA 4ZVHA 4IOCQ 4WP9A 2WB4A 2QLWA 4ZIWA 4OHYA 2GJIA 1MU2B 5C42B 4OYMA 2W01A 2UUBJ 2BW7A 3UN2A 4ZVQB 1YJRA 3BYPA 1QE1B 3PVXA 5EX3A 3BZQA 4RUBA 3BKFA 3OR1B 1RWNB 1XNRJ 4B3RJ 3W5XA 2B8PA 4GO7X 3PW0A 5ETLA 2HLUA 2ZZTA 4EZ9A 1U7LA 3PJWA 1F0XA 4CQ1A 2A1BA 2XLIA 5C5JA 2CQGA 1HARA 2E1PA 1ICEB 1RP5A 1Q5YA 5BR8J 1Q7YT 1VBKA 4RL1A 2YQ0A 4DLGA 2IM2A 2MZJA 5DRKA 2SXLA 2OPQB 5KFHA 5F8NA 1LWFB 2EFPA 3BQ0A 2DD8S 2YNIA 4JI2J 1Q7LB 2QFJA 1RTIB 3M30A 3R9LA 4WP3A 3M2VA 4RW4A 4ED6A 5B0BA 2K2PA 2N7CA 4ZPCA 3SCJE 2ZHAA 1BD6A 4YB1P 4FXVA 2RS2A 3X1LB 3LP2B 4CM2A 2R8IA 3GJQB 5KFUA 2QTWA 3Q24A 4CLKA 3MOJB 3W5YA 1B4SA 4PQUB 5HQMA 2KT5A 2Q66A 2I5JB 2BUNA 3RBZA 3NBPB 1TL1B 4ID5B 3CC7S 2CA9A 5F8JA 2XBPA 4LF5F 2H1YA 2YH1A 1IUJA 2KHDA 4YOEA 3DGPB 1FX2A 4JP8A 3OFHA 3GCXP 1H6KX 3MEGB 1OY6A 2GGPA 1NNDA 2X7IA 3THPA 3TAPA 4PZVA 3UR3C 1AA1B 4BC7A 2DH8A 1S0NA 2VODA 5KFAA 3K17A 2JRSA 4ZA1A 3DM2A 2P8IA 2M9KA 5D3GA 4LRBA 2GQ2A 4OYPA 1BWEA 1GQEA 1S6UA 1YDLA 3UVJB 4Z7YA 5E3PA 1SL1A 2X51A 2OPSB 2EBGA 4YB7A 3FFIA 4OYOA 4ANDA 3FBBA 3GFXA 2OTJS 1OQ3A 1OWXA 3KKFA 2KH9A 2AYEA 1N8RT 2WOMB 2LEAA 3UE2A 4LRFA 2A18A 4J9UE 1KQSR 4CLFA 1YHQS 1S6QA 4GMKA 4BBYA 5K20B 1RA7A 4LF4F 4UZCA 1PGZA 2CNNB 3DOKB 1NSKL 3MEKA 1VHIA 1RT1B 4RR5A 1YVFA 3F41A 2VH7A 3KNGA 3LP1A 1N4LA 4WE1A 2MB0B 1YJ9S 1Z2LA 4Y2CA 2B4UA 3PDNA 4ECYA 2YNFB 4ZVGA 4OX6A 3BYRA 1H7XA 3Q8SB 2XGQA 3BGRA 2VU5A 5ETPA 4NLRA 3DLEB 3EDRB 4CO1A 5G0RB 2XYHB 1XBWA 3BSOA 4F2RA 3K5NA 4F4YA 2ZHOA 2YPYA 2CPDA 1VC6A 5DDRC 5ETQA 1HKAA 1FJCA 4W90B 4OZ5A 2MLYA 3OXLA 2GC8A 1URNA 3RBXA 1HR0F 4P74A 3M1VB 2BQ3A 2ZBIA 4A8FA 4P75A 5A76A 1HI1A 3D3BJ 1HNXF 2Y3YA 4ZCIA 3M8YA 2PFDA 1VMBA 3DN9A 2OEKA 2WVCA 2BE2B 5E3QA 2CNKB 1RT6A 3QGPA 2E7VA 2AYMA 1VQ6S 1YG0A 1WOOA 2NXNA 2E44A 4GKJF 2DPJA 1S6OA 3OUYA 3IR7B 2V6AA 5EX0A 9ATCB 1QDUB 4F4KA 2LDIA 1RTHA 4IFYA 1BC6A 3I5CA 2WSEC 1ZPWX 1QTMA 3RR7A 3QO9A 3QLHA 3PIPQ 4DPTA 1U02A 4A46A 2R9LA 1EB0A 3D2WA 1OYDA 4QIGA 3SCIE 3B8HA 2OGUA 4FS2A 1U1MA 1K47A 4K4XA 2QZ8A 1IQZA 1ZOTA 3RG6A 2B9WA 4YHHF 1U0SA 1VQ8S 1WTFA 3I82A 5HQ8A 3GLJA 2XHWA 5DM7Q 4ECWA 1OJ4A 2VIHA 2VDHA 4FDFA 1UW4A 1RBOB 4R5PB 3LWMA 1H0HB 4B3MJ 2CZ9A 1S6PB 2QL9B 3U1NA 1SQGA 5FLXU 2A2DA 5CH7B 2B4VA 3QT5A 8AT1B 2LCWA 4NLQA 3MUTP 1SKSA 3EXYA 2MHNA 3PO5A 4DUZJ 1ZA2B 2AJQA 3TVYA 3OQ2A 4FXWA 4WJBA 3KG1A 3L7PA 2FIUA 1IN0A 2CJ9A 3RRHA 2HQDA 3TUPA 1B7FA 3M8ZA 3S8SA 1RHJB 2E1RA 2B5JA 5BYSA 3MM5B 1W2IA 1WWHA 4NLDA 1ZAXA 2CPJA 3UW1A 1P1LA 2BQRA 4O3QA 3KG4A 1NH8A 3POTB 4J9SA 2CJAA 1ACMB 2VPXB 1NHVA 4NLGA 4OI4A 4NA3A 2L3MA 4NCBA 5KG0A 1RA6A 1RT5A 2EG1A 1V5VA 2VZ9A 2YWGA 5HSPA 5F8GA 1IXKA 1WC5A 5F0UA 3KFWX 4ZMMA 2GW8A 2DGUA 4M5JA 1HIYA 3HHDA 2GVDB 4K4WA 3GIMA 1KQFB 2BEFA 2HNDA 4UQTA 4LRDA 2HHHF 3TAMB 4OI3A 2MZSA 3RRKA 2MQPA 2AX0A 2CXEA 3CF5Q 3EGZA 3J7ZT 2AJFE 2ASDA 2C2RA 3FC9A 1LXNA 3D9BA 1UWBB 2IDLA 1WC0A 4DL4A 4OLOA 1F3VA 2UXDJ 3GFZA 3MMBA 1AW0A 3H25A 2EC0A 1YJTA 4BS2A 4EBEA 2HWHA 4QR2A 2IHR1 4DN0A 3W2WA 1JJ2R 4YDXA 3NWGA 3L7UA 1MNEA 2DGQA 3S6EA 3DNCA 1OS5A 4I7FB 5DG8A 4ELUA 2VC0A 4QWDA 3HVAA 3TZXA 3I87A 1X31C 2J0WA 2BW2A 2OMOA 2HFOA 7FDRA 2DRDA 5A2QY 2C2ZB 2IY5B 4RJVA 3DRSB 2HQIA 2WSFC 1RT4B 3THTA 4J90A 5E2QA 1CJUB 1CPZA 3MCMA 2V8HA 3HDSA 1KLNA 2CQ4A 2DNNA 2KZZA 1Q95G 3FCWA 1SJQA 1DLOB 2ILZA 1GEHA 1FRIA 1Y5IB 3HVTA 5BYRA 2W7AA 3TR5A 2VFUA 2KYZA 3JSMB 3M2RA 1TFWA 3QWUA 2FJWA 2DY1A 4DF8A 1S59A 4NMLA 5C25B 3ETMA 3MFHA 1FJEB 3HHLA 3ITHB 2JFDA 2QLJB 3CCLS 3V6HA 3I9ZA 3G4SS 2BJEA 1HI0P 3CJKA 3TJAA 1N5YB 3NWRA 1R0CB 3J7YI 3QSYB 4KH0B 3KDNA 1SXLA 2JH3A 4DSIA 1S0MA 2HKEA 2O66A 1FRLA 2BZ2A 2J7WA 3MPUB 4IG3A 1TTHB 3PNIA 5A8WB 4EEYA 2H4WB 4DQIA 4OI1A 1EIYB 3BQ1A 3O3LA 1HFEL 2ZITA 5D0GA 4JI7J 3N6NA 4OX7A 3U1MA 2DPIA 3RB6A 2QT7A 1RGVA 1GK8A 1R89A 4H4KC 4JI8F 3CCVS 1Q8BA 1O0PA 1M1KT 1TL4A 4MK8A 5HJYA 4USIA 4WBFA 4OJHA 3HULA 1XJWB 3OL8A 2E29A 5U47A 1RT2B 2ZH7A 2QA2A 3AD7C 4HACA 4TNOA 1X9SA 1ZBTA 1R8AA 1FTRA 5KFOA 1HMVB 3PX4A 4CYUB 1B0TA 4KBIA 5ADZA 3FRZA 1RCXB 3O5TB 3LF0A 2AJ4A 1WD6A 2V69A 2DNPA 1T3NA 2XTJP 3KG0A 2QC3A 2VPZB 2OI2A 3LAKA 4IDKA 1KVIA 2J6SA 5C24B 5T7LA 1RBLA 1RAEB 3IC1A 2CKWA 1NEEA 3VAKA 4WCEQ 4QWCA 3L3CA 4KKOB 1HBUB 2XMWA 4NWBA 2ZKTA 3OVSA 4U7CA 2JLGA 1WEYA 3LAMA 4ZLNA 4DN9A 4C8ZA 1CJVB 4ZLPA 2MPUA 1HI8A 4OHZA 4ECQA 2P9EA 3KJVA 1SIZA 2PEBA 2PA3A 1JKHA 2CJKA 1IKVB 5HBMB 4LSZB 4N8OA 1RTJA 3GONA 3PACA 3TVZA 2MKHA 4JB8B 3DLGB 3GCWP 4NXNJ 1NDPA 3D6MB 3FK4A 3KMSA 5IS2A 4NOHA 2R42A 3HI9A 2BJ7A 3AODA 1YBUA 4RUHA 1Q1KA 1NK0A 2FHJA 2AZ3A 4KO0A 1S7IA 3GMGA 4UOHA 4NYOA 2KDOA 2KFZA 2BKNA 4RKUC 2J9CA 2BM1A 1SBRA 2V8GA 4DQSA 3EZUA 4MKBA 3TVKA 3PX6A 4KC5A 2UUBF 3QT8A 1HQEA 1SV5B 3ZZYA 4C8MA 1I94J 2ZH6A 4I6YA 3FEXB 4Y28C 3HFKA 1XNRF 3UDLA 1MSWD 1RWKB 4B3RF 5IZHA 4ANEA 1RKJA 1QAXA 3W65A 4RW7B 1RADB 4J9VA 2BANA 2DVIA 1S1TB 2F1FA 2JFKA 4OHXA 1NK4A 3PYDA 4M5MA 1KR4A 1YZ7A 4ZJLA 2HZAA 5BR8F 3TQEA 2DIVA 4MKVA 3B6BA 1TQLA 2E1MC 3KLEA 1VBXA 1RQ0A 2KN4A 2QE5A 4CLTA 3K5MA 3OVBA 3HKWA 5IV4A 1LNQA 4JI2F 4ZLLA 3AT1B 2DH9A 5EWFA 1JLEA 1RHRB 2GVZA 1KBRA 3A13A 2M52A 4ZJQA 2Y8WA 2HGLA 3H5XA 4EMDA 3H7HB 3DGVA 1KP6A 1MROB 2DEIA 4NASA 5I3UA 3TQ1A 3T5HA 3V2UC 4LSNA 3I96A 1N48A 3KLGA 4C3MA 4WFYA 1X4FA 3UI3A 1S77D 3NP5A 4K4SA 2XHCA 3MEDB 1IM4A 4MKYA 4F0MA 5AE3A 2HEKA 2XMVA 4KT0C 4DWIA 1C2PA 3Q89A 5HAOA 3JYTA 2CPFA 4FYDA 3PRBA 1KHWA 3CXCR 2GJ2A 5B09A 4ELTA 3QGIA 1Q8IA 2HVIA 2J0XA 1TKTA 3TUZC 1SH3A 3AH6A 3H42A 3GJTB 1VOMA 4C3LA 4DPOA 2CVIA 3QIPB 2B3TB 2FYXA 3FCHA 4DQRA 3W60A 1MMLA 2W9CB 1NJWA 2CQ2A 4XTTA 3V6DA 1WC4A 1YSJA 1ZTWA 3PRVA 2BR0A 3CCES 1A9NB 2HBZB 1JB0C 5KG6A 3I55S 4ZVUB 2NPFA 1S57A 1DQ8A 5J2QB 2EK6A 4YN3B 5B0DA 4NLVA 2MEWA 3BPSP 4DL3A 3KXDA 2WONA 4HT5A 4C6AA 2MKIA 4ZPAA 2I6WA 5CYMA 4IYQA 3HFVA 1SL0A 1N34J 1T9TA 3L9ZA 1U09A 4DCJB 4Q0BB 3H40A 6FD1A 2PC6A 1JJHA 2VJVA 4ECUA 4CDIA 4ZPTR 5CCLA 2KO1A 4B9MA 1SQFA 4DV4J 4B3OA 2B8QA 4H4OA 5BYQA 2XS7A 1RACB 1YX2A 4ED3A 1ZS6A 4L6V3 5HMZA 2P6SA 1RT3A 1K44A 5DDOC 1HBNB 1S1VB 4UUXA 1U2RA 5B0CA 4M5NA 4MIWA 3PX0A 3KK1A 1U6FA 1ZM2A 3U27A 4C11A 2CIMA 2QA1A 2FJDB 1WSVA 1XMBA 1DARA 4R0EA 2MGZB 2HAFA 4BCAA 4ED1A 2F9JA 3MPDA 3V81A 3Q8QB 3N0VA 4CO5A 2DNMA 3K89A 2HVHA 3DDIA 2K06A 2B9EA 4F7VA 1FJGJ 4ECZA 4ALZA 3C15A 2Y1LB 3H5YA 3HXMA 2XMUA 1PIEA 2NCKL 3TUIC 2K3KA 4ZITA 3QZ7A 2BJDA 5D4NA 2PEHA 1BQNA 2Y0SD 4E8UA 1RHMB 1NDLA 3W2VB 2ZNZA 1AZSB 1QVGR 1UP1A 4DV6J 4UY85 2VG6B 3AXKA 3OR1A 4A8XA 1G2EA 1TKZB 3K7RA 1KS2A 1NUEA 4OHWA 4DR2J 3SEOA 3GPAA 4LF2A 1WDTA 2O5DA 2RQKA 2NUUG 1BXNA 4ZCKA 1U45A 2HHSA 1B0PA 1DFDA 1N0VC 2E5LJ 4V19X 2FZCB 5F9LA 1R8HA 3OL9A 2C42A 2V8PA 1Q82T 1T9UA 3K59A 4LIRA 4QWEA 2LDYA 5KAKA 3FSIA 3FRYA 4N77A 2AP6A 1IR1A 3PZPA 2OD6A 2C1EB 3EYZA 1T94A 1LWFA 1OQ6A 5IT9Y 3CPWR 4O3SA 2NXJA 3KK3A 3NCRA 2A6MA 1PC4A 1YK9A 5FDLB 4DF4A 4O3OA 1X9MA 2FHJD 4CLLA 1TKXB 4B3MF 3JQMA 5J1PA 4IRDA 3DLKB 3L95X 5HROB 1UFWA 1GMWA 1K0VA 4V19J 2MQMA 3QIDA 2QA4G 1VK3A 2KXHA 4DUZF 2FY8A 1XC9A 2CZ4A 4WFBQ 4FNIA 2DH7A 2ILYA 4ID5A 2EFVA 4AL6A 5C7PA 2WB1D 4MYTA 3CCQS 4DX5A 1XWLA 1LK7A 2KXNB 1YRUA 2NR0A 4DR5J 3MEGA 3NS7B 3EVWA 4HH1A 4WKRA 1EQMA 3ZTQA 1KC8T 1O51A 3OTBA 1X5PA 3TAQA 4PAAA 5ETTA 2FUG9 1ZA1B 3MFIA 4ZOSA 5LSLA 1SJRA 1V5IB 1GH8A 1T3OA 2VA3A 4KSEB 1TUGB 2RAQA 1D9FA 4DV5J 5ETOA 4X4OA 1Y3JA 1EKRA 2XEXA 4V1Ak 4YQWA 1EAYC 5JVGQ 4DR3J 3DOKA 4WU2A 5D4PA 5CHCB 3FSYA 1NPPA 2HLTA 3SQOP 1C4CA 2AJ1A 1ZETA 3NOCA 4ANCA 2FVSA 3I6PA 1RT1A 2KVIA 1ZM9A 1TUVA 4M5DB 5C2CA 3OL6A 1NK9A 3HHNB 1FWPA 3SV4A 3SI8A 4NCGA 1HWJA 3PXGa 4F0HA 3OFGA 4RNMA 1UJ6A 3Q8PB 1N36J 2EFOA 1B64A 4OYXA 1PBAA 2QFIA 4WZQA 2F40A 2ZUGA 3DLEA 4IH7A 5G0RA 1TP7A 3PW2A 2KFNA 1NU4A 3AOBA 3BDPA 1CJKB 1U1OA 3PFOA 4N41A 5DG7A 2DNHA 4K7QA 9RUBA 2D3UA 3HF5A 3J81Y 2BOPA 2E7XA 2ZH5A 1UFKA 2FLNA 2OPPA 3FDSA 3DYAB 2XS5A 1RHKB 2OIHA 3I4HX 2YWHA 5GAGI 2BE9B 2WVBA 3BH6B 4PABA 2HFSA 4EO8A 1NJIT 3RR8A 2V8VA 3NS5A 1FK9A 2C3PA 3B4MA 2KJWA 1JX4A 4EU0A 2VD3A 1FERA 3LPEA 3FBEA 4P7VA 3DU5A 5A6PA 4FKXA 4HT7A 5HQLA 1T0TV 3A8IA 1A7GE 1SJ4P 3ICLA 3C6UA 2YKOA 3V4IA 4ED5A 2DIUA 3U7JA 3A8JA 2D1CA 3FJ2A 5LMUJ 3MD3A 4I2QB 4DR7J 2BRLA 2HW3A 4A8OA 4M5LA 2MQ8A 4FYYB 2A10A 3N4WA 1KHVA 3MM7A 2DKOB 4J7CA 4OZ2A 1R8BA 5B7WA 1Y7PA 3LPYA 1YITS 3G71S 4YR2A 5J2MB 1N56A 3PHEA 1XR6A 3VAMA 2MXYA 2FHOB 2PI5A 2XO6A 4HH0A 2Y0BB 2B51A 4DZDA 3CCZA 1NKEA 4CLUA 1OSCA 3A4TA 5ETVA 4JI7F 3M6UA 4NLUA 1M1HA 3QJPA 4F36A 3C16A 2OP5A 1IJEB 2D3ZA 1B3TA 2WZ1A 3C46A 2Z2LA 3CJRA 1TVRB 1LV5A 3HX9A 2ZM6J 4QIVA 3UD4P 4M5HA 3FGVA 2X1GA 1S1UA 3VR1A 2M8HA 3R3TA 3US5A 2KM8B 3KDOA 1IR2A 3LWLA 3MM8B 1KVKA 1KDNA 5KFSA 4AQYJ 2VPYB 3C14A 5DO2A 4AL7A 4L72B 3R1HA 4JI5J 3QRPA 1WF0A 2CQBA 2RILA 1AFJA 1HHTP 2VOPA 2PI4A 1REVB 1S7HA 4DOZA 2W2NP 2W4DA 1NSQA 1U2FA 2Z30B 3MM6A 1HLWA 4K4ZA 1G1XA 4DV7F 1WHVA 2IRXA 3BN4A 2HHTA 3RW7A 4AYBD 2GVDA 1K0TA 2W2PP 3CIZA 1VQLS 1GTEA 1JLBA 4U7UD 4C97A 2JEJA 3D66A 4QJVA 3BM7A 4URSA 2IIHA 3HLUA 3HFZB 2HZVA 1GMWD 2M7SA 3ENQA 1O8BA 4NXNF 1UEUA 1UA0A 3KJFB 1M90T 1SH2A 1ZH5A 1M5PC 4ZVOB 4HR2A 4KE5A 2YY3A 4KV8B 4K2XA 3CD6S 3QPIA 2FVPA 4F67A 5KT3A 3NG8A 2WBRA 4NLSA 2HFVA 3VAIA 3SDEB 1GMUA 1TV6B 5I42A 1BGXT 2VICA 4OZ1A 4ZPVR 4DSEA 3RJMB 5HMXA 1I94F 4O23A 3J7A1 3W7BA 5IT4A 5KG7A 4LQ3A 4JYAJ 3QSIA 5E3AA 2F9DA 2CVEA 2RT3A 3I5BA 3DOLA 5D4OA 1R8CA 1S72S 1RDRA 4Y00A 2GMHA 2BX6A 1RAOA 1YJWS 1NO8A 1F2HA 1R6YA 3MUVP 1G3OA 3DRPB 4N8NA 1DLOA 1H3DA 3PHTA 2XLKA 3W8GA 2XB2D 2D3O1 3VZIA 1W25A 2JDJA 1WC1A 1RAGB 3W9HA 1LW2A 1WEXA 3W1YC 3H2LA 4AFFA 2GO8A 1IWAA 3N5FA 4RNOA 5LSOA 3B4DA 4L3NA 2M88A 1X0PA 3IAM9 3JAMY 3UNGC 1QAYA 4PWUA 4CLZA 5DGBA 2HURA 1S9GA 2IBKA 1YRTA 2JC0A 1GXUA 3OFEA 1NDCA 2JWNA 1GX5A 1S10A 4QU7A 3QWPA 1KOOA 5D15A 4BWMA 4PR6A 4X4PA 1RWWB 2HIQA 5IM0B 5K14B 1JLQB 2R8KA 2HMIB 5HVFA 3WX8A 4K4YA 1T9WA 4P6QA 1R3NA 2OH2A 1X4BA 2CG4A 1O5JA 2QV6A 5D6GA 1VQOS 3KLFA 1IQTA 2QEXS 4DSKA 1BWVA 5FIIA 5E5NA 3TARA 1ZYQA 2HHWA 2RHQB 2QSFA 2EPIA 3IS9A 2A0FB 5SUHA 3DLBA 3KHHA 2B6AB 2QYCA 1B99A 1KQGB 3R5BA 2DJWA 3AFGA 1CULA 1RT2A 4EYIB 4DL6A 5EGYA 4A8MP 3KJQB 4U6PA 2CQDA 2RMLA 4NZ6A 3MUMP 4CYUA 3IGVA 4PPZA 4TU9A 2J6TA 3W9JA 1FHTA 4E0DA 5KFEA 1Z4UA 2IC3B 1N34F 2CQIA 4KTQA 4H4MB 5CABA 2PN6A 4O4GA 2GQQA 3WC0A 1I3OB 1UW9A 4DV4F 2H65B 4ECRA 1N5VA 3TEHB 2RUGA 5LXYA 3MMAB 2YKNB 4HI1A 1CJVA 4NEYA 1HA1A 4ENOA 1VISA 2ATCB 2V63A 3GE9A 4O44B 5F8HA 1CC7A 4RPFA 3PEJA 2ZEJA 1HNZJ 3H59A 5HBMA 2V4QA 2F63A 1S4FA 3PW5A 3MF5A 1NK6A 2FHKA 4TXSA 3CJ0A 5CD4H 2W2QP 3O2IA 3KYLA 3TO8A 4K50A 4PXEA 1G7CB 4R8UB 3BO2A 2GO9A 5DQGA 1FJGF 1FF2A 1XN9A 2KT2A 4NPOA 1JLAB 5SZTA 2ZFHA 2ASYA 3KLHB 2ZJQQ 3GV8B 3N6MA 1VQ7S 1IVZA 4U8VA 4U7UK 5CQGA 2HS4A 1FEEA 3R7BB 4KGZB 1T03B 1NRKA 5JVHQ 3ETOA 1MG7A 5M2PA 3HP6A 3Q2SC 2W8LA 1NKCA 1CG2A 2QA4S 5B0EA 5J1EB 3PEHA 5J2NB 2XI2A 4DV6F 2IMOA 4LF6J 2JHEA 2RS8A 3LQVA 2ZBRA 2LQBA 1WOSA 1OY8A 2VV5A 2VASA 1LW0B 3H8YA 2R2UA 1NPRA 3IBFB 2JC1A 2E5GA 3ZTPA 1U0HB 1LWCA 4G3IA 4Z2XA 3VTIA 3WDOA 3M32B 1FWLA 4HI2A 4FBUA 2VHGA 2E5LF 3VV2B 5B0AA 4FBTA 4PG8A 4OV1A 3R5GA 1WACA 2V2QA 5F8IA 5M2RA 2VDIA 1PJ6A 2YWWA 3UFCX 5CXTA 3BN7A 4LUBA 4P10A 3MEEB 3QFWA 1T02A 1PKUA 4DV2J 4OYZA 3SCKE 1ULRA 3F0NA 1FEHA 5IC4B 5E3CA 1TL3B 2XYGB 4TYAA 1HNIA 3TEGA 4RBTA 2J9EA 1C0UB 3P3DA 3NXZA 2BVZA 3MPVA 1W7WA 3ENVA 4LFAJ 2PFFB 2M70A 3AJDA 4BC9A 1PJ7A 4EUVA 2DR7A 4K8RA 1XNQJ 2FJBB 5KFQA 1V9OA 2VL1A 1X7VA 2A3JA 2RD5C 4X64J 2OKQA 1CJTA 4FVMA 2HIYA 1U1KA 3MM9B 1FNXH 2VG7B 5K8PA 3CO9A 3BSAA 3AHPA 4DR5F 3ILIA 2PMWA 4NEZA 4MAKA 2ACMA 3QIPA 4WTOB 2EVZA 3G82A 4PRFA 1H73A 4NI2B 4OJGA 3N6LA 1KWMA 4CO4A 2FD2A 1FCAA 1GAOA 3ET6B 2GAHC 1EP4B 1BHNA 4ZLJA 2WVDA 3FSXA 2MKCA 1BQMA 1UWAA 5J2QA 4RUAA 4OX8A 4ZHRB 4IR1A 2CJYB 4DV5F 4FF1A 1VIXA 4CP5A 3JTPA 3FQKA 3ENAA 4HHUA 4DR3F 1HBOB 2CPIA 2BKPA 3I0RB 3M9OB 2L9WA 1FKAF 1FO1A 4CWBA 2AEJA 1F2GA 1SKRA 3P49B 3D67A 4X4UA 2DNZA 1N88A 3TWZA 4EYHB 2LMIA 1IJFB 2ZE2B 2F8MA 1S0VA 1PSDA 1B0VA 3DRXA 1HD1A 1N36F 4UW2A 3K0JA 1D1UA 4Y2AA 2QMXA 2IJFA 2XWYA 1HBNA 1S1VA 2FC9A 2F4FA 2J7KA 4MTPA 4Q44A 4JBCA 4U9RA 2VA2A 1T05A 3BV8A 4C0OC 3C3LA 1MMDA 2XZDB 2R4FA 2DHGA 3PYFA 5LL6d 3E01B 1YJNS 1HNWJ 2E7WA 4BHQA 3DMJB 2LKZA 4U67Q 4GRSA 1WG5A 3QAUA 4IO1A 3DI6B 2YBVA 3IWNC 3JXOA 1VC0A 2XI3A 2N7YA 3T9NA 3NAIA 2V9WA 1MMNA 3G6VA 2VG5B 5KG4A 2AF6A 5KFTA
chains in the Genus database with same CATH topology
2GIRA 1VJWA 3V4IB 2CDQA 5H1SV 1Q1KA 2OPSA 2LXUA 5HI7A 3K59A 1NK0A 2FHJA 2MDAA 4A8SA 3MTJA 1SUQB 1YJVA 3CDWA 4KO0A 3EGNA 4KV8A 3GMGA 2CPYA 2F3JA 1FDNA 4K5SA 3MGJA 4NYOA 2RVJA 3TA1A 5LMUF 2UVVA 4DR7F 2M0GB 1U1NA 2HNDB 2B0GA 2KDOA 4LSLA 4HDGA 4O3RA 1FNMA 2IJNA 4TLRA 1DHMA 2KFZA 4RKUC 2KJVA 2GIQA 2J9CA 2BM1A 3CDUA 3VF0B 1SBRA 2RRBA 2V8GA 3IWXA 4B3TF 4QPXA 2KHCA 2HHQA 2WOMA 4DQSA 4X4QA 4DFPA 3EZUA 2I8EA 3T6JA 2UV8G 2ZOGA 3M6VA 4MKBA 3TVKA 3SDEA 1H38A 4X4NA 3PX6A 2ZD1B 2X1BA 4OI2A 3PKYA 4KC5A 1FD2A 2UUBF 1TL5A 3MM7B 4EWTA 4QWBA 4J9MA 1HQEA 1DQAA 1TV6A 3FMWA 1SV5B 2Q79A 1WI6A 3CIMA 4CO2A 2F8HA 1E6YA 2MZQA 2RNEA 3ZZYA 5F3ZA 4C8MA 3A1YG 5AXNA 2YKMB 4B9SA 3NMAA 2ZH6A 5JJBA 2UVWA 4OQJA 4DJBA 2U1AA 5H9EJ 1Y4ZB 2ATLA 1M5SA 4I6YA 3FEXB 1P9QC 4Y28C 3CCUS 3HFKA 2VB6A 3PJXA 1XNRF 1LK5A 3UDLA 1MSWD 1HW9A 4B3RF 5IZHA 1DTQA 1ZM3A 2B4OA 1RKJA 2RRNA 2UXDF 2MSTA 2P9GA 1FDAA 4RX6A 3M8PB 2RDIA 1QAXA 4RW7B 2HYIB 4DL5A 1MWZA 2NUHA 5LT5A 4DFJA 1A6LA 4M1KA 3IN5A 4UY8T 2BANA 2YNFA 4NRTA 2DVIA 3TP2A 1S1TB 2F1FA 2JFKA 3GYNA 3C6TA 4OHXA 3OTEA 1NK4A 5CYQB 1G6BA 1KR4A 1FVSA 3RBDA 1K73T 1GXLA 4O0IA 4IO9Q 5L8RC 5BR8F 3TA0A 1NB7A 2APOA 3W2WB 2E1AA 5AE2A 5F41A 2DIVA 3RRGA 2FJXA 4C8NA 3NNAA 2IAJA 2E1CA 1TQLA 5GADU 2E1MC 2YNHB 4IOBA 4CH7A 3KLEA 3HPOA 1VBXA 1RQ0A 5HMYA 3GIJA 3DRPA 4FVCA 3BREA 4J9PA 1VQYA 2KN4A 2QE5A 2ACYA 1GX6A 3K5MA 1S1UB 3OVBA 2ZM6F 2HGNA 2ZNYA 3CJ3A 4Q43A 2YNIB 3GIIA 4DFMA 3HKWA 2PE8A 1LXJA 2YKQA 2Z0GA 4JI2F 1E6VA 2DNGA 4CTAA 2W9BB 4NRUA 1S9EA 3TRGA 1RTDA 3DLJA 2DH9A 5EWFA 3M2VB 4RW4B 3HHLC 4URQU 1U47A 4RU9A 1JLEA 2PA8D 4WXOA 3PIOQ 3G6YA 2UP1A 4RW9A 2VQFF 1U1LA 2V2KA 3S1TA 2JSXA 1FESA 1L3TA 1XEZA 2M52A 4YP3A 2I0XA 1UFLA 2HGLA 5HLFA 2G13A 1WHXA 3GG0A 4Z37A 4AQYF 3H5XA 1RKIA 4N47A 4RW8B 3ZZOA 4RUCA 4PKDB 3M1VA 1TAQA 3LP0B 1KN6A 3CSKA 2OSQA 2NQPA 2DGWA 4NL5A 3MMCB 1MROB 4JI5F 5I3UA 3TQ1A 3T5HA 3V2UC 3EZ5A 4LSNA 5KT5A 1F60B 3I96A 4Q45A 1N48A 3KLGA 4C3MA 1NJZA 1DBDA 1GNKA 1WG1A 4WFYA 3V4MA 2CPXA 1X4FA 3UI3A 1S77D 3IAS9 3NP5A 3HVTB 2BYCA 5GAEU 1J5OA 4K4SA 1SB6A 3MEDB 5B0FA 1IM4A 4MKYA 4KAIA 3CCJS 4QIFA 2BE2A 5AE3A 2MSSA 4A8KA 3MM6B 3C2PA 2LU1A 2XMVA 3M4XA 4KT0C 4DWIA 1C2PA 3C66A 3MDFA 3JYTA 1HD0A 3WX4A 2CPFA 3NRBA 2AGOA 2ROPA 4DL2A 1U49A 2X3GA 2E9ZA 4PWDA 4FYDA 2FLLA 1Q79A 5IM0A 1U24A 2AJ0A 4PCQA 3IRWP 1QLNA 1JLQA 3TANA 3PRBA 1KHWA 3PFEA 3RYLA 3CD7A 3ZZRA 3KWMA 3I9V9 5L1LA 3CXCR 1XNQF 2GJ2A 3D0IE 5A0YA 3HHLB 2HRYA 5B09A 1M5OC 4F2SA 1TK0A 1FXDA 3NAHA 5GVQA 2HNYB 4ES3A 4ELTA 3QGIA 3MECA 1JLBB 4EGLA 2NSCA 3CMES 4JI3F 1Q8IA 2HVIA 3M2UB 2GGPB 2J0XA 1ZTTA 2ZC3A 4C8YA 2ZH2A 2HHPA 5IWAF 1TKTA 3K5LA 4FPRA 3TUZC 3KOAA 3M8SA 1XTZA 4HL9A 1SH3A 3AH6A 5B0GA 4QU6A 1VOMA 1OSDA 2PMZD 4TLQA 4C3LA 2IA6A 3K2YA 4DPOA 1RYSA 1FNOA 2CVIA 2Q6CA 4OZJA 3QIPB 2B3TB 1OPZA 1S1WA 1Y5NB 2KI2A 4PUOA 2V4RA 6FDRA 2EG2A 1VQKS 3MAHA 3FCHA 2RQ4A 4DQRA 3Q2TC 5D3GB 1Y5LB 4LF9F 4IOAQ 1IKXB 1CQNA 1FE0A 1QSSA 1JNZB 1MMLA 1ELOA 2W9CB 2LEPA 4NYPA 3OBIA 3CJ4A 3M9NB 1VRUB 1FTCA 1VRTA 3HVWA 1NJWA 2CQ2A 2DISA 3M6WA 1YWXA 3SZ2A 3V6DA 3FFIB 5E41A 5LXRA 2B6AA 3VAGA 4IR9A 4EO6A 1YSJA 4Y65A 1SKWA 1ZTWA 1OO0B 1YBAA 4IG3B 2KM8C 2BR0A 2ZKUA 2YTCA 3CCES 3OSPA 5GAHI 4FXDA 3WBZA 1A9NB 2CPEA 3GIKA 1JB0C 2D9PA 5KG6A 2KXFA 3I55S 2NPFA 2KU7A 5KG5A 4LF8F 1WHWA 1DQ8A 5IXUA 5J2QB 2QLXA 2EK6A 4LJMA 5B0DA 1FD8A 4O4RA 2UUWA 1X4EA 4ELVA 2IRUA 4NLVA 4DL3A 3R27A 4DQPA 2L9DA 4ED7A 2K7JA 1S6QB 4R5PA 3GSDA 4OIXA 2WONA 4HT5A 1IBMF 2POKA 3RZAA 3OSNA 3AAWB 1TK8A 5I42B 1LOUA 2MKIA 2WTFA 1LWEA 4ZPAA 2V9KA 5CYMA 3VWSA 5F8MA 1J2VA 4RWWA 2PIIA 1S6PA 2EFGA 4IYQA 5DG9A 4MJKA 2RKIB 1HPZB 1ROFA 4F26A 2MZ1A 1SL0A 1JIHA 3VQSA 4WFNQ 4DHVA 1U09A 4Q0BB 3G8QA 4LQ9A 6FD1A 3H40A 5HP1B 2AGQA 2PC6A 1JJHA 2IC3A 3LP1B 4ECUA 4WE1B 4FNHA 4GC7A 4ZPTR 5CCLA 1JJ4A 4LFBF 3GR0A 1Q53A 3FQLA 2KO1A 3DOLB 4JYAF 4B9MA 3OV7A 2IYIA 5DLFA 4B3OA 2XMMA 2R7RA 4H4OA 1Q86T 4OJ3A 5BYQA 3CJ2A 3OL7A 4IRKA 3JB9k 4DG1A 3ZZTA 1HYSB 1EETB 1M0SA 3EUNA 2XS7A 2FGOA 1GT8A 1DAXA 1JLGA 3BGRB 4ED3A 1X8DA 3MD1A 3K8VA 4G1IA 2P6SA 4L6V3 3U02A 5HMZA 3MMAA 2HNZB 1RT3A 2YKNA 3OR2B 1H2UX 5DDOC 1HBNB 1S1VB 4UUXA 1U2RA 4G6VB 2HVZA 4DX8H 5B0CA 2R7QA 1VIOA 1QAJA 3QJLA 4J5OA 3MM5A 2EFQA 4MIWA 5KFPA 2Y1IA 4O44A 3PX0A 3KK1A 1L5UA 3GYXB 2ZJRQ 3BSNA 2I38A 1U6FA 1ZM2A 3U27A 4C11A 5L1IA 2CIMA 2QA1A 1C1CB 4R0JA 4ZK7M 2CQCA 3GG1A 3G8SA 1S76D 3POTA 2FJDB 2FVCA 2NYIA 1LW2B 1DARA 1XMBA 4I56A 1N5SA 4R0EA 4DDFA 1X4AA 2MGZB 1YIJS 4BCAA 4ED1A 4I2PA 3DFEA 3CMAS 2F9JA 3VZHA 5KFCA 2G1DA 2BBEA 2FC8A 4DMZA 3V81A 2HWIA 3LH2S 1JLCA 2WSCC 3Q8QB 1SC6A 2WAQD 3N0VA 4CO5A 2DNMA 2JZ5A 5DQIA 4CNZA 4N76A 2HVHA 5KG1A 4WK3A 2DGOA 2EWHA 4TY8B 3G96A 1HNWF 4R8UA 5GAGU 5LSRA 4ECZA 2ZZMA 4ALZA 2DNOA 4JV2A 3BGUA 2XNRA 2ZBCA 2OFHX 2IM3A 1XMOF 3OVAA 1JLAA 1S9GB