2HZGA

Crystal structure of predicted mandelate racemase from rhodobacter sphaeroides
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
393
structure length
393
Chain Sequence
SLKIDAVDLFYLSMPEVTDAADGSQDALLVRVAAGGHIGWGECEAAPLPSIAAFVCPKSHGVCRPVSDSVLGQRLDGPDDIARIAALVGYNSMDLLQAPHMLSGIEMALWDLLGRRLSAPAWALLGYSASHGKRPYASLLFGDTPQETLERARAARRDGFAAVKFGWGPIGRGTVAADADQIMAAREGLGPDGDLMVDVGQIFGEDVEAAAARLPTLDAAGVLWLEEPFDAGALAAHAALAGRGARVRIAGGEAAHNFHMAQHLMDYGRIGFIQIDCGRIGGLGPAKRVADAAQARGITYVNHTFTSHLALSASLQPFAGLEADRICEYPAAPQQLALDITGDHIRPDAEGLIRAPEAPGLGLQVAASALRRYLVETEIRIGGQLIYRTPQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of predicted Mandelate racemase from Rhodobacter sphaeroides
rcsb
source organism Rhodobacter sphaeroides
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme/Enolase super
total genus 134
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2hzgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2hzgA01
3PWGA 4ENLA 2HXUA 4EWJA 3ES8A 2P3ZA 4E5TA 3TQPA 3JW7A 3H8AA 5FJRA 5BOFA 3UJSA 4GISA 4HCLA 2QQ6A 4ZCWA 3S47A 3MWCA 4IP4A 3EKGA 3R0UA 3DESA 1KCZA 2PU0A 3NZGA 2HXTA 2RDXA 1SJBA 3OZYA 2HNEA 2PA6A 3BSMA 3VA8A 4G8TA 3OPSA 2ONEA 1ELSA 1JCTA 4DYEA 2OVLA 1MRAA 2AKMA 2OZ8A 2POZA 4MMWA 2CHRA 4KWSA 1JDFA 2AL2A 1OEPA 3N4FA 3R25A 4HNCA 3OP2A 3ZVHB 4A6GA 3K1GA 3DDMA 1MDRA 3DGBA 2XGZA 2P8BA 3V5FA 3DFHA 1E9IA 1TE6A 3ZLFA 1P43A 4IZGA 6ENLA 3FV9A 4MGGA 3SN0A 2XSXA 4IL2A 4GYPA 3GC2A 4FI4A 2PCEA 3V5CA 3PK7A 3I6TA 2GGJA 3BJSA 3RO6A 2OZ3A 3FXGA 3P3BA 2OZTA 3OTRA 3FCPA 1MDLA 3PFRA 3H7VA 3DG3A 1P48A 2GGGA 1WUEA 1NELA 3U9IA 2PP1A 3B97A 2PODA 3N4EA 1ECQA 2FYMA 4E6MA 5BOEA 3D46A 1JPDX 3MY9A 3UXLA 2PU1A 2XH7A 1KKOA 4H19A 2DW7A 2NQLA 3MQTA 3CK5A 3MZNA 2PSNA 3ENLA 4HN8A 2OX4A 2I5QA 3P0WA 3T6CA 3HPFA 3T9PA 2QDEA 3SSZA 3IK4A 5FJTA 4DXKA 1KKRA 4IHCA 3TOYA 2GGEA 4Z17A 1R6WA 2O56A 1EBHA 2MNRA 1XS2A 3NFUA 1KD0A 3Q45A 2QJMA 2PTWA 3CAWA 3DERA 2GGIA 3GD6A 4H2HA 1XPYA 1FHUA 4A3RA 3RR1A 3QTPA 4E4UA 1JPMA 2DW6A 3TWBA 2PTZA 3NO1A 5FJOA 2AL2B 2OO6A 2XH0A 3UJ2A 3MKCA 3CXOA 4G7FA 1TZZA 1EBGA 5EU9A 3I6EA 2P8CA 3DG7A 1PDYA 1BKHA 3V4BA 2OG9A 2PGWA 4YWSA 4IP5A 4E4FA 2PTYA 3UXKA 1SJAA 3TJIA 3QN3A 4E8GA 2PGEA 4H1ZA 4M0XA 1EC8A 3ZVIA 3THUA 3IJLA 2QVHA 3OZMA 3H12A 4J3ZA 3D47A 3QLDA 2OFJA 3UCCA 2ZC8A 1FHVA 3R11A 7ENLA 3CT2A 2OPJA 3QPEA 2GSHA 3TW9A 3KUMA 2GDQA 3TTEA 3ZLHA 3SN4A 3N6HA 3UCDA 4GYPC 2HZGA 4GMEA 4DX3A 3UJFA 4GGBA 3FJ4A 4GFIA 3ZVHA 3RCYA 3EEZA 1TKKA 3Q4DA 3CB3A 1DTNA 4GIRA 3DFYA 3IJIA 2PMQA 3TCSA 3VFCA 4Z1YA 1SJDA 4KEMA 4A35A 2OKTA 3UJEA 2PP3A 3VCNA 2QJJA 3SN1A 3VC6A 4HNLA 4F4RA 3T4WA 3DEQA 2XH4A 2OQHA 3R10A 1PDZA 3MSYA 4K1WA 4MKSA 1EC7A 2XH2A 4IT1A 2MUCA 1RVKA 4DN1A 1YEYA 4X2PA 3PWIA 4K8GA 3ZLGA 3TWAA 5FJUA 1MNSA 1F9CA 3VDGA 5ENLA 4HCDA 3UGVA 3CYJA 3OW1A 1L8PA 2PP0A 2PTXA 3QKEA 5IDZA 3P93A 3S5SA 3MUCA 4JN8A 3H70A 1R0MA 1NU5A 4DHGA 3VC5A 5FJPA 2OQYA 3BOXA 1EC9A 2PS2A 3SQSA 2QGYA 3GY1A 3UJRA 3GO2A 3NXLA 4JN7A 1BQGA 3DG6A 4KT2A 4M6UA 4HPNA 1W6TA 2GL5A 2AKZA 3RRAA 2AL1A 4FP1A 4KPLA 3RITA 2OLAA 3TJ4A 3DIPA 3R1ZA 3FYYA 3SBFA 4K2SA 3I4KA 3U4FA 2P88A 3T8QA 3IJQA 3JZUA 4HYRA 5J04A 4DWDA 2ZADA 3V3WA 2FKPA 2QDDA 3RGTA 3N6JA 4ROPA 4JHMA 3FVDA 1WUFA 2QJNA 3R0KA 1MUCA 4ZA0A 2PPGA 3VCCA 2GGHA 4IL0A 4J1OA 1IYXA 4HCHA 4H83A 1ONEA 2P0IA 1SJCA 3SJNA 3STPA 3ES7A 4GGHA 3JVAA
chains in the Genus database with same CATH superfamily
1VJIA 1C29A 1O94A 2XN1A 4EWJA 1VH7A 4FNQA 3LEPA 2OLHA 2BXYA 3HMJG 2O9PA 1RP9A 8RUCA 1W54A 1UZHA 4MPQA 2IQ0A 3NPVA 1ZBVA 2OB3A 2NXIA 2C18A 4UFLA 5BZAA 3O3RA 4J3TA 3S47A 4ADSA 3U2OA 4CQDA 3NZGA 3KZSA 5HANA 4FSAA 3S42A 3EF6A 2ZZ4A 5CLTA 3EEGA 3HN3A 1LTDA 1N62C 1D3HA 3VKDA 4ICMA 4JKMA 5DMMA 4L1XA 1ZSXA 3G6MA 5AECA 4KCVA 4DWSA 1R38A 1JCMP 3UVAA 3W38A 1KBBA 3HV9A 4HMCA 1JD9A 2Z0IA 2OWWA 1IGSA 4UWMA 3L9CA 1WKYA 4WIWA 2NUXA 3SR6B 1IWAA 1AQ0A 2J3NA 4R5EA 1J2WA 2VQTA 3QYSA 2OYLA 3BMVA 3R25A 3G1RA 1BVNP 5BMXA 3L2IA 2IUZA 3CIWA 3A13A 4PTVA 4GRTA 2REQA 2VEFA 1VB9A 2ZX8A 1WV2A 1D7FA 1XIGA 4C6LA 4MGGA 1X1ZA 1ODZA 2C13A 3WDHA 1ZAHA 5E0KA 1V02E 3GC2A 4JICA 2PDIA 3HIJA 1LF1A 3W7RA 3BJSA 4M7TA 1OJXA 1A3XA 2OZ3A 1GEUA 2VFEA 2WPFA 2NV1A 4RNHA 1XBXA 3HU7A 2ZZ6A 4J7RA 3LCXA 2CFFA 1EA9C 1EXBA 5DEZA 5DQPA 1XH0A 5CGTA 1A4LA 1I2OA 2IKHA 4I6VA 2RGLA 1TZ7A 1J4EA 3H54A 1DBTA 2QMKA 3E0IA 5XIMA 2EF9A 2WV8A 3GHRA 3IJ9A 1Y7VA 3LTYA 3VNJA 4JFTA 4PTXA 1PYFA 3S9ZA 2W5FA 3IACA 4IHCA 2J74A 4W4QA 3WDJA 1SO4A 1RUSA 4HYWA 1BWCA 3V35A 1HUVA 3DYOA 3Q45A 4QX4A 1BF2A 3CAWA 3NUKA 4IIDA 4IGMA 1PX3A 4S2CA 3O63A 2D22A 2IQDA 4Y8EA 4TIMA 3VIFA 2WCGA 1CEOA 3QMRA 4D6FA 3LHWA 5KTLA 4LCQA 1W32A 3SY8A 2QPSA 5E09A 3WLMA 2IXUA 1JEZA 1NVMA 3UXDA 1UWIA 5HMDA 2ZZ1A 2Z1VA 1UA7A 1UHVA 3AYTA 3KX6A 2V69A 2VCCA 4HHLA 5JCIA 3TXZA 1DPMA 5MF5A 3DGZA 2E0PA 3C0QA 4FLRA 4WOZA 1FWSA 4XBSA 1M6IA 4IMAA 4QDMA 3KLKA 4KFPA 4YWSA 1RQEA 3APTA 3PULA 1CLXA 4UXDA 4PTMA 3RK8A 2XM2A 3S9YA 2DSUA 2B0MA 1W8SA 3AS2A 3O6DA 4IMGA 4B3LA 4RLIA 2EPNA 1BEUA 2TPRA 4ZGYA 1LWJA 2EPKX 4KERA 4Q8TA 1HGWA 3AROA 3CUZA 3A6OA 1GVIA 2W67A 2WCSA 2ZZ0A 4IJCA 1ZL1A 3TH6A 1FHVA 2V5JA 4FR6A 5G1TA 1JDDA 1QO5A 3P8IA 8TIMA 1I45A 2P50A 2YAUA 4GQQA 1TJRA 5LIKX 3WDQA 3TTEA 4XZNX 4DBUA 1NY1A 4Q4OA 5FKYA 4DJDA 2WPEA 1PEZA 4S3GA 5CBJA 2V8ZA 4GMEA 4EXQA 1HG3A 3FOKA 3OGRA 1FWNA 4UFKA 4Q8OA 4P7QA 4CD7A 1LQAA 4V1YA 3OVRA 3INPA 1C8VA 1RSCA 2HS6A 3BGAA 1KW1A 3CPUA 4GG9A 4UTFA 5JQ9A 3KCOA 4F40A 4CNSA 4M7SA 4X0VA 1R3WA 1TPFA 3CZLA 2QR6A 4IIGA 1V02A 1E6NA 3WFAA 3Q94A 2ABBA 3W29A 4AWSA 3BJFA 2X8CA 1SMAA 3A3HA 1TIMA 4NP7A 3T4WA 4JTAA 4GZIA 1F3TA 4S39A 5MHBA 3AXMA 3AS3A 1U33A 3KDNA 3UG5A 2UBPC 7CGTA 3H4WA 5KMYA 3WQDA 1B31A 1GOOA 2VZUA 3G1HA 1JL8A 3LCHA 3FHQA 3WF0A 1FWAC 4ZR8A 4H9MA 4YMZA 1OYAA 3GLCA 2VELA 3UXAA 3QY6A 4GZJA 1C8XA 5LA1A 2FHCA 3GU1A 4JN8A 4L9XA 1S5NA 3EOEA 4YCOA 1MW1A 2GLKA 9XIAA 1LOSA 4MFDA 4K3ZA 2HK0A 2ZRXA 4JQ9A 3WLSA 1XRVA 2AAQA 3GRSA 4LWWA 4AF0A 2ZVIA 4KBXA 3SQSA 2MANA 1YDNA 5HNNA 7ODCA 3DG6A 3KW3A 3WNKA 1X6UA 3W9ZA 3ABQA 4EE9A 2ZA2A 1DJGA 3H2AA 4BI6A 4FNPA 1A5UA 4NSBA 3WK0A 5CPMA 4W88A 5D04C 1OD0A 4C6BA 4N9DA 4EPDC 1UPPA 3GUWA 2AQVA 3ZWSA 2X1SA 1H49A 3GDBA 4R88A 3T8QA 3N2OA 2VC9A 3MANA 2VFDA 3WBEA 5CC6A 3BLFA 1H51A 3WNOA 3V3WA 3N4AA 3CQJA 1Q6QA 4LBSA 2EG8A 2DQXA 3GRTA 5DBUA 3O06A 3T0DA 1Q4WA 2HS8A 4LJ3A 3HPZA 3SEPA 3MCOA 3SRKA 1B3VA 3ATYA 1ONEA 3H6OA 3ALFA 1F2JA 4E2OA 1SZRA 2DFAA 1R2RA 1W91A 2ZDRA 1DE5A 1UWUA 4P5UA 3HW2A 4O1BA 4R7WA 3DHUA 1DJHA 1V3HA 1GQIA 1VYSX 4I9AA 3WD2A 4BCEA 2YW3A 3R0UA 4E3TA 5JCKA 3CEPA 4CCDA 5H8PA 3M0IA 2Z2BA 4LF2A 4TV6A 3VNKA 1M3UA 3G5EA 2DZAA 4PUDA 3QSTA 1V93A 2ZTKA 2OVLA 5CPSA 4FXSA 3OVQA 3NPWA 1KCXA 1I2NA 4L4LA 5AFDA 3NOYA 1JI1A 3GG1A 4GNKB 1RR2A 2WVTA 5E1QA 4BEUA 3N4FA 4HK6A 1OFBA 4HNCA 5E0CA 3ZJ6A 5ABEA 5K9CA 4G1NA 3SCNA 2VQUA 2TYSA 1NDYA 2VI0A 4PB3A 3TA9A 4IZGA 3E3HA 2WWDA 3WBXA 3SN0A 1L6FA 2DEPA 3UW6A 1NHSA 3PK7A 3R4IA 2ODOA 2CLKA 4MY8A 5C2GA 4H4TA 2G3IA 2ZE3A 3EGJA 1Q1RA 4I5UA 2VR5A 3HM7A 2OXNA 4WDXA 3SSJA 3CHCA 4HU3A 3EUB3 2X40A 2A7PA 3N4EA 1QW7A 3D46A 1MSSA 2X7VA 2NV2A 3O9NA 1YTKA 4RDZA 4MADA 2QPUA 3B0UX 1ZK7A 3APGA 4H3DA 3OGVA 2B31A 1EWEA 4LOCA 4JTDA 4LY8A 2GJRA 3LZ5A 1M53A 2DVUA 2GGEA 2Z2AA 4L7ZA 1XLFA 5EPDA 2O56A 3NFUA 3U7BA 5BROA 1RHCA 1X8FA 2A2IA 4JTUA 4GJJA 4NU7A 3VD3A 1VPYA 3G24A 2CHOA 4LF1A 3QC0A 3LM3A 3BG9A 1ISZA 4I8YA 3AMZA 3T40A 1CGUA 1C7TA 1GT8A 1UW9A 3H24A 2R1LA 1E6XM 1G5AA 5G4WA 4S3DA 4WZHA 5A8NA 1PDYA 2WHKA 4JFUA 1DJZA 4TVYA 1PIGA 2JE8A 5FEZA 4IFRA 2VKZG 3LCWA 4POCA 4MJ2A 2QGHA 4IIFA 5CJMA 1RH9A 5D2XA 4EQSA 2D0GA 5CZTA 4P7LA 3LN3A 4W7UA 1TMHA 1SSGA 4F0SA 3A5VA 4MUZA 1BPLB 1UC4A 4H9XA 4B92A 4R33A 3UCCA 3UXIA 4IX0A 4FIRA 4HPHA 2WMJA 4S3BA 5AHNA 3LXCA 1QI3A 2FDSA 4DBWA 2V67A 1XFCA 1N5WC 2YVFA 3SQPA 5FF2A 1HKIA 2WJEA 1KBJA 2ICSA 1A5MC 1MYRA 4JTIA 4KIRA 4WY0F 1H62A 4O1CA 3RPMA 1XLEA 1LLWA 4Y9PA 5J5DA 3WD3A 3EKLA 1OQFA 4Z2JA 1UR2A 4JNYA 3BK0A 3CB3A 4Y90A 4D71A 2PGRA 2FHBA 2XVPA 5DFAA 1IQ8A 2Y7GA 2H8XA 2UY5A 1QK0A 4DM1A 1A5CA 4EF8A 1V8EA 3II1A 3OODA 4GIEA 1SW7A 5CBBA 1GUVA 3TQ0A 3B8WA 5LIXX 2Y61A 3W84A 1VJSA 1WP6A 1W9PA 4NRRA 3LGEA 4UCGA 1NHPA 1ZS2A 4HTBA 3MSYA 1VYRA 1OCBA 6XIMA 1ZGDA 3T2QA 4U28A 4PTNA 4D8ZA 1OWQA 2ISWA 3GB6A 3G77A 1ZX9A 3LQLA 3L2MA 1J18A 3FHAA 1MNZA 3ABRA 1KTBA 4F66A 1JRBA 1DXLA 1H5YA 3HGOA 3WH5A 1PSCA 3EA1A 1QHPA 3CGBA 1R3RA 4QS5A 2WHMA 1VEMA 1OHLA 2DSZA 3QW3A 2X1RA 3EXRA 4NEWA 3WMLA 4UZUA 3I68A 2G8ZA 4BA0A 4O17A 5ECUA 3P7YA 3VI2A 4YTRA 3PZVA 5CLWA 1JCLA 1US0A 1XDMA 4MNJA 5C54A 5HATA 3VIOA 3GBDA 4XAYA 2CZ5A 2TODA 2Q6ZA 5CSRA 1XYAA 2WKGA 4UQ9A 2BWGA 2VVSA 1JR1A 1OG0A 1W9UA 5CBIA 3H4XA 1BRLB 2GWNA 3UPWA 3WQ6A 4OUIA 3SUUA 1I2PA 3JZEA 5EMLA 4AEEA 1REQA 4NL1A 4DXXA 4M29A 1ONRA 2BP1A 2FKPA 1TREA 4BQ4A 3OHMB 4B4HA 3T0BA 3W6LA 4MYXA 2E28A 1OFDA 3O16A 4O8RA 3DENA 4GXMA 1EXPA 1QPRA 4O28A 3UG3A 4JPGA 3RN6A 5LXXA 1FOBA 2J6XA 5JUVA 3NVYB 2VR2A 3W1MA 3P8JA 3N9SA 2RJHA 3UNTA 1CXHA 4MJZA 4HNOA 3R79A 1FWFC 2YBUA 4CNTA 3N14A 4D1JA 4E5TA 3UA3A 3ABXA 3TTQA 3C2YA 1CENA 3KRSA 2JEPA 2XIOA 1OM0A 5FEPA 4A2SA 3M0JA 1UWSA 4KEZA 3CM4A 4NXKA 4TR9A 5CGMA 4HCLA 1FDYA 4JTKA 2TAAA 4QBXA 3LV6A 1RD5A 5L9FA 1I6NA 1PPIA 1S46A 3CT7A 4YN5A 2HXTA 4MKNA 3RRXA 1WDSA 4OBTA 1GERA 4G8TA 2QDGA 3RNDA 2ONEA 1KC7A 1W5QA 3P81A 2Y24A 2DPEA 1EQCA 1A47A 4S3FA 1KWGA 4CU6A 2NPXA 1GEQA 5JRBA 1QOXA 2W3ZA 4FOKA 4IG2A 1IR2A 4ZXLA 1V4YA 1XGDA 2OLSA 3BCFA 3SUTA 5J5RA 2CIPA 1SO3A 2PGFA 4JQ1A 5FSDC 3ZYZA 1G4TA 3N19B 3K1GA 4N2YA 4BFAA 3DH9A 3B8VA 3U6WA 4ZMGA 2YL9A 4J4KA 3PJXA 1QPKA 4GC3A 3CHFA 1X38A 4ZFMA 4N0RA 3TYAA 2CLIA 2BV9A 3MP3A 5REQB 2WLYA 3LY0A 2FVLA 1TELA 3VNDA 3T07A 2DH3A 4WGXA 1GVEA 1KNWA 1TX0A 4LRTA 1TVNA 2CBIA 4LCRA 1XGZA 3NSNA 3HQOA 5BW6A 4IPLA 3FCPA 3KRBA 4B5XA 3DG3A 4OV4A 4KEUA 1ECQA 3AU6A 1JPDX 3WJZA 1ITUA 5LXEA 2FVKA 5HR6A 2DSVA 3ANVA 4GK8A 1QATA 3HZ3A 4HK7A 5LNSA 1F6YA 3URNA 4FS9A 1B5TA 3A3XA 2WNZA 4YCPA 3EWWA 2J47A 2NSOA 5C71A 5FS9A 2PDBA 5C55A 1QPQA 4KMQA 2QJMA 4Z2LA 2CC0A 3VOFA 5F4XA 4KCTA 4FALA 4BI7A 4QG6A 1W1IE 3G3MA 3LPFA 3NZ1A 3P5ZA 2CWXA 1LDCA 2UV8G 4JIQA 3MMDA 1ITXA 3FDGA 2FIQA 3LDVA 3P82A 3EMZA 4TU1A 3C2OA 1QW8A 1HKJA 7TAAA 4HU0A 3R13A 1DIOA 4MHBA 3C6CA 3F03K 1KCKA 1OD8A 3HBLA 2XSAA 2NVKX 4O14A 1VJZA 3G0XA 3LG3A 3R8GA 4NX0A 1G94A 1X1NA 3AQUA 2Y6ZA 2W6RA 3UU0A 2XSBA 2WMKA 3GW0A 4LUYA 2NWSA 5A6AA 1BKHA 2GR0A 4IP5A 2WANA 2CITA 1SJAA 2Y63A 3UXKA 2WZMA 1UUOA 1NQ6A 1JZ6A 2RFGA 3BLPX 4AW7A 3VIPA 4EKJA 1IWBA 1TG7A 1X6NA 2E40A 5I07A 3VOCA 2GFTA 1UWTA 3WNNA 4LC6A 5AOUA 3RJXA 4GO8A 3UWEA 5B80A 3SFKA 1V51A 2BXZA 2OFJA 3S46A 2A3HA 3LZ3A 4HN4A 1LBFA 2EPMX 2NT0A 3OIHA 4PRWA 3UGRA 3W2UA 4Q4KA 1T96A 4WSKA 5J8LA 3U8GA 4QJ1A 1RBAA 4F0RA 3E02A 1V6TA 3ME3A 1V03A 4PN2A 3SIZA 3P6LA 2BY3A 4JTLA 4E2BA 4LALA 4HPGA 2OSWA 4HOZA 3PAJA 4X61A 4UB9A 4I90A 3SCWA 4W5UA 1E9YB 2E3ZA 3GH7A 3UJFA 2DSKA 3LENA 4IJRA 5ABFA 3W1NA 3ARYA 1GOIA 3OVPA 4DPPA 3PG8A 5AC6A 3RLGA 4H4YA 4C7FA 3UR8A 2D23A 3N29A 2Z6JA 4UTUA 3I7SA 2GQ8A 4XSMA 2QF8A 1RLDA 4ZFCA 4J9JA 3KS5A 1MXSA 3DYMA 2V5KA 3CUFA 4HNLA 1JRCA 5GNYA 1JGIA 3GU2A 4QDPA 3FW6A 4PCSA 3NQFA 4NEVA 4AZHA 3AOFA 4RNJA 3MBFA 1PL9A 2ZA3A 5JIWA 3AXKA 3G3DA 1Q13A 1F7BA 1XLJA 2Z28A 3NVVB 1YDOA 1J01A 1PTDA 2Y8UA 4H6EA 1UA3A 1RP8A 1UH2A 3XINA 2ZUWA 3I3BA 3CIVA 4E4PA 3FA4A 3PZMA 3UGVA 1DP0A 4QJ4B 2YR1A 2Z7KA 3DGHA 1BLIA 1WDRA 3E38A 3M4HA 4W93A 3F4WA 3AMLA 2BSLA 3CS2A 5FF0A 5T8GA 3CMGA 1EUAA 1UOZA 4GUIA 4QLKA 3SZ8A 1K4QA 2XN0A 1RALA 1A0DA 1JNDA 2R94A 3PB2A 1NH6A 4FP1A 3EOLA 2A6NA 1QMLA 4GI6A 1H0GA 2WYSA 1LM1A 2QLYA 4XVEA 3PSWA 2R1PA 1Q3NA 1M9HA 3HPSA 4DZAA 1GJPA 2BGSA 3S1GA 1K3UA 2VEMA 2JK6A 3WQOA 4WX2A 4S38A 3CBWA 4N9BA 1VAHA 4P2VA 1NAL1 3LNPA 1QVBA 4W8BA 1DEDA 3AISA 1JCNA 1XKJA 1FWWA 3AALA 4MDPA 2Q8LA 4ICCX 2C1HA 2GGHA 1BRLA 2OSXA 4LV4A 1V7AA 1JUEA 3LB0A 3MW7A 3QGAC 2FPYA 4DAIA 3TK7A 3L65A 4RL3A 1F8IA 4JQ3A 1AL7A 4QE5A 2BOGX 2OJPA 3R89A 4HP5A 1VQZA 3AHXA 3BANA 2NLIA 3TQPA 1OVDA 3GR8A 2R24A 1TPC1 3B8SA 3T78A 4LB4A 2YOCA 4MF4A 4KCWA 1M7PA 1WKFA 1XCXA 3EKGA 3MUY1 4NF7A 4LB3A 2RDXA 2HBXA 1ZP4A 1YDYA 5DY2A 2GOUA 2ALRA 5TF0A 1M7OA 3VM7A 1S2AA 3QGKC 1EA0A 4GQRA 4XWUA 5JBFA 3ARVA 3IUDA 3TN3A 1VKFA 2CHRA 1H2JA 1G4PA 2GQWA 1RXOB 1TVLA 5HDRA 1JDFA 1OEPA 1O68A 4AFYA 2CERA 3F4DA 1WNOA 3PZTA 3VGGA 1P1XA 4R53A 2QXWA 3R8HA 1LRNA 4B5NA 4O1DA 3C0JA 3K30A 1W5MA 3ARZA 3U4AA 2W62A 5A69A 3SCPA 1CW2A 2DZXA 2PDGA 1UKTA 2VP8A 4M24A 3G1VA 1CIUA 3ZM8A 3V5CA 1J79A 3OEXA 3WQ5A 4CD6A 3C2FA 2GGJA 4LUIA 2BCPA 3MO7A 3AAMA 1KFKA 2WXDM 3GVVA 1AQFA 3LHUA 2WK2A 4H7CA 4PUEA 3RJYA 1MOKA 2VOMA 5ABFB 4ROQA 4Q8WA 3K1DA 4IIBA 1BHGA 3NG3A 3MMWA 1KGUA 4J27A 3BW2A 2PU1A 2E6YA 1UCWA 4NZFA 5G4EA 5KINA 2QUVA 1N8IA 3V0SA 1OCNA 4GQ0A 1LWHA 2OX4A 3S6TA 2I5QA 3P0WA 4UR8A 1Q6EA 1GYMA 3MUIA 2Z24A 3GXDA 4DJDD 3DKJA 4PODA 4AISA 2W3RA 3CYVA 1BGAA 1JXKA 2WC4A 4LVDA 4LV9A 4A8IA 4GPNA 4GYJA 2OO0A 2ZXBA 4QFUA 2WBAA 1FDZA 2QJIA 5AYYA 1EPVA 4FZIA 3NQ7A 5JVLA 1YNYA 4OVXA 3WDRA 4PTDA 3TTYA 3PNUA 1ZZMA 2Z1XA 2RH9A 2VD8A 3T42A 3SCTA 4F0HA 4B5VA 4E2DA 3ECQA 3NO1A 1OJTA 3A21A 5CAHA 4IOTA 2XH0A 4AH7A 4AF0B 5ABTA 4RPQA 3N18A 4HZ6A 3RX3A 3VDCA 2G95A 4AEFA 3UESA 3DG7A 4O11A 1CGXA 3QV6A 4S23A 3CQHA 2DVTA 2INEA 3CL6A 1XYLA 2OG9A 4IQEA 2EPHA 4EOUA 1AODA 3SGGA 1T3QC 4DWSC 4FDCB 1TX2A 3AUJA 5IBXA 1TV2A 3N25A 1EC8A 1C91A 2W27A 2ZRYA 1F3WA 1V3MA 1XLGA 3W72A 4H7VA 5IM51 5LIWX 3UR5A 1JGMA 3A47A 3H4KA 3T08A 3RLUA 4J3ZA 3FYPA 1BVWA 4HA1A 2Y8VA 3NDOA 3CZKA 3R11A 2F61A 1V6YA 1OX4A 3KVLA 3W71A 1V0KA 4XZBA 3MV01 3P84A 4JYFA 4E3VA 3IEBA 1JYXA 4NKCA 1E43A 1FHDA 3W75A 4RDWA 3MVIA 3MKVA 3ARRA 3KRZA 2HZGA 1OSEA 1A80A 2PLJA 4X2RA 3W2KA 5C9UA 4ZTYA 3WENA 4DX3A 3THQA 3PZ9A 4GY1A 4H8UA 2YZRA 2Q71A 1VEPA 3RCYA 4MAZA 1PYMA 2D2HA 3K4DA 3PY2A 4P61A 1UZDA 2JALA 3PWAA 3DFYA 1DXFA 1F3XA 3VFCA 4ZE4A 1QJWA 3VD4A 5KZEA 3C52A 1KV8A 4B9ZA 1EHNA 1GK8A 3UZXA 2XVNA 4JY9A 3M5XA 1EJXC 4I3GA 3SN1A 3QR1A 3VABA 3NEHA 1AZ1A 3IUHA 4ZQRA 1JYNA 1F8MA 4A8LA 2XFRA 4J3WA 3STCA 2VL4A 1TPB1 2IKGA 2MUCA 4O18A 3QLLA 4B3KA 1XH2A 2Z1WA 1GPFA 3VGBA 1FXQA 2OX1A 1HJSA 1HFBA 3ZLGA 3TWAA 1ISYA 3CPGA 1DJWA 4AVOA 4DELA 2OELA 4PMDA 3G1FA 2WOVA 1QDSA 3MUCA 1BYAA 1VZWA 2ZXQA 1RA0A 2E9LA 1LJYA 3HG5A 3G6LA 3TJXA 1F4AA 1YQZA 5GVJA 1Y5VA 3W81A 4D8LA 4HJFA 1FHLA 1EC9A 2PS2A 2WMIB 4BQ2A 5D2WA 1PZ0A 1ZMCA 3HG2A 2HPMA 3GR4A 2Q3OA 3QR3A 4H4PA 1D3GA 1YPXA 3WLRA 1FFQA 1OT1A 3I4KA 3C8NA 3HFTA 1YXDA 1R3SA 4O12A 5BMWA 1XINA 3DC0A 1FX6A 1UMLA 1W5NA 1UWRA 3ARSA 3W83A 5CC7A 5G2IA 1IXNA 4IMCA 4MUPA 1R3TA 3FVDA 4D2JA 1MFVA 4V1XA 2RJGA 1A50A 2J7GA 3S1UA 2EPOA 4GO9A 3TN4A 4QXIA 3FDKA 1MUWA 3OLDA 1SJCA 3NDYA 3E0LA 3JVAA 3E49A 4G7EB 1R5YA 2DU2A 4XK2A 1KR0A 4XZLX 4QSHA 1B3WA 3QSRA 5BOFA 3OLIA 4RUBA 1P6WA 3CNYA 2FPTA 2HSAA 3RMEA 3OZYA 5K7JA 2P0OA 2B7QA 2A8XA 1HJXA 4PSRA 4J3VA 3VA8A 5F2LA 2FZ9A 1H1NA 3U48A 1W3HA 3O0FA 3QZAA 3K5XA 4PH6A 3E0FA 3C3UA 3OBEA 4GUJA 1L9WA 2E5CA 1R46A 3NL6A 1A4MA 2YX0A 3A7RA 1S1RA 1CYGA 4YNGA 3BLDA 3RM8A 2DY3A 2PLCA 1EL3A 4NZ4A 4PBEA 2YXOA 1EF2A 1UG6A 1PE1A 1V59A 4C5ZA 3V5FA 4Q4QA 1BYDA 4HVXA 1TYTA 4KFOA 1XC6A 1Q45A 3ARXA 6ENLA 1KQZA 2J7DA 4JTGA 4ACZA 1MWOA 1TCDA 4YTQA 1HKMA 2WNWA 1LL4A 2XWEA 1DTUA 5IDIA 2AQWA 4LAMA 3OZOA 1KRAC 1HGYA 2X50A 3VXGA 3TC3A 1XLAA 3HF3A 3MTWA 5CAKA 4NY2A 1XDLA 4NNBA 4ZVJA 3FXGA 2PBGA 3Q37A 4PRTA 2X41A 3GG7A 4MNMA 5DF0A 4R7OA 2PD5A 3LU2A 3IJ8A 1W1A1 3PFRA 3H7VA 1UR8A 2J66A 1G67A 3SCOA 4W7WA 1WUEA 4Y6GA 1O5XA 2VGGA 1DJIA 1WO2A 3GHUA 4L4PA 1NJJA 2FGBA 3GTFA 3AMKA 2VD9A 4OOZA 2OCZA 4NZ1A 1MI3A 1XYZA 4HNVA 3FYOA 1EP1A 4GKTA 2ALDA 2IKIA 4GD0A 1OF6A 3WEZA 4JQAA 4W84A 3SSZA 3IK4A 2BVYA 4DXKA 4X63A 3GFYA 1EGZA 3BOLA 3OZPA 4GQBA 4H2CA 4UTWC 4ADUA 3GDKA 3RHGA 5AYZA 2GGIA 4U33A 1IT0A 4AXKA 1ZALA 1AZ2A 3ARTA 4LCSA 4DF1A 1HZYA 3T2PA 1XP3A 4A3HA 1JF5A 3B3DA 1VBHA 2WSKA 4RDVA 2YA2A 5K9DA 5C9XA 1TWSA 3QPZA 1C7SA 4C7DA 4WXZA 4FLQA 4ZBCA 2X16A 3WH7A 4ZQPA 3GD4A 3CV2A 1AJZA 1UB3A 5EU9A 1HJQA 1W9BM 1JDEA 1JCJA 3LPGA 5C9RA 4KKXA 1SMDA 3FVMA 4IGNA 4CEUC 4U2YA 3CWNA 1ME7A 1F5ZA 3ITGA 1M65A 3SQLA 4ZZ9A 5KVHA 2WHJA 5BCAA 3GXNA 1XIIA 4ZENA 2QIIA 3KZPA 3EX6A 1UIOA 3T0CA 3ZR5A 3M16A 2EQDA 1HO1A 2QMJA 3VZZA 4Q32A 3B9EA 4C1NA 2QCLA 1FCQA 1I4NA 3EX1A 2H9AA 3WMCA 4BF5A 5C7HA 3TV8A 3W27A 3TDFA 3HQNA 3CUJA 1J5SA 2WBGA 3C2VA 4MLRA 1QWKA 5T9BG 5A6JA 5F2MA 1NSJA 1L2UA 4AEOA 2C0HA 1UH4A 2FH6A 1S5WA 1UZ4A 2VENA 3UP8A 3N9RA 2IQTA 1S5MA 3WH9A 2FZBA 3EEZA 3UA4A 2F6XA 2EG6A 2HWGA 1PBGA 3W00A 1U5VA 4ICNA 7REQB 3TCSA 3HRDC 4KH2A 4HOWA 4KEMA 4FF5A 2OKTA 3T55A 2GDUA 2BC1A 5IOBA 3CIXA 4HHHA 4AZCA 3AMGA 4XQ6A 4Q8MA 5D33A 3KL3A 4GCXA 4H4IA 2RDUA 4XISA 3TX9A 2J27A 1LOQA 2E5DA 3BICA 1J0KA 3LYEA 1EC7A 4IF2A 1S2VA 4K38A 4OFCA 2DUZA 4C65A 4F3HA 3GIPA 3TTOA 1C8QA 1XIBA 2BNJA 1VFUA 1N5XA 1K9DA 3W76A 1Z69A 2FTYA 3BPWA 3TYUA 3SW6A 4GXPA 3VDGA 4GXWA 4XBJA 2GR3A 5A6BA 8A3HA 3P93A 3S5SA 3IVUA 3EDKA 4O52A 1NU5A 4UNLA 1LG1A 3R2GA 1JFXA 4YTUA 4RPPA 1UR3M 2E6DA 4P8XA 1FKWA 4AIUA 2PC4A 4MJMA 2UY4A 4PBGA 4PUMA 3KL5A 1S39A 2Z27A 4N7QA 3KBSA 3F2CA 1CZ1A 3IGSA 4GBDA 4MVAA 4N02A 1XIHA 1XV8A 2ISDA 3FYYA 2BHUA 3QPYA 1E4LA 3RXZA 1KRMA 1GVSA 1JAEA 4MWAC 1EJUC 3EPOA 5EMJA 4JD4A 3FX4A 4HA0A 3L5LA 5G2WA 1NOUA 1WBJA 3BUVA 1E1CB 1M03A 1MVYA 4JHZA 3WF1A 2PAJA 3IIZA 5RUBA 1PX4A 1UPMB 2PDJA 4O13A 2VGIA 5U4NA 5CG0A 3E74A 2VUYA 4LAKA 4XAZA 2XIMA 3QH2A 4I6KA 3USZA 3ZMRA 1IYXA 3EKZA 2J7FA 1E9LA 3L7RA 3YPIA 4PEEA 5DRIA 2GVEA 1UBPC 4CD4A 2XINA 4AVNA 4OUEA 4G5DA 2ZX6A 2XWDA 2ZWYA 2PWEA 1OADA 1W3NA 4OT7A 1SUXA 1F3PA 4YVXA 5F4WA 3CXBA 3WLTA 5K2ZA 3IJ6A 3PBVA 4INFA 2ATMA 1QRQA 3UT0A 1SM9A 3B0XA 3M0MA 2NW0A 1XHGA 1JCTA 3N15A 4JCMA 3IAPA 1K4HA 3QQWA 5HMEA 4PL1A 4B2DA 4XUGA 5M17A 3IGXA 3W88A 1BZLA 1RQHA 6TAAA 1O5KA 3GNNA 1WQ5A 2B81A 4BK9A 1BG4A 2JF6A 3OHIA 1KFCA 5KVIA 1BG9A 1JUBA 2ZUUA 5D05A 2G3NA 1S7MA 1QFEA 2HE5A 2BTMA 4WY0A 4DIAA 3W2NA 4WK9A 4AC7C 3UR7A 3NM1A 1GRAA 3VNIA 3LXBA 5M03A 3M7SA 2YVJA 5JBDA 3B9NA 1B3XA 7PTDA 4XO6A 1P1MA 4AHPA 1F05A 1M41A 1GRHA 2XVKA 5LA0A 2GZXA 3KS6A 2XFFA 1VPXA 1TWWA 1KLZA 2GUUA 5GPRA 5DX7A 4FMVA 5A8PA 1P5BA 3H21A 1YIXA 1FXPA 2C8NA 3U2ZA 1E6RA 2ZRUA 7TIMA 1KFLA 1S5VA 2YIHA 3GNOA 4HN8A 2WVVB 4H4SA 4Z2HA 3SGZA 4FIQA 1P0NA 5BRQA 3MI3A 1MQQA 2DUAA 1E3XA 4GE8A 4IM4A 2YDRA 4Z17A 1FP9A 1GVFA 3ARWA 1RK5A 2IW0A 2YYUA 4LC8A 1J11A 5DELA 1J5TA 5JMUA 1PTAA 1Q7QA 4LYQA 3H7RA 2QCFA 3N1AA 3PZOA 3TN6A 3WCZA 1VF8A 3PZUA 2EQ9A 5JCMA 4J57A 4Z2KA 1R30A 3QZEA 1LRTA 4HSOA 5I78A 2ZZ2A 3UG8A 4H6KA 2WM0A 1RY8A 2G3MA 3TWBA 3F4CA 1E1EA 1H60A 3CLWA 1I0BA 4JTSA 4IICA 3BLLA 4M1RA 4K7VA 3U0HA 1E71M 4GYFA 3WQEA 4WDUA 3PF3A 3FEQA 1N55A 1FWRA 1RBLA 1E1FA 4I8DA 4TVCA 4QE1A 4E4FA 1EJ7L 5E5CA 1Q6LA 5AC5A 4WLCA 3TJIA 3AHYA 1YMYA 3JR2A 1J6PA 2PGEA 2ZZ7A 1EZ2A 2QCDA 3ZT6A 1XFBA 3VMPA 3LSCA 4GFSA 4LT9A 4F2BA 3PPHA 2XDFA 4N4PA 1GHSA 2EQ6A 2I17A 4PB5A 4PZVA 1Q85A 3EPMA 2QIWA 3B0PA 1FH8A 3BGGA 3VFLA 2CETA 1X6LA 3KUMA 4O10A 4MZ1A 1XISA 3UBPC 4LS1A 3C4UA 3CUXA 4CQAA 4J3SA 4KS0A 6XIAA 2I9EA 3VGFA 3WQGA 4W9TA 4Z42C 2F2KA 1AW1A 1MEWA 1XKYA 3L21A 3S2LA 4FK9A 4UZSA 1TKKA 1KTCA 4EM3A 3S4TA 1CB2A 3KOWA 3EWBX 3O6YX 3LGGA 4JDYA 3V36A 3H7UA 3VDAA 4C6DA 2QJJA 1Q2RA 2VX5A 2Y0FA 3VD9A 1D3CA 3MV11 1I9CB 1C3FA 1GESA 3ZR4A 3S8HA 4GVFA 2WHLA 3R10A 2VGBA 2PDMA 4QS6A 3SM0A 4MKSA 1ISXA 5KITA 2V3DA 2XH2A 2PDCA 2W92A 3M0XA 5C9WA 4QLLA 3WG6A 1B54A 5GQBA 2E1DA 3MZ2A 1DWJM 4K7YA 4LPCA 4PMQA 4TMCA 2OYMA 3SJ3A 4DN1A 2V5DA 5CQ1A 2FVMA 1A0EA 3QBUA 2FTWA 4Y9OA 5C2XA 2OEMA 2VZOA 1DL3A 3GDLA 4K68A 4JTFA 1KGXA 3MB9A 4HPJA 3B9AA 1EO7A 1C92A 1OGGA 3E5PA 1RY0A 3LBOA 1PXGA 4F9JA 3G8EA 1E6PA 3F1QA 3MWAA 1CT5A 4YTSA 3S1VA 1R85A 2DDXA 1DORA 2EQ8A 2FB3A 4RZ4A 1SW3A 4XD6A 2WC7A 4GVGA 1V3JA 4FX7A 2YDQA 3ALGA 4HGXA 1QCWA 1B3OA 4K39A 2P88A 3R94A 4MZYA 3SIMA 3TAOA 2KAUC 4QQUA 4CU8A 3UQNA 4JX4A 3LK6A 3W85A 1N63C 2NX3A 4KRTA 3W73A 4ATDA 4JNZA 3JRKA 4QG9A 1BVZA 3V1HA 1J0IA 1WUFA 4CQBA 4TQTA 2D69A 1A5SA 4PMJA 1TPEA 2PPGA 1DQXA 5HJLA 2WSYA 3VNLA 1Z7AA 2AGTA 3DFTA 1Q6FA 4G9PA 4RX0A 1RD6A 5A6BD 1Q6OA 5E6ZA 4K1GA 3VIMA 1TTQA 3SB0A 1IWPA 1QI2A 4RW3A 2CU0A 2P3ZA 1TFVA 3KVKA 2FJUB 4CN6A 2G97A 1K9FA 3UJSA 3W7LA 4R34A 3SRHA 4AQLA 4IP4A 2A5HA 4ZL1A 2NVAA 3PFMA 4DM2A 3PNZA 4IQDA 3VGDA 3DCPA 2BDQA 4U3AA 1CXKA 1UQZA 1W1VA 1VFSA 5AVHA 3IPWA 2BG5A 4KWVA 2D1ZA 1HT6A 4Q4PA 1U83A 1J0ZA 1N82A 3WJXA 5FMHA 3W7GA 4L1WA 2DT0A 2FTPA 1S3HA 1I60A 1J2BA 2AL2A 2HVOA 2BLEA 2VXNA 4Y9MA 4MTVA 3PBYA 3NAVA 3QFWA 1P4CA 5G4HC 4AUBA 3MDWA 2XGZA 4HNNA 2P76A 1CLVA 5A2AA 1TRDA 4ZO8A 3UWYA 2WBKA 4L6DA 4GR1A 3HURA 1VFTA 3TAKA 1PX8A 4RW5A 2VFHA 5AN7A 1WA3A 1JZ7A 2EXOA 2ZUTA 3NVTA 4GX8A 3TYBA 5I7GA 3KAOA 3RO6A 1Z8AA 1IEXA 1YHTA 1R9ZA 3K13A 3FNDA 3KOFA 2A7RA 1ZP3A 4W8AA 2FH8A 1LOLA 3S5ZA 2OGJA 5FAJA 1A3WA 3V75A 3O1NA 1W3KA 4OQVA 2X8RA 4ZXOA 3W4RA 3S83A 4RXFA 3ZQ9A 4WSHA 5G5IA 3SUVA 3GVQA 1V6WA 1QHOA 3EA3A 4H19A 5D32A 4EAMA 5LGZA 1T7LA 3CK5A 4N4QA 3ZJ8A 3BO9A 3FGCB 4AB4A 2GPTA 5GNXA 1PCKA 2JFEX 3CC1A 2E68A 3TC6A 2DP3A 3G0UA 3N2TA 3II4A 4LANA 2D3NA 3TW6A 3TSBA 2BZNA 1TYGA 2I56A 1XS2A 1IXPA 2DIJA 5CH9A 5I3DA 3LS9A 4WKAA 1PVNA 1YBQB 3FN9A 1XWYA 2C0AA 1EOKA 3RX4A 1O4UA 3CL8A 4RE3A 1ZJHA 5A6TC 3KBWA 5U1OA 4Y9AA 3QMTA 1BWVA 1EJVC 3ARQA 4PB4A 1I75A 1J93A 1V77A 2GDVA 4PSPA 3SGUA 3MBDA 2DW6A 4GUFA 4MM1A 1M04A 2PTZA 1UP3A 1Y5XA 1DQWA 4Q8VA 2GWGA 3NR0A 2XIIA 2EKCA 2WAGA 2P8CA 4AIOA 4DXVA 4WCJA 1PZ3A 1DJYA 1SU5A 2XISA 3PTMA 1B4KA 3VIGA 2ANUA 2PTYA 2QDHA 2WO5A 2G4JA 3P80A 1GJWA 1FCUA 3WQ4A 1P6CA 1DWFM 4KETA 1U5JA 1GWJA 3BAKA 1XUZA 1WDPA 5LGXA 3OYZA 4AWUA 3ZVIA 3GZ3A 1TA3B 1UD2A 4EACA 4IFOA 1A5BA 3B0YA 3LRLA 1WE5A 3URAA 4ZB0A 3IRDA 5K3VA 3PPGA 1GG0A 3SADA 4GI8A 1AQMA 1T8XA 2OEKA 1QBBA 3D47A 1V7YA 3URQA 3EBVA 1NARA 4BY3A 4WUIA 2WP5A 2NWRA 5HNUA 2DIKA 3ARPA 3UEQA 4XKMA 2YCEA 3D5HA 1NWRA 3Q6JA 3OJGA 3ORWA 4W87A 3HJZA 1UKSA 4OV9A 2PLKA 2QCMA 1E1CA 1DIKA 3VDHA 3URBA 1H1YA 4CQ9A 1T8QA 3M0LA 5DN1A 4L9YA 2QULA 4AIBA 1JULA 5FI8A 1TUFA 1BF6A 3Q4DA 4XSLA 4GIAA 3E6EA 4K36A 1XL9A 4PR4A 3W7CA 1S1PA 3B40A 3S0CA 4Z1YA 3ITCA 3CAVA 1BD0A 5HMFA 3M9YA 4U10A 3GWQA 3UY7A 4A35A 5AHEA 4OTKA 4OKDA 4S1FA 1EHAA 1V08A 4YHEA 4Q4SA 3EA2A 4H6QA 2R1KA 1REQB 5TQLA 3IGHX 2O7QA 1U1UA 4H8VA 4UFJA 1CTNA 2HCVA 2Y85A 3PG9A 3L2LA 1R86A 1RVKA 5LNUA 1UKQA 1UH3A 2QAEA 3NJ3A 3UETA 2X1UA 1J10A 2J4GA 2OOGA 1BSLA 5K9XA 3CWOX 4S2BA 4C1LA 1FEBA 1Q6DA 2W63A 4XZHA 1X39A 4O54A 1TV7A 5LHEA 2O9OA 3TIMA 5I03A 1NWSA 3EXTA 2JGQA 3KVMA 3NL2A 1IXQA 3PG6A 3CO4A 4YVPA 1X7FA 2VR4A 6REQB 1BGGA 1XSKA 3D6NA 3G1AA 2OQYA 2X30A 3MO4A 1OT2A 2QGYA 5MKGA 2HPIA 3DUGA 3EWUA 1JNEA 1UD4A 3NXLA 4JN7A 4AYGA 3EWZA 2OT0A 4KT2A 4HPNA 3QFBA 4IWWA 4K8HA 5A8GA 4WQ6A 2YKKA 2J77A 3G1SA 1GTEA 3TR2A 5IBXC 3QF0A 3FSTA 4Z1AA 4AHQA 3SBFA 2BFGA 1EBDA 1F3EA 2YSWA 5I0DA 2V9DA 4LGXA 4JR5A 2ZX7A 4RZBA 5HWNA 3JZUA 1XI3A 3K8MA 2DJXA 1CWYA 1VC4A 4PFHA 1XLCA 2ZZ3A 4V15A 5H91A 3IIOA 3AXXA 5GJPA 4C6FA 3UWQA 4HMNA 3WO8A 1L6SA 3GZAA 5F7UA 2FQIA 4CVWA 3I7QA 1NM9A 3VCCA 3PJWA 1JZ2A 3GK0A 4C6NA 5HK4A 2E7FA 4NASA 3EAUA 3EWDA 3NGJA 4JY8A 4GVIA 1TQXA 5C9ZA 2CBJA 4RCXA 4GCAA 3T1GA 2PC8A 4BQ3A 3P14A 3U5YA 1A53A 4BQ5A 2QQ6A 4M19A 3RUBL 5I5RA 1X7IA 3CTTA 1QASA 7A3HA 3STEA 2AAMA 3NYDA 1SJBA 1VFHA 4ML4A 1R8LA 2G41A 1OFOA 4PUJA 3L5MA 3CZJA 1SFTA 3M07A 2C3ZA 1XCFA 4XAPA 4MWAD 1EYWA 1VR6A 1ELSA 3EPNA 1D2KA 3NIYA 5KZDA 5I24A 2VURA 1K77A 4Q8PA 5KZ6A 2DT1A 2XG9A 2PWVA 3WBWA 3IV3A 1Y65A 5C7VA 2R14A 2VEIA 3UNDA 4XTDA 2IPFA 1M7JA 1N8FA 4AU0A 1KXQA 3PHAA 3GXTA 3BMXA 3H55A 4UUIA 4OBRA 3TSDA 2P8BA 3NL3A 3BV4A 2TSYA 1OZQA 4AXNA 2J62A 4GJIA 2D0FA 4H9ZA 1O5QA 4GYPA 1TV3A 5G5HB 2F6UA 3T44A 3LHVA 3GXMA 3P62A 2VNCA 1HNYA 2WPBA 1NPXA 2ABAA 1N8WA 2ISVA 4H04A 3P61A 1KR1A 4F9DA 3SCVA 1FWHC 3K46A 5LIYX 2CCRA 4LUTA 4WF7A 4H4QA 4EVZA 1QPOA 1AFSA 2JKEA 3HO8A 2J7CA 3IV8A 1GQLA 4TOQA 3L5OA 3MZNA 5I3GA 2DJLA 3P74A 2YLLA 3FA5A 1M01A 3FY1A 3LPPA 3NURA 2AAAA 1M7XA 1G01A 1TB3A 3RM9A 3QXBA 3V7PA 2X8GA 3NWRA 2FZDA 5MKGB 3NVZB 2FLIA 1W1TA 3DERA 4BKNA 4JKLA 3TEVA 3GD6A 4UTTA 5FACA 1S2TA 1H7WA 3LRMA 1D8CA 2PF0A 2FB2A 1UP0A 1QI4A 1L6YA 5H1WA 2V2DA 3W7IA 2HROA 2ACSA 1CBGA 1EP2A 5IRPA 3XIMA 4MAVA 2OO6A 4QG8A 2DQWA 3WEOA 4PCNA 4MY1A 5ABHA 1EBGA 5FA5A 2E77A 4RXGA 4RK8A 3GD3A 2ZE0A 3EANA 2CLEA 3V4BA 2E8ZA 3C8FA 1FWDC 4HB7A 3GVWA 1UOKA 5PTDA 3CV7A 1MW0A 2HQAA 3HPXA 4O1AA 2ZX9A 4CKQA 1RCQA 3SRFA 3WLQA 3UWWA 1GJUA 3VOGA 1Z42A 3A4AA 1A3HA 2J79A 3RG6A 1YPIA 3A4WA 3PZQA 2NUWA 3KLLA 2WM1A 2ZKMX 3GVRA 3O07A 4NJIA 2ZZ5A 3BE7A 3EOOA 1UR0A 2WSPA 3PPCA 4PA8A 2Y5EA 4Q6XA 1L6WA 2E09A 3PBGA 3RCNA 4HBKA 1CXLA 4QJ3B 1GRFA 4NG3A 1X98A 2VUNA 3L8KA 1UP2A 2NZLA 2I5IA 4TVUA 4WKFA 4W5ZA 1W3LA 2CXEA 1GOXA 3TW9A 2QYGA 1J0YA 1NDWA 2DUXA 3SN4A 1P7TA 3G18A 4QEEA 1E6QM 1XUUA 1T0OA 3CL7A 3LADA 4KIEA 3VKCA 5ABGA 2J13A 4CLMA 4NZJA 4DNHA 4AZIA 1JDAA 1GVYA 2ZICA 3EXSA 4M56A 5AHFA 3IK2A 3W6MA 2Y5JA 1I2RA 1MQPA 3SO7A 1DTNA 2XU2A 3VNZA 3BVJA 2O4MA 5EY5A 2VX4A 3HGRA 2PMQA 1RJRA 3L23A 3LXAA 3GUGA 5IXEA 3BSHA 2OYKA 3N2CA 2QNEA 3I7RA 5D02A 3G1DA 3NZPA 1OY0A 2YJQA 3QRHA 3P60A 4JS3A 3RILA 4ZO9A 2XIJA 1DXIA 1S2CA 3BAIA 1GZ1A 3FAWA 4PRRA 1KBLA 9XIMA 2YCLA 3VKKA 3F2DA 4UTWA 2JQXA 3A64A 3MU7A 4G56A 4QJ5B 3T05A 4BHYA 2PCQA 4HSNA 2PUZA 4NXSA 3TMQA 1EOMA 5BWFA 2G0WA 4K8GA 1A5KC 1AG1O 4AD5A 2YPIA 3AS1A 1WCGA 3ELFA 2GR2A 1IEVA 4GH3A 2RUSA 2PDLA 3R0DA 2QCEA 3NNTA 1DKWA 1H4PA 1LQ2A 4I9MA 4C91A 3G22A 1QI0A 4X60A 2RGMA 2V3FA 3CV1A 4AWEA 1BQCA 2AKZA 3KEHA 2YFNA 1W1PA 3L68A 1OYCA 2YBTA 1E72M 2FZNA 2E4TA 1H41A 1MXGA 1HKKA 3IJQA 1R47A 4I9TA 3TP4A 4EQXA 1W9XA 4NI8A 2VC6A 4DWDA 2X99A 1FA2A 5I00A 1US2A 2QDDA 1UMYA 5D30A 1Z6KA 4ERAA 4ATLA 4ONVA 3EAOA 3W28A 1IXOA 3WX7A 2X2GA 3KP0A 2GJXB 3N6QA 4NI3A 2BX7A 4YS1A 1E0UA 4OWGA 1LPFA 1CCWB 3BWWA 3G0SA 1CPUA 2F8QA 1TWIA 3QKZA 1NWUA 2F38A 4WOQA 4LYRA 3LCLA 2PURA 3ZT5A 1YTEA 1RAKA 2I5GA 1GCYA 2WMHA 5D09A 1HJUA 3EB2A 1TPUA 2H90A 1EEPA 3ITTA 5BXRA 1UYQA 4LYKA 3CUHA 4J2MA 4AX6A 4ZCWA 1Q65A 3KBNA 2GVGA 3EYPA 4P8WA 3E2QA 2V63A 1KA9F 2PA6A 2PWFA 3H22A 5CPNA 2VJXA 5M5DA 5B7ZA 4LRSA 3MVTA 4RJEA 1J9YA 4FO4A 3S2NA 3SFWA 4A21A 1BSIA 3QV8A 2Q01A 1THFD 1OG6A 3TROA 1UKPA 4A29A 2AKMA 4HNUA 1Z32X 3QY8A 1AH4A 1JPIA 3CB8A 5FS6A 2C16A 1FCVA 4A6GA 3MMTA 2BVDA 4QROA 3GHSA 3W2MA 3L0GA 5FF3A 3BG3A 3W01A 4P8VA 2H3BA 1JIBA 1MXDA 4JIPA 1FO4A 2RAGA 3N12A 1C9DA 1H6VA 3O0KA 3GTXA 4JZ5A 3B8TA 2GJNA 1OC5A 3SAZA 1XYMA 4D9PA 4XD4A 3DJJA 4XB3A 3AO0A 2ON3A 1NEYA 5D2VA 1KXVA 1B2YA 3PBUA 3DN5A 4ASTA 2O0TA 3ZIZA 1I1WA 4Q8QA 4Q6JA 1H63A 2JF7A 4E6MA 2WW5A 3GDTA 3BARA 1WZLA 4GY0A 2WOWA 3COTA 3RR4A 1SGJA 3NS1B 3TJLA 3NQ6A 3VUPA 3QQ0A 4MWAA 4KWWA 5BXSA 4EPBC 3QQ1A 2NQ9A 2GUBA 2NQZA 3AIWA 3MYOA 4A4AA 4XD5A 2WZTA 2GVLA 3AJ7A 3FGCA 1O12A 3T9PA 3GIYA 4L5ZA 1KKRA 1PHQA 4H4XA 4D1IA 5BRBA 5TIMA 2HV5A 2BASA 2Z7GA 4H9UA 3AIQA 3ARUA 3ERPA 3EMQA 3S2JA 1KM4A 4LU0A 2WSQA 2A3EA 1SVDA 1K7XA 4EMIA 5L6UA 1XPYA 3DFSA 1FHUA 3VDBA 3GX9A 4GI9A 2CPUA 4A3RA 1K7EA 2A6LA 3JUGA 2VEGA 1RJPA 3S2CA 4IJBA 4Z1DA 1KRCC 2CFYA 4RDYA 2PDXA 3MSGA 1GSNA 4DUWA 1MRQA 3UJ2A 1AJ0A 4WSJA 1LCOA 4EXAA 4O4WA 1ZUAX 5D2TA 1Q7ZA 4RR4A 5HMSA 4GABA 1LBLA 2CBUA 4LUSA 3MSDA 4PEKA 4H1ZA 2YZ5A 2D2OA 3QW4B 5GRTA 1B57A 3LHTA 3H2EA 2EPLX 4FX9A 1JXJA 3DK4A 3IJLA 2PDKA 4O57A 1QTWA 2VCBA 1F4HA 4L9ZA 4QNEA 1V0MA 2VYOA 3OGSA 1XW8A 4GUGA 2NXGA 4GHRA 3QLDA 3ITLA 5I6SA 3VZYA 1PUDA 3WBAA 5FD0A 3CT2A 4H41A 1B0IA 3BV7A 1QU4A 1GXFA 4V2XA 1R7AA 3ZOAA 3A4JA 4MWAE 1NQKA 5CSUA 4HK5A 1JD7A 1OX4B 2XJ7A 4HHMA 1AMKA 6A3HA 3NQAA 3W1LA 2Y5SA 4GGBA 2EG7A 2XUCA 4L64A 4PFMA 5LSMA 1VBUA 4LQ1A 3WUFA 4NILA 3S1XA 1XG3A 2NV9A 3KBJA 4C6QA 2WNQA 3C61A 1H7OA 3WMSA 2IKJA 2Z2UA 3WIJA 2A3CA 3PB0A 3NOEA 1W5OA 5REQA 1Q63A 4KRUA 5EMKA 3VTRA 5K4XA 4WDWA 2QV5A 2FJKA 4E8CA 5BWAA 1XXXA 2GK1A 2NVCA 1E6ZA 3DXIA 4ORIA 3IJDA 3KWXA 4HMDA 3R07C 5HWMA 2HDJA 4C6KA 4CD8A 3TUUA 4MSSA 3WN6A 1BTMA 1XX1A 4P8UA 4AZ6A 5LA2A 3BZJA 3PWIA 1GW1A 1F6KA 2NSXA 1YQ2A 3KE0A 4MIMA 4LA1A 5ENLA 4Z0SA 3GG8A 2PP0A 1HJWA 3IIVA 1OIFA 3QV7A 2HK1A 2P1FA 5DT7A 1R0MA 5CC5A 2VOTA 4PMYA 2OTDA 3NSMA 1U5HA 5HBFA 3DI0A 4LUTB 1AOGA 1ZKQA 1C90A 4UQAA 1K7FA 3TVAA 1KV5A 3M6DA 3RFAA 1IIGA 3WJWA 2QF7A 4O53A 2EHHA 3MPGA 2PTDA 2E6AA 3IIXA 3WD0A 4ZSUA 2OLAA 4OGZA 3QOMA 2ZRWA 3OO2A 4N9EA 2WZIA 2ZXDA 4LS0A 3M0KA 3SCSA 4DO5A 3UR2A 2CESA 4Z2IA 3NEVA 3F4VA 2ASHA 2C14A 3TC7A 1IZKA 3NSXA 3NTYA 4AYSA 3IWPA 4DJFA 3P2VA 2B7NA 3PAOA 4J5NA 4JBRA 1E6SM 5EMUA 4UQCA 2FMOA 3RGTA 1W1YA 4QITA 5FEXA 3TQKA 4LW7A 2XIQA 4GWEA 5JCNA 4D6IA 2JIEA 3HQ1A 1TJ2A 4NJHA 1FIQB 4BEQA 1R3QA 3W3OA 1NHRA 2A3AA 4Q22A 1OCQA 1XIMA 2Z26A 2O92A 1DJXA 1LLOA 3M0VA 3ZJ7A 1Q6CA 4ENLA 4Y96A 4NYYA 2X8HA 1US3A 5HXMA 3W7PA 4BR1A 1LQ0A 3D3FA 3AIRA 4H9VA 3H8AA 4PUWA 3STGA 5DO8A 1GRTA 4R9XA 3TOPA 4PBFA 4C6EA 1R2SA 1EB3A 2J7BA 1XLBA 1TQJA 4GOAA 4IMFA 1R3YA 4ML9A 2WOIA 2WVSA 2BGNE 2A85A 1VPQA 3RYSA 1YBQA 2DIEA 1DOSA 4NT0A 5AHMA 4KRZA 4QP0A 4FXRA 3WLIA 2HISA 3EDDA 4MMWA 4WHBA 4JXCA 1EPXA 2CNCA 3WYZA 3WQFA 1BXCA 2V3AA 3FK4A 1HVXA 4HIBA 3OP2A 3DDMA 2GRTA 4LVAA 3CV6A 4Z0JA 1RM6B 5H8MA 2Y62A 3LA4A 2Q8ZA 1X8CA 4O8AA 2OZ0A 1IE7C 1UQYA 1IT7A 1WZAA 2GSJA 3DH7A 4N6EA 1QNSA 3MJYA 2QHAA 2W61A 2YGYA 2ACRA 2IS7A 4TV5A 3A12A 1X1OA 1KCLA 3I6TA 5HPOA 1EDTA 2PWUA 3ITVA 1Z9AA 2VRQA 2R8WA 1E4NA 1EIBA 2E9BA 2J8GA 1TIWA 2J9XA 4WDTA 1E4MM 1WOBA 1MDLA 3GW3A 1G4EA 3H2NA 4IGSA 3FXYA 4HA4A 2QV4A 2CZVA 1STZA 3TXVA 3A3WA 4FPSA 3B97A 2FYMA 1JZ4A 2FZMA 2YXXA 1SR9A 3FS2A 4QRNA 2R1NA 5I79A 3D9XA 4X0NA 2ZWZA 3MMUA 3ITYA 1WZMA 2ZYFA 3O6CA 5DT5A 2PSNA 1GG1A 2Y8KA 4CN4A 2BOFX 1E0XA 3T6CA 2QDEA 1H3GA 1ENUA 4ZO6A 5C8BB 2XFWA 4JFWA 3AIEA 1YTDA 1OK4A 4AX7A 3GXFA 1GKRA 1W3TA 3BW3A 2X09A 1ALDA 3GTNA 3O8AA 3H2CA 1VDVA 1IT8A 1SZGA 3U5UA 4LY4A 4W85A 1HO4A 3QEZA 5HQEA 3L4XA 4NAFA 3OC4A 5LNVA 1RA5A 1ZB5A 4GVHA 1T99A 3A7AA 3BGJA 4IGHA 2I9UA 1OABA 4P7OA 5I23A 4ZOEA 4A2RA 3KTCA 3AM9A 3WNPA 5C5YA 3GVGA 1F8WA 3QY7A 2JKPA 3B04A 2V2CA 4UR7A 1EYEA 2QVNA 5GJMA 5KZMA 5FF7A 1AL8A 3L4TA 1H0IA 4GC4A 1H7PA 2J88A 3M1ZA 3PVFA 5HUPA 4FNSA 1HL9A 2PGWA 4N6FA 3ZFHA 2ACUA 2CBVA 4UQEA 2IPGA 5D8WA 4E8GA 1O95A 5FJJA 5A8MA 3C56A 4FLOA 4EWND 5A8QA 2CZFA 1FWIC 5CKSA 4LNYA 4W7VA 3GNPA 4WJ8A 1F07A 2CYGA 2V38A 2YCLB 2ZIDA 1U1HA 3VK5A 1O1ZA 3VYLA 2QUNA 1QW9A 4UQBA 1KGWA 3BAYA 3PUGA 4XZIA 3H23A 1CGWA 2PRLA 3SRDA 3GH4A 5G5GB 3R5EA 3XISA 1CGYA 1GQNA 4JQ2A 3BDKA 9RUBA 2H9AB 1YNQA 3TYDA 1EGMA 1QNRA 1UR9A 3RM4A 2PLMA 4W86A 4GFIA 2J7EA 3UZJA 2ZRVA 3DFQA 1CXFA 1UZ1A 5D38A 5XINA 3ZR6A 2CEQA 4IPIA 2GOKA 1WX0A 5FJIA 3EOUA 5FL1A 1ECEA 5LNWA 2C3CA 1TV4A 3VCNA 3N04A 1YDVA 4FR1A 1H7XA 1W1ZA 1KTNA 3WQVA 2CKRA 1MUMA 5T91A 3NZQA 3W02A 2OQHA 1DYSA 3N3TA 1CLKA 1BXNA 1VIWA 3HA1A 4YU1A 2XZ7A 6TIMA 4DLMA 1QI5A 2YDAA 2YW4A 4Z1BA 5BXPA 4UTIA 1KO0A 1QBAA 5AB3A 2BY0A 1QO2A 2PTXA 3RMJA 1TV8A 3ZXWA 4ADWA 4LIIA 3LI1A 1FECA 5DXXA 2WKLA 5AC7A 3IGUA 2R9ZA 5A8OA 2BY1A 1JF6A 4QE4A 3AZRA 4XKYB 1V6VA 1FFVC 3N9KA 1WPCA 5DCBA 5HUOA 3PP7A 2QUUA 5BRPA 1DE6A 1SO6A 4HZ8A 5AC4A 3VILA 4MB5A 1TPWA 1QPNA 4JN6A 2YCIX 5JCLA 1XH1A 1N7KA 1TPH1 3R58A 2YVGA 4O4VA 1TSIA 3WFZA 4N42A 4DYKA 4JHMA 3AJXA 1A5LC 3QOKA 1NFPA 3WF4A 3T4CA 5AY7A 2POTA 2WVUA 3AIVA 3LMZA 4IL0A 1TMQA 4D72A 3S5YA 3B4UA 3RX2A 1ZJIA 2P0IA 2D24A 3STPA 2UZ9A 3S9IA 4DBSA 4GUHA 2RDTA 4FAMA 4J3XA 3TNOA 2C1GA 4FX6M 1W2VA 3CO8A 1K70A 4GI4A 4NNAA 3JW7A 2QW5A 3BQ5A 2YB4A 3Q2DA 1JZ8A 2PBOA 2PRMA 3LB8A 4HTYA 4J56A 2Y1HA 3MWCA 3BTNA 4CUCA 3WLJA 3KOYA 3LHYA 3QFEA 3VX0A 3WLNA 1JJKA 4DVOA 1A5AA 2F84A 4DB7A 3BSMA 4AZGA 1PTGA 3AICA 4B5WA 3DHPA 2BBFA 4DWSD 3PJTA 3E96A 4DYEA 2CW6A 1TYPA 2OOFA 2F5ZA 3MSRA 2J9ZA 2X1TA 3UFYA 2CLPA 1D7YA 4KWSA 1G69A 3CAQA 1OF8A 3ITXA 3U7VA 3VGHA 1X96A 1EWDA 4CNOA 2TRSA 1O66A 2DORA 2WLZA 3BLEA 2W9MA 3BG5A 3W1PA 4MWAB 3ZLFA 1P43A 4R7JA 4URIA 4UR9A 4ERIA 1PWLA 3FV9A 3TFXA 2PRHA 3C5QA 3DHFA 3MA8A 4EMWA 5TBOA 1HKVA 2I1OA 4WGHA 4ZO7A 1QNPA 1UC5A 3AZSA 4U31A 2NVDA 3VOIA 3LMYA 2IPJA 1WB0A 4DNAA 3D0CA 5I02A 4AY1A 1U22A 1XQLA 4D6HA 4PUKA 2PZ0A 4A3YA 4EF9A 4OZOA 5D4YA 1I2QA 3VKBA 1LLZA 1WDWA 2ZUMA 3AMCA 3MUAA 5F4SA 1P48A 2YDSA 3WDIA 2WP6A 3W2JA 4UMBA 1SSDA 2VC7A 2Z00A 1ICQA 2GJLA 4RZ5A 3S5NA 2J7HA 3WF3A 2XH7A 3SCQA 1E70M 4YXGA 1GONA 1UJPA 2B7PA 2CZDA 5A2BA 1O1HA 1NDVA 3V16A 2EBNA 4K8DA 4UOJA 1MMFA 4LAOA 3LV5A 3HV8A 3CZGA 1QAPA 3VMNA 2ZOXA 4UTKA 2WWCA 3PS7A 1F61A 4ACYA 1XRTA 5M2FX 4GNVA 1WDDA 1MZRA 1GOQA 4IMDA 1RCOB 4NJKA 3ZS4A 4M3PA 2E1WA 4MZ8A 3UVIA 3GFZA 3NQDA 2R91A 2QCNA 4DF0A 4FLSA 3CEUA 1JPMA 3V1PA 3DJGX 3AWOA 4DNMA 4LS2A 1TR9A 4YYCA 2PZNA 1YADA 3CHEA 3DAQA 2V3GA 3AIBA 4M51A 2R6OA 2DSWA 4GRSA 3PANA 4ZB5A 5D03A 3JU2A 4AIEA 4C1KA 3KL0A 1DJQA 1POJA 4WD0A 3U3HA 3TW7A 1YNPA 4LVFA 3L12A 2QVHA 3NO3A 4LAUA 4L61A 3P0XA 2WB5A 3SCUA 3LLXA 3PJUA 4B9YA 4MNLA 4ATWA 4JIHA 1HKWA 3CH9A 4US5D 4LNCA 3VNMA 3WLKX 3NM3A 4DAFA 4LEFA 4RKAA 2IXVA 4IH3A 2WC3A 3S3GA 5DMNA 1GYLA 1JUKA 4GYPC 5CXPA 4JTTA 3W7JA 1ODUA 1V3IA 1GKPA 4L80A 3QV9A 4E8DA 4QCEA 3LRKA 4AAJA 1FQ0A 1XDJA 1OBAA 4XVDA 2ISSA 4UC5A 1LL7A 3NQ8A 1WZKA 3KXQA 4OECA 3TYCA 3VU2A 1YE4A 1SZFA 1WYGA 1VS1A 3DFPA 2XGBA 3RO8A 4C6CA 5IHRA 4PMUA 3VAVA 2OQLA 1P7TB 1Z41A 3O05A 1WXYA 5C70A 4JNMA 4DUXA 2A3LA 4RV3A 5T26A 2X05A 3MHGA 1EIXA 1C8YA 1PAMA 4AG0A 4IPNB 1AD4A 3VC6A 4HSHA 4MB3A 4PMVA 1KBKA 3LGDA 2CKSA 2NX1A 2VGFA 1LUCB 2QJHA 4BWLC 2V68A 1H5VA 3LX9A 4H8HA 3ANYA 2YFOA 1ONWA 3EX4A 5JH2A 1ZBCA 4JIIX 3QHMA 1Y0EA 4UTTC 1XG4A 4Y8FA 1YEYA 5EBAA 3K8KA 4U5IA 1PS9A 1WBHA 1HQTA 3WD1A 1OC7A 3K2GA 3OW1A 2DZUA 5IDZA 5EKYA 1JPHA 1GVQA 1DJNA 1QK2A 2WZHA 1PIFA 5FJPA 1IV8A 4F79A 3MP4A 4H8NA 4UNIA 2R82A 1LUCA 2Y2WA 1FFRA 1SO5A 2AMGA 1OGSA 3GO2A 3EWYA 4FNTA 1TO3A 2Y7DA 3AS0A 3O0HA 1T6MA 4M6UA 4BS0A 4R9OA 4UMCA 1QUMA 4FEZA 2X0YA 3RRAA 1KM2A 2ESCA 1VRDA 4AHOA 3TJ4A 1PZ1A 2C15A 2YQUA 1VEOA 2YBVA 4UMAA 1XF0A 3M5YA 3IAQA 3S2MA 5AYIA 1VCVA 1WAUA 3OLEA 2YCJA 2PWDA 2VRKA 1MEIA 3BAJA 4QIUA 5CEWA 4HA3A 1IHIA 1GZGA 3QYQA 3NQBA 1A49A 3TU9A 5HR7A 3W74A 3DKLA 2WQPA 4CNNA 5LKYA 3VMOA 1HVQA 5AYBA 4DJEA 3NL5A 3THDA 3TONA 3NYZA 4GJ1A 1R7OA 4J1OA 4HCHA 3B03A 3WQPA 4D6DA 4O0QA 4Q4MA 4GGHA 3NQEA 2HXUA 2BGQA 5JIPA 1VFFA 1W2PA 5DBTA 2VWTA 2WVVA 3IVSA 1QNQA 4D6EA 5HULA 1EQPA 2Z29A 4GBUA 1VLIA 1LZOA 1EJWC 2EKGA 1HL8A 3DESA 5GJNA 1KXTA 1KCZA 2PU0A 1E3ZA 5B7YA 1Q1WA 5JU6A 1X97A 1Z3NA 4IX2A 2VCAA 3GYEA 4DYJA 3VIHA 2DV0A 1POKA 2ACQA 3LTSA 5EBUA 4L6HA 1V3LA 3CLMA 3E9AA 3LCGA 4XO7A 3WQ8A 4QLJA 3PTKA 2H6RA 4XAFA 1LP6A 4Y9NA 1TMLA 3W1QA 1V97A 5A3HA 5IFPA 3DFHA 3EDFA 4A05A 4B91A 2W3SA 1MZHA 1H2IA 1EKOA 2V5CA 4YHGA 1CNVA 3VIIA 3WH6A 2VZTA 1UR4A 4HKPA 2XSXA 4I7WA 5LHFA 1JG9A 3LLFA 4FI4A 1KB3A 2C7FA 2DZTA 1DWHM 1M1BA 3WNMA 1B30A 2YL6A 3DX5A 1EDGA 3ANUA 5A6SA 1LT7A 1DQUA 1XIFA 2FFIA 2GQAA 1J12A 3WUBA 2XTKA 3H53A 2ZBTA 1NELA 3N2MA 3E2VA 1XIDA 1UR1A 1DHPA 4JTRA 4TUFA 1W8GA 3O7UA 2WNNA 3POHA 5F2GA 2DW7A 1M68A 4OE7A 2A4AA 3L4YA 5FCZA 5E6YA 4BJHA 1EDQA 1HP5A 3TZFA 1AK5A 1KM3A 2UY2A 3N73A 4C6PA 2NX9A 3GKFA 1E5NA 2EJAA 3FIGA 1Y5WA 1KD0A 2RHGA 3RNMA 3FAXA 1AW5A 3R8RA 1GOMA 1GPWA 2HTMA 1LBMA 1RJQA 4IP7A 3LM7A 3VD5A 4OHQA 1FWGC 4XKYA 4H4UA 1ICSA 2ZRZA 3UZWA 1KBIA 5CCZA 3QTPA 4E4UA 2OKOA 1KN0A 4LFYA 1TWDA 1R3VA 1JAKA 1SQ7A 2G50A 4IIEA 5IHSA 1ZBWA 4JTJA 1KFEA 1YX1A 6CGTA 2V3EA 1TZZA 3TSMA 4WY0B 3C0SA 3KHJA 2SFPA 3PZIA 3OB8A 2I14A 1LRQA 3CHVA 4YJ5A 3V0TA 3WKZA 4XD3A 4L56A 3GM8A 1TV5A 5TNVA 2DT3A 3L4WA 4ZQNA 2F9RA 6ALDA 2WOQA 1XSIA 4JEJA 3WK3A 2YLAA 4QISA 3THUA 4H01A 3AIUA 1D8WA 1CGVA 4FX8A 1E0VA 2AQOA 1WKDA 4NZ5A 4Z08A 3LI0A 5A6KA 5TD4A 2Y7EA 2CLFA 3PUOA 3S6DA 4I9JA 5LNRA 5HNRA 2JIWA 3GFXA 1BWLA 2ZC8A 3I3DA 3NGFA 5JXQA 4PULA 4C6OA 1CXEA 5G2HA 1Z89A 3QHNA 4MB4A 2GDQA 1MQRA 1JFHA 3LTPA 1XLHA 4JL1A 1ZJBA 3N6HA 4PGLA 4WEVX 2NQ5A 4MJ4A 3WD4A 3W7MA 3M43A 4IUGA 1K8YA 3NQMA 3KLJA 5CJNA 1W37A 4A22A 1I1XA 4EX4A 3FJ4A 3PM6A 1OFPA 1NF0A 3DYPA 3P67A 1E9ZB 3ZVHA 1AVAA 4AZCB 3NRZB 4XUYA 1CB7B 2W54A 3WF2A 3IJIA 4TMBA 1EUNA 3IJ7A 4FA3A 2X7WA 1SJDA 3VKJA 4PCFA 2BHYA 3TYEA 4JTEA 4P7NA 4UFIA 1ZFJA 2BVTA 2E3TA 2EGZA 4L1GA 4APNA 3AUOA 3MHFA 3M5ZA 3DEQA 4DPQA 2QT3A 2WZEA 2A0NA 1PJ9A 1VIZA 5I09A 1UBSA 1JI2A 4G2DA 3AZTA 1FH7A 4PUNA 3R43A 1W31A 2V2HA 1N61C 2H8ZA 1PV8A 4L4OA 1ZXIC 4X2PA 4D8AA 1AH0A 4EXBA 2Y88A 5EGRA 2UY3A 3R12A 2VM8A 1XCWA 2QCHA 2W4XA 5F1VA 1V6UA 2OR2A 1NFGA 3CUIA 4TVDA 1YYAA 3OG3A 4US5A 5E9XA 2WMFA 4EPKA 4FB7A 2C3DA 5D9MA 1LT8A 2RDWA 1PIIA 1BWKA 1W3IA 3M47A 1X2GA 1DV7A 1G9HA 1WAWA 3GHTA 2KX9A 1ISWA 4H4VA 3UPBA 3F7JA 1T5AA 1VBRA 1W6TA 2GL5A 4ZOBA 3NPXA 2AL1A 3RITA 3HG4A 3TQVA 3BOFA 3THCA 4S3CA 5G1MA 3L67A 1ICPA 2X0HA 1DWGM 3T2OA 2CLMA 4HYRA 4AZ5A 3ICJA 3N11A 3SQMA 1QNVA 8XIMA 3G1YA 3W7KA 2WJFA 3WQWA 2FZ8A 1GZJA 4AD3A 3R0KA 4M82A 4IG2B 1JZ3A 1H61A 3I10A 5EMMA 1Z48A 3EX3A 5FF4A 1GVRA 1EO5A 2QKFA 4MYAA 4ZQCA 4KFNA 3GAKA 3PWGA 1L8NA 4YLWA 1EP3A 4UCFA 3UZ5A 3TCEA 3C86A 1ZQ5A 4ECLA 3T7VA 1CGTA 1JVNA 3GE7A 4RNFA 1W0MA 1UUQA 4EQWA 1ISVA 4HMEA 1ZNNA 1EH9A 4ZEPA 3W82A 5HJXA 4GISA 4YWIA 3UCQA 4TO8A 4PE8A 1W9VA 4OU1A 4P7RA 2AGKA 4QR6A 4MNKA 4CGTA 1VENA 2V0TA 1MO9A 1UJQA 5KSWA 2VX7A 4GIYA 1PO9A 1V79A 1NTHA 3OYXA 3GSMA 1W3JA 1KM5A 4M5PA 3CGTA 1TUXA 3DI1A 4HNTA 3AU2A 3K8LA 2GH5A 2DZWA 2XN2A 5FS8A 1H7RA 5CC3A 2POZA 3CGCA 1QXLA 3WY1A 4XIMA 2PE4A 4PMZA 5HOSA 3GDMA 2V5BA 3SUWA 5FEWA 3L0KA 3APYA 2QZRA 2J6VA 3ZVHB 1FCBA 3RLVA 3N2XA 1MDRA 4ZOAA 2C91A 3GS6A 1X2HA 4F2TA 4QSFA 3ISIX 5E9AA 3TLLA 4HOXA 1H1ZA 3A7UA 2QJGA 2G4FA 1K9TA 1KLYA 2R9RA 4KESA 1NF7A 3GQYA 1MW2A 3RU6A 2HVNA 3M0ZA 4AC1X 4PTWA 5CZJA 1LG2A 5D9NA 4AVFA 4EP8C 4AZBA 2XFYA 1WYIA 1J0HA 5E0FA 4BF7A 3MS8A 3IRSA 3WK1A 1Z44A 2ZCGA 1FDJA 3LBCA 4HHPA 3RAOA 4UTMA 3U9IA 1C9WA 2PP1A 5EMYA 5FSEC 1HN1A 2ZUNA 1DHKA 5FOOA 4PCTA 1ZAIA 1RPKA 3GNRA 3ONBA 3F5KA 1FFUC 2X42A 1TTIA 4DJFC 3SY1A 3HB9A 1UIPA 4LSBA 4JYDA 1QHZA 3U57A 2BHZA 3N34A 1VCGA 2OODA 1XYFA 3G8RA 5FJTA 1GQKA 3UZZA 3M44A 2F7FA 5K4ZA 3ZZ1A 2TMDA 3S1WA 3W2LA 2X0SA 1KFWA 4A3UA 5EA9A 3IARA 3F2BA 4YIWA 4AD1A 3I65A 1Q2SA 3LCFA 3W1RA 1W56A 2HVMA 1N60C 1XLIA 3MJMA 4JHOA 3WZ0E 2G37A 2WMGA 2BC0A 1M5WA 3JS3A 4UOQA 2INFA 3GAYA 5KETA 2AL2B 3AYVA 3CUGA 2ZUVA 1IEIA 1VFOA 4NIRA 2Y89A 1ADSA 1YW1A 2J8FA 4ORMA 2X2YA 4AZ7A 1VBJA 1UROA 4NAEB 3AN1A 2HMCA 4J28A 4HJWA 1OK6A 4CNPA 3QN3A 3E1F1 3W1TA 3IVTA 4RNIA 4E0CA 4MLJA 3E5BA 1RPXA 3UG4A 2VDHA 5KEZA 2HRWA 3EWCA 2GVYA 2J75A 3GG0A 3RCMA 3LOTA 3RF9A 4KPRA 1V6XA 2BMBA 4KF1A 2ZUSA 3O6AA 1RCXB 1ZHAA 4QGCA 4JTCA 1WXJA 2VDIA 3L5AA 4YPJA 1FWTA 4FHAA 3W53A 4EK7A 3E12A 4I7UA 3UCDA 4M1BA 2W91A 3WLLA 1JEHA 1BYBA 1K1DA 2B7OA 1NWTA 4JTQA 1Q6RA 2NT1A 1J8VA 3NQCA 1OZMA 5FAGA 1J96A 4HZMA 1JRPA 2VHLA 3M0HA 1TWZA 4IQLA 4NX5A 1VGAA 5HAOA 3W23A 1EX5A 1OFQA 5I3HA 3W22A 3NXFA 3UYIA 5SWUA 1ITQA 3LD5A 4B5TA 1FWCC 4DO6A 3W87A 4NUWA 5C0QA 3PUDA 3AXHA 4JFVA 2PDPA 3CWHA 1TCMA 1KFBA 1GTHA 1MFUA 3KBMA 4JFSA 2WKJA 3BW4A 3QVQA 5EBKA 3TE9A 1IZJA 5HQMA 1PCWA 4KWOA 4KGLA 3HOJA 4U2ZA 4Q7NA 2YL8A 2I7GA 1V3KA 3CQ0A 2OEJA 2P10A 3UWZA 2ATSA 4JIEA 3OBKA 2GVJA 4NQ1A 2GUYA 3DFOA 4XAGA 2WSRA 2OT1A 3TA6A 4Q7BA 2WJZA 1F9CA 5A6LA 3CZEA 3K4AA 3QKEA 2Z4GA 5HQLA 1XLMA 3KHDA 4DHGA 4TVWA 2E5BA 1OC6A 3BZGA 2O9TA 4BI5A 4V28A 1F74A 5BNKA 2BXVA 1RBOB 1OFEA 3AHZA 2G3JA 4Z1CA 6REQA 5CPTA 3ITOA 1TPDA 3UD6A 3S5OA 2XHYA 2CWNA 2Q8XA 1EX1A 2WJDA 5CSYA 3N17A 1E55A 2ZZBA 5ECVA 1ITCA 4FNRA 1HW6A 3B8IA 1FWBC 3W0KA 3WNLA 3QZ6A 2TPSA 2QS8A 3CQIA 3CH0A 1D7KA 5BU6A 3VOHA 4DQWA 1AA1B 3SR7A 1K6WA 1B9ZA 4DBDA 2CXGA 3GC5A 4G6CA 2LLEA 3ABOA 2ZXAA 4DUOA 1UD6A 1GGOA 1K8XA 2GQ3A 4DO4A 1NP2A 3BSGA 5BXTA 4U3CA 3REQA 1DVJA 3VCRA 1Q8JA 2J78A 4F8XA 2QJNA 4X22A 3B0VC 1PKMA 3OIXA 4M81A 4Z2GA 3A9IA 1B4EA 4ACZB 7XIMA 5I3FA 2XIBA 4ZQOA 2JGYA 4Q7IA 3DFNA 3SJNA 3W07A 3ES7A 5A6MA 2FFCA 4J2PA 1FVPA 1AJ2A 3WFLA 2VFFA 3UF9A 2ZC1A 3OOQA 4ZOCA 1IR1A 4X9SA 1LWIA 1KXHA 2J8TA 2CDUA 5FJRA 1MW3A 4EM4A 4RE0A 3PPFA 4FXFA 3SECA 1SYTA 4OJYA 4K8EA 2UWFA 3GXPA 5LIUX 1VYPX 3QFAA 3VO0A 4DZ5A 1SB3B 1VLWA 2PDUA 3RLHA 2NQHA 3TTSA 3LUTA 4OOUA 1XGEA 1YRRA 3ZT7A 1ADDA 2V6AA 3ZSSA 4U5KA 4A8RA 4EIVA 4DBEA 2EQ7A 3CASA 5U7SA 1MRAA 3W70A 3GIQA 5E93A 1W5PA 3VM5A 1FTXA 3G2GA 1XLLA 4GY7A 1IIHA 4L6OA 5DMLA 3EDJA 1OYBA 4HQVA 3D3AA 1XD1A 2GR1A 2GK1B 4QEHA 2Q3RA 3VGEA 2OMAA 3SI9A 4YVVA 1E9IA 1K8CA 3PUEA 1TE6A 2C6QA 5GNZA 1JDCA 3SURA 2DH2A 2HE8A 4QAWA 3DC8A 1N2VA 4E38A 4DJDC 2QCCA 5AYXA 2HEJA 3LNMA 3GRIA 1IEQA 5CPQA 2PDFA 3UY8A 5A95A 5AVNA 1O7AA 4XZWA 2VMFA 4KEVA 3PN8A 3L66A 1JQVA 4ADTA 1QOQA 1ZU8A 3UPMA 4J40A 4LTSA 4ZE5A 2Z1KA 5DANA 4MY9A 1G7VA 3A4XA 2O55A 3KVJA 4WXYA 4JEQA 4RE2A 1YPFA 2L5HA 4M80A 1ZPTA 3MY9A 3UXLA 1GYNA 5AZ1A 4JX6A 1IEWA 4JKKA 3ABZA 3HGSA 3E0WA 3LXDA 4WRHA 3ENLA 4J3UA 5HINA 1SZEA 2X1IA 4W8LA 4MG4A 4B90A 4M6QA 4LVGA 1C93A 5CZ0A 3RIKA 3MKKA 3WLPA 1R9XA 4B16A 4AD2A 3BLKA 3WUEA 5HPCA 1YXCA 3FEMA 1OX5A 1MO0A 1OFRA 3QJAA 1R6WA 3GXIA 4BV6A 3WBYA 1P0EA 1U1JA 1XQKA 2Y70A 3CGEA 2W0HA 4LEQA 2ZDSA 4B4FA 3UZYA 1WXZA 3L0NA 3H2OA 1ME8A 1E56A 3REQB 1EFZA 3KM8A 5TAOA 2VRJA 4EMJA 5EFFA 3ONCA 2WPCA 3WL1A 3FJLA 2ZFAA 4GX9A 2EO7A 3MKCA 3CXOA 4G7FA 1A0CA 4QDWA 1UWAA 1V0NA 4UTHA 3C0LA 2PEVA 3A23A 4ILSA 3CPRA 3ZWTA 3WDPP 4H4WA 3GNXA 2Q02A 3SDOA 1BKSA 1EJTC 4B2DD 4H6RA 2P3EA 4V27A 3TN5A 2F6KA 4PCPA 5AHIA 1KQYA 2V30A 4D6JA 6PTDA 3VX1A 4YWOA 4DZHA 1VCFA 3DOPA 5BYWA 3J7HA 3BJTA 4M0XA 3VIKA 1XD0A 3DU0A 3H2MA 4NJJA 3GC4A 1GHRA 4PC8A 4BF9A 3H12A 1W17A 4UNKA