2HZEB

Crystal structures of a poxviral glutaredoxin in the oxidized and reduced states show redox-correlated structural changes
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
108
Chain Sequence
HQMAEEFVQQRLANNKVTIFVKYTPFCRNALDILNKFSFKRGAYEIVDIKEFKPENELRDYFEQITGGKTVPRIFFGKTSIGGYSDLLEIDNMDALGDILSSIGVLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin-1
publication title Crystal Structures of a Poxviral Glutaredoxin in the Oxidized and Reduced States Show Redox-correlated Structural Changes.
pubmed doi rcsb
source organism Ectromelia virus
molecule tags Electron transport, oxidoreductase
total genus 35
structure length 108
sequence length 109
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hzeB00
1M99A 2WCIA 3M9JA 20GSA 3FRCA 1XW6A 1X5EA 2L4CA 4O7HA 3ZIJA 4ZB6A 2NVLA 3CRUA 5IMCA 3APSA 1NSWA 2DJ2A 3WT1A 4RUVA 1XW5A 1GTAA 4RQXA 1HQOA 1URMA 3FZAA 4MPGA 2HYXA 1ERTA 2ZUPA 4KDXA 2FLSA 2LJAA 4JR6A 2IMIA 3IOSA 2CZ3A 1DBYA 2O85A 3UAPA 3A2XA 3FY7A 1A2LA 3GH6A 1MDJA 4HJ2A 5DQYA 1WOUA 2PVQA 2HZFA 3M1GA 2KHPA 2LJRA 4DSRA 5GAPD 2LRTA 2PU9C 4K7OA 3PGTA 4TR1B 4WF4A 3HD5A 2PMTA 5IMFA 1XOAA 1CQHA 2PGTA 3RAZA 5IOWA 4I6XA 1VGLA 3IC4A 4IN0A 2FWFA 3GKMA 2BJXA 1Z6NA 1GNWA 1SK2A 4ZIJA 3EVIA 5JWOB 2CX3A 4ZBDA 1JZRA 2EC4A 2VL2A 3KCMA 4MF6A 3HZ4A 2GZPA 3O3TA 2C3QA 5HR0A 2ALBA 5INYA 4G2EA 3GHAA 5F8BA 4HZ2A 3UL3A 2YN1A 2H74A 1RK4A 1DSBA 3IPZA 4IBPA 4ULXA 3L9VA 5ID2B 1J0FA 2H73A 3ZFLA 3GV1A 1FVKA 3MWHA 2FCHA 2OJLA 5KN0A 1B9YC 4KA0A 1SKRB 1QXHA 3GKXA 5ELAA 5C04A 2H1BA 5EVOA 1AIUA 3DWVA 5DALB 1YKAA 5DVBA 2HFDA 1QUWA 4I2TA 4PURA 2DJ3A 2PUKC 2YWIA 5LD0A 4MF7A 1ON4A 3TB2A 1PGTA 3LWAA 1PN9A 2KP2A 2N5AA 5J9BA 3TUEA 3EINA 2IWTA 2X99A 1TRUA 3ED3A 3GNJA 2GSSA 3VPTA 5DQSA 3KP8A 1JFUA 4ZILA 4BWQA 1XWAA 2RM5A 4GQFA 4WEYA 2CVBA 1S3AA 2VCQA 3TRQA 2RM6A 2RLIA 1X9SB 4IHUA 1RQMA 2HZEB 4NMUA 2VIMA 4MZBA 2DIZA 3D4MA 4XS4A 4YQVA 2CZ2A 7GSSA 3ISOA 2NPBA 5A4VA 3DRNA 2LQOA 2GT6A 2QKEA 1BAYA 1ZYQB 2O89A 3N9JA 2R37A 4KB3A 1PL1A 2Z9SA 2CVKA 2N5FA 3DVWA 4MP4A 4QQ7A 5D9WA 3EMPA 2K8VA 2K9FA 1TXXA 4GRFA 3EMXA 4IELA 2CT6A 1XBSA 1WIKA 2JL4A 1OC8A 3L78A 2H6ZA 3WYWA 3ZL5A 2BTOT 2X8HA 2YPMA 3P2AA 1MDIA 1SJIA 3UBKA 1UVZA 1PX6A 4L8EA 3TKSC 5KN3A 1GTBA 1HNBA 2GZYA 5ECIB 4X0XA 5AN1A 3QDNA 5E4WA 4KH7A 3J7Yb 5GSTA 3U5RE 4ML1A 2YZUA 4XRAA 4GLTA 5ECPB 1PKWA 1T4ZA 4TOPA 2WJUA 4HOJA 3ZITA 4FYCA 3CTFA 2CX4A 3UEMA 3TKSA 2MBSA 3MSZA 1OYJA 5CRHA 2C3NA 4OMVA 3SWLA 2MMAA 2LKUA 4PGTA 4KNDA 3I6AA 3PR8A 1T3BA 2FD3A 2IFQA 4K7IA 1UN2A 3F4RA 2E2GA 2IL3A 3TKRA 1TK8B 4V1Ag 2OKAA 5CO3A 1ACVA 4J2FA 2H6YA 2C3TA 3VPQA 2B5XA 3ZYWA 1Z7PA 5ECLB 4KUNA 5FT3A 2YV7A 2H72A 4G19A 3TJKA 3ZREA 4YQMA 2AHEA 4K0NA 1WJKA 3PH9A 3EURA 4TN8A 2PN8A 3HXSA 5G5EA 1NW2A 3F9UA 1K0CA 2L5OA 1GL8A 4MCUA 5IM9A 1X5DA 2XPEA 3IA1A 2A2SA 3TJGA 4GCIA 1IYIA 2AB6A 1A0FA 1PL2A 1OKTA 3ZTLA 5J5NA 3EU4A 4GWRA 1TI1A 3RPNA 2VLUA 3GTUA 3WGDA 2K18A 1TRWA 5LCZA 2H6XA 2WULA 3APQA 4WBRD 2H70A 3FYGA 4EC0A 3UOMA 5COHA 2QGVA 5DJMA 1PKZA 1TU7A 3W8SA 1W4VA 4GXZA 5HFKA 4F2IA 5EY6A 1WWJA 3ME8A 1GNEA 2GSRA 3GL5A 1VF1A 3E0UA 5D93A 4N30A 3IK7A 2FGXA 2KLXA 1WMJA 1YF0A 1RW1A 1GWCA 4OCFA 1S3DA 1CQGA 13GSA 2IMDA 4AGSA 2H66A 2LNTA 1GSDA 2GQKA 1LU4A 3D5JA 1SL0B 3QAVA 3LXTA 4EUYA 1TI3A 4AJ7A 3KTBA 3FR9A 4PNGA 3P8WA 2YZHA 3KP9A 4HEA2 1ZGNA 4PUAA 2C0GA 2VO4A 5DCGA 2B5YA 3GURA 2PWJA 2HSHA 1HNAA 3D22A 3F0IA 2EIRA 1EEJA 1M2DA 3HJPA 1ABAA 3LJRA 1GSSA 4KSOA 4TRXA 1XVWA 3GN3A 5KN1A 2MMNA 2B1LA 1GSQA 4J56E 4OO5A 1JZWA 2H1GA 3F6DA 2CVDA 1U3IA 1H75A 4YAPA 2CQ9A 2YJHA 4MH3A 2V41A 1M9BA 2B5EA 2CA8A 5HFGA 3TDGA 2L57A 3ZIVA 1XVQA 3WGEA 4EDZA 3C7MA 1XPVA 2H8LA 4WETA 2TRCP 1HNCA 1GUHA 1B8XA 4K7NA 1G6YA 4EVMA 2VLVA 1QFNA 4IKHA 2OE1A 3FW2A 1F3BA 4F03A 5G5FA 4NHZA 5JCWA 5ECRB 3NZNA 4GSSA 4V2MA 4YQUA 3IAS2 4F9ZA 1A8LA 1PQNA 1V57A 1QQ2A 2CAIA 2G2QA 2YWOA 1OC9A 2N5BA 2HE3A 4MDCA 5HR2A 2I9HA 3EYTA 1G7EA 1BEDA 4YAVA 1SD8A 3GFKA 5IMDA 3GX8A 4HUAA 5A5KA 2AJQB 1O85A 3MAKA 5IO0A 2ON7A 3IBHA 1AAZA 1JLWA 1EOHA 4O32A 6GSSA 3W8JA 3DVXA 3M0FA 2KUCA 3KZQA 1S3CA 2DC5A 2JADA 5D73A 3P90A 4XRDA 1R26A 3IV4A 1XWGA 4EDYA 5FWGA 2FA4A 3LFLA 3MNGA 3TOTA 4KDUA 3KGKA 1GRXA 4FYUA 1PX7A 4BL7A 2F8FA 4F82A 2V6OA 3VK9A 3ZZXA 4ID0A 4OWYA 3ME7A 2XPDA 1O73A 2GZZA 3BCIA 1GLQA 2WDUA 1F3AA 1YKCA 3V1WA 4WR5A 2YWNA 3L9SA 2X8CA 4ZBAA 2R6KA 2OE3A 4IJ3A 2H0HA 5IO2A 1R7HA 1V58A 2K6VA 3ERGA 2ZNMA 4HS1A 1EV9A 3IHQA 1C72A 1YEXA 2R5GA 1KBNA 1EOGA 2I4AA 2HT9A 1PD21 2P31A 3F3RA 3UVTA 3VWWA 1GSFA 3QD9A 3FR3A 2HI7A 3ZVJA 2V6KA 2VAFA 4TXOA 4EO3A 2OACA 2B7JA 3KH7A 3LGCA 2DIYA 3IXRA 1F9MA 5CRGA 3IDVA 2HNLA 4POLA 3D21A 1ZYEA 3TOUA 1QK8A 2WFCA 4WF5A 4WXTA 1SD9A 5EPFA 4OO4A 1YQ1A 4OD7A 19GSA 4JZQA 2ZCTA 2LTKA 1YDKA 1O6JA 4L5LA 1UC7A 4HU7A 1Z7RA 1UA5A 4ACSA 1M9AA 1SYRA 3D0ZA 4AJ8A 3GYKA 1MD3A 2NBSA 1M7TA 3D6IA 4N10A 5DBQA 4RI7A 3CMIA 2MYGA 1V40A 3ZLPA 3NOFA 2E2MA 4MMMA 1X9WB 3ZRDA 5A4WA 1OE8A 1DUGA 4ZL7A 4MH2A 4TR4A 2VL9A 4O92A 3J7Yk 4EKZA 4NPBA 3VI7A 2MMZA 3DD3A 2IMEA 2GQLA 4ECCA 1JZOA 5G2ZA 3ZMLA 1I9DA 2AV4A 1AXDA 4LL4B 1B4PA 2L6CA 1GTUA 4XTSA 1K3YA 4GF0A 1XIYA 1AUCA 5IMVA 4NHWA 3TRPA 4K6XA 4ZB8A 2J9HA 2R4VA 4BWSA 3FZ4A 3M8NA 3PINA 1YJ6A 2FA8A 3UARA 2HRNA 1JLVA 1MEKA 3C71A 4POKA 5CAXA 2X8GA 4GSNA 1PRXA 4XIHA 4IJIA 3BBYA 2FUG2 4POMA 2B1KA 2IFQB 2OA7A 1BX9A 2E0QA 3WD6A 3DMLA 2VCWA 4ZXGA 2F51A 5ID2A 3G9BA 1AQVA 3R2QA 2O7KA 3UBLA 1Y25A 3FZ5A 4CHSA 4HZ4A 1K3LA 3F8UA 1SJ6A 5ENUA 2H19A 1SL2B 2YP6A 4KCEA 1A23A 2PPTA 5DALA 8GSSA 3Q19A 1YY7A 4EXJA 3CSHA 5B6MA 3GSTA 5LNKe 1EWXA 3UMAA 3TGZA 5E59A 2DMLA 1EGOA 2FNOA 2XBQA 1A8YA 2DJJA 1TRSA 4V1Ap 1GLPA 2NTOA 3C8EA 3KD0A 4DEJA 3APOA 5C00A 5KN2A 4XS1A 3LXZA 5H5RA 3GTUB 3F6FA 5HR3A 1SK1A 1T00A 1XWKA 1F2EA 1TU8A 2HZEA 1U3AA 3GSSA 1QMVA 3WT2A 5ELGA 1TK5B 3A5WA 3GKNA 4FO5A 4MZCA 1U87A 1A0RP 3I43A 2TRXA 5IOXA 1MDKA 2LRNA 3LG6A 5JCUA 3FK8A 1K0OA 1USBA 3KMOA 2M72A 1VRSD 1G7OA 3L9UA 3IRAA 2R2JA 4EF0A 2JSZA 5J9CA 4ECJA 1HYUA 1X5CA 9GSSA 2PBJA 5CYYA 4JBBA 1Z5YE 2H76A 2RUEA 1B48A 2GT5A 1K0DA 2MBTA 2VCXA 3KIJA 4KAEA 1OAZA 2XHFA 3CSJA 4JU5A 3FZ9A 1SYXA 4YH2A 4D73B 3QOUA 4HDEA 4MJEA 4LLRA 4N0ZA 5F07A 2C0FA 3LEFA 4PX1A 2ON5A 3CXGA 2WGRA 5GAND 4MA9A 3TJFA 3KJYA 2VUPA 3VFIA 2P5QA 2YV9A 3IE3A 4OFMA 1GP1A 1XWBA 2LRCA 4AJ6A 5DAKA 1I5GA 3C1SA 1OKDA 3SBCA 3VWVA 5D9VA 3Q6OA 3ERWA 4MK3A 2WB9A 14GSA 1YEPA 4TXVA 3NIVA 5JWQB 3GX0A 2EIOA 4IP6A 1XWCA 5G31A 4PNFA 1LBKA 3S9FA 5HQPA 2JZSA 4LL1B 4MZWA 2GS3A 4IQAA 1R4WA 5DCHA 2IJYA 2E7PA 2GGTA 1Z9HA 2VCZA 1J08A 4EE0A 4WKWA 3FEUA 3EWLA 3FHKA 2NDOA 2B6MA 3E9JB 5IQYA 4OCEA 3ZMKA 4N0VA 4TKYA 3RHCA 1EV4A 3G7YA 4DSSB 3BCKA 1TRVA 1XW9A 4DSQA 2V2GA 4I2UA 4MJBA 4G10A 3HDCA 1G0TA 1EZKA 1K0NA 1SU9A 4HQZA 2DJ0A 1KNGA 1WP0A 1WPIA 1V9WA 1KTEA 1E2YA 1GTIA 2HRFA 2OBIA 3FKFA 2YWMA 1PSQA 2WRTA 2L5LA 3O6TA 1Q4JA 4N11A 1Y6EA 3BOAA 4ZB9A 2C4JA 1OC3A 1FAAA 3QMXA 2P0GA 1FB6A 4DVCA 4I5QA 3D4TA 3KMNA 5B8AA 2P5RA 1TOFA 1TP9A 3LYPA 5ECQB 1JZDA 4K8MA 5B6NA 4IQ1A 3F3QA 5AISA 3L4NA 2H1AA 1K0BA 3M3MA 3H79A 5ABRA 2LS5A 4K2DA 18GSA 4X43A 2VL3A 1AW9A 2L6DA 5CRWA 1TDIA 2CV4A 1V2AA 3HY2A 2HXKA 2H30A 4PQHA 2H1DA 1PMTA 1THOA 1NM3A 3P7XA 1M0UA 3HA9A 3RDWA 4BVXA 4HQSA 3CRTA 2O8VB 1E6BA 2H71A 4POBA 2M80A 2LSTA 4F0BA 4KGIA 3ZFBA 4ECIA 1XFLA 4PUFC 2AUVA 3TJJA 2VLTA 1SJZA 2DBCA 2IPAA 4FH8A 4IP1A 3HVSA 3CSIA 3RHBA 1HD2A 2GSQA 5JCGA 3VLNA 2YNXA 4PXOA 3H4KA 1SENA 1JHBA 3IK9A 1SL1B 1XOBA 3MDKA 2EIQA 1O8WA 3EE2A 2LEGA 3HKRA 1GUMA 3UVHA 1B9XC 3LYKA 4HJMA 4IVFA 4G9HA 4KSMA 2BMXA 6GSWA 3GUSA 3OR5A 4MABA 1G6WA 2V1MA 4I97A 3GL3A 1BG5A 2DSAA 1WE0A 3BJ5A 3CYNA 4QL9A 3IAM2 1K0AA 3H93A 1O81A 2GSTA 2XC2A 4JEDA 4E8EA 1DE2A 4H86A 5F0GA 4IS0A 2IIYA 2C0EA 2VL2C 1AQXA 2L4QA 1Q98A 1NHYA 3VURA 5IPGA 1ERUA 1VF2A 4V2LA 1O7UA 1Z6MA 1FW1A 1T7PB 4XS6A 4L0UA 4P3YB 2R3XA 5HR1A 1B4QA 4ZL9A 3KEBA 2I1UA 3DEXA 3HVVA 5IIZA 4GTUA 4JRRA 4XS4B 3QAWA 4MPFA 2WZ9A 1AQWA 3TJBA 1ZL9A 1TK0B 4NXIA 2RIIA 2F3MA 4L0WA 2GQMA 6GSTA 4J57E 2LV3A 5ECHB 4GSTA 1FB0A 5H5QA 3LSZA 2PERA 5H5SA 3TKQA 3GA4A 4K0GA 4KW6A 2VM1A 4ISDA 5G1LA 4NWYA 5CREA 4PQ1A 2YCDA 1ZCPA 4Q5NA 5DJLA 1M2BA 4EL1A 3TKPA 4Q5QA 5KEJA 2OBKA 3DGQA 2JZTA 1TW9A 2C80A 1F37A 5DDLA 1THXA 2FY6A 2XBIA 2AYTA 2JACA 5D96A 3BD2A 5D9XA 2I81A 1XZOA 2F8AA 4I8BA 4KCAA 4KDYA 2C1YA 2B7KA 3VI5A 4TR1A 3HCZA 3EU3A 1F6MC 4JE1A 2M46A 2H75A 1OVNA 2VCTA 2A2RA 3F4TA 2F9SA 1SK0A 1R5AA 2WS2A 3H8QA 3IR4A 2MMOA 4Z7XA 6GSVA 2GVPA 2LJKA 2L59A 3GH9A 4MJAA 4FYBA 2OE0A 2RUFA 1FOVA 1Z3EA 2REMA 1EEMA 5CRDA 1V98A 2KP1A 3KH9A 1GSYA 2GLRA 3HYPA 4ECBA 5ECOB 4OFNA 3KXOA 3TKSE 4BVYA 3DKSA 4XHMA 3GRXA 1GSEA 3GKKA 2CAQA 3HHVA 3GIXA 1A2JA 1ST9A 5D8IA 1ZZYA 3CTGA 5GSSA 4HI7A 5HFIA 5B7CA 1T4YA 2IMKA 1MD4A 5ECMB 1ERWA 4K9ZA 3UJ1A 4MJCA 4TVEA 3JCML 5ECNB 1T8EB 2D2ZA 2LQQA 1TTZA 4IGJA 2KOKA 17GSA 1FVJA 2FHEA 4XCSA 1GSUA 3A3TA 4PQIA 2YJ7A 4KX4A 3C1RA 4ML6A 5IPHA 4GQCA 3LORA 3I69A 5DAKB 2K8SA 1XXUA 4NAXA 3M9KA 3TRXA 3QR6A 2I3YA 3EC3A 3ERFA 4E8HA 4MLYA 2ES7A 5J4UA 3QPMA 5B8BA 5AGYA 2DJ1A 2C0DA 4LMWA 1AC1A 1SKSB 1ZMAA 3QFBC 2B3SA 2YOIA 3DYRA 5F05A 4BA7A 3W6GA 2JZRA 1FO5A 5D9TA 3HJOA 22GSA 1EGRA 1TJDA 3QAGA 1W89A 1DE1A 4ZL8A 4WBJA 2VOCA 5GZZB 2OADA 1GULA 2LNSA 5F06A 5G1KA 3US3A 2C8UA 3DIEA 4TR3A 4IW9A 2H01A 3Q18A 2VCVA 4QL7A 3C73A 5JWRB 4NV2A 3UIWA 2MZCA 5A4UA 1BYEA 4X1UA 3VWXA 1NHOA 2DLXA 3N5OA 2DJKA 1H4OA 1ILOA 4HU9A 2VD0A 2IMFA 3L0HA 3U6VA 4RI6A 1WRYA 4L5OA 3VWUA 2QSIA 1BQ7A 5AIVA 1FHEA 3TCOA 4AF2A 1EP8A 3GMFA 3Q74A 1GUKA 1A2MA 1GH2A 3QFAC 4WR4A 1VF3A 4CW9A 4K1FA 2HLSA 1XCCA 4RQRA 5J41A 4ILFA 1U88A 3HJMA 2TIRA 4TR0A 12GSA 1QGVA 4LMVA 2FWGA 3E3EA 5ECKB 1OC9B 4O5RA 4D73A 5AIXA 5ECSA 3K8NA 1T1VA 2G0FA 1ZOFA 3A2VA 3CBUA 1U6TA 16GSA 1OE7A 3RPPA 1YZXA 3G7IA 3H1NA 4KE3A 2X64A 2J23A 1K0MA 3O76A 1J9BA 2GDRA 2V32A 2H0IA 2O87A 3HZ8A 3DXBA 3G7JA 5L71A 5CP1A 2YANA 5G30A 4TW5A 4FIWA 3F63A 3ZVJD 1X9MB 3HVXA 4LA1A 1YF1A 2LUSA 5FHIA 1N8JA 1MTCA 4JR4A 2A4VA 2VD1A 4MF5A 5J3RA 4Q5FA 4NV5A 4BPYA 6GSUA 1K3OA 5EL8A 1EP7A 1PA3A 1R5PA 1KEBA 1X0RA 6GSXA 1BJXA 3AY8A 11GSA 4F0CA 2VM2A 2H0GA 4OFTA 2DMMA 5CNWA 1O8XA 2JU5A 2GTUA 1M2AA 2JSYA 4Q5RA 6GSYA 3RBTA 1ML6A 1N2AA 3F4SA 1SKWB 3LQ7A 2AAWA 3WGXA 2FWEA 5IMZA 3QCPA 3A2WA 4V2NA 5IMAA 10GSA 4ZBBA 2IN3A 3KM6A 3I9V2 3FR6A 1TKDB 4DSSA 2PVOC 1A24A 1ERVA 2HSYA 3KTLA 4TXOB 2QC7A 4CDOA 1FG4A 1VF4A 2FWHA 1LJRA 1IYHA
chains in the Genus database with same CATH superfamily
1M99A 2WCIA 3M9JA 20GSA 3FRCA 1XW6A 1M3JA 1X5EA 2L4CA 4O7HA 3ZIJA 4ZB6A 2NVLA 3CRUA 5IMCA 3APSA 1NSWA 2DJ2A 3WT1A 4RUVA 1XW5A 1GTAA 4RQXA 1HQOA 1URMA 3FZAA 4MPGA 2HYXA 1ERTA 2ZUPA 4KDXA 2FLSA 2LJAA 4JR6A 2IMIA 3IOSA 2CZ3A 1DBYA 2O85A 3UAPA 3A2XA 3FY7A 1A2LA 3GH6A 1MDJA 4HJ2A 5DQYA 1WOUA 2PVQA 2HZFA 3M1GA 2KHPA 2LJRA 4DSRA 5GAPD 2LRTA 2PU9C 4K7OA 3PGTA 4TR1B 4WF4A 4EIQA 3HD5A 2PMTA 5IMFA 1XOAA 1CQHA 2PGTA 3RAZA 5IOWA 4I6XA 1VGLA 3IC4A 4IN0A 2FWFA 3GKMA 2BJXA 1Z6NA 1GNWA 1SK2A 4ZIJA 3EVIA 5JWOB 2CX3A 4ZBDA 1JZRA 2EC4A 2VL2A 3KCMA 4MF6A 3HZ4A 2GZPA 3O3TA 2C3QA 5HR0A 2ALBA 5INYA 4G2EA 3GHAA 5F8BA 4HZ2A 3UL3A 2YN1A 2H74A 1RK4A 1DSBA 3IPZA 4IBPA 4ULXA 3L9VA 5ID2B 1J0FA 2H73A 3ZFLA 3GV1A 1FVKA 3MWHA 2FCHA 2OJLA 5KN0A 1B9YC 4KA0A 1SKRB 1QXHA 3GKXA 5ELAA 3FMWA 5C04A 4G0KA 2H1BA 5EVOA 1AIUA 3DWVA 5DALB 1YKAA 5DVBA 2HFDA 1QUWA 4I2TA 4PURA 2DJ3A 2PUKC 2YWIA 5LD0A 4MF7A 1ON4A 3TB2A 1PGTA 3LWAA 1PN9A 2KP2A 2N5AA 5J9BA 3TUEA 3EINA 2IWTA 1ZYPA 2X4AA 2X99A 1TRUA 3ED3A 3GNJA 2GSSA 3VPTA 5DQSA 3KP8A 1JFUA 4ZILA 4BWQA 1XWAA 2RM5A 4GQFA 4WEYA 2CVBA 1S3AA 4CY8A 2VCQA 3TRQA 2RM6A 2RLIA 1X9SB 4IHUA 1RQMA 2HZEB 4NMUA 2VIMA 4MZBA 2DIZA 3D4MA 4XS4A 4YQVA 2CZ2A 7GSSA 3ISOA 2NPBA 5A4VA 3DRNA 2LQOA 2GT6A 2QKEA 1BAYA 1ZYQB 2O89A 3N9JA 2R37A 4KB3A 4O5QA 1PL1A 2Z9SA 2CVKA 2N5FA 3DVWA 4MP4A 4QQ7A 5D9WA 3EMPA 2K8VA 2K9FA 1TXXA 4GRFA 3EMXA 4IELA 2CT6A 1XBSA 1WIKA 2JL4A 1OC8A 3L78A 2H6ZA 3WYWA 3ZL5A 2BTOT 2X8HA 2YPMA 3P2AA 1MDIA 1SJIA 3UBKA 1UVZA 1PX6A 4L8EA 3TKSC 5KN3A 1GTBA 1HNBA 2GZYA 5ECIB 4X0XA 5AN1A 3QDNA 5E4WA 4KH7A 3J7Yb 5GSTA 3U5RE 4ML1A 2YZUA 4XRAA 4GLTA 5ECPB 1PKWA 1T4ZA 4TOPA 2WJUA 4HOJA 3ZITA 4FYCA 3CTFA 2CX4A 3UEMA 3TKSA 2MBSA 3MSZA 1OYJA 5CRHA 5BMUA 2C3NA 4OMVA 3SWLA 2MMAA 2LKUA 4PGTA 4KNDA 3I6AA 3PR8A 1T3BA 2FD3A 2IFQA 4K7IA 1UN2A 3F4RA 2E2GA 2IL3A 3TKRA 1TK8B 4V1Ag 2OKAA 5CO3A 1ACVA 4J2FA 2H6YA 2C3TA 3VPQA 2B5XA 3ZYWA 1Z7PA 4FQUA 5ECLB 4KUNA 5FT3A 2YV7A 2H72A 4G19A 3TJKA 3ZREA 4YQMA 2AHEA 4K0NA 1WJKA 4EIPA 3PH9A 3EURA 4TN8A 2PN8A 3HXSA 5G5EA 1NW2A 3F9UA 1K0CA 2L5OA 1GL8A 4MCUA 5IM9A 1X5DA 2XPEA 3IA1A 2A2SA 3TJGA 4GCIA 1IYIA 2AB6A 1A0FA 1PL2A 1OKTA 3ZTLA 5J5NA 3EU4A 4GWRA 1TI1A 3RPNA 2VLUA 3GTUA 3WGDA 2K18A 1TRWA 5LCZA 2H6XA 2WULA 3APQA 4WBRD 2H70A 3FYGA 4EC0A 3UOMA 5COHA 2QGVA 5DJMA 1PKZA 1TU7A 3W8SA 5KOWA 1W4VA 4GXZA 5HFKA 4F2IA 5EY6A 1WWJA 3ME8A 1GNEA 2GSRA 3GL5A 1VF1A 3E0UA 4N30A 5D93A 3IK7A 2FGXA 2KLXA 1WMJA 1YF0A 1RW1A 1GWCA 4OCFA 1S3DA 1CQGA 13GSA 2IMDA 4AGSA 2H66A 2LNTA 1GSDA 2GQKA 1LU4A 3D5JA 1SL0B 3QAVA 3LXTA 4EUYA 1TI3A 4AJ7A 3KTBA 3FR9A 4PNGA 3P8WA 2YZHA 3KP9A 4HEA2 1ZGNA 4PUAA 2C0GA 2VO4A 5DCGA 2B5YA 3GURA 4BVXB 2PWJA 2HSHA 1HNAA 3D22A 3F0IA 1PN0A 2EIRA 1EEJA 1M2DA 3HJPA 4X4JA 1ABAA 4YKGA 3LJRA 1GSSA 4KSOA 4TRXA 1XVWA 3GN3A 5KN1A 2MMNA 2B1LA 1GSQA 4J56E 4OO5A 1JZWA 2H1GA 1S3RA 3F6DA 2CVDA 1U3IA 1H75A 4YAPA 2CQ9A 2YJHA 4MH3A 2X49A 2V41A 1M9BA 2B5EA 2CA8A 5HFGA 3TDGA 2L57A 3ZIVA 1XVQA 3WGEA 4EDZA 3C7MA 1XPVA 2H8LA 4WETA 2TRCP 1HNCA 1GUHA 1B8XA 4K7NA 1G6YA 4EVMA 2VLVA 1QFNA 4IKHA 2OE1A 3FW2A 1F3BA 4F03A 5G5FA 4NHZA 5JCWA 5ECRB 3NZNA 4GSSA 4V2MA 4YQUA 3IAS2 4F9ZA 1A8LA 1PQNA 1V57A 1QQ2A 2CAIA 2G2QA 2YWOA 1OC9A 2N5BA 3HVNA 2HE3A 4MDCA 5HR2A 2I9HA 3EYTA 1G7EA 1BEDA 4YAVA 1SD8A 3GFKA 5IMDA 3GX8A 4BIKA 4HUAA 5A5KA 2AJQB 1O85A 3MAKA 5IO0A 2ON7A 3IBHA 1AAZA 1JLWA 1EOHA 4O32A 6GSSA 3W8JA 3DVXA 3M0FA 2KUCA 3KZQA 1S3CA 3A5IA 2DC5A 3IHGA 2JADA 5D73A 3P90A 4XRDA 1R26A 3IV4A 1XWGA 4EDYA 5FWGA 2FA4A 3LFLA 3MNGA 3TOTA 4KDUA 3KGKA 1GRXA 4FYUA 1PX7A 4BL7A 2F8FA 4F82A 2V6OA 3VK9A 3ZZXA 4ID0A 4OWYA 3ME7A 2XPDA 1O73A 2GZZA 3BCIA 1GLQA 2WDUA 1F3AA 1YKCA 3V1WA 4WR5A 2YWNA 3L9SA 2X8CA 4ZBAA 2R6KA 2OE3A 4IJ3A 2H0HA 5IO2A 1R7HA 1V58A 2K6VA 3ERGA 2ZNMA 4HS1A 1EV9A 3IHQA 1C72A 1YEXA 2R5GA 1KBNA 1EOGA 2I4AA 2HT9A 1PD21 2P31A 3F3RA 3UVTA 3VWWA 1GSFA 3QD9A 3FR3A 2HI7A 3ZVJA 2V6KA 2VAFA 4TXOA 4EO3A 4MNNA 2OACA 2B7JA 3KH7A 3LGCA 2DIYA 3IXRA 1F9MA 5CRGA 3IDVA 2HNLA 4POLA 3D21A 1ZYEA 3TOUA 1QK8A 2WFCA 4WF5A 4WXTA 1FOHA 1SD9A 5EPFA 4OO4A 1YQ1A 4OD7A 19GSA 4JZQA 2ZCTA 4BVYB 2LTKA 1YDKA 1O6JA 4L5LA 1UC7A 4HU7A 1Z7RA 1UA5A 4ACSA 1M9AA 1SYRA 3D0ZA 4AJ8A 3GYKA 1MD3A 2NBSA 1M7TA 3D6IA 4N10A 5DBQA 4Z2UA 4RI7A 3CMIA 2MYGA 1V40A 3ZLPA 3NOFA 2E2MA 4MMMA 1X9WB 3ZRDA 5A4WA 1OE8A 1DUGA 4ZL7A 4MH2A 4TR4A 2VL9A 4O92A 3J7Yk 4EKZA 4NPBA 3VI7A 2MMZA 3DD3A 2IMEA 2GQLA 4ECCA 3R3EA 1JZOA 5G2ZA 3ZMLA 1I9DA 2AV4A 1AXDA 4LL4B 1B4PA 2L6CA 1GTUA 4XTSA 1K3YA 4GF0A 1XIYA 1AUCA 5IMVA 4NHWA 3TRPA 4K6XA 4ZB8A 2J9HA 2R4VA 4BWSA 3FZ4A 3M8NA 3PINA 1YJ6A 2FA8A 3UARA 2HRNA 1JLVA 1MEKA 3C71A 4POKA 5CAXA 2X8GA 4GSNA 1PRXA 4XIHA 4IJIA 3BBYA 2FUG2 4POMA 2B1KA 2IFQB 2OA7A 2R0GA 1BX9A 2E0QA 3WD6A 3DMLA 2VCWA 4ZXGA 2F51A 5ID2A 3G9BA 1AQVA 3R2QA 2O7KA 3UBLA 1Y25A 3FZ5A 4CHSA 4HZ4A 1K3LA 3F8UA 4ICYA 1SJ6A 5ENUA 2H19A 1SL2B 2YP6A 4KCEA 1A23A 2PPTA 5DALA 8GSSA 3Q19A 1YY7A 4EXJA 3CSHA 5B6MA 3GSTA 5LNKe 1EWXA 3UMAA 3TGZA 5E59A 2DMLA 1EGOA 2FNOA 2XBQA 1A8YA 2DJJA 1TRSA 4V1Ap 1GLPA 2NTOA 3C8EA 3KD0A 4DEJA 3APOA 5C00A 5KN2A 4XS1A 3LXZA 5H5RA 3GTUB 3F6FA 5HR3A 1SK1A 1T00A 1XWKA 1F2EA 1TU8A 2HZEA 1U3AA 3GSSA 1QMVA 3WT2A 5ELGA 1TK5B 3A5WA 3GKNA 4FO5A 4MZCA 1U87A 2HSMA 1A0RP 3I43A 2TRXA 5IOXA 1MDKA 2LRNA 3LG6A 5JCUA 3FK8A 1K0OA 1USBA 3KMOA 2M72A 3CQFA 1VRSD 1G7OA 3L9UA 3IRAA 2R2JA 4EF0A 2JSZA 5J9CA 4ECJA 1HYUA 1X5CA 9GSSA 2PBJA 5CYYA 4JBBA 1Z5YE 2H76A 2RUEA 1B48A 2GT5A 1K0DA 2MBTA 2VCXA 3KIJA 4KAEA 1OAZA 2XHFA 3CSJA 4JU5A 3FZ9A 1SYXA 4YH2A 4D73B 3QOUA 4HDEA 4MJEA 2UZ8A 4LLRA 3EPTA 4N0ZA 5F07A 2C0FA 3LEFA 4PX1A 2ON5A 3CXGA 2WGRA 3MIXA 5GAND 4MA9A 3TJFA 3KJYA 4G0IA 2VUPA 2DKHA 3VFIA 2P5QA 2YV9A 3IE3A 4OFMA 1GP1A 1XWBA 2LRCA 4AJ6A 5DAKA 1I5GA 3C1SA 1OKDA 3SBCA 3VWVA 2R0PA 3Q6OA 5D9VA 3ERWA 4MK3A 2WB9A 14GSA 1YEPA 4TXVA 3NIVA 5JWQB 3GX0A 2EIOA 4IP6A 1XWCA 5G31A 4PNFA 1LBKA 3S9FA 5HQPA 2JZSA 4LL1B 4MZWA 2GS3A 4IQAA 1R4WA 5DCHA 2IJYA 2E7PA 4Z2RA 2GGTA 1Z9HA 2VCZA 1J08A 4EE0A 4WKWA 3FEUA 3EWLA 3FHKA 2NDOA 2B6MA 3E9JB 5IQYA 4OCEA 3ZMKA 4N0VA 4TKYA 3RHCA 1EV4A 3G7YA 4DSSB 3BCKA 1TRVA 1XW9A 4DSQA 2V2GA 4I2UA 1ZYNA 4MJBA 4G10A 3HDCA 1G0TA 4HSCX 1EZKA 1K0NA 1SU9A 4HQZA 2DJ0A 1KNGA 1WP0A 1WPIA 1V9WA 1KTEA 1E2YA 1GTIA 2HRFA 2OBIA 3FKFA 2YWMA 3MYDA 1PSQA 2WRTA 4A5PA 2L5LA 3O6TA 1Q4JA 4N11A 1Y6EA 3BOAA 4ZB9A 2C4JA 1OC3A 1FAAA 3QMXA 2P0GA 1FB6A 4DVCA 4I5QA 3D4TA 3KMNA 2QA1A 5B8AA 2P5RA 1TOFA 1TP9A 3PPUA 3LYPA 5ECQB 1JZDA 4K8MA 5B6NA 4IQ1A 3F3QA 5AISA 3L4NA 2H1AA 4USSA 1K0BA 3M3MA 3H79A 2A2PA 5ABRA 2LS5A 4K2DA 18GSA 4X43A 2VL3A 1AW9A 2L6DA 5CRWA 1TDIA 2CV4A 1V2AA 3HY2A 2HXKA 2H30A 4PQHA 2H1DA 1PMTA 1THOA 1NM3A 3P7XA 1M0UA 3HA9A 3RDWA 4BVXA 4HQSA 3CRTA 2O8VB 1E6BA 2H71A 4POBA 2M80A 2LSTA 4F0BA 4KGIA 3ZFBA 4ECIA 1XFLA 4PUFC 2AUVA 3TJJA 2VLTA 1SJZA 2DBCA 2IPAA 4FH8A 4IP1A 3HVSA 4CY6A 3CSIA 3RHBA 1HD2A 2GSQA 5JCGA 3VLNA 2YNXA 4PXOA 3H4KA 1SENA 1JHBA 3IK9A 1SL1B 1XOBA 3MDKA 2EIQA 1O8WA 3EE2A 2LEGA 3HKRA 1GUMA 3UVHA 1B9XC 3LYKA 4Z2TA 4HJMA 4IVFA 4G9HA 4KSMA 2BMXA 6GSWA 3GUSA 3OR5A 4MABA 1G6WA 2V1MA 4I97A 3GL3A 1BG5A 2DSAA 1WE0A 3BJ5A 3CYNA 4QL9A 3IAM2 1K0AA 3H93A 1O81A 2GSTA 2XC2A 4JEDA 4E8EA 1DE2A 4H86A 5F0GA 4IS0A 2IIYA 4K2XA 2C0EA 2VL2C 1AQXA 4K5RA 2L4QA 1Q98A 1NHYA 3VURA 5IPGA 1ERUA 1VF2A 4V2LA 1O7UA 1Z6MA 1FW1A 1T7PB 4XS6A 4L0UA 4P3YB 2R3XA 5HR1A 1B4QA 4ZL9A 3KEBA 2HRAA 2I1UA 3DEXA 3HVVA 5IIZA 4GTUA 4JRRA 4XS4B 3QAWA 4MPFA 2WZ9A 1AQWA 3TJBA 1ZL9A 1TK0B 4NXIA 2RIIA 2F3MA 4L0WA 2GQMA 6GSTA 4J57E 2LV3A 5ECHB 4GSTA 2R0CA 1FB0A 5H5QA 3LSZA 2PERA 5H5SA 3TKQA 3GA4A 4K0GA 4KW6A 2VM1A 4ISDA 5G1LA 4NWYA 5CREA 4PQ1A 2YCDA 1ZCPA 4Q5NA 5DJLA 1M2BA 4EL1A 3TKPA 4Q5QA 5KEJA 2OBKA 5BRTA 3DGQA 2JZTA 1TW9A 2C80A 1F37A 5DDLA 1THXA 2FY6A 2XBIA 2AYTA 2JACA 5D96A 3BD2A 5D9XA 2I81A 1XZOA 2F8AA 4I8BA 4KCAA 4KDYA 2C1YA 2B7KA 3VI5A 4TR1A 3HCZA 3EU3A 1F6MC 4JE1A 4G0LA 2M46A 2H75A 2QA2A 1OVNA 2VCTA 2A2RA 3F4TA 2DKIA 2F9SA 1SK0A 1R5AA 2WS2A 3H8QA 3IR4A 2MMOA 4Z7XA 6GSVA 2GVPA 2LJKA 2L59A 3GH9A 4MJAA 4FYBA 2OE0A 2RUFA 1FOVA 4O5UA 1Z3EA 2REMA 1EEMA 5CRDA 1V98A 2KP1A 3KH9A 1GSYA 2GLRA 3HYPA 4ECBA 5ECOB 4OFNA 3KXOA 3TKSE 4BVYA 3DKSA 4YKFA 4XHMA 3GRXA 1GSEA 3GKKA 2CAQA 3HHVA 3GIXA 1A2JA 1ST9A 5D8IA 1ZZYA 3CTGA 5GSSA 4HI7A 5HFIA 5B7CA 1T4YA 1XG8A 2IMKA 1MD4A 5ECMB 1ERWA 4K9ZA 3UJ1A 4MJCA 4TVEA 3JCML 5ECNB 1T8EB 4K5SA 2D2ZA 2LQQA 1TTZA 4IGJA 2KOKA 2HRKA 3LW9A 17GSA 1FVJA 2FHEA 4XCSA 1GSUA 3A3TA 4PQIA 2YJ7A 4KX4A 3C1RA 4ML6A 5IPHA 4GQCA 3LORA 3I69A 5DAKB 2K8SA 1XXUA 4NAXA 3M9KA 3TRXA 3QR6A 2I3YA 3EC3A 3ERFA 4E8HA 4MLYA 2ES7A 5J4UA 3QPMA 5B8BA 5AGYA 2DJ1A 2C0DA 4LMWA 1AC1A 1SKSB 1ZMAA 3QFBC 2B3SA 2YOIA 3DYRA 5F05A 4BA7A 3W6GA 2JZRA 1FO5A 5D9TA 3HJOA 22GSA 1EGRA 1TJDA 3QAGA 1W89A 1DE1A 4ZL8A 4WBJA 2VOCA 5GZZB 2OADA 1GULA 2LNSA 5F06A 5G1KA 3US3A 2C8UA 3DIEA 2A4HA 4TR3A 4IW9A 2H01A 3Q18A 2VCVA 4QL7A 3C73A 5JWRB 4NV2A 3UIWA 2MZCA 5A4UA 1BYEA 4X1UA 3VWXA 1NHOA 2DLXA 3N5OA 2DJKA 1H4OA 1ILOA 4HU9A 2VD0A 2IMFA 3L0HA 3U6VA 4RI6A 1WRYA 4L5OA 3VWUA 2QSIA 1BQ7A 5AIVA 1FHEA 3TCOA 4AF2A 1EP8A 3GMFA 3Q74A 1GUKA 1A2MA 1GH2A 3QFAC 4WR4A 1VF3A 4CW9A 4K1FA 2HLSA 1XCCA 4RQRA 5J41A 4ILFA 3IC8A 1U88A 3HJMA 2TIRA 4TR0A 12GSA 1QGVA 4LMVA 2FWGA 3E3EA 5ECKB 1OC9B 4O5RA 4D73A 5AIXA 5ECSA 4PTSA 3K8NA 1T1VA 2G0FA 1ZOFA 3A2VA 3CBUA 1U6TA 16GSA 1OE7A 3RPPA 1YZXA 3G7IA 4KF9A 3H1NA 4KE3A 2X64A 2J23A 1K0MA 3O76A 1J9BA 2GDRA 2V32A 2H0IA 2O87A 3HZ8A 3DXBA 3G7JA 5L71A 5CP1A 2YANA 5G30A 4TW5A 4FIWA 5KOXA 3F63A 3ZVJD 1X9MB 3HVXA 4LA1A 1YF1A 2LUSA 5FHIA 1N8JA 1MTCA 4JR4A 1M3IA 2A4VA 2VD1A 4MF5A 5J3RA 4Q5FA 4NV5A 4BL7B 4BPYA 1PFOA 6GSUA 1K3OA 5EL8A 1EP7A 1PA3A 1R5PA 1KEBA 1X0RA 6GSXA 1BJXA 3AY8A 11GSA 4F0CA 2VM2A 2H0GA 4OFTA 2DMMA 5CNWA 1O8XA 2JU5A 2GTUA 1M2AA 2JSYA 4Q5RA 6GSYA 3RBTA 1ML6A 1N2AA 3F4SA 1SKWB 3LQ7A 2AAWA 3WGXA 2FWEA 5IMZA 3QCPA 3A2WA 4V2NA 5IMAA 10GSA 4ZBBA 2IN3A 3KM6A 3I9V2 3FR6A 1TKDB 4DSSA 2PVOC 1A24A 1ERVA 2HSYA 3KTLA 4TXOB 2QC7A 4CDOA 1FG4A 1VF4A 2FWHA 1LJRA 1IYHA
chains in the Genus database with same CATH topology
1M99A 2WCIA 3M9JA 20GSA 3FRCA 1XW6A 1X5EA 2L4CA 4O7HA 3ZIJA 4ZB6A 2NVLA 3CRUA 5IMCA 3APSA 1NSWA 2DJ2A 3WT1A 4RUVA 1XW5A 1GTAA 4RQXA 1HQOA 1URMA 3FZAA 4MPGA 2HYXA 1ERTA 2ZUPA 4KDXA 2FLSA 2LJAA 4JR6A 2IMIA 3IOSA 2CZ3A 1DBYA 2O85A 3UAPA 3A2XA 3FY7A 1A2LA 3GH6A 1MDJA 4HJ2A 5DQYA 1WOUA 2PVQA 2HZFA 3M1GA 2KHPA 2LJRA 4DSRA 5GAPD 2LRTA 2PU9C 4K7OA 3PGTA 4TR1B 4WF4A 4EIQA 3HD5A 2PMTA 5IMFA 1XOAA 1CQHA 2PGTA 3RAZA 5IOWA 4I6XA 1VGLA 3IC4A 4IN0A 2FWFA 3GKMA 2BJXA 1Z6NA 1GNWA 1SK2A 4ZIJA 3EVIA 5JWOB 2CX3A 4ZBDA 1JZRA 2EC4A 2VL2A 3KCMA 4MF6A 3HZ4A 2GZPA 3O3TA 2C3QA 5HR0A 2ALBA 5INYA 4G2EA 3GHAA 5F8BA 4HZ2A 3UL3A 2YN1A 2H74A 1RK4A 1DSBA 3IPZA 4IBPA 4ULXA 3L9VA 5ID2B 1J0FA 2H73A 3ZFLA 3GV1A 1FVKA 3MWHA 2FCHA 2OJLA 5KN0A 1B9YC 4KA0A 1SKRB 1QXHA 3GKXA 5ELAA 3FMWA 5C04A 4G0KA 2H1BA 5EVOA 1AIUA 3DWVA 5DALB 1YKAA 5DVBA 2HFDA 1QUWA 4I2TA 4PURA 2DJ3A 2PUKC 2YWIA 5LD0A 4MF7A 1ON4A 3TB2A 1PGTA 3LWAA 1PN9A 2KP2A 2N5AA 5J9BA 3TUEA 3EINA 2IWTA 1ZYPA 2X4AA 2X99A 1TRUA 3ED3A 3GNJA 2GSSA 3VPTA 5DQSA 3KP8A 1JFUA 4ZILA 4BWQA 1XWAA 2RM5A 4GQFA 4WEYA 2CVBA 1S3AA 4CY8A 2VCQA 3TRQA 2RM6A 2RLIA 1X9SB 4IHUA 1RQMA 2HZEB 4NMUA 2VIMA 4MZBA 2DIZA 3D4MA 4XS4A 4YQVA 2CZ2A 7GSSA 3ISOA 2NPBA 5A4VA 3DRNA 2LQOA 2GT6A 2QKEA 1BAYA 1ZYQB 2O89A 3N9JA 2R37A 4KB3A 4O5QA 1PL1A 2Z9SA 2CVKA 2N5FA 3DVWA 4MP4A 4QQ7A 5D9WA 3EMPA 2K8VA 2K9FA 1TXXA 4GRFA 3EMXA 4IELA 2CT6A 1XBSA 1WIKA 2JL4A 1OC8A 3L78A 2H6ZA 3WYWA 3ZL5A 2BTOT 2X8HA 2YPMA 3P2AA 1MDIA 1SJIA 3UBKA 1UVZA 1PX6A 4L8EA 3TKSC 5KN3A 1GTBA 1HNBA 2GZYA 5ECIB 4X0XA 5AN1A 3QDNA 5E4WA 4KH7A 3J7Yb 5GSTA 3U5RE 4ML1A 2YZUA 4XRAA 4GLTA 5ECPB 1PKWA 1T4ZA 4TOPA 2WJUA 4HOJA 3ZITA 4FYCA 3CTFA 2CX4A 3UEMA 3TKSA 2MBSA 3MSZA 1OYJA 5CRHA 5BMUA 2C3NA 4OMVA 3SWLA 2MMAA 2LKUA 4PGTA 4KNDA 3I6AA 3PR8A 1T3BA 2FD3A 2IFQA 4K7IA 1UN2A 3F4RA 2E2GA 2IL3A 3TKRA 1TK8B 4V1Ag 2OKAA 5CO3A 1ACVA 4J2FA 2H6YA 2C3TA 3VPQA 2B5XA 3ZYWA 1Z7PA 4FQUA 5ECLB 4KUNA 5FT3A 2YV7A 2H72A 4G19A 3TJKA 3ZREA 4YQMA 2AHEA 4K0NA 1WJKA 4EIPA 3PH9A 3EURA 4TN8A 2PN8A 3HXSA 5G5EA 1NW2A 3F9UA 1K0CA 2L5OA 1GL8A 4MCUA 5IM9A 1X5DA 2XPEA 3IA1A 2A2SA 3TJGA 4GCIA 1IYIA 2AB6A 1A0FA 1PL2A 1OKTA 3ZTLA 5J5NA 3EU4A 4GWRA 1TI1A 3RPNA 2VLUA 3GTUA 3WGDA 2K18A 1TRWA 5LCZA 2H6XA 2WULA 3APQA 4WBRD 2H70A 3FYGA 4EC0A 3UOMA 5COHA 2QGVA 5DJMA 1PKZA 1TU7A 3W8SA 5KOWA 1W4VA 4GXZA 5HFKA 4F2IA 5EY6A 1WWJA 3ME8A 1GNEA 2GSRA 3GL5A 1VF1A 3E0UA 4N30A 5D93A 3IK7A 2FGXA 2KLXA 1WMJA 1YF0A 1RW1A 1GWCA 4OCFA 1S3DA 1CQGA 13GSA 2IMDA 4AGSA 2H66A 2LNTA 1GSDA 2GQKA 1LU4A 3D5JA 1SL0B 3QAVA 3LXTA 4EUYA 1TI3A 4AJ7A 3KTBA 3FR9A 4PNGA 3P8WA 2YZHA 3KP9A 4HEA2 1ZGNA 4PUAA 2C0GA 2VO4A 5DCGA 2B5YA 3GURA 4BVXB 2PWJA 2HSHA 1HNAA 3D22A 3F0IA 1PN0A 2EIRA 1EEJA 1M2DA 3HJPA 4X4JA 1ABAA 4YKGA 3LJRA 1GSSA 4KSOA 4TRXA 1XVWA 3GN3A 5KN1A 2MMNA 2B1LA 1GSQA 4J56E 4OO5A 1JZWA 2H1GA 3F6DA 2CVDA 1U3IA 1H75A 4YAPA 2CQ9A 2YJHA 4MH3A 2X49A 2V41A 1M9BA 2B5EA 2CA8A 5HFGA 3TDGA 2L57A 3ZIVA 1XVQA 3WGEA 4EDZA 3C7MA 1XPVA 2H8LA 4WETA 2TRCP 1HNCA 1GUHA 1B8XA 4K7NA 1G6YA 4EVMA 2VLVA 1QFNA 4IKHA 2OE1A 3FW2A 1F3BA 4F03A 5G5FA 4NHZA 5JCWA 5ECRB 3NZNA 4GSSA 4V2MA 4YQUA 3IAS2 4F9ZA 1A8LA 1PQNA 1V57A 1QQ2A 2CAIA 2G2QA 2YWOA 1OC9A 2N5BA 2HE3A 4MDCA 5HR2A 2I9HA 3EYTA 1G7EA 1BEDA 4YAVA 1SD8A 3GFKA 5IMDA 3GX8A 4HUAA 5A5KA 2AJQB 1O85A 3MAKA 5IO0A 2ON7A 3IBHA 1AAZA 1JLWA 1EOHA 4O32A 6GSSA 3W8JA 3DVXA 3M0FA 2KUCA 3KZQA 1S3CA 3A5IA 2DC5A 3IHGA 2JADA 5D73A 3P90A 4XRDA 1R26A 3IV4A 1XWGA 4EDYA 5FWGA 2FA4A 3LFLA 3MNGA 3TOTA 4KDUA 3KGKA 1GRXA 4FYUA 1PX7A 4BL7A 2F8FA 4F82A 2V6OA 3VK9A 3ZZXA 4ID0A 4OWYA 3ME7A 2XPDA 1O73A 2GZZA 3BCIA 1GLQA 2WDUA 1F3AA 1YKCA 3V1WA 4WR5A 2YWNA 3L9SA 2X8CA 4ZBAA 2R6KA 2OE3A 4IJ3A 2H0HA 5IO2A 1R7HA 1V58A 2K6VA 3ERGA 2ZNMA 4HS1A 1EV9A 3IHQA 1C72A 1YEXA 2R5GA 1KBNA 1EOGA 2I4AA 2HT9A 1PD21 2P31A 3F3RA 3UVTA 3VWWA 1GSFA 3QD9A 3FR3A 2HI7A 3ZVJA 2V6KA 2VAFA 4TXOA 4EO3A 4MNNA 2OACA 2B7JA 3KH7A 3LGCA 2DIYA 3IXRA 1F9MA 5CRGA 3IDVA 2HNLA 4POLA 3D21A 1ZYEA 3TOUA 1QK8A 2WFCA 4WF5A 4WXTA 1FOHA 1SD9A 5EPFA 4OO4A 1YQ1A 4OD7A 19GSA 4JZQA 2ZCTA 4BVYB 2LTKA 1YDKA 1O6JA 4L5LA 1UC7A 4HU7A 1Z7RA 1UA5A 4ACSA 1M9AA 1SYRA 3D0ZA 4AJ8A 3GYKA 1MD3A 2NBSA 1M7TA 3D6IA 4N10A 5DBQA 4Z2UA 4RI7A 3CMIA 2MYGA 1V40A 3ZLPA 3NOFA 2E2MA 4MMMA 1X9WB 3ZRDA 5A4WA 1OE8A 1DUGA 4ZL7A 4MH2A 4TR4A 2VL9A 4O92A 3J7Yk 4EKZA 4NPBA 3VI7A 2MMZA 3DD3A 2IMEA 2GQLA 4ECCA 3R3EA 1JZOA 5G2ZA 3ZMLA 1I9DA 2AV4A 1AXDA 4LL4B 1B4PA 2L6CA 1GTUA 4XTSA 1K3YA 4GF0A 1XIYA 1AUCA 5IMVA 4NHWA 3TRPA 4K6XA 4ZB8A 2J9HA 2R4VA 4BWSA 3FZ4A 3M8NA 3PINA 1YJ6A 2FA8A 3UARA 2HRNA 1JLVA 1MEKA 3C71A 4POKA 5CAXA 2X8GA 4GSNA 1PRXA 4XIHA 4IJIA 3BBYA 2FUG2 4POMA 2B1KA 2IFQB 2OA7A 2R0GA 1BX9A 2E0QA 3WD6A 3DMLA 2VCWA 4ZXGA 2F51A 5ID2A 3G9BA 1AQVA 3R2QA 2O7KA 3UBLA 1Y25A 3FZ5A 4CHSA 4HZ4A 1K3LA 3F8UA 4ICYA 1SJ6A 5ENUA 2H19A 1SL2B 2YP6A 4KCEA 1A23A 2PPTA 5DALA 8GSSA 3Q19A 1YY7A 4EXJA 3CSHA 5B6MA 3GSTA 5LNKe 1EWXA 3UMAA 3TGZA 5E59A 2DMLA 1EGOA 2FNOA 2XBQA 1A8YA 2DJJA 1TRSA 4V1Ap 1GLPA 2NTOA 3C8EA 3KD0A 4DEJA 3APOA 5C00A 5KN2A 4XS1A 3LXZA 5H5RA 3GTUB 3F6FA 5HR3A 1SK1A 1T00A 1XWKA 1F2EA 1TU8A 2HZEA 1U3AA 3GSSA 1QMVA 3WT2A 5ELGA 1TK5B 3A5WA 3GKNA 4FO5A 4MZCA 1U87A 2HSMA 1A0RP 3I43A 2TRXA 5IOXA 1MDKA 2LRNA 3LG6A 5JCUA 3FK8A 1K0OA 1USBA 3KMOA 2M72A 1VRSD 1G7OA 3L9UA 3IRAA 2R2JA 4EF0A 2JSZA 5J9CA 4ECJA 1HYUA 1X5CA 9GSSA 2PBJA 5CYYA 4JBBA 1Z5YE 2H76A 2RUEA 1B48A 2GT5A 1K0DA 2MBTA 2VCXA 3KIJA 4KAEA 1OAZA 2XHFA 3CSJA 4JU5A 3FZ9A 1SYXA 4YH2A 4D73B 3QOUA 4HDEA 4MJEA 2UZ8A 4LLRA 3EPTA 4N0ZA 5F07A 2C0FA 3LEFA 4PX1A 2ON5A 3CXGA 2WGRA 3MIXA 5GAND 4MA9A 3TJFA 3KJYA 4G0IA 2VUPA 2DKHA 3VFIA 2P5QA 2YV9A 3IE3A 4OFMA 1GP1A 1XWBA 2LRCA 4AJ6A 5DAKA 1I5GA 3C1SA 1OKDA 3SBCA 3VWVA 2R0PA 3Q6OA 5D9VA 3ERWA 4MK3A 2WB9A 14GSA 1YEPA 4TXVA 3NIVA 5JWQB 3GX0A 2EIOA 4IP6A 1XWCA 5G31A 4PNFA 1LBKA 3S9FA 5HQPA 2JZSA 4LL1B 4MZWA 2GS3A 4IQAA 1R4WA 5DCHA 2IJYA 2E7PA 4Z2RA 2GGTA 1Z9HA 2VCZA 1J08A 4EE0A 4WKWA 3FEUA 3EWLA 3FHKA 2NDOA 2B6MA 3E9JB 5IQYA 4OCEA 3ZMKA 4N0VA 4TKYA 3RHCA 1EV4A 3G7YA 4DSSB 3BCKA 1TRVA 1XW9A 4DSQA 2V2GA 4I2UA 1ZYNA 4MJBA 4G10A 3HDCA 1G0TA 1EZKA 1K0NA 1SU9A 4HQZA 2DJ0A 1KNGA 1WP0A 1WPIA 1V9WA 1KTEA 1E2YA 1GTIA 2HRFA 2OBIA 3FKFA 2YWMA 3MYDA 1PSQA 2WRTA 4A5PA 2L5LA 3O6TA 1Q4JA 4N11A 1Y6EA 3BOAA 4ZB9A 2C4JA 1OC3A 1FAAA 3QMXA 2P0GA 1FB6A 4DVCA 4I5QA 3D4TA 3KMNA 2QA1A 5B8AA 2P5RA 1TOFA 1TP9A 3PPUA 3LYPA 5ECQB 1JZDA 4K8MA 5B6NA 4IQ1A 3F3QA 5AISA 3L4NA 2H1AA 4USSA 1K0BA 3M3MA 3H79A 2A2PA 5ABRA 2LS5A 4K2DA 18GSA 4X43A 2VL3A 1AW9A 2L6DA 5CRWA 1TDIA 2CV4A 1V2AA 3HY2A 2HXKA 2H30A 4PQHA 2H1DA 1PMTA 1THOA 1NM3A 3P7XA 1M0UA 3HA9A 3RDWA 4BVXA 4HQSA 3CRTA 2O8VB 1E6BA 2H71A 4POBA 2M80A 2LSTA 4F0BA 4KGIA 3ZFBA 4ECIA 1XFLA 4PUFC 2AUVA 3TJJA 2VLTA 1SJZA 2DBCA 2IPAA 4FH8A 4IP1A 3HVSA 4CY6A 3CSIA 3RHBA 1HD2A 2GSQA 5JCGA 3VLNA 2YNXA 4PXOA 3H4KA 1SENA 1JHBA 3IK9A 1SL1B 1XOBA 3MDKA 2EIQA 1O8WA 3EE2A 2LEGA 3HKRA 1GUMA 3UVHA 1B9XC 3LYKA 4Z2TA 4HJMA 4IVFA 4G9HA 4KSMA 2BMXA 6GSWA 3GUSA 3OR5A 4MABA 1G6WA 2V1MA 4I97A 3GL3A 1BG5A 2DSAA 1WE0A 3BJ5A 3CYNA 4QL9A 3IAM2 1K0AA 3H93A 1O81A 2GSTA 2XC2A 4JEDA 4E8EA 1DE2A 4H86A 5F0GA 4IS0A 2IIYA 4K2XA 2C0EA 2VL2C 1AQXA 4K5RA 2L4QA 1Q98A 1NHYA 3VURA 5IPGA 1ERUA 1VF2A 4V2LA 1O7UA 1Z6MA 1FW1A 1T7PB 4XS6A 4L0UA 4P3YB 2R3XA 5HR1A 1B4QA 4ZL9A 3KEBA 2HRAA 2I1UA 3DEXA 3HVVA 5IIZA 4GTUA 4JRRA 4XS4B 3QAWA 4MPFA 2WZ9A 1AQWA 3TJBA 1ZL9A 1TK0B 4NXIA 2RIIA 2F3MA 4L0WA 2GQMA 6GSTA 4J57E 2LV3A 5ECHB 4GSTA 2R0CA 1FB0A 5H5QA 3LSZA 2PERA 5H5SA 3TKQA 3GA4A 4K0GA 4KW6A 2VM1A 4ISDA 5G1LA 4NWYA 5CREA 4PQ1A 2YCDA 1ZCPA 4Q5NA 5DJLA 1M2BA 4EL1A 3TKPA 4Q5QA 5KEJA 2OBKA 5BRTA 3DGQA 2JZTA 1TW9A 2C80A 1F37A 5DDLA 1THXA 2FY6A 2XBIA 2AYTA 2JACA 5D96A 3BD2A 5D9XA 2I81A 1XZOA 2F8AA 4I8BA 4KCAA 4KDYA 2C1YA 2B7KA 3VI5A 4TR1A 3HCZA 3EU3A 1F6MC 4JE1A 4G0LA 2M46A 2H75A 2QA2A 1OVNA 2VCTA 2A2RA 3F4TA 2DKIA 2F9SA 1SK0A 1R5AA 2WS2A 3H8QA 3IR4A 2MMOA 4Z7XA 6GSVA 2GVPA 2LJKA 2L59A 3GH9A 4MJAA 4FYBA 2OE0A 2RUFA 1FOVA 4O5UA 1Z3EA 2REMA 1EEMA 5CRDA 1V98A 2KP1A 3KH9A 1GSYA 2GLRA 3HYPA 4ECBA 5ECOB 4OFNA 3KXOA 3TKSE 4BVYA 3DKSA 4YKFA 4XHMA 3GRXA 1GSEA 3GKKA 2CAQA 3HHVA 3GIXA 1A2JA 1ST9A 5D8IA 1ZZYA 3CTGA 5GSSA 4HI7A 5HFIA 5B7CA 1T4YA 2IMKA 1MD4A 5ECMB 1ERWA 4K9ZA 3UJ1A 4MJCA 4TVEA 3JCML 5ECNB 1T8EB 4K5SA 2D2ZA 2LQQA 1TTZA 4IGJA 2KOKA 2HRKA 3LW9A 17GSA 1FVJA 2FHEA 4XCSA 1GSUA 3A3TA 4PQIA 2YJ7A 4KX4A 3C1RA 4ML6A 5IPHA 4GQCA 3LORA 3I69A 5DAKB 2K8SA 1XXUA 4NAXA 3M9KA 3TRXA 3QR6A 2I3YA 3EC3A 3ERFA 4E8HA 4MLYA 2ES7A 5J4UA 3QPMA 5B8BA 5AGYA 2DJ1A 2C0DA 4LMWA 1AC1A 1SKSB 1ZMAA 3QFBC 2B3SA 2YOIA 3DYRA 5F05A 4BA7A 3W6GA 2JZRA 1FO5A 5D9TA 3HJOA 22GSA 1EGRA 1TJDA 3QAGA 1W89A 1DE1A 4ZL8A 4WBJA 2VOCA 5GZZB 2OADA 1GULA 2LNSA 5F06A 5G1KA 3US3A 2C8UA 3DIEA 2A4HA 4TR3A 4IW9A 2H01A 3Q18A 2VCVA 4QL7A 3C73A 5JWRB 4NV2A 3UIWA 2MZCA 5A4UA 1BYEA 4X1UA 3VWXA 1NHOA 2DLXA 3N5OA 2DJKA 1H4OA 1ILOA 4HU9A 2VD0A 2IMFA 3L0HA 3U6VA 4RI6A 1WRYA 4L5OA 3VWUA 2QSIA 1BQ7A 5AIVA 1FHEA 3TCOA 4AF2A 1EP8A 3GMFA 3Q74A 1GUKA 1A2MA 1GH2A 3QFAC 4WR4A 1VF3A 4CW9A 4K1FA 2HLSA 1XCCA 4RQRA 5J41A 4ILFA 3IC8A 1U88A 3HJMA 2TIRA 4TR0A 12GSA 1QGVA 4LMVA 2FWGA 3E3EA 5ECKB 1OC9B 4O5RA 4D73A 5AIXA 5ECSA 4PTSA 3K8NA 1T1VA 2G0FA 1ZOFA 3A2VA 3CBUA 1U6TA 16GSA 1OE7A 3RPPA 1YZXA 3G7IA 4KF9A 3H1NA 4KE3A 2X64A 2J23A 1K0MA 3O76A 1J9BA 2GDRA 2V32A 2H0IA 2O87A 3HZ8A 3DXBA 3G7JA 5L71A 5CP1A 2YANA 5G30A 4TW5A 4FIWA 5KOXA 3F63A 3ZVJD 1X9MB 3HVXA 4LA1A 1YF1A 2LUSA 5FHIA 1N8JA 1MTCA 4JR4A 2A4VA 2VD1A 4MF5A 5J3RA 4Q5FA 4NV5A 4BL7B 4BPYA 6GSUA 1K3OA 5EL8A 1EP7A 1PA3A 1R5PA 1KEBA 1X0RA 6GSXA 1BJXA 3AY8A 11GSA 4F0CA 2VM2A 2H0GA 4OFTA 2DMMA 5CNWA 1O8XA 2JU5A 2GTUA 1M2AA 2JSYA 4Q5RA 6GSYA 3RBTA 1ML6A 1N2AA 3F4SA 1SKWB 3LQ7A 2AAWA 3WGXA 2FWEA 5IMZA 3QCPA 3A2WA 4V2NA 5IMAA 10GSA 4ZBBA 2IN3A 3KM6A 3I9V2 3FR6A 1TKDB 4DSSA 2PVOC 1A24A 1ERVA 2HSYA 3KTLA 4TXOB 2QC7A 4CDOA 1FG4A 1VF4A 2FWHA 1LJRA 1IYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M99 A;  2WCI A;  3M9J A;  20GS A;  3FRC A;  1XW6 A;  1X5E A;  2L4C A;  4O7H A;  3ZIJ A;  4ZB6 A;  2NVL A;  3CRU A;  5IMC A;  3APS A;  1NSW A;  2DJ2 A;  3WT1 A;  4RUV A;  1XW5 A;  1GTA A;  4RQX A;  1HQO A;  1URM A;  3FZA A;  4MPG A;  2HYX A;  1ERT A;  2ZUP A;  4KDX A;  2FLS A;  2LJA A;  4JR6 A;  2IMI A;  3IOS A;  2CZ3 A;  1DBY A;  2O85 A;  3UAP A;  3A2X A;  3FY7 A;  1A2L A;  3GH6 A;  1MDJ A;  4HJ2 A;  5DQY A;  1WOU A;  2PVQ A;  2HZF A;  3M1G A;  2KHP A;  2LJR A;  4DSR A;  5GAP D;  2LRT A;  2PU9 C;  4K7O A;  3PGT A;  4TR1 B;  4WF4 A;  3HD5 A;  2PMT A;  5IMF A;  1XOA A;  1CQH A;  2PGT A;  3RAZ A;  5IOW A;  4I6X A;  1VGL A;  3IC4 A;  4IN0 A;  2FWF A;  3GKM A;  2BJX A;  1Z6N A;  1GNW A;  1SK2 A;  4ZIJ A;  3EVI A;  5JWO B;  2CX3 A;  4ZBD A;  1JZR A;  2EC4 A;  2VL2 A;  3KCM A;  4MF6 A;  3HZ4 A;  2GZP A;  3O3T A;  2C3Q A;  5HR0 A;  2ALB A;  5INY A;  4G2E A;  3GHA A;  5F8B A;  4HZ2 A;  3UL3 A;  2YN1 A;  2H74 A;  1RK4 A;  1DSB A;  3IPZ A;  4IBP A;  4ULX A;  3L9V A;  5ID2 B;  1J0F A;  2H73 A;  3ZFL A;  3GV1 A;  1FVK A;  3MWH A;  2FCH A;  2OJL A;  5KN0 A;  1B9Y C;  4KA0 A;  1SKR B;  1QXH A;  3GKX A;  5ELA A;  5C04 A;  2H1B A;  5EVO A;  1AIU A;  3DWV A;  5DAL B;  1YKA A;  5DVB A;  2HFD A;  1QUW A;  4I2T A;  4PUR A;  2DJ3 A;  2PUK C;  2YWI A;  5LD0 A;  4MF7 A;  1ON4 A;  3TB2 A;  1PGT A;  3LWA A;  1PN9 A;  2KP2 A;  2N5A A;  5J9B A;  3TUE A;  3EIN A;  2IWT A;  2X99 A;  1TRU A;  3ED3 A;  3GNJ A;  2GSS A;  3VPT A;  5DQS A;  3KP8 A;  1JFU A;  4ZIL A;  4BWQ A;  1XWA A;  2RM5 A;  4GQF A;  4WEY A;  2CVB A;  1S3A A;  2VCQ A;  3TRQ A;  2RM6 A;  2RLI A;  1X9S B;  4IHU A;  1RQM A;  2HZE B;  4NMU A;  2VIM A;  4MZB A;  2DIZ A;  3D4M A;  4XS4 A;  4YQV A;  2CZ2 A;  7GSS A;  3ISO A;  2NPB A;  5A4V A;  3DRN A;  2LQO A;  2GT6 A;  2QKE A;  1BAY A;  1ZYQ B;  2O89 A;  3N9J A;  2R37 A;  4KB3 A;  1PL1 A;  2Z9S A;  2CVK A;  2N5F A;  3DVW A;  4MP4 A;  4QQ7 A;  5D9W A;  3EMP A;  2K8V A;  2K9F A;  1TXX A;  4GRF A;  3EMX A;  4IEL A;  2CT6 A;  1XBS A;  1WIK A;  2JL4 A;  1OC8 A;  3L78 A;  2H6Z A;  3WYW A;  3ZL5 A;  2BTO T;  2X8H A;  2YPM A;  3P2A A;  1MDI A;  1SJI A;  3UBK A;  1UVZ A;  1PX6 A;  4L8E A;  3TKS C;  5KN3 A;  1GTB A;  1HNB A;  2GZY A;  5ECI B;  4X0X A;  5AN1 A;  3QDN A;  5E4W A;  4KH7 A;  3J7Y b;  5GST A;  3U5R E;  4ML1 A;  2YZU A;  4XRA A;  4GLT A;  5ECP B;  1PKW A;  1T4Z A;  4TOP A;  2WJU A;  4HOJ A;  3ZIT A;  4FYC A;  3CTF A;  2CX4 A;  3UEM A;  3TKS A;  2MBS A;  3MSZ A;  1OYJ A;  5CRH A;  2C3N A;  4OMV A;  3SWL A;  2MMA A;  2LKU A;  4PGT A;  4KND A;  3I6A A;  3PR8 A;  1T3B A;  2FD3 A;  2IFQ A;  4K7I A;  1UN2 A;  3F4R A;  2E2G A;  2IL3 A;  3TKR A;  1TK8 B;  4V1A g;  2OKA A;  5CO3 A;  1ACV A;  4J2F A;  2H6Y A;  2C3T A;  3VPQ A;  2B5X A;  3ZYW A;  1Z7P A;  5ECL B;  4KUN A;  5FT3 A;  2YV7 A;  2H72 A;  4G19 A;  3TJK A;  3ZRE A;  4YQM A;  2AHE A;  4K0N A;  1WJK A;  3PH9 A;  3EUR A;  4TN8 A;  2PN8 A;  3HXS A;  5G5E A;  1NW2 A;  3F9U A;  1K0C A;  2L5O A;  1GL8 A;  4MCU A;  5IM9 A;  1X5D A;  2XPE A;  3IA1 A;  2A2S A;  3TJG A;  4GCI A;  1IYI A;  2AB6 A;  1A0F A;  1PL2 A;  1OKT A;  3ZTL A;  5J5N A;  3EU4 A;  4GWR A;  1TI1 A;  3RPN A;  2VLU A;  3GTU A;  3WGD A;  2K18 A;  1TRW A;  5LCZ A;  2H6X A;  2WUL A;  3APQ A;  4WBR D;  2H70 A;  3FYG A;  4EC0 A;  3UOM A;  5COH A;  2QGV A;  5DJM A;  1PKZ A;  1TU7 A;  3W8S A;  1W4V A;  4GXZ A;  5HFK A;  4F2I A;  5EY6 A;  1WWJ A;  3ME8 A;  1GNE A;  2GSR A;  3GL5 A;  1VF1 A;  3E0U A;  5D93 A;  4N30 A;  3IK7 A;  2FGX A;  2KLX A;  1WMJ A;  1YF0 A;  1RW1 A;  1GWC A;  4OCF A;  1S3D A;  1CQG A;  13GS A;  2IMD A;  4AGS A;  2H66 A;  2LNT A;  1GSD A;  2GQK A;  1LU4 A;  3D5J A;  1SL0 B;  3QAV A;  3LXT A;  4EUY A;  1TI3 A;  4AJ7 A;  3KTB A;  3FR9 A;  4PNG A;  3P8W A;  2YZH A;  3KP9 A;  4HEA 2;  1ZGN A;  4PUA A;  2C0G A;  2VO4 A;  5DCG A;  2B5Y A;  3GUR A;  2PWJ A;  2HSH A;  1HNA A;  3D22 A;  3F0I A;  2EIR A;  1EEJ A;  1M2D A;  3HJP A;  1ABA A;  3LJR A;  1GSS A;  4KSO A;  4TRX A;  1XVW A;  3GN3 A;  5KN1 A;  2MMN A;  2B1L A;  1GSQ A;  4J56 E;  4OO5 A;  1JZW A;  2H1G A;  3F6D A;  2CVD A;  1U3I A;  1H75 A;  4YAP A;  2CQ9 A;  2YJH A;  4MH3 A;  2V41 A;  1M9B A;  2B5E A;  2CA8 A;  5HFG A;  3TDG A;  2L57 A;  3ZIV A;  1XVQ A;  3WGE A;  4EDZ A;  3C7M A;  1XPV A;  2H8L A;  4WET A;  2TRC P;  1HNC A;  1GUH A;  1B8X A;  4K7N A;  1G6Y A;  4EVM A;  2VLV A;  1QFN A;  4IKH A;  2OE1 A;  3FW2 A;  1F3B A;  4F03 A;  5G5F A;  4NHZ A;  5JCW A;  5ECR B;  3NZN A;  4GSS A;  4V2M A;  4YQU A;  3IAS 2;  4F9Z A;  1A8L A;  1PQN A;  1V57 A;  1QQ2 A;  2CAI A;  2G2Q A;  2YWO A;  1OC9 A;  2N5B A;  2HE3 A;  4MDC A;  5HR2 A;  2I9H A;  3EYT A;  1G7E A;  1BED A;  4YAV A;  1SD8 A;  3GFK A;  5IMD A;  3GX8 A;  4HUA A;  5A5K A;  2AJQ B;  1O85 A;  3MAK A;  5IO0 A;  2ON7 A;  3IBH A;  1AAZ A;  1JLW A;  1EOH A;  4O32 A;  6GSS A;  3W8J A;  3DVX A;  3M0F A;  2KUC A;  3KZQ A;  1S3C A;  2DC5 A;  2JAD A;  5D73 A;  3P90 A;  4XRD A;  1R26 A;  3IV4 A;  1XWG A;  4EDY A;  5FWG A;  2FA4 A;  3LFL A;  3MNG A;  3TOT A;  4KDU A;  3KGK A;  1GRX A;  4FYU A;  1PX7 A;  4BL7 A;  2F8F A;  4F82 A;  2V6O A;  3VK9 A;  3ZZX A;  4ID0 A;  4OWY A;  3ME7 A;  2XPD A;  1O73 A;  2GZZ A;  3BCI A;  1GLQ A;  2WDU A;  1F3A A;  1YKC A;  3V1W A;  4WR5 A;  2YWN A;  3L9S A;  2X8C A;  4ZBA A;  2R6K A;  2OE3 A;  4IJ3 A;  2H0H A;  5IO2 A;  1R7H A;  1V58 A;  2K6V A;  3ERG A;  2ZNM A;  4HS1 A;  1EV9 A;  3IHQ A;  1C72 A;  1YEX A;  2R5G A;  1KBN A;  1EOG A;  2I4A A;  2HT9 A;  1PD2 1;  2P31 A;  3F3R A;  3UVT A;  3VWW A;  1GSF A;  3QD9 A;  3FR3 A;  2HI7 A;  3ZVJ A;  2V6K A;  2VAF A;  4TXO A;  4EO3 A;  2OAC A;  2B7J A;  3KH7 A;  3LGC A;  2DIY A;  3IXR A;  1F9M A;  5CRG A;  3IDV A;  2HNL A;  4POL A;  3D21 A;  1ZYE A;  3TOU A;  1QK8 A;  2WFC A;  4WF5 A;  4WXT A;  1SD9 A;  5EPF A;  4OO4 A;  1YQ1 A;  4OD7 A;  19GS A;  4JZQ A;  2ZCT A;  2LTK A;  1YDK A;  1O6J A;  4L5L A;  1UC7 A;  4HU7 A;  1Z7R A;  1UA5 A;  4ACS A;  1M9A A;  1SYR A;  3D0Z A;  4AJ8 A;  3GYK A;  1MD3 A;  2NBS A;  1M7T A;  3D6I A;  4N10 A;  5DBQ A;  4RI7 A;  3CMI A;  2MYG A;  1V40 A;  3ZLP A;  3NOF A;  2E2M A;  4MMM A;  1X9W B;  3ZRD A;  5A4W A;  1OE8 A;  1DUG A;  4ZL7 A;  4MH2 A;  4TR4 A;  2VL9 A;  4O92 A;  3J7Y k;  4EKZ A;  4NPB A;  3VI7 A;  2MMZ A;  3DD3 A;  2IME A;  2GQL A;  4ECC A;  1JZO A;  5G2Z A;  3ZML A;  1I9D A;  2AV4 A;  1AXD A;  4LL4 B;  1B4P A;  2L6C A;  1GTU A;  4XTS A;  1K3Y A;  4GF0 A;  1XIY A;  1AUC A;  5IMV A;  4NHW A;  3TRP A;  4K6X A;  4ZB8 A;  2J9H A;  2R4V A;  4BWS A;  3FZ4 A;  3M8N A;  3PIN A;  1YJ6 A;  2FA8 A;  3UAR A;  2HRN A;  1JLV A;  1MEK A;  3C71 A;  4POK A;  5CAX A;  2X8G A;  4GSN A;  1PRX A;  4XIH A;  4IJI A;  3BBY A;  2FUG 2;  4POM A;  2B1K A;  2IFQ B;  2OA7 A;  1BX9 A;  2E0Q A;  3WD6 A;  3DML A;  2VCW A;  4ZXG A;  2F51 A;  5ID2 A;  3G9B A;  1AQV A;  3R2Q A;  2O7K A;  3UBL A;  1Y25 A;  3FZ5 A;  4CHS A;  4HZ4 A;  1K3L A;  3F8U A;  1SJ6 A;  5ENU A;  2H19 A;  1SL2 B;  2YP6 A;  4KCE A;  1A23 A;  2PPT A;  5DAL A;  8GSS A;  3Q19 A;  1YY7 A;  4EXJ A;  3CSH A;  5B6M A;  3GST A;  5LNK e;  1EWX A;  3UMA A;  3TGZ A;  5E59 A;  2DML A;  1EGO A;  2FNO A;  2XBQ A;  1A8Y A;  2DJJ A;  1TRS A;  4V1A p;  1GLP A;  2NTO A;  3C8E A;  3KD0 A;  4DEJ A;  3APO A;  5C00 A;  5KN2 A;  4XS1 A;  3LXZ A;  5H5R A;  3GTU B;  3F6F A;  5HR3 A;  1SK1 A;  1T00 A;  1XWK A;  1F2E A;  1TU8 A;  2HZE A;  1U3A A;  3GSS A;  1QMV A;  3WT2 A;  5ELG A;  1TK5 B;  3A5W A;  3GKN A;  4FO5 A;  4MZC A;  1U87 A;  1A0R P;  3I43 A;  2TRX A;  5IOX A;  1MDK A;  2LRN A;  3LG6 A;  5JCU A;  3FK8 A;  1K0O A;  1USB A;  3KMO A;  2M72 A;  1VRS D;  1G7O A;  3L9U A;  3IRA A;  2R2J A;  4EF0 A;  2JSZ A;  5J9C A;  4ECJ A;  1HYU A;  1X5C A;  9GSS A;  2PBJ A;  5CYY A;  4JBB A;  1Z5Y E;  2H76 A;  2RUE A;  1B48 A;  2GT5 A;  1K0D A;  2MBT A;  2VCX A;  3KIJ A;  4KAE A;  1OAZ A;  2XHF A;  3CSJ A;  4JU5 A;  3FZ9 A;  1SYX A;  4YH2 A;  4D73 B;  3QOU A;  4HDE A;  4MJE A;  4LLR A;  4N0Z A;  5F07 A;  2C0F A;  3LEF A;  4PX1 A;  2ON5 A;  3CXG A;  2WGR A;  5GAN D;  4MA9 A;  3TJF A;  3KJY A;  2VUP A;  3VFI A;  2P5Q A;  2YV9 A;  3IE3 A;  4OFM A;  1GP1 A;  1XWB A;  2LRC A;  4AJ6 A;  5DAK A;  1I5G A;  3C1S A;  1OKD A;  3SBC A;  3VWV A;  5D9V A;  3Q6O A;  3ERW A;  4MK3 A;  2WB9 A;  14GS A;  1YEP A;  4TXV A;  3NIV A;  5JWQ B;  3GX0 A;  2EIO A;  4IP6 A;  1XWC A;  5G31 A;  4PNF A;  1LBK A;  3S9F A;  5HQP A;  2JZS A;  4LL1 B;  4MZW A;  2GS3 A;  4IQA A;  1R4W A;  5DCH A;  2IJY A;  2E7P A;  2GGT A;  1Z9H A;  2VCZ A;  1J08 A;  4EE0 A;  4WKW A;  3FEU A;  3EWL A;  3FHK A;  2NDO A;  2B6M A;  3E9J B;  5IQY A;  4OCE A;  3ZMK A;  4N0V A;  4TKY A;  3RHC A;  1EV4 A;  3G7Y A;  4DSS B;  3BCK A;  1TRV A;  1XW9 A;  4DSQ A;  2V2G A;  4I2U A;  4MJB A;  4G10 A;  3HDC A;  1G0T A;  1EZK A;  1K0N A;  1SU9 A;  4HQZ A;  2DJ0 A;  1KNG A;  1WP0 A;  1WPI A;  1V9W A;  1KTE A;  1E2Y A;  1GTI A;  2HRF A;  2OBI A;  3FKF A;  2YWM A;  1PSQ A;  2WRT A;  2L5L A;  3O6T A;  1Q4J A;  4N11 A;  1Y6E A;  3BOA A;  4ZB9 A;  2C4J A;  1OC3 A;  1FAA A;  3QMX A;  2P0G A;  1FB6 A;  4DVC A;  4I5Q A;  3D4T A;  3KMN A;  5B8A A;  2P5R A;  1TOF A;  1TP9 A;  3LYP A;  5ECQ B;  1JZD A;  4K8M A;  5B6N A;  4IQ1 A;  3F3Q A;  5AIS A;  3L4N A;  2H1A A;  1K0B A;  3M3M A;  3H79 A;  5ABR A;  2LS5 A;  4K2D A;  18GS A;  4X43 A;  2VL3 A;  1AW9 A;  2L6D A;  5CRW A;  1TDI A;  2CV4 A;  1V2A A;  3HY2 A;  2HXK A;  2H30 A;  4PQH A;  2H1D A;  1PMT A;  1THO A;  1NM3 A;  3P7X A;  1M0U A;  3HA9 A;  3RDW A;  4BVX A;  4HQS A;  3CRT A;  2O8V B;  1E6B A;  2H71 A;  4POB A;  2M80 A;  2LST A;  4F0B A;  4KGI A;  3ZFB A;  4ECI A;  1XFL A;  4PUF C;  2AUV A;  3TJJ A;  2VLT A;  1SJZ A;  2DBC A;  2IPA A;  4FH8 A;  4IP1 A;  3HVS A;  3CSI A;  3RHB A;  1HD2 A;  2GSQ A;  5JCG A;  3VLN A;  2YNX A;  4PXO A;  3H4K A;  1SEN A;  1JHB A;  3IK9 A;  1SL1 B;  1XOB A;  3MDK A;  2EIQ A;  1O8W A;  3EE2 A;  2LEG A;  3HKR A;  1GUM A;  3UVH A;  1B9X C;  3LYK A;  4HJM A;  4IVF A;  4G9H A;  4KSM A;  2BMX A;  6GSW A;  3GUS A;  3OR5 A;  4MAB A;  1G6W A;  2V1M A;  4I97 A;  3GL3 A;  1BG5 A;  2DSA A;  1WE0 A;  3BJ5 A;  3CYN A;  4QL9 A;  3IAM 2;  1K0A A;  3H93 A;  1O81 A;  2GST A;  2XC2 A;  4JED A;  4E8E A;  1DE2 A;  4H86 A;  5F0G A;  4IS0 A;  2IIY A;  2C0E A;  2VL2 C;  1AQX A;  2L4Q A;  1Q98 A;  1NHY A;  3VUR A;  5IPG A;  1ERU A;  1VF2 A;  4V2L A;  1O7U A;  1Z6M A;  1FW1 A;  1T7P B;  4XS6 A;  4L0U A;  4P3Y B;  2R3X A;  5HR1 A;  1B4Q A;  4ZL9 A;  3KEB A;  2I1U A;  3DEX A;  3HVV A;  5IIZ A;  4GTU A;  4JRR A;  4XS4 B;  3QAW A;  4MPF A;  2WZ9 A;  1AQW A;  3TJB A;  1ZL9 A;  1TK0 B;  4NXI A;  2RII A;  2F3M A;  4L0W A;  2GQM A;  6GST A;  4J57 E;  2LV3 A;  5ECH B;  4GST A;  1FB0 A;  5H5Q A;  3LSZ A;  2PER A;  5H5S A;  3TKQ A;  3GA4 A;  4K0G A;  4KW6 A;  2VM1 A;  4ISD A;  5G1L A;  4NWY A;  5CRE A;  4PQ1 A;  2YCD A;  1ZCP A;  4Q5N A;  5DJL A;  1M2B A;  4EL1 A;  3TKP A;  4Q5Q A;  5KEJ A;  2OBK A;  3DGQ A;  2JZT A;  1TW9 A;  2C80 A;  1F37 A;  5DDL A;  1THX A;  2FY6 A;  2XBI A;  2AYT A;  2JAC A;  5D96 A;  3BD2 A;  5D9X A;  2I81 A;  1XZO A;  2F8A A;  4I8B A;  4KCA A;  4KDY A;  2C1Y A;  2B7K A;  3VI5 A;  4TR1 A;  3HCZ A;  3EU3 A;  1F6M C;  4JE1 A;  2M46 A;  2H75 A;  1OVN A;  2VCT A;  2A2R A;  3F4T A;  2F9S A;  1SK0 A;  1R5A A;  2WS2 A;  3H8Q A;  3IR4 A;  2MMO A;  4Z7X A;  6GSV A;  2GVP A;  2LJK A;  2L59 A;  3GH9 A;  4MJA A;  4FYB A;  2OE0 A;  2RUF A;  1FOV A;  1Z3E A;  2REM A;  1EEM A;  5CRD A;  1V98 A;  2KP1 A;  3KH9 A;  1GSY A;  2GLR A;  3HYP A;  4ECB A;  5ECO B;  4OFN A;  3KXO A;  3TKS E;  4BVY A;  3DKS A;  4XHM A;  3GRX A;  1GSE A;  3GKK A;  2CAQ A;  3HHV A;  3GIX A;  1A2J A;  1ST9 A;  5D8I A;  1ZZY A;  3CTG A;  5GSS A;  4HI7 A;  5HFI A;  5B7C A;  1T4Y A;  2IMK A;  1MD4 A;  5ECM B;  1ERW A;  4K9Z A;  3UJ1 A;  4MJC A;  4TVE A;  3JCM L;  5ECN B;  1T8E B;  2D2Z A;  2LQQ A;  1TTZ A;  4IGJ A;  2KOK A;  17GS A;  1FVJ A;  2FHE A;  4XCS A;  1GSU A;  3A3T A;  4PQI A;  2YJ7 A;  4KX4 A;  3C1R A;  4ML6 A;  5IPH A;  4GQC A;  3LOR A;  3I69 A;  5DAK B;  2K8S A;  1XXU A;  4NAX A;  3M9K A;  3TRX A;  3QR6 A;  2I3Y A;  3EC3 A;  3ERF A;  4E8H A;  4MLY A;  2ES7 A;  5J4U A;  3QPM A;  5B8B A;  5AGY A;  2DJ1 A;  2C0D A;  4LMW A;  1AC1 A;  1SKS B;  1ZMA A;  3QFB C;  2B3S A;  2YOI A;  3DYR A;  5F05 A;  4BA7 A;  3W6G A;  2JZR A;  1FO5 A;  5D9T A;  3HJO A;  22GS A;  1EGR A;  1TJD A;  3QAG A;  1W89 A;  1DE1 A;  4ZL8 A;  4WBJ A;  2VOC A;  5GZZ B;  2OAD A;  1GUL A;  2LNS A;  5F06 A;  5G1K A;  3US3 A;  2C8U A;  3DIE A;  4TR3 A;  4IW9 A;  2H01 A;  3Q18 A;  2VCV A;  4QL7 A;  3C73 A;  5JWR B;  4NV2 A;  3UIW A;  2MZC A;  5A4U A;  1BYE A;  4X1U A;  3VWX A;  1NHO A;  2DLX A;  3N5O A;  2DJK A;  1H4O A;  1ILO A;  4HU9 A;  2VD0 A;  2IMF A;  3L0H A;  3U6V A;  4RI6 A;  1WRY A;  4L5O A;  3VWU A;  2QSI A;  1BQ7 A;  5AIV A;  1FHE A;  3TCO A;  4AF2 A;  1EP8 A;  3GMF A;  3Q74 A;  1GUK A;  1A2M A;  1GH2 A;  3QFA C;  4WR4 A;  1VF3 A;  4CW9 A;  4K1F A;  2HLS A;  1XCC A;  4RQR A;  5J41 A;  4ILF A;  1U88 A;  3HJM A;  2TIR A;  4TR0 A;  12GS A;  1QGV A;  4LMV A;  2FWG A;  3E3E A;  5ECK B;  1OC9 B;  4O5R A;  4D73 A;  5AIX A;  5ECS A;  3K8N A;  1T1V A;  2G0F A;  1ZOF A;  3A2V A;  3CBU A;  1U6T A;  16GS A;  1OE7 A;  3RPP A;  1YZX A;  3G7I A;  3H1N A;  4KE3 A;  2X64 A;  2J23 A;  1K0M A;  3O76 A;  1J9B A;  2GDR A;  2V32 A;  2H0I A;  2O87 A;  3HZ8 A;  3DXB A;  3G7J A;  5L71 A;  5CP1 A;  2YAN A;  5G30 A;  4TW5 A;  4FIW A;  3F63 A;  3ZVJ D;  1X9M B;  3HVX A;  4LA1 A;  1YF1 A;  2LUS A;  5FHI A;  1N8J A;  1MTC A;  4JR4 A;  2A4V A;  2VD1 A;  4MF5 A;  5J3R A;  4Q5F A;  4NV5 A;  4BPY A;  6GSU A;  1K3O A;  5EL8 A;  1EP7 A;  1PA3 A;  1R5P A;  1KEB A;  1X0R A;  6GSX A;  1BJX A;  3AY8 A;  11GS A;  4F0C A;  2VM2 A;  2H0G A;  4OFT A;  2DMM A;  5CNW A;  1O8X A;  2JU5 A;  2GTU A;  1M2A A;  2JSY A;  4Q5R A;  6GSY A;  3RBT A;  1ML6 A;  1N2A A;  3F4S A;  1SKW B;  3LQ7 A;  2AAW A;  3WGX A;  2FWE A;  5IMZ A;  3QCP A;  3A2W A;  4V2N A;  5IMA A;  10GS A;  4ZBB A;  2IN3 A;  3KM6 A;  3I9V 2;  3FR6 A;  1TKD B;  4DSS A;  2PVO C;  1A24 A;  1ERV A;  2HSY A;  3KTL A;  4TXO B;  2QC7 A;  4CDO A;  1FG4 A;  1VF4 A;  2FWH A;  1LJR A;  1IYH A; 
#chains in the Genus database with same CATH topology
 1M99 A;  2WCI A;  3M9J A;  20GS A;  3FRC A;  1XW6 A;  1M3J A;  1X5E A;  2L4C A;  4O7H A;  3ZIJ A;  4ZB6 A;  2NVL A;  3CRU A;  5IMC A;  3APS A;  1NSW A;  2DJ2 A;  3WT1 A;  4RUV A;  1XW5 A;  1GTA A;  4RQX A;  1HQO A;  1URM A;  3FZA A;  4MPG A;  2HYX A;  1ERT A;  2ZUP A;  4KDX A;  2FLS A;  2LJA A;  4JR6 A;  2IMI A;  3IOS A;  2CZ3 A;  1DBY A;  2O85 A;  3UAP A;  3A2X A;  3FY7 A;  1A2L A;  3GH6 A;  1MDJ A;  4HJ2 A;  5DQY A;  1WOU A;  2PVQ A;  2HZF A;  3M1G A;  2KHP A;  2LJR A;  4DSR A;  5GAP D;  2LRT A;  2PU9 C;  4K7O A;  3PGT A;  4TR1 B;  4WF4 A;  4EIQ A;  3HD5 A;  2PMT A;  5IMF A;  1XOA A;  1CQH A;  2PGT A;  3RAZ A;  5IOW A;  4I6X A;  1VGL A;  3IC4 A;  4IN0 A;  2FWF A;  3GKM A;  2BJX A;  1Z6N A;  1GNW A;  1SK2 A;  4ZIJ A;  3EVI A;  5JWO B;  2CX3 A;  4ZBD A;  1JZR A;  2EC4 A;  2VL2 A;  3KCM A;  4MF6 A;  3HZ4 A;  2GZP A;  3O3T A;  2C3Q A;  5HR0 A;  2ALB A;  5INY A;  4G2E A;  3GHA A;  5F8B A;  4HZ2 A;  3UL3 A;  2YN1 A;  2H74 A;  1RK4 A;  1DSB A;  3IPZ A;  4IBP A;  4ULX A;  3L9V A;  5ID2 B;  1J0F A;  2H73 A;  3ZFL A;  3GV1 A;  1FVK A;  3MWH A;  2FCH A;  2OJL A;  5KN0 A;  1B9Y C;  4KA0 A;  1SKR B;  1QXH A;  3GKX A;  5ELA A;  3FMW A;  5C04 A;  4G0K A;  2H1B A;  5EVO A;  1AIU A;  3DWV A;  5DAL B;  1YKA A;  5DVB A;  2HFD A;  1QUW A;  4I2T A;  4PUR A;  2DJ3 A;  2PUK C;  2YWI A;  5LD0 A;  4MF7 A;  1ON4 A;  3TB2 A;  1PGT A;  3LWA A;  1PN9 A;  2KP2 A;  2N5A A;  5J9B A;  3TUE A;  3EIN A;  2IWT A;  1ZYP A;  2X4A A;  2X99 A;  1TRU A;  3ED3 A;  3GNJ A;  2GSS A;  3VPT A;  5DQS A;  3KP8 A;  1JFU A;  4ZIL A;  4BWQ A;  1XWA A;  2RM5 A;  4GQF A;  4WEY A;  2CVB A;  1S3A A;  4CY8 A;  2VCQ A;  3TRQ A;  2RM6 A;  2RLI A;  1X9S B;  4IHU A;  1RQM A;  2HZE B;  4NMU A;  2VIM A;  4MZB A;  2DIZ A;  3D4M A;  4XS4 A;  4YQV A;  2CZ2 A;  7GSS A;  3ISO A;  2NPB A;  5A4V A;  3DRN A;  2LQO A;  2GT6 A;  2QKE A;  1BAY A;  1ZYQ B;  2O89 A;  3N9J A;  2R37 A;  4KB3 A;  4O5Q A;  1PL1 A;  2Z9S A;  2CVK A;  2N5F A;  3DVW A;  4MP4 A;  4QQ7 A;  5D9W A;  3EMP A;  2K8V A;  2K9F A;  1TXX A;  4GRF A;  3EMX A;  4IEL A;  2CT6 A;  1XBS A;  1WIK A;  2JL4 A;  1OC8 A;  3L78 A;  2H6Z A;  3WYW A;  3ZL5 A;  2BTO T;  2X8H A;  2YPM A;  3P2A A;  1MDI A;  1SJI A;  3UBK A;  1UVZ A;  1PX6 A;  4L8E A;  3TKS C;  5KN3 A;  1GTB A;  1HNB A;  2GZY A;  5ECI B;  4X0X A;  5AN1 A;  3QDN A;  5E4W A;  4KH7 A;  3J7Y b;  5GST A;  3U5R E;  4ML1 A;  2YZU A;  4XRA A;  4GLT A;  5ECP B;  1PKW A;  1T4Z A;  4TOP A;  2WJU A;  4HOJ A;  3ZIT A;  4FYC A;  3CTF A;  2CX4 A;  3UEM A;  3TKS A;  2MBS A;  3MSZ A;  1OYJ A;  5CRH A;  5BMU A;  2C3N A;  4OMV A;  3SWL A;  2MMA A;  2LKU A;  4PGT A;  4KND A;  3I6A A;  3PR8 A;  1T3B A;  2FD3 A;  2IFQ A;  4K7I A;  1UN2 A;  3F4R A;  2E2G A;  2IL3 A;  3TKR A;  1TK8 B;  4V1A g;  2OKA A;  5CO3 A;  1ACV A;  4J2F A;  2H6Y A;  2C3T A;  3VPQ A;  2B5X A;  3ZYW A;  1Z7P A;  4FQU A;  5ECL B;  4KUN A;  5FT3 A;  2YV7 A;  2H72 A;  4G19 A;  3TJK A;  3ZRE A;  4YQM A;  2AHE A;  4K0N A;  1WJK A;  4EIP A;  3PH9 A;  3EUR A;  4TN8 A;  2PN8 A;  3HXS A;  5G5E A;  1NW2 A;  3F9U A;  1K0C A;  2L5O A;  1GL8 A;  4MCU A;  5IM9 A;  1X5D A;  2XPE A;  3IA1 A;  2A2S A;  3TJG A;  4GCI A;  1IYI A;  2AB6 A;  1A0F A;  1PL2 A;  1OKT A;  3ZTL A;  5J5N A;  3EU4 A;  4GWR A;  1TI1 A;  3RPN A;  2VLU A;  3GTU A;  3WGD A;  2K18 A;  1TRW A;  5LCZ A;  2H6X A;  2WUL A;  3APQ A;  4WBR D;  2H70 A;  3FYG A;  4EC0 A;  3UOM A;  5COH A;  2QGV A;  5DJM A;  1PKZ A;  1TU7 A;  3W8S A;  5KOW A;  1W4V A;  4GXZ A;  5HFK A;  4F2I A;  5EY6 A;  1WWJ A;  3ME8 A;  1GNE A;  2GSR A;  3GL5 A;  1VF1 A;  3E0U A;  4N30 A;  5D93 A;  3IK7 A;  2FGX A;  2KLX A;  1WMJ A;  1YF0 A;  1RW1 A;  1GWC A;  4OCF A;  1S3D A;  1CQG A;  13GS A;  2IMD A;  4AGS A;  2H66 A;  2LNT A;  1GSD A;  2GQK A;  1LU4 A;  3D5J A;  1SL0 B;  3QAV A;  3LXT A;  4EUY A;  1TI3 A;  4AJ7 A;  3KTB A;  3FR9 A;  4PNG A;  3P8W A;  2YZH A;  3KP9 A;  4HEA 2;  1ZGN A;  4PUA A;  2C0G A;  2VO4 A;  5DCG A;  2B5Y A;  3GUR A;  4BVX B;  2PWJ A;  2HSH A;  1HNA A;  3D22 A;  3F0I A;  1PN0 A;  2EIR A;  1EEJ A;  1M2D A;  3HJP A;  4X4J A;  1ABA A;  4YKG A;  3LJR A;  1GSS A;  4KSO A;  4TRX A;  1XVW A;  3GN3 A;  5KN1 A;  2MMN A;  2B1L A;  1GSQ A;  4J56 E;  4OO5 A;  1JZW A;  2H1G A;  1S3R A;  3F6D A;  2CVD A;  1U3I A;  1H75 A;  4YAP A;  2CQ9 A;  2YJH A;  4MH3 A;  2X49 A;  2V41 A;  1M9B A;  2B5E A;  2CA8 A;  5HFG A;  3TDG A;  2L57 A;  3ZIV A;  1XVQ A;  3WGE A;  4EDZ A;  3C7M A;  1XPV A;  2H8L A;  4WET A;  2TRC P;  1HNC A;  1GUH A;  1B8X A;  4K7N A;  1G6Y A;  4EVM A;  2VLV A;  1QFN A;  4IKH A;  2OE1 A;  3FW2 A;  1F3B A;  4F03 A;  5G5F A;  4NHZ A;  5JCW A;  5ECR B;  3NZN A;  4GSS A;  4V2M A;  4YQU A;  3IAS 2;  4F9Z A;  1A8L A;  1PQN A;  1V57 A;  1QQ2 A;  2CAI A;  2G2Q A;  2YWO A;  1OC9 A;  2N5B A;  3HVN A;  2HE3 A;  4MDC A;  5HR2 A;  2I9H A;  3EYT A;  1G7E A;  1BED A;  4YAV A;  1SD8 A;  3GFK A;  5IMD A;  3GX8 A;  4BIK A;  4HUA A;  5A5K A;  2AJQ B;  1O85 A;  3MAK A;  5IO0 A;  2ON7 A;  3IBH A;  1AAZ A;  1JLW A;  1EOH A;  4O32 A;  6GSS A;  3W8J A;  3DVX A;  3M0F A;  2KUC A;  3KZQ A;  1S3C A;  3A5I A;  2DC5 A;  3IHG A;  2JAD A;  5D73 A;  3P90 A;  4XRD A;  1R26 A;  3IV4 A;  1XWG A;  4EDY A;  5FWG A;  2FA4 A;  3LFL A;  3MNG A;  3TOT A;  4KDU A;  3KGK A;  1GRX A;  4FYU A;  1PX7 A;  4BL7 A;  2F8F A;  4F82 A;  2V6O A;  3VK9 A;  3ZZX A;  4ID0 A;  4OWY A;  3ME7 A;  2XPD A;  1O73 A;  2GZZ A;  3BCI A;  1GLQ A;  2WDU A;  1F3A A;  1YKC A;  3V1W A;  4WR5 A;  2YWN A;  3L9S A;  2X8C A;  4ZBA A;  2R6K A;  2OE3 A;  4IJ3 A;  2H0H A;  5IO2 A;  1R7H A;  1V58 A;  2K6V A;  3ERG A;  2ZNM A;  4HS1 A;  1EV9 A;  3IHQ A;  1C72 A;  1YEX A;  2R5G A;  1KBN A;  1EOG A;  2I4A A;  2HT9 A;  1PD2 1;  2P31 A;  3F3R A;  3UVT A;  3VWW A;  1GSF A;  3QD9 A;  3FR3 A;  2HI7 A;  3ZVJ A;  2V6K A;  2VAF A;  4TXO A;  4EO3 A;  4MNN A;  2OAC A;  2B7J A;  3KH7 A;  3LGC A;  2DIY A;  3IXR A;  1F9M A;  5CRG A;  3IDV A;  2HNL A;  4POL A;  3D21 A;  1ZYE A;  3TOU A;  1QK8 A;  2WFC A;  4WF5 A;  4WXT A;  1FOH A;  1SD9 A;  5EPF A;  4OO4 A;  1YQ1 A;  4OD7 A;  19GS A;  4JZQ A;  2ZCT A;  4BVY B;  2LTK A;  1YDK A;  1O6J A;  4L5L A;  1UC7 A;  4HU7 A;  1Z7R A;  1UA5 A;  4ACS A;  1M9A A;  1SYR A;  3D0Z A;  4AJ8 A;  3GYK A;  1MD3 A;  2NBS A;  1M7T A;  3D6I A;  4N10 A;  5DBQ A;  4Z2U A;  4RI7 A;  3CMI A;  2MYG A;  1V40 A;  3ZLP A;  3NOF A;  2E2M A;  4MMM A;  1X9W B;  3ZRD A;  5A4W A;  1OE8 A;  1DUG A;  4ZL7 A;  4MH2 A;  4TR4 A;  2VL9 A;  4O92 A;  3J7Y k;  4EKZ A;  4NPB A;  3VI7 A;  2MMZ A;  3DD3 A;  2IME A;  2GQL A;  4ECC A;  3R3E A;  1JZO A;  5G2Z A;  3ZML A;  1I9D A;  2AV4 A;  1AXD A;  4LL4 B;  1B4P A;  2L6C A;  1GTU A;  4XTS A;  1K3Y A;  4GF0 A;  1XIY A;  1AUC A;  5IMV A;  4NHW A;  3TRP A;  4K6X A;  4ZB8 A;  2J9H A;  2R4V A;  4BWS A;  3FZ4 A;  3M8N A;  3PIN A;  1YJ6 A;  2FA8 A;  3UAR A;  2HRN A;  1JLV A;  1MEK A;  3C71 A;  4POK A;  5CAX A;  2X8G A;  4GSN A;  1PRX A;  4XIH A;  4IJI A;  3BBY A;  2FUG 2;  4POM A;  2B1K A;  2IFQ B;  2OA7 A;  2R0G A;  1BX9 A;  2E0Q A;  3WD6 A;  3DML A;  2VCW A;  4ZXG A;  2F51 A;  5ID2 A;  3G9B A;  1AQV A;  3R2Q A;  2O7K A;  3UBL A;  1Y25 A;  3FZ5 A;  4CHS A;  4HZ4 A;  1K3L A;  3F8U A;  4ICY A;  1SJ6 A;  5ENU A;  2H19 A;  1SL2 B;  2YP6 A;  4KCE A;  1A23 A;  2PPT A;  5DAL A;  8GSS A;  3Q19 A;  1YY7 A;  4EXJ A;  3CSH A;  5B6M A;  3GST A;  5LNK e;  1EWX A;  3UMA A;  3TGZ A;  5E59 A;  2DML A;  1EGO A;  2FNO A;  2XBQ A;  1A8Y A;  2DJJ A;  1TRS A;  4V1A p;  1GLP A;  2NTO A;  3C8E A;  3KD0 A;  4DEJ A;  3APO A;  5C00 A;  5KN2 A;  4XS1 A;  3LXZ A;  5H5R A;  3GTU B;  3F6F A;  5HR3 A;  1SK1 A;  1T00 A;  1XWK A;  1F2E A;  1TU8 A;  2HZE A;  1U3A A;  3GSS A;  1QMV A;  3WT2 A;  5ELG A;  1TK5 B;  3A5W A;  3GKN A;  4FO5 A;  4MZC A;  1U87 A;  2HSM A;  1A0R P;  3I43 A;  2TRX A;  5IOX A;  1MDK A;  2LRN A;  3LG6 A;  5JCU A;  3FK8 A;  1K0O A;  1USB A;  3KMO A;  2M72 A;  3CQF A;  1VRS D;  1G7O A;  3L9U A;  3IRA A;  2R2J A;  4EF0 A;  2JSZ A;  5J9C A;  4ECJ A;  1HYU A;  1X5C A;  9GSS A;  2PBJ A;  5CYY A;  4JBB A;  1Z5Y E;  2H76 A;  2RUE A;  1B48 A;  2GT5 A;  1K0D A;  2MBT A;  2VCX A;  3KIJ A;  4KAE A;  1OAZ A;  2XHF A;  3CSJ A;  4JU5 A;  3FZ9 A;  1SYX A;  4YH2 A;  4D73 B;  3QOU A;  4HDE A;  4MJE A;  2UZ8 A;  4LLR A;  3EPT A;  4N0Z A;  5F07 A;  2C0F A;  3LEF A;  4PX1 A;  2ON5 A;  3CXG A;  2WGR A;  3MIX A;  5GAN D;  4MA9 A;  3TJF A;  3KJY A;  4G0I A;  2VUP A;  2DKH A;  3VFI A;  2P5Q A;  2YV9 A;  3IE3 A;  4OFM A;  1GP1 A;  1XWB A;  2LRC A;  4AJ6 A;  5DAK A;  1I5G A;  3C1S A;  1OKD A;  3SBC A;  3VWV A;  2R0P A;  3Q6O A;  5D9V A;  3ERW A;  4MK3 A;  2WB9 A;  14GS A;  1YEP A;  4TXV A;  3NIV A;  5JWQ B;  3GX0 A;  2EIO A;  4IP6 A;  1XWC A;  5G31 A;  4PNF A;  1LBK A;  3S9F A;  5HQP A;  2JZS A;  4LL1 B;  4MZW A;  2GS3 A;  4IQA A;  1R4W A;  5DCH A;  2IJY A;  2E7P A;  4Z2R A;  2GGT A;  1Z9H A;  2VCZ A;  1J08 A;  4EE0 A;  4WKW A;  3FEU A;  3EWL A;  3FHK A;  2NDO A;  2B6M A;  3E9J B;  5IQY A;  4OCE A;  3ZMK A;  4N0V A;  4TKY A;  3RHC A;  1EV4 A;  3G7Y A;  4DSS B;  3BCK A;  1TRV A;  1XW9 A;  4DSQ A;  2V2G A;  4I2U A;  1ZYN A;  4MJB A;  4G10 A;  3HDC A;  1G0T A;  4HSC X;  1EZK A;  1K0N A;  1SU9 A;  4HQZ A;  2DJ0 A;  1KNG A;  1WP0 A;  1WPI A;  1V9W A;  1KTE A;  1E2Y A;  1GTI A;  2HRF A;  2OBI A;  3FKF A;  2YWM A;  3MYD A;  1PSQ A;  2WRT A;  4A5P A;  2L5L A;  3O6T A;  1Q4J A;  4N11 A;  1Y6E A;  3BOA A;  4ZB9 A;  2C4J A;  1OC3 A;  1FAA A;  3QMX A;  2P0G A;  1FB6 A;  4DVC A;  4I5Q A;  3D4T A;  3KMN A;  2QA1 A;  5B8A A;  2P5R A;  1TOF A;  1TP9 A;  3PPU A;  3LYP A;  5ECQ B;  1JZD A;  4K8M A;  5B6N A;  4IQ1 A;  3F3Q A;  5AIS A;  3L4N A;  2H1A A;  4USS A;  1K0B A;  3M3M A;  3H79 A;  2A2P A;  5ABR A;  2LS5 A;  4K2D A;  18GS A;  4X43 A;  2VL3 A;  1AW9 A;  2L6D A;  5CRW A;  1TDI A;  2CV4 A;  1V2A A;  3HY2 A;  2HXK A;  2H30 A;  4PQH A;  2H1D A;  1PMT A;  1THO A;  1NM3 A;  3P7X A;  1M0U A;  3HA9 A;  3RDW A;  4BVX A;  4HQS A;  3CRT A;  2O8V B;  1E6B A;  2H71 A;  4POB A;  2M80 A;  2LST A;  4F0B A;  4KGI A;  3ZFB A;  4ECI A;  1XFL A;  4PUF C;  2AUV A;  3TJJ A;  2VLT A;  1SJZ A;  2DBC A;  2IPA A;  4FH8 A;  4IP1 A;  3HVS A;  4CY6 A;  3CSI A;  3RHB A;  1HD2 A;  2GSQ A;  5JCG A;  3VLN A;  2YNX A;  4PXO A;  3H4K A;  1SEN A;  1JHB A;  3IK9 A;  1SL1 B;  1XOB A;  3MDK A;  2EIQ A;  1O8W A;  3EE2 A;  2LEG A;  3HKR A;  1GUM A;  3UVH A;  1B9X C;  3LYK A;  4Z2T A;  4HJM A;  4IVF A;  4G9H A;  4KSM A;  2BMX A;  6GSW A;  3GUS A;  3OR5 A;  4MAB A;  1G6W A;  2V1M A;  4I97 A;  3GL3 A;  1BG5 A;  2DSA A;  1WE0 A;  3BJ5 A;  3CYN A;  4QL9 A;  3IAM 2;  1K0A A;  3H93 A;  1O81 A;  2GST A;  2XC2 A;  4JED A;  4E8E A;  1DE2 A;  4H86 A;  5F0G A;  4IS0 A;  2IIY A;  4K2X A;  2C0E A;  2VL2 C;  1AQX A;  4K5R A;  2L4Q A;  1Q98 A;  1NHY A;  3VUR A;  5IPG A;  1ERU A;  1VF2 A;  4V2L A;  1O7U A;  1Z6M A;  1FW1 A;  1T7P B;  4XS6 A;  4L0U A;  4P3Y B;  2R3X A;  5HR1 A;  1B4Q A;  4ZL9 A;  3KEB A;  2HRA A;  2I1U A;  3DEX A;  3HVV A;  5IIZ A;  4GTU A;  4JRR A;  4XS4 B;  3QAW A;  4MPF A;  2WZ9 A;  1AQW A;  3TJB A;  1ZL9 A;  1TK0 B;  4NXI A;  2RII A;  2F3M A;  4L0W A;  2GQM A;  6GST A;  4J57 E;  2LV3 A;  5ECH B;  4GST A;  2R0C A;  1FB0 A;  5H5Q A;  3LSZ A;  2PER A;  5H5S A;  3TKQ A;  3GA4 A;  4K0G A;  4KW6 A;  2VM1 A;  4ISD A;  5G1L A;  4NWY A;  5CRE A;  4PQ1 A;  2YCD A;  1ZCP A;  4Q5N A;  5DJL A;  1M2B A;  4EL1 A;  3TKP A;  4Q5Q A;  5KEJ A;  2OBK A;  5BRT A;  3DGQ A;  2JZT A;  1TW9 A;  2C80 A;  1F37 A;  5DDL A;  1THX A;  2FY6 A;  2XBI A;  2AYT A;  2JAC A;  5D96 A;  3BD2 A;  5D9X A;  2I81 A;  1XZO A;  2F8A A;  4I8B A;  4KCA A;  4KDY A;  2C1Y A;  2B7K A;  3VI5 A;  4TR1 A;  3HCZ A;  3EU3 A;  1F6M C;  4JE1 A;  4G0L A;  2M46 A;  2H75 A;  2QA2 A;  1OVN A;  2VCT A;  2A2R A;  3F4T A;  2DKI A;  2F9S A;  1SK0 A;  1R5A A;  2WS2 A;  3H8Q A;  3IR4 A;  2MMO A;  4Z7X A;  6GSV A;  2GVP A;  2LJK A;  2L59 A;  3GH9 A;  4MJA A;  4FYB A;  2OE0 A;  2RUF A;  1FOV A;  4O5U A;  1Z3E A;  2REM A;  1EEM A;  5CRD A;  1V98 A;  2KP1 A;  3KH9 A;  1GSY A;  2GLR A;  3HYP A;  4ECB A;  5ECO B;  4OFN A;  3KXO A;  3TKS E;  4BVY A;  3DKS A;  4YKF A;  4XHM A;  3GRX A;  1GSE A;  3GKK A;  2CAQ A;  3HHV A;  3GIX A;  1A2J A;  1ST9 A;  5D8I A;  1ZZY A;  3CTG A;  5GSS A;  4HI7 A;  5HFI A;  5B7C A;  1T4Y A;  1XG8 A;  2IMK A;  1MD4 A;  5ECM B;  1ERW A;  4K9Z A;  3UJ1 A;  4MJC A;  4TVE A;  3JCM L;  5ECN B;  1T8E B;  4K5S A;  2D2Z A;  2LQQ A;  1TTZ A;  4IGJ A;  2KOK A;  2HRK A;  3LW9 A;  17GS A;  1FVJ A;  2FHE A;  4XCS A;  1GSU A;  3A3T A;  4PQI A;  2YJ7 A;  4KX4 A;  3C1R A;  4ML6 A;  5IPH A;  4GQC A;  3LOR A;  3I69 A;  5DAK B;  2K8S A;  1XXU A;  4NAX A;  3M9K A;  3TRX A;  3QR6 A;  2I3Y A;  3EC3 A;  3ERF A;  4E8H A;  4MLY A;  2ES7 A;  5J4U A;  3QPM A;  5B8B A;  5AGY A;  2DJ1 A;  2C0D A;  4LMW A;  1AC1 A;  1SKS B;  1ZMA A;  3QFB C;  2B3S A;  2YOI A;  3DYR A;  5F05 A;  4BA7 A;  3W6G A;  2JZR A;  1FO5 A;  5D9T A;  3HJO A;  22GS A;  1EGR A;  1TJD A;  3QAG A;  1W89 A;  1DE1 A;  4ZL8 A;  4WBJ A;  2VOC A;  5GZZ B;  2OAD A;  1GUL A;  2LNS A;  5F06 A;  5G1K A;  3US3 A;  2C8U A;  3DIE A;  2A4H A;  4TR3 A;  4IW9 A;  2H01 A;  3Q18 A;  2VCV A;  4QL7 A;  3C73 A;  5JWR B;  4NV2 A;  3UIW A;  2MZC A;  5A4U A;  1BYE A;  4X1U A;  3VWX A;  1NHO A;  2DLX A;  3N5O A;  2DJK A;  1H4O A;  1ILO A;  4HU9 A;  2VD0 A;  2IMF A;  3L0H A;  3U6V A;  4RI6 A;  1WRY A;  4L5O A;  3VWU A;  2QSI A;  1BQ7 A;  5AIV A;  1FHE A;  3TCO A;  4AF2 A;  1EP8 A;  3GMF A;  3Q74 A;  1GUK A;  1A2M A;  1GH2 A;  3QFA C;  4WR4 A;  1VF3 A;  4CW9 A;  4K1F A;  2HLS A;  1XCC A;  4RQR A;  5J41 A;  4ILF A;  3IC8 A;  1U88 A;  3HJM A;  2TIR A;  4TR0 A;  12GS A;  1QGV A;  4LMV A;  2FWG A;  3E3E A;  5ECK B;  1OC9 B;  4O5R A;  4D73 A;  5AIX A;  5ECS A;  4PTS A;  3K8N A;  1T1V A;  2G0F A;  1ZOF A;  3A2V A;  3CBU A;  1U6T A;  16GS A;  1OE7 A;  3RPP A;  1YZX A;  3G7I A;  4KF9 A;  3H1N A;  4KE3 A;  2X64 A;  2J23 A;  1K0M A;  3O76 A;  1J9B A;  2GDR A;  2V32 A;  2H0I A;  2O87 A;  3HZ8 A;  3DXB A;  3G7J A;  5L71 A;  5CP1 A;  2YAN A;  5G30 A;  4TW5 A;  4FIW A;  5KOX A;  3F63 A;  3ZVJ D;  1X9M B;  3HVX A;  4LA1 A;  1YF1 A;  2LUS A;  5FHI A;  1N8J A;  1MTC A;  4JR4 A;  1M3I A;  2A4V A;  2VD1 A;  4MF5 A;  5J3R A;  4Q5F A;  4NV5 A;  4BL7 B;  4BPY A;  1PFO A;  6GSU A;  1K3O A;  5EL8 A;  1EP7 A;  1PA3 A;  1R5P A;  1KEB A;  1X0R A;  6GSX A;  1BJX A;  3AY8 A;  11GS A;  4F0C A;  2VM2 A;  2H0G A;  4OFT A;  2DMM A;  5CNW A;  1O8X A;  2JU5 A;  2GTU A;  1M2A A;  2JSY A;  4Q5R A;  6GSY A;  3RBT A;  1ML6 A;  1N2A A;  3F4S A;  1SKW B;  3LQ7 A;  2AAW A;  3WGX A;  2FWE A;  5IMZ A;  3QCP A;  3A2W A;  4V2N A;  5IMA A;  10GS A;  4ZBB A;  2IN3 A;  3KM6 A;  3I9V 2;  3FR6 A;  1TKD B;  4DSS A;  2PVO C;  1A24 A;  1ERV A;  2HSY A;  3KTL A;  4TXO B;  2QC7 A;  4CDO A;  1FG4 A;  1VF4 A;  2FWH A;  1LJR A;  1IYH A; 
#chains in the Genus database with same CATH homology
 1M99 A;  2WCI A;  3M9J A;  20GS A;  3FRC A;  1XW6 A;  1X5E A;  2L4C A;  4O7H A;  3ZIJ A;  4ZB6 A;  2NVL A;  3CRU A;  5IMC A;  3APS A;  1NSW A;  2DJ2 A;  3WT1 A;  4RUV A;  1XW5 A;  1GTA A;  4RQX A;  1HQO A;  1URM A;  3FZA A;  4MPG A;  2HYX A;  1ERT A;  2ZUP A;  4KDX A;  2FLS A;  2LJA A;  4JR6 A;  2IMI A;  3IOS A;  2CZ3 A;  1DBY A;  2O85 A;  3UAP A;  3A2X A;  3FY7 A;  1A2L A;  3GH6 A;  1MDJ A;  4HJ2 A;  5DQY A;  1WOU A;  2PVQ A;  2HZF A;  3M1G A;  2KHP A;  2LJR A;  4DSR A;  5GAP D;  2LRT A;  2PU9 C;  4K7O A;  3PGT A;  4TR1 B;  4WF4 A;  4EIQ A;  3HD5 A;  2PMT A;  5IMF A;  1XOA A;  1CQH A;  2PGT A;  3RAZ A;  5IOW A;  4I6X A;  1VGL A;  3IC4 A;  4IN0 A;  2FWF A;  3GKM A;  2BJX A;  1Z6N A;  1GNW A;  1SK2 A;  4ZIJ A;  3EVI A;  5JWO B;  2CX3 A;  4ZBD A;  1JZR A;  2EC4 A;  2VL2 A;  3KCM A;  4MF6 A;  3HZ4 A;  2GZP A;  3O3T A;  2C3Q A;  5HR0 A;  2ALB A;  5INY A;  4G2E A;  3GHA A;  5F8B A;  4HZ2 A;  3UL3 A;  2YN1 A;  2H74 A;  1RK4 A;  1DSB A;  3IPZ A;  4IBP A;  4ULX A;  3L9V A;  5ID2 B;  1J0F A;  2H73 A;  3ZFL A;  3GV1 A;  1FVK A;  3MWH A;  2FCH A;  2OJL A;  5KN0 A;  1B9Y C;  4KA0 A;  1SKR B;  1QXH A;  3GKX A;  5ELA A;  3FMW A;  5C04 A;  4G0K A;  2H1B A;  5EVO A;  1AIU A;  3DWV A;  5DAL B;  1YKA A;  5DVB A;  2HFD A;  1QUW A;  4I2T A;  4PUR A;  2DJ3 A;  2PUK C;  2YWI A;  5LD0 A;  4MF7 A;  1ON4 A;  3TB2 A;  1PGT A;  3LWA A;  1PN9 A;  2KP2 A;  2N5A A;  5J9B A;  3TUE A;  3EIN A;  2IWT A;  1ZYP A;  2X4A A;  2X99 A;  1TRU A;  3ED3 A;  3GNJ A;  2GSS A;  3VPT A;  5DQS A;  3KP8 A;  1JFU A;  4ZIL A;  4BWQ A;  1XWA A;  2RM5 A;  4GQF A;  4WEY A;  2CVB A;  1S3A A;  4CY8 A;  2VCQ A;  3TRQ A;  2RM6 A;  2RLI A;  1X9S B;  4IHU A;  1RQM A;  2HZE B;  4NMU A;  2VIM A;  4MZB A;  2DIZ A;  3D4M A;  4XS4 A;  4YQV A;  2CZ2 A;  7GSS A;  3ISO A;  2NPB A;  5A4V A;  3DRN A;  2LQO A;  2GT6 A;  2QKE A;  1BAY A;  1ZYQ B;  2O89 A;  3N9J A;  2R37 A;  4KB3 A;  4O5Q A;  1PL1 A;  2Z9S A;  2CVK A;  2N5F A;  3DVW A;  4MP4 A;  4QQ7 A;  5D9W A;  3EMP A;  2K8V A;  2K9F A;  1TXX A;  4GRF A;  3EMX A;  4IEL A;  2CT6 A;  1XBS A;  1WIK A;  2JL4 A;  1OC8 A;  3L78 A;  2H6Z A;  3WYW A;  3ZL5 A;  2BTO T;  2X8H A;  2YPM A;  3P2A A;  1MDI A;  1SJI A;  3UBK A;  1UVZ A;  1PX6 A;  4L8E A;  3TKS C;  5KN3 A;  1GTB A;  1HNB A;  2GZY A;  5ECI B;  4X0X A;  5AN1 A;  3QDN A;  5E4W A;  4KH7 A;  3J7Y b;  5GST A;  3U5R E;  4ML1 A;  2YZU A;  4XRA A;  4GLT A;  5ECP B;  1PKW A;  1T4Z A;  4TOP A;  2WJU A;  4HOJ A;  3ZIT A;  4FYC A;  3CTF A;  2CX4 A;  3UEM A;  3TKS A;  2MBS A;  3MSZ A;  1OYJ A;  5CRH A;  5BMU A;  2C3N A;  4OMV A;  3SWL A;  2MMA A;  2LKU A;  4PGT A;  4KND A;  3I6A A;  3PR8 A;  1T3B A;  2FD3 A;  2IFQ A;  4K7I A;  1UN2 A;  3F4R A;  2E2G A;  2IL3 A;  3TKR A;  1TK8 B;  4V1A g;  2OKA A;  5CO3 A;  1ACV A;  4J2F A;  2H6Y A;  2C3T A;  3VPQ A;  2B5X A;  3ZYW A;  1Z7P A;  4FQU A;  5ECL B;  4KUN A;  5FT3 A;  2YV7 A;  2H72 A;  4G19 A;  3TJK A;  3ZRE A;  4YQM A;  2AHE A;  4K0N A;  1WJK A;  4EIP A;  3PH9 A;  3EUR A;  4TN8 A;  2PN8 A;  3HXS A;  5G5E A;  1NW2 A;  3F9U A;  1K0C A;  2L5O A;  1GL8 A;  4MCU A;  5IM9 A;  1X5D A;  2XPE A;  3IA1 A;  2A2S A;  3TJG A;  4GCI A;  1IYI A;  2AB6 A;  1A0F A;  1PL2 A;  1OKT A;  3ZTL A;  5J5N A;  3EU4 A;  4GWR A;  1TI1 A;  3RPN A;  2VLU A;  3GTU A;  3WGD A;  2K18 A;  1TRW A;  5LCZ A;  2H6X A;  2WUL A;  3APQ A;  4WBR D;  2H70 A;  3FYG A;  4EC0 A;  3UOM A;  5COH A;  2QGV A;  5DJM A;  1PKZ A;  1TU7 A;  3W8S A;  5KOW A;  1W4V A;  4GXZ A;  5HFK A;  4F2I A;  5EY6 A;  1WWJ A;  3ME8 A;  1GNE A;  2GSR A;  3GL5 A;  1VF1 A;  3E0U A;  4N30 A;  5D93 A;  3IK7 A;  2FGX A;  2KLX A;  1WMJ A;  1YF0 A;  1RW1 A;  1GWC A;  4OCF A;  1S3D A;  1CQG A;  13GS A;  2IMD A;  4AGS A;  2H66 A;  2LNT A;  1GSD A;  2GQK A;  1LU4 A;  3D5J A;  1SL0 B;  3QAV A;  3LXT A;  4EUY A;  1TI3 A;  4AJ7 A;  3KTB A;  3FR9 A;  4PNG A;  3P8W A;  2YZH A;  3KP9 A;  4HEA 2;  1ZGN A;  4PUA A;  2C0G A;  2VO4 A;  5DCG A;  2B5Y A;  3GUR A;  4BVX B;  2PWJ A;  2HSH A;  1HNA A;  3D22 A;  3F0I A;  1PN0 A;  2EIR A;  1EEJ A;  1M2D A;  3HJP A;  4X4J A;  1ABA A;  4YKG A;  3LJR A;  1GSS A;  4KSO A;  4TRX A;  1XVW A;  3GN3 A;  5KN1 A;  2MMN A;  2B1L A;  1GSQ A;  4J56 E;  4OO5 A;  1JZW A;  2H1G A;  3F6D A;  2CVD A;  1U3I A;  1H75 A;  4YAP A;  2CQ9 A;  2YJH A;  4MH3 A;  2X49 A;  2V41 A;  1M9B A;  2B5E A;  2CA8 A;  5HFG A;  3TDG A;  2L57 A;  3ZIV A;  1XVQ A;  3WGE A;  4EDZ A;  3C7M A;  1XPV A;  2H8L A;  4WET A;  2TRC P;  1HNC A;  1GUH A;  1B8X A;  4K7N A;  1G6Y A;  4EVM A;  2VLV A;  1QFN A;  4IKH A;  2OE1 A;  3FW2 A;  1F3B A;  4F03 A;  5G5F A;  4NHZ A;  5JCW A;  5ECR B;  3NZN A;  4GSS A;  4V2M A;  4YQU A;  3IAS 2;  4F9Z A;  1A8L A;  1PQN A;  1V57 A;  1QQ2 A;  2CAI A;  2G2Q A;  2YWO A;  1OC9 A;  2N5B A;  2HE3 A;  4MDC A;  5HR2 A;  2I9H A;  3EYT A;  1G7E A;  1BED A;  4YAV A;  1SD8 A;  3GFK A;  5IMD A;  3GX8 A;  4HUA A;  5A5K A;  2AJQ B;  1O85 A;  3MAK A;  5IO0 A;  2ON7 A;  3IBH A;  1AAZ A;  1JLW A;  1EOH A;  4O32 A;  6GSS A;  3W8J A;  3DVX A;  3M0F A;  2KUC A;  3KZQ A;  1S3C A;  3A5I A;  2DC5 A;  3IHG A;  2JAD A;  5D73 A;  3P90 A;  4XRD A;  1R26 A;  3IV4 A;  1XWG A;  4EDY A;  5FWG A;  2FA4 A;  3LFL A;  3MNG A;  3TOT A;  4KDU A;  3KGK A;  1GRX A;  4FYU A;  1PX7 A;  4BL7 A;  2F8F A;  4F82 A;  2V6O A;  3VK9 A;  3ZZX A;  4ID0 A;  4OWY A;  3ME7 A;  2XPD A;  1O73 A;  2GZZ A;  3BCI A;  1GLQ A;  2WDU A;  1F3A A;  1YKC A;  3V1W A;  4WR5 A;  2YWN A;  3L9S A;  2X8C A;  4ZBA A;  2R6K A;  2OE3 A;  4IJ3 A;  2H0H A;  5IO2 A;  1R7H A;  1V58 A;  2K6V A;  3ERG A;  2ZNM A;  4HS1 A;  1EV9 A;  3IHQ A;  1C72 A;  1YEX A;  2R5G A;  1KBN A;  1EOG A;  2I4A A;  2HT9 A;  1PD2 1;  2P31 A;  3F3R A;  3UVT A;  3VWW A;  1GSF A;  3QD9 A;  3FR3 A;  2HI7 A;  3ZVJ A;  2V6K A;  2VAF A;  4TXO A;  4EO3 A;  4MNN A;  2OAC A;  2B7J A;  3KH7 A;  3LGC A;  2DIY A;  3IXR A;  1F9M A;  5CRG A;  3IDV A;  2HNL A;  4POL A;  3D21 A;  1ZYE A;  3TOU A;  1QK8 A;  2WFC A;  4WF5 A;  4WXT A;  1FOH A;  1SD9 A;  5EPF A;  4OO4 A;  1YQ1 A;  4OD7 A;  19GS A;  4JZQ A;  2ZCT A;  4BVY B;  2LTK A;  1YDK A;  1O6J A;  4L5L A;  1UC7 A;  4HU7 A;  1Z7R A;  1UA5 A;  4ACS A;  1M9A A;  1SYR A;  3D0Z A;  4AJ8 A;  3GYK A;  1MD3 A;  2NBS A;  1M7T A;  3D6I A;  4N10 A;  5DBQ A;  4Z2U A;  4RI7 A;  3CMI A;  2MYG A;  1V40 A;  3ZLP A;  3NOF A;  2E2M A;  4MMM A;  1X9W B;  3ZRD A;  5A4W A;  1OE8 A;  1DUG A;  4ZL7 A;  4MH2 A;  4TR4 A;  2VL9 A;  4O92 A;  3J7Y k;  4EKZ A;  4NPB A;  3VI7 A;  2MMZ A;  3DD3 A;  2IME A;  2GQL A;  4ECC A;  3R3E A;  1JZO A;  5G2Z A;  3ZML A;  1I9D A;  2AV4 A;  1AXD A;  4LL4 B;  1B4P A;  2L6C A;  1GTU A;  4XTS A;  1K3Y A;  4GF0 A;  1XIY A;  1AUC A;  5IMV A;  4NHW A;  3TRP A;  4K6X A;  4ZB8 A;  2J9H A;  2R4V A;  4BWS A;  3FZ4 A;  3M8N A;  3PIN A;  1YJ6 A;  2FA8 A;  3UAR A;  2HRN A;  1JLV A;  1MEK A;  3C71 A;  4POK A;  5CAX A;  2X8G A;  4GSN A;  1PRX A;  4XIH A;  4IJI A;  3BBY A;  2FUG 2;  4POM A;  2B1K A;  2IFQ B;  2OA7 A;  2R0G A;  1BX9 A;  2E0Q A;  3WD6 A;  3DML A;  2VCW A;  4ZXG A;  2F51 A;  5ID2 A;  3G9B A;  1AQV A;  3R2Q A;  2O7K A;  3UBL A;  1Y25 A;  3FZ5 A;  4CHS A;  4HZ4 A;  1K3L A;  3F8U A;  4ICY A;  1SJ6 A;  5ENU A;  2H19 A;  1SL2 B;  2YP6 A;  4KCE A;  1A23 A;  2PPT A;  5DAL A;  8GSS A;  3Q19 A;  1YY7 A;  4EXJ A;  3CSH A;  5B6M A;  3GST A;  5LNK e;  1EWX A;  3UMA A;  3TGZ A;  5E59 A;  2DML A;  1EGO A;  2FNO A;  2XBQ A;  1A8Y A;  2DJJ A;  1TRS A;  4V1A p;  1GLP A;  2NTO A;  3C8E A;  3KD0 A;  4DEJ A;  3APO A;  5C00 A;  5KN2 A;  4XS1 A;  3LXZ A;  5H5R A;  3GTU B;  3F6F A;  5HR3 A;  1SK1 A;  1T00 A;  1XWK A;  1F2E A;  1TU8 A;  2HZE A;  1U3A A;  3GSS A;  1QMV A;  3WT2 A;  5ELG A;  1TK5 B;  3A5W A;  3GKN A;  4FO5 A;  4MZC A;  1U87 A;  2HSM A;  1A0R P;  3I43 A;  2TRX A;  5IOX A;  1MDK A;  2LRN A;  3LG6 A;  5JCU A;  3FK8 A;  1K0O A;  1USB A;  3KMO A;  2M72 A;  1VRS D;  1G7O A;  3L9U A;  3IRA A;  2R2J A;  4EF0 A;  2JSZ A;  5J9C A;  4ECJ A;  1HYU A;  1X5C A;  9GSS A;  2PBJ A;  5CYY A;  4JBB A;  1Z5Y E;  2H76 A;  2RUE A;  1B48 A;  2GT5 A;  1K0D A;  2MBT A;  2VCX A;  3KIJ A;  4KAE A;  1OAZ A;  2XHF A;  3CSJ A;  4JU5 A;  3FZ9 A;  1SYX A;  4YH2 A;  4D73 B;  3QOU A;  4HDE A;  4MJE A;  2UZ8 A;  4LLR A;  3EPT A;  4N0Z A;  5F07 A;  2C0F A;  3LEF A;  4PX1 A;  2ON5 A;  3CXG A;  2WGR A;  3MIX A;  5GAN D;  4MA9 A;  3TJF A;  3KJY A;  4G0I A;  2VUP A;  2DKH A;  3VFI A;  2P5Q A;  2YV9 A;  3IE3 A;  4OFM A;  1GP1 A;  1XWB A;  2LRC A;  4AJ6 A;  5DAK A;  1I5G A;  3C1S A;  1OKD A;  3SBC A;  3VWV A;  2R0P A;  3Q6O A;  5D9V A;  3ERW A;  4MK3 A;  2WB9 A;  14GS A;  1YEP A;  4TXV A;  3NIV A;  5JWQ B;  3GX0 A;  2EIO A;  4IP6 A;  1XWC A;  5G31 A;  4PNF A;  1LBK A;  3S9F A;  5HQP A;  2JZS A;  4LL1 B;  4MZW A;  2GS3 A;  4IQA A;  1R4W A;  5DCH A;  2IJY A;  2E7P A;  4Z2R A;  2GGT A;  1Z9H A;  2VCZ A;  1J08 A;  4EE0 A;  4WKW A;  3FEU A;  3EWL A;  3FHK A;  2NDO A;  2B6M A;  3E9J B;  5IQY A;  4OCE A;  3ZMK A;  4N0V A;  4TKY A;  3RHC A;  1EV4 A;  3G7Y A;  4DSS B;  3BCK A;  1TRV A;  1XW9 A;  4DSQ A;  2V2G A;  4I2U A;  1ZYN A;  4MJB A;  4G10 A;  3HDC A;  1G0T A;  1EZK A;  1K0N A;  1SU9 A;  4HQZ A;  2DJ0 A;  1KNG A;  1WP0 A;  1WPI A;  1V9W A;  1KTE A;  1E2Y A;  1GTI A;  2HRF A;  2OBI A;  3FKF A;  2YWM A;  3MYD A;  1PSQ A;  2WRT A;  4A5P A;  2L5L A;  3O6T A;  1Q4J A;  4N11 A;  1Y6E A;  3BOA A;  4ZB9 A;  2C4J A;  1OC3 A;  1FAA A;  3QMX A;  2P0G A;  1FB6 A;  4DVC A;  4I5Q A;  3D4T A;  3KMN A;  2QA1 A;  5B8A A;  2P5R A;  1TOF A;  1TP9 A;  3PPU A;  3LYP A;  5ECQ B;  1JZD A;  4K8M A;  5B6N A;  4IQ1 A;  3F3Q A;  5AIS A;  3L4N A;  2H1A A;  4USS A;  1K0B A;  3M3M A;  3H79 A;  2A2P A;  5ABR A;  2LS5 A;  4K2D A;  18GS A;  4X43 A;  2VL3 A;  1AW9 A;  2L6D A;  5CRW A;  1TDI A;  2CV4 A;  1V2A A;  3HY2 A;  2HXK A;  2H30 A;  4PQH A;  2H1D A;  1PMT A;  1THO A;  1NM3 A;  3P7X A;  1M0U A;  3HA9 A;  3RDW A;  4BVX A;  4HQS A;  3CRT A;  2O8V B;  1E6B A;  2H71 A;  4POB A;  2M80 A;  2LST A;  4F0B A;  4KGI A;  3ZFB A;  4ECI A;  1XFL A;  4PUF C;  2AUV A;  3TJJ A;  2VLT A;  1SJZ A;  2DBC A;  2IPA A;  4FH8 A;  4IP1 A;  3HVS A;  4CY6 A;  3CSI A;  3RHB A;  1HD2 A;  2GSQ A;  5JCG A;  3VLN A;  2YNX A;  4PXO A;  3H4K A;  1SEN A;  1JHB A;  3IK9 A;  1SL1 B;  1XOB A;  3MDK A;  2EIQ A;  1O8W A;  3EE2 A;  2LEG A;  3HKR A;  1GUM A;  3UVH A;  1B9X C;  3LYK A;  4Z2T A;  4HJM A;  4IVF A;  4G9H A;  4KSM A;  2BMX A;  6GSW A;  3GUS A;  3OR5 A;  4MAB A;  1G6W A;  2V1M A;  4I97 A;  3GL3 A;  1BG5 A;  2DSA A;  1WE0 A;  3BJ5 A;  3CYN A;  4QL9 A;  3IAM 2;  1K0A A;  3H93 A;  1O81 A;  2GST A;  2XC2 A;  4JED A;  4E8E A;  1DE2 A;  4H86 A;  5F0G A;  4IS0 A;  2IIY A;  4K2X A;  2C0E A;  2VL2 C;  1AQX A;  4K5R A;  2L4Q A;  1Q98 A;  1NHY A;  3VUR A;  5IPG A;  1ERU A;  1VF2 A;  4V2L A;  1O7U A;  1Z6M A;  1FW1 A;  1T7P B;  4XS6 A;  4L0U A;  4P3Y B;  2R3X A;  5HR1 A;  1B4Q A;  4ZL9 A;  3KEB A;  2HRA A;  2I1U A;  3DEX A;  3HVV A;  5IIZ A;  4GTU A;  4JRR A;  4XS4 B;  3QAW A;  4MPF A;  2WZ9 A;  1AQW A;  3TJB A;  1ZL9 A;  1TK0 B;  4NXI A;  2RII A;  2F3M A;  4L0W A;  2GQM A;  6GST A;  4J57 E;  2LV3 A;  5ECH B;  4GST A;  2R0C A;  1FB0 A;  5H5Q A;  3LSZ A;  2PER A;  5H5S A;  3TKQ A;  3GA4 A;  4K0G A;  4KW6 A;  2VM1 A;  4ISD A;  5G1L A;  4NWY A;  5CRE A;  4PQ1 A;  2YCD A;  1ZCP A;  4Q5N A;  5DJL A;  1M2B A;  4EL1 A;  3TKP A;  4Q5Q A;  5KEJ A;  2OBK A;  5BRT A;  3DGQ A;  2JZT A;  1TW9 A;  2C80 A;  1F37 A;  5DDL A;  1THX A;  2FY6 A;  2XBI A;  2AYT A;  2JAC A;  5D96 A;  3BD2 A;  5D9X A;  2I81 A;  1XZO A;  2F8A A;  4I8B A;  4KCA A;  4KDY A;  2C1Y A;  2B7K A;  3VI5 A;  4TR1 A;  3HCZ A;  3EU3 A;  1F6M C;  4JE1 A;  4G0L A;  2M46 A;  2H75 A;  2QA2 A;  1OVN A;  2VCT A;  2A2R A;  3F4T A;  2DKI A;  2F9S A;  1SK0 A;  1R5A A;  2WS2 A;  3H8Q A;  3IR4 A;  2MMO A;  4Z7X A;  6GSV A;  2GVP A;  2LJK A;  2L59 A;  3GH9 A;  4MJA A;  4FYB A;  2OE0 A;  2RUF A;  1FOV A;  4O5U A;  1Z3E A;  2REM A;  1EEM A;  5CRD A;  1V98 A;  2KP1 A;  3KH9 A;  1GSY A;  2GLR A;  3HYP A;  4ECB A;  5ECO B;  4OFN A;  3KXO A;  3TKS E;  4BVY A;  3DKS A;  4YKF A;  4XHM A;  3GRX A;  1GSE A;  3GKK A;  2CAQ A;  3HHV A;  3GIX A;  1A2J A;  1ST9 A;  5D8I A;  1ZZY A;  3CTG A;  5GSS A;  4HI7 A;  5HFI A;  5B7C A;  1T4Y A;  2IMK A;  1MD4 A;  5ECM B;  1ERW A;  4K9Z A;  3UJ1 A;  4MJC A;  4TVE A;  3JCM L;  5ECN B;  1T8E B;  4K5S A;  2D2Z A;  2LQQ A;  1TTZ A;  4IGJ A;  2KOK A;  2HRK A;  3LW9 A;  17GS A;  1FVJ A;  2FHE A;  4XCS A;  1GSU A;  3A3T A;  4PQI A;  2YJ7 A;  4KX4 A;  3C1R A;  4ML6 A;  5IPH A;  4GQC A;  3LOR A;  3I69 A;  5DAK B;  2K8S A;  1XXU A;  4NAX A;  3M9K A;  3TRX A;  3QR6 A;  2I3Y A;  3EC3 A;  3ERF A;  4E8H A;  4MLY A;  2ES7 A;  5J4U A;  3QPM A;  5B8B A;  5AGY A;  2DJ1 A;  2C0D A;  4LMW A;  1AC1 A;  1SKS B;  1ZMA A;  3QFB C;  2B3S A;  2YOI A;  3DYR A;  5F05 A;  4BA7 A;  3W6G A;  2JZR A;  1FO5 A;  5D9T A;  3HJO A;  22GS A;  1EGR A;  1TJD A;  3QAG A;  1W89 A;  1DE1 A;  4ZL8 A;  4WBJ A;  2VOC A;  5GZZ B;  2OAD A;  1GUL A;  2LNS A;  5F06 A;  5G1K A;  3US3 A;  2C8U A;  3DIE A;  2A4H A;  4TR3 A;  4IW9 A;  2H01 A;  3Q18 A;  2VCV A;  4QL7 A;  3C73 A;  5JWR B;  4NV2 A;  3UIW A;  2MZC A;  5A4U A;  1BYE A;  4X1U A;  3VWX A;  1NHO A;  2DLX A;  3N5O A;  2DJK A;  1H4O A;  1ILO A;  4HU9 A;  2VD0 A;  2IMF A;  3L0H A;  3U6V A;  4RI6 A;  1WRY A;  4L5O A;  3VWU A;  2QSI A;  1BQ7 A;  5AIV A;  1FHE A;  3TCO A;  4AF2 A;  1EP8 A;  3GMF A;  3Q74 A;  1GUK A;  1A2M A;  1GH2 A;  3QFA C;  4WR4 A;  1VF3 A;  4CW9 A;  4K1F A;  2HLS A;  1XCC A;  4RQR A;  5J41 A;  4ILF A;  3IC8 A;  1U88 A;  3HJM A;  2TIR A;  4TR0 A;  12GS A;  1QGV A;  4LMV A;  2FWG A;  3E3E A;  5ECK B;  1OC9 B;  4O5R A;  4D73 A;  5AIX A;  5ECS A;  4PTS A;  3K8N A;  1T1V A;  2G0F A;  1ZOF A;  3A2V A;  3CBU A;  1U6T A;  16GS A;  1OE7 A;  3RPP A;  1YZX A;  3G7I A;  4KF9 A;  3H1N A;  4KE3 A;  2X64 A;  2J23 A;  1K0M A;  3O76 A;  1J9B A;  2GDR A;  2V32 A;  2H0I A;  2O87 A;  3HZ8 A;  3DXB A;  3G7J A;  5L71 A;  5CP1 A;  2YAN A;  5G30 A;  4TW5 A;  4FIW A;  5KOX A;  3F63 A;  3ZVJ D;  1X9M B;  3HVX A;  4LA1 A;  1YF1 A;  2LUS A;  5FHI A;  1N8J A;  1MTC A;  4JR4 A;  2A4V A;  2VD1 A;  4MF5 A;  5J3R A;  4Q5F A;  4NV5 A;  4BL7 B;  4BPY A;  6GSU A;  1K3O A;  5EL8 A;  1EP7 A;  1PA3 A;  1R5P A;  1KEB A;  1X0R A;  6GSX A;  1BJX A;  3AY8 A;  11GS A;  4F0C A;  2VM2 A;  2H0G A;  4OFT A;  2DMM A;  5CNW A;  1O8X A;  2JU5 A;  2GTU A;  1M2A A;  2JSY A;  4Q5R A;  6GSY A;  3RBT A;  1ML6 A;  1N2A A;  3F4S A;  1SKW B;  3LQ7 A;  2AAW A;  3WGX A;  2FWE A;  5IMZ A;  3QCP A;  3A2W A;  4V2N A;  5IMA A;  10GS A;  4ZBB A;  2IN3 A;  3KM6 A;  3I9V 2;  3FR6 A;  1TKD B;  4DSS A;  2PVO C;  1A24 A;  1ERV A;  2HSY A;  3KTL A;  4TXO B;  2QC7 A;  4CDO A;  1FG4 A;  1VF4 A;  2FWH A;  1LJR A;  1IYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...