2HZGA

Crystal structure of predicted mandelate racemase from rhodobacter sphaeroides
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
393
structure length
393
Chain Sequence
SLKIDAVDLFYLSMPEVTDAADGSQDALLVRVAAGGHIGWGECEAAPLPSIAAFVCPKSHGVCRPVSDSVLGQRLDGPDDIARIAALVGYNSMDLLQAPHMLSGIEMALWDLLGRRLSAPAWALLGYSASHGKRPYASLLFGDTPQETLERARAARRDGFAAVKFGWGPIGRGTVAADADQIMAAREGLGPDGDLMVDVGQIFGEDVEAAAARLPTLDAAGVLWLEEPFDAGALAAHAALAGRGARVRIAGGEAAHNFHMAQHLMDYGRIGFIQIDCGRIGGLGPAKRVADAAQARGITYVNHTFTSHLALSASLQPFAGLEADRICEYPAAPQQLALDITGDHIRPDAEGLIRAPEAPGLGLQVAASALRRYLVETEIRIGGQLIYRTPQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme/Enolase super
publication title Crystal structure of predicted Mandelate racemase from Rhodobacter sphaeroides
rcsb
source organism Rhodobacter sphaeroides
molecule tags Isomerase
total genus 134
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2hzgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2hzgA01
2MNRA 4GIRA 3P93A 3DERA 3THUA 3UJRA 3R11A 5FJRA 4Z1YA 2GGHA 1ONEA 3CXOA 4IL2A 2QJMA 4DYEA 3T4WA 1JCTA 2PTWA 5ENLA 2QJNA 1KKOA 2PTZA 1TE6A 3VDGA 3ZLGA 5FJUA 1R6WA 2XSXA 5BOFA 3IJQA 4DX3A 3ZLFA 2AL2A 3MZNA 4EWJA 4G7FA 3CT2A 4GYPA 2OFJA 3FVDA 3R25A 7ENLA 3U9IA 3VC5A 2PGEA 3CB3A 4HCHA 3T8QA 2AKZA 2QDEA 2CHRA 3B97A 4ROPA 4J1OA 1NELA 3S5SA 3V3WA 2XH0A 1EBGA 3FV9A 1EC8A 3NZGA 3MUCA 2OVLA 2ONEA 3VCNA 4E8GA 3S47A 2PU0A 4JN8A 4K8GA 2OQYA 3IJLA 4IL0A 3OP2A 2AL2B 1OEPA 4HNCA 4F4RA 2QVHA 2PS2A 3CAWA 3RCYA 3MKCA 4K1WA 4H2HA 3OPSA 4G8TA 3QPEA 1MRAA 3OW1A 1P48A 3H12A 2PP1A 5J04A 3SJNA 3RR1A 2P8BA 1NU5A 3EEZA 3UCCA 4GISA 5EU9A 4IHCA 1PDZA 3H7VA 3QLDA 1EBHA 2OX4A 3ZLHA 3OTRA 3ENLA 3SN0A 4DHGA 6ENLA 1EC7A 2OZTA 1FHUA 2QGYA 3HPFA 2PPGA 4ZCWA 1ELSA 3UXLA 2XH2A 4KT2A 3I4KA 4M0XA 3NXLA 2O56A 4GGBA 2XGZA 1E9IA 3JZUA 3JW7A 3TJIA 3UGVA 2QDDA 3V5CA 2PODA 3SSZA 4GGHA 3VA8A 4KEMA 4FP1A 4E6MA 3ZVHA 2PP0A 4H19A 4FI4A 1JDFA 3PWGA 3TWAA 1RVKA 3R1ZA 3STPA 1TKKA 2OPJA 3R0UA 3I6TA 3H8AA 3TW9A 2OLAA 2PMQA 4IP5A 2P8CA 1ECQA 3V4BA 2OQHA 2GGJA 3T9PA 3DESA 2OO6A 3DG3A 3GD6A 3I6EA 3QKEA 3BJSA 3FXGA 2GGIA 1WUEA 3DFYA 3MWCA 2FKPA 2DW6A 5BOEA 2I5QA 4GFIA 3PWIA 2HNEA 3R0KA 3JVAA 3U4FA 3Q45A 2XH4A 4ZA0A 3ZVHB 4X2PA 3QTPA 3V5FA 3KUMA 2HXUA 2P3ZA 4A6GA 1FHVA 2PTXA 4DN1A 3P3BA 2GL5A 3UCDA 4E5TA 4DWDA 3SBFA 1MDRA 1JPDX 3OZMA 1MNSA 3FJ4A 1R0MA 3R10A 3RGTA 3DDMA 3UJSA 4GMEA 4MGGA 3D47A 4HNLA 3UJFA 1XPYA 3P0WA 1MUCA 4HYRA 3SQSA 3BOXA 4MKSA 4DXKA 2POZA 3VFCA 3PK7A 3RO6A 3MQTA 2PP3A 2HZGA 4A35A 4YWSA 2MUCA 1SJBA 3DG7A 2PU1A 3EKGA 1SJCA 3N4EA 1TZZA 3TQPA 3DFHA 2OZ3A 2QJJA 3NO1A 4HN8A 3GO2A 1XS2A 4ENLA 2OZ8A 4HCDA 2PGWA 3VCCA 3TJ4A 1YEYA 5FJTA 4IZGA 4H83A 2PTYA 2XH7A 3GC2A 3TOYA 1BKHA 1KD0A 2RDXA 2HXTA 4K2SA 3QN3A 1MDLA 5FJPA 3MSYA 1SJAA 2PSNA 2AKMA 1PDYA 4JN7A 3ES8A 4Z17A 3FYYA 4KPLA 4A3RA 1JPMA 4HCLA 1KKRA 1BQGA 3ES7A 3RITA 2PCEA 2DW7A 3VC6A 1IYXA 3H70A 3CYJA 4GYPC 3UXKA 3FCPA 2AL1A 3TCSA 2GSHA 3T6CA 3K1GA 3PFRA 2P88A 2OG9A 3OZYA 3NFUA 3IK4A 4IP4A 4IT1A 1KCZA 3N6HA 3TTEA 3MY9A 2PA6A 3BSMA 3DG6A 2NQLA 3N4FA 4E4FA 2GGEA 1P43A 1EC9A 3RRAA 4M6UA 3TWBA 1SJDA 3IJIA 1DTNA 3ZVIA 5FJOA 2GGGA 3SN4A 3N6JA 3CK5A 3D46A 1W6TA 2ZC8A 4E4UA 3DGBA 2FYMA 3SN1A 2GDQA 1F9CA 3DEQA 4H1ZA 3GY1A 3UJEA 2OKTA 4J3ZA 3UJ2A 4JHMA 3DIPA 1L8PA 3Q4DA 5IDZA 2QQ6A 4KWSA 4HPNA 1WUFA 2P0IA 2ZADA 4MMWA
chains in the Genus database with same CATH superfamily
3RF9A 1ODZA 3QY6A 3LCIA 2VRQA 5C9ZA 3B0XA 3P93A 3A21A 3H4WA 4MJ4A 1FBAA 4YVPA 3PVFA 2AAQA 3NQ6A 3RK8A 2QJMA 4ZE5A 2ZUWA 4PUUA 1UJPA 2PRLA 4L6DA 6XIMA 2VTFA 1QW9A 4L1XA 2EKCA 1IR2A 3VDGA 1OQFA 3T8LA 1DQUA 2VD8A 3MV01 3ZLFA 1D3HA 4JQ2A 3WN6A 1TA3B 3SQPA 1RQHA 3TC3A 4LUYA 4MY1A 3CWNA 2PB1A 4O17A 4XZLX 1OGBA 3AJ7A 2GJRA 3U2CA 3M44A 5A6LA 2EQ6A 4LY8A 1XC4A 2WSYA 3H2NA 2NV2A 3K30A 1EX1A 3CJPA 1AJZA 3HO8A 1W2PA 1Q7QA 3QHOA 1RCQA 1VYRA 3TSMA 4FX7A 1GVFA 1A80A 2H8XA 4KGLA 5JCLA 3GW3A 3HN3A 1JAKA 3FV9A 3GXPA 5IBXA 3FG2P 1KA9F 1LVLA 3VCNA 1CX9A 1K9DA 1IT7A 4E8GA 3GXIA 4GQBA 4D1JA 3AHTA 4WLCA 4GG9A 4LFYA 4M29A 1E72M 3LRLA 3BURA 2XG9A 2D2JA 3GNXA 4US6A 3OVRA 3W38A 1W5QA 3R8RA 3W7CA 1L6WA 4KRZA 2WPBA 3K4DA 2PS2A 2DU2A 4CQ9A 2PAJA 4G8TA 1MRAA 4AF0B 1XW8A 3VI2A 3VOHA 3BH4A 3QQ1A 2BVYA 2QW5A 4B92A 2DT3A 2NUXA 4DAFA 2ZRYA 1NEYA 3SEPA 5AN7A 1GERA 1UD2A 3R07C 5CJNA 1R9XA 4GO9A 1E3ZA 3MMDA 1E6ZA 3HB9A 2X1SA 1YDNA 1TUFA 1E1EA 2QAFA 4J3TA 2EGZA 2J7GA 1ZRQA 5F2MA 3RNDA 5I07A 4QG9A 5AECA 4IX0A 2FTWA 3SCQA 4Q32A 1GVEA 5AHNA 3HG3A 3KAOA 2FGZA 2OB3A 5HAOA 2W55A 3I4KA 5ECUA 3DENA 3GVGA 1ZBKA 4UBPC 1MQRA 3SCOA 3TKFA 1HFBA 2BV9A 3N2MA 3CIWA 3U4AA 4ZO9A 1Q85A 4GGHA 3OO2A 2YGYA 4ECLA 3VIGA 1HUVA 2QR6A 2YW3A 4LJ3A 1J0YA 3AU6A 4H19A 3UESA 1HN1A 1VRDA 1KBKA 1JDFA 4GY0A 3TXZA 3HMCA 3ZS4A 5DXXA 4BQ5A 3L2LA 3MA8A 4H6QA 1BEUA 3VVGA 1Y5XA 1N60C 5A8NA 4TVUA 3QV7A 4P5UA 1PXGA 4MDPA 5FSDC 4HIBA 5H8MA 3AXHA 4CN4A 2WBKA 3OLEA 2BVDA 2C13A 4DZHA 4PUWA 2C19A 1WYIA 1YBQB 3GB6A 1ONWA 3DGRA 3AJXA 4H6KA 2BASA 3DFYA 1CXHA 3DC0A 3EANA 2F5ZA 2C1GA 5HNNA 1ZSXA 2WCGA 2PRMA 2OOFA 1S2VA 4MG4A 3EEGA 4BQ2A 1N5WC 2REQA 3KCLA 2F2KA 3W7HA 2Z25A 1HGWA 4Z2HA 1BG9A 4DBUA 1SFJA 1P0BA 2XVNA 4XSLA 2HCVA 4B9YA 1GRGA 3ZM8A 4BI7A 2YDRA 4DWSD 1R38A 5CSUA 1R30A 2G96A 4C6OA 4NJGA 4BK9A 2PDPA 1WYGA 4MGGA 3IV8A 3DFTA 3KVLA 5CPQA 2DQWA 5B7ZA 2ZZ0A 1I1WA 4GH3A 2HPMA 3NQ7A 1H09A 1EP2A 3EA1A 2UY5A 1VEOA 4M1BA 2NPXA 1JDEA 4S3AA 3A22A 3BG9A 3PNZA 4J35A 1XX1A 2IPFA 2J25A 1CGXA 1V0KA 1XH0A 4O1AA 1F7BA 3ONCA 4HN8A 1X2HA 4KMQA 4ILSA 2P10A 1M3UA 1YEYA 3O07A 3C0LA 2WSKA 2GR1A 4H83A 1VYPX 3FA4A 2PTYA 1GYMA 4FS9A 3PHAA 5FL1A 2GUUA 3EXRA 2HXTA 4FOUA 4RE4A 4K2SA 2ZXBA 3K13A 1AH0A 2H8ZA 3MC5A 3E2RA 2QCGA 4JFVA 5D04C 1BZLA 3EF6A 1JPMA 3CL6A 1W9BM 1BQGA 3ARTA 3WUGA 4CNSA 2V30A 2ZZ2A 4GOAA 1UPMB 4V1XA 3C2FA 4D6JA 1NVMA 4Q6JA 4EF8A 5REQB 4Q7BA 4C6FA 3ANYA 3WLKX 5CZSA 3DK4A 4O14A 4HPJA 1OINA 4PMYA 1KBLA 1WDDA 3IV3A 2R1LA 1HF6A 3S6TA 4O0KA 3NFUA 2RJHA 3TYAA 1GOQA 1UMYA 3OODA 3KVJA 3VMOA 1V3LA 2ISVA 2CWXA 4MJMA 3VIOA 1KTCA 4OOZA 1RP9A 2NQLA 3LD5A 3TK7A 4JHZA 3TDFA 4C6KA 3RYSA 1TX0A 3GG1A 2F84A 3SCNA 3K4WA 3N6JA 1EJUC 4RNIA 4UQAA 2C0AA 3P80A 2GK1B 1Q6LA 3WF1A 2FYMA 2WBGA 2D23A 1OG0A 2ZYFA 3C56A 4R27A 1PSCA 1MWOA 2C8NA 3UJ2A 3SR6B 1I6NA 3WLTA 2XGBA 4YCOA 4Q6XA 3IAPA 4GD0A 4JGDA 4OIFA 4XAPA 3QFAA 2E7FA 1QHZA 3JRKA 1TPUA 3ITXA 3MUZ1 2WMHA 4GNKB 4FOJA 1UA7A 1X2GA 2QPUA 4GR1A 3DERA 1DL3A 1X7FA 4LC8A 4EMWA 1DJHA 4HMCA 4FK9A 1FWNA 4H3DA 1OIFA 1ITXA 3A5VA 2OSXA 4AX7A 1AL7A 4XBKA 1V51A 3GNDA 1TQJA 1GEHA 3AFBA 1VFOA 2X1TA 1UUMA 3EBVA 1UQYA 1HGYA 2GQAA 3VDBA 1H7PA 3PSVA 3ZYZA 5C0QA 1US3A 1XLIA 4GYPA 4Z2LA 4I3GA 1V6TA 4FNSA 3P82A 2QCDA 2GR2A 1UWAA 4LY4A 1U83A 1PKYA 3E2QA 1XLEA 5EYWA 3E2VA 2QUTA 3L21A 4LU0A 4BF7A 1RLDA 1FWEC 3BL3A 5E1QA 3KOXA 1W37A 5F7UA 4DJDA 2GFTA 2XIIA 3B9AA 2ZX6A 2OVLA 4GI6A 2GLKA 3MJMA 1PHWA 4DJDC 3SDOA 3W83A 4UFIA 2UZ9A 5A3HA 4ONVA 4GYJA 2X8GA 3NO5A 4ZMGA 4JIRA 2YYUA 3MYPA 1BAGA 4Q33A 5TF0A 3BLLA 1JCXA 3Q94A 5L9FA 2BHYA 3M6YA 1YTKA 5CBBA 3U5UA 3A7RA 3AWNA 4YHGA 3MO4A 4KCWA 4ML9A 3XIMA 2CLOA 1UC5A 3E3HA 1N62C 1TYGA 3PZ9A 5K3VA 4C1LA 1C92A 1J4EA 3HQOA 3B8VA 3UYIA 2X09A 3O6YX 4TQTA 1ZU8A 4AG0A 3REQA 2OX1A 4EPEC 4PB5A 4HK5A 1XBZA 5BYWA 2W0UA 2RABA 1FCUA 3BARA 3H2CA 4YMZA 2YSWA 1GZ1A 3NZQA 2QF7A 4PRWA 3DYMA 2QGYA 3S2NA 3MCNA 2PPGA 1XLMA 5IDIA 3FOKA 4LB3A 1PTAA 3NXLA 4WJEA 2O56A 1AUSL 1LOQA 3V75A 2ZXDA 3IIXA 2ZRUA 2OOGA 3TYEA 3F2DA 1AW5A 2D20A 2DZPA 3VGBA 1T96A 5XIAA 1BGAA 4I6KA 4MWAB 5EMLA 3D3FA 1H60A 2JKAA 1OZMA 1LG1A 5AKQA 1TJ1A 1TUXA 1D7FA 3R58A 4NILA 1O95A 2OLAA 4YS1A 3AICA 3MVTA 1TPDA 5HQLA 1W1TA 3G1AA 4W88A 2ZRWA 3T2PA 1KQYA 3ETRB 3SCSA 4DBDA 1A4LA 1QPRA 1I1XA 1D2KA 1VLIA 1FWRA 1UW9A 3QHMA 1BRLA 1AODA 4O1EA 2DZXA 4MPKA 3W2NA 3RM4A 3MWCA 2FKPA 4PUNA 3R0KA 1UQZA 1BHGA 1UD4A 3PZTA 4UNIA 2I9UA 2RH9A 3A13A 2J77A 2NV1A 2E6FA 3AHXA 3ZR5A 1ZAJA 3S1WA 4PC8A 3G77A 1XFBA 4H4RA 4BI5A 2XWEA 4GQ0A 2E25A 1TPFA 1FXPA 3KM8A 3TYUA 4CQCA 2PD9A 1JGMA 4G5DA 2CHOA 4JICA 4GCAA 1EIBA 1M65A 4XK2A 1BQCA 5C9XA 1KBIA 3D47A 3L9CA 1X39A 3P0WA 2QUNA 4AYGA 2RGLA 3FN9A 1JPKA 5TD4A 4CU8A 3PG9A 5JBEA 3ANVA 2Y24A 1OF8A 4F0KA 4OUIA 3A4JA 2Y62A 4Y8EA 4Q8TA 3KRBA 1XIIA 3LCGA 1XHCA 1GUVA 2Z7GA 4U3AA 1X98A 3ITLA 1F3WA 2V3AA 3RG6A 1ONFA 1A0EA 1XYLA 2Y7EA 2DZBA 3F4VA 3HGJA 3M46A 3ZSTA 1LCOA 1MUWA 4GVFA 4S1FA 4R7OA 2OZ8A 4PUDA 2WYSA 4L80A 5I3JA 4PTMA 1A5CA 4H6EA 3OB8A 1QT1A 2WSRA 4GBDA 5I24A 5G4WA 4GINA 3KTXA 4IFKA 8XIAA 4MNLA 3G1RA 1KFWA 4O10A 4H9MA 2DVXA 3LERA 1E43A 1Q2SA 4K37A 1BSLA 2YA0A 1Y5WA 1JPHA 3PN8A 1GW9A 2GVEA 4WRHA 3WLMA 4Y8FA 2WZEA 2ZVRA 3LNPA 4J3UA 3GK0A 5GJNA 5DLCA 1OCJA 5CG0A 1P4CA 1DQXA 2W92A 3OHMB 4CCZA 4MYXA 1TCDA 1YTDA 1V7AA 4LGXA 2NVKX 4JQ3A 3C5QA 1M03A 1EGZA 4IG2B 2YL9A 4LAOA 3VO0A 4ATDA 1E40A 2RHGA 2LLEA 3VOGA 3O63A 4LALA 1P6CA 3IC9A 3ICJA 2XZ9A 5L6UA 1Q66A 2VZOA 3DG6A 5LZLA 1GKRA 4E4FA 3HG2A 2GGEA 2VOTA 1QNRA 4AZ7A 3P5ZA 2UY3A 5FF2A 4IH3A 1JPIA 1QWKA 4F8XA 3KRZA 4E4PA 4HPHA 2YCLB 3EOUA 3KOYA 5DMYA 3CZ8A 5JBFA 1F9CA 4GHRA 2OT0A 4JY9A 1VKFA 2J74A 2ZTJA 2OZ0A 4J3ZA 3R2GA 3DIPA 1L8PA 2CZDA 3PTKA 2WPEA 2PDFA 3NRZB 1G67A 1LJYA 2P0OA 4H4YA 1V0MA 4NIRA 1OFPA 1ZL1A 1EZ2A 1GHSA 4MJZA 4GI9A 5CQ1A 3AUJA 5FAGA 3M0ZA 3PJTA 1OFQA 3E0WA 4Z1YA 3W37A 2ISSA 1T40A 4FF7A 3EAOA 2WOQA 4WDWA 3P84A 1THFD 1UP3A 5CC6A 3B04A 2V82A 5FJUA 4AYSA 2XSXA 3O7UA 3S5ZA 7REQA 2D0FA 5AZ1A 4K6AA 3KVKA 5CZ0A 1B90A 4S38A 1DWGM 4DJDD 5A8OA 3TQ0A 3F4DA 3M41A 5AHEA 2VFFA 4HCHA 4M8UA 1TR9A 2V81A 3APTA 4UMAA 2QUVA 4XKYB 4F3HA 2OWCA 4PMQA 4W7WA 3TV8A 2HV5A 2WW5A 3T44A 3S5SA 5CH9A 4P8WA 2A0NA 3NL3A 5AC4A 4IJRA 5FESA 3SB0A 3W3OA 1WDSA 5GNZA 3CHDA 2GVJA 1RXOB 5LKYA 3M5VA 2J8GA 2XIBA 2AOSA 3DXIA 5JCKA 4K36A 3B9JB 3A23A 3CO4A 2X2GA 1ESWA 3LS9A 1OG6A 2DORA 5FD0A 2MANA 1MZRA 3DYPA 4YNGA 4HB7A 2PDWA 4JIEA 3T07A 3E2SA 3M0KA 3H2EA 1OYAA 4MY9A 1BXNA 5D9PA 1PWLA 1NQKA 3P62A 5HMEA 1J93A 3H2OA 4FIQA 4IQJA 4NZ1A 1W9PA 4PH6A 1JRCA 3UWZA 3L0GA 5HUPA 3KTCA 3NZPA 1E3XA 4LVAA 3U7VA 2FPYA 3PTQA 3NYZA 1DE6A 3QOKA 1RY0A 4OQVA 2NQ9A 3N17A 1SO5A 4XZMX 3VNMA 1VB9A 2VWSA 2WLYA 2X7VA 2DVUA 3AISA 1CYGA 3IGHX 3HTWA 3C8NA 3SN0A 1KQZA 3CXBA 1X6LA 1XIHA 3LCXA 3N29A 4TTUA 1QI5A 5A1AA 3SUTA 3MBDA 1J5TA 3TMLA 1H1ZA 3EPOA 4W8BA 1E5NA 2XH2A 4KESA 4UWMA 2VJXA 2G3FA 3LHWA 1M7OA 2ZX5A 1PYMA 2Y63A 1WKYA 1E9IA 3KWSA 1H0IA 5C2GA 2FH8A 4F0HA 2JEQA 4NZ3A 2XM1A 3LPFA 2BB0A 3EXTA 4APNA 4HPGA 4E3TA 1PZ2A 4PB4A 1CIUA 1LROA 2NQHA 2VGGA 1LOLA 2VC9A 4U33A 3L68A 4UTFA 3LMZA 3POHA 3AWOA 1ONXA 3OLGA 2E6DA 2V5JA 1KV5A 2W54A 2CXEA 2OO6A 3KZSA 2E09A 2OWWA 3GG7A 2VZVA 5FS6A 3QH2A 3QKEA 3LNMA 1HKIA 3EX3A 4OECA 2BS9A 1B3OA 1JUKA 1QFEA 1T7LA 4C6DA 5D05A 3DBPA 2NX3A 3U4FA 4RDYA 3Q45A 4HK7A 1JYWA 5A8GA 6REQB 5A6JA 4IXHA 2NX9A 3QTPA 2V68A 2WM0A 3DAQA 1PUDA 3CEUA 3ZR6A 4J5NA 1UP0A 4DO5A 4Z42C 3VGDA 4PL2A 1RD5A 4FR6A 2C0HA 4L56A 3R8HA 3I4EA 3B9EA 4S3GA 2P5NA 1G1YA 3UJSA 2EPNA 1KN0A 1TV3A 2I14A 4GIYA 4ZXOA 2YDQA 2R9RA 1HT6A 1O94A 4HMNA 4WDTA 3GVQA 4L7ZA 3QY8A 1VGAA 5DCDA 4MB5A 5HNTA 4PCSA 1IZCA 1S5NA 1KFJA 1XSIA 5HR6A 2H9AB 4RR4A 5CEWA 4WY0F 3M0HA 1OHLA 1CW2A 1QPKA 4M24A 1H0GA 1I2PA 1RBOB 4NNAA 1IXQA 4LUSB 4WKFA 4O1DA 5M2FX 2DZWA 3W00A 2GYIA 4INFA 3DI0A 4HKPA 1MDLA 3NQCA 2WMGA 3CUGA 2V3EA 1R5YA 4Z17A 1W54A 1DWJM 1XI3A 4QNEA 1V6XA 4HCLA 1OJXA 5G5IA 1GT8A 4PSPA 1G4PA 2FPVA 2CBVA 2C3ZA 1EDGA 3VC6A 1IYXA 4O0QA 4J56A 4HJWA 1NM9A 3WDIA 4YVVA 2VR4A 3CHFA 3FAXA 2QNEA 4PCNA 1GTEA 4NZCA 4DM2A 4AD4A 2CLKA 3EWCA 2OEJA 1O7AA 3SIZA 3ZJ6A 4PMZA 3LCHA 4WOZA 2AAMA 4M3PA 2NW0A 3VIHA 1SMDA 2PA6A 5JCIA 5I3KA 4D6EA 5LHFA 1W1A1 2OCZA 1J2WA 2OQLA 3SURA 2J4GA 3MTWA 3WH8A 1ZMCA 1GOMA 5JQ9A 1GVQA 4GVIA 3G22A 3MHGA 1AQMA 3AYVA 2IKHA 1WDQA 2J7DA 1L0PA 4JDYA 3GY1A 4PL1A 3UJEA 4WVXA 4D6FA 4DBSA 4C7DA 5ABEA 4S2CA 1E15A 1JD7A 2E1WA 2WVUA 1XISA 2E6AA 4S3CA 4AX6A 1ZFJA 3MI2A 2EBNA 2A6LA 1BTMA 2VDGA 4CD8A 4G7EB 3THQA 4QAWA 3CZJA 4GIRA 2QF8A 4H9YA 3WDPP 2Y8UA 3AZSA 5EBKA 4CGTA 4LC6A 5H91A 3TW7A 1NF7A 4GIEA 1JCTA 1ZPTA 2PTWA 1F6YA 3OBEA 3L0NA 2DIKA 2O55A 4W8LA 1TWZA 4HP5A 3HFTA 2BY1A 2L5HA 4RZ6A 3TA6A 4RNJA 4ACZB 5BOFA 2NLIA 3O6CA 4DX3A 3AM9A 3W07A 4YXGA 1KB3A 3QV9A 1EJWC 3GFZA 4BEUA 4A8NA 3LENA 2WJFA 1F76A 3GS6A 3W82A 2NLYA 3MANA 3WELA 2JKPA 1HQTA 2QT3A 5A6BD 1UZ4A 3ABOA 4JN6A 3GAKA 1B9BA 1KTNA 3QSRA 2DZTA 4J1OA 1LL4A 2Z6IA 3WNKA 3NDZA 4Q4SA 4IPPA 2FJUB 4UMBA 3M9YA 3GRSA 2B7QA 1EC8A 2ONEA 4Z2KA 1XIFA 5LNWA 3S42A 1H2JA 3TROA 1DTUA 3SUWA 1BF6A 5JH2A 5CXPA 2R1NA 1KCXA 2EEXA 4PFHA 1YXCA 4AB4A 4EANA 2QUMA 5FKYA 3TU9A 2CLPA 4X9SA 3L4YA 4BFAA 1YDOA 2UWFA 5ECVA 2FVLA 4AEOA 1XSJA 2XFYA 5FF0A 3CO8A 2HDJA 4F4RA 5A69A 3QFBA 4TX9A 4NZJA 1G4SA 1DBTA 1PYFA 3AU2A 4DNMA 2VX7A 4K1WA 4XD4A 4FIRA 3G1DA 4KCTA 1GVIA 1F07A 1LQAA 4IMGA 2ALRA 2XVPA 3IIZA 3GZAA 4GC4A 5LNVA 1GYNA 2HVNA 3G3MA 2F7FA 4UZUA 3H4KA 4P61A 6TIMA 3QQWA 1B3WA 3V1PA 4M5PA 1IQ8A 3NL5A 2YJQA 1BYAA 5CSYA 1FO4A 2XVGA 3LU2A 1TCMA 1OF6A 3VUSA 1J18A 4UR8A 1EP3A 1GORA 4YVXA 2W4XA 3LTPA 2WMIB 1XR2A 4JDBA 4ML4A 3FDGA 1S3HA 4QJ5B 1XIBA 2GJNA 5GJMA 1FFUC 1SPQA 2CHNA 4U3CA 3M0MA 4QE4A 3UGVA 2PODA 3TYCA 3EX6A 3LUTA 4NZFA 2AMGA 3LCFA 4XIMA 4GBUA 3W1XA 1UKQA 1A5KC 1QBBA 5AC5A 3GXDA 1X6UA 5F2LA 4A22A 4FI4A 4JCMA 1RK5A 4PA8A 2OJPA 3VDHA 3TWAA 1SW7A 1EYWA 3CL8A 4S39A 2PUZA 3LXCA 4TX6A 3PBMA 1F4AA 3H8AA 3V4BA 3TP4A 1IR1A 2FH6A 4LUTA 2FGBA 2Q8ZA 4JQ4A 6XIAA 1VJSA 3DHPA 4UQCA 4XO7A 3SUSA 1CTNA 3FXYA 3SQMA 3WBAA 5D32A 4IMEA 5FS7A 3WG6A 1ADOA 4WDUA 5E6YA 4F0SA 3LV5A 3OQEA 5BOEA 4GFIA 3WJYA 5I09A 4XZWA 3P81A 2P3EA 1E4MM 3S5NA 3ZSSA 2EG6A 2HXUA 1JYXA 3WQWA 2WLZA 5AYZA 3WLLA 3SCWA 4A3UA 3CV7A 2ZWZA 3CV6A 2ZICA 3HPXA 3UW6A 5GPRA 4A3YA 4JHOA 1R0MA 1JCNA 5CZKA 2F38A 3HQ1A 4KEUA 4JAWA 1W8GA 4K1GA 4S3KA 4EPDC 1HL2A 1HIZA 4K8HA 1MUCA 4P8UA 3RRXA 5CZTA 2XWDA 4AC7C 5LA1A 1A50A 1DHPA 4FXRA 4I9MA 4H8HA 3GTNA 1TX2A 4Y9MA 4RDZA 1R3WA 4GX9A 4EPKA 1PCKA 1QK2A 2E9BA 5HUOA 4MAVA 5E9AA 2J7CA 3O16A 2HWGA 3APYA 4Q8VA 3UZ5A 1UASA 4S3EA 5EFFA 5F1VA 2WSPA 5HNRA 1QXLA 1VP5A 5FCZA 5JH1A 4QXIA 3VCCA 4M6VA 3ZT7A 3VFLA 3COTA 3QM3A 4ADSA 3UA4A 4PR4A 3V1HA 1TVNA 1UWTA 2ON3A 3WDHA 1NHQA 3G0UA 1QAPA 2D24A 3MSYA 3E0VA 1RY8A 2PBGA 3QBUA 3Q37A 1C9DA 1KKRA 4QITA 1NARA 1CLKA 4NNBA 2W3ZA 3V35A 4FZIA 2VZSA 4GO8A 1ISWA 3CWHA 1JCMP 3WDRA 1JEHA 1GZGA 3O9NA 3LY0A 1GRBA 2Q8LA 3KW3A 3TCSA 4HK6A 3YPIA 3GLCA 1C8YA 1O1ZA 1ZJIA 4KWOA 3PFRA 2YIHA 1WCGA 3GUWA 5CGQA 2BNJA 2GJXB 4JTFA 4GE8A 1BYBA 4CQBA 1V3KA 2J7HA 4RW3A 3W7RA 2O4MA 3VK5A 4HYWA 2E9MA 2XVKA 3WD1A 1UKTA 1PPIA 2OXNA 1LBMA 3GDKA 2YFOA 3S5OA 3M7WA 3N4FA 4F66A 1XG3A 2TRSA 1QNPA 3IJIA 3W7KA 3F5JA 1JYVA 2VKZG 1FTXA 3F7JA 1GETA 4US5A 4LX4A 3NAVA 4C60A 4PMOA 3FY1A 2V3DA 3PAOA 7PTDA 3GRTA 3ARXA 3FSTA 1I75A 4YJ5A 3N2BA 2VT0A 1HL9A 1QOXA 2P0IA 4S23A 1HX0A 4MWAC 1HJXA 2GUBA 3WF0A 1W3IA 1G9HA 1FKWA 4DUXA 4E2DA 3KBWA 1A5BA 4DLMA 4C6CA 3B3DA 3CH9A 3AN1A 2CEQA 5DQPA 1UA3A 1GVRA 4Q4QA 1S7MA 3SAZA 4CD6A 2H6RA 2NSXA 3E5BA 4DELA 1KC7A 4RUBA 4E8DA 3NL2A 3MZNA 1V8EA 1TPC1 3NG3A 4G7FA 5FF7A 3URBA 4MB4A 1WKDA 3HRDC 2ZWYA 3S8HA 1XDMA 3MU7A 1L8NA 3GHTA 5ER0A 3BDKA 5JCNA 1TJ0A 5FF4A 1GKQA 1UR4A 5FIPA 4PTNA 1WDWA 4FOKA 1EGMA 4IQLA 4PMVA 2WSQA 4I6VA 5HA7A 2ZCGA 3RAOA 1ML1A 1UD8A 2XN0A 4Q8OA 3AS1A 1OSEA 1XLHA 3C3NA 2FZ8A 4JKKA 2QCMA 3GTIA 5CBIA 1K4GA 4NNCA 1H3GA 2ESCA 4LNCA 4LEQA 4IPNB 3VINA 1E1CA 2INEA 4M6PA 1XYZA 3TC7A 3U6WA 3N19B 1SO3A 2NSOA 4GZJA 4ICMA 5A2AA 2Y5SA 4XZHA 3BW3A 3Q2DA 2CC0A 1ZJAA 5DCEA 1YNPA 1BF2A 1T8QA 4DPPA 3NEVA 1P1MA 3ALGA 2R82A 3VGHA 2IPGA 3QYQA 2A3EA 1Q6RA 1PDZA 4JIIX 7XIMA 4C1NA 3DI1A 1UWIA 1GOOA 2B31A 3EB3A 3FIGA 2NQJA 1EO5A 3IGUA 5KZ6A 5K4XA 3F2CA 1AMKA 3DECA 4FB7A 4GA8A 1EC7A 3GNNA 2D2GA 3TXVA 5I3GA 3VKBA 1RQBA 4WJ8A 3EB2A 1AJ2A 1SR9A 3IK2A 4BJHA 2CDUA 2FHFA 4D9PA 1KCLA 4EIVA 5DX7A 3N3TA 2PDNA 1GNXA 3IUHA 1B54A 4E6MA 3ZVHA 5TNVA 3MMTA 1AZ2A 4XUYA 3LYEA 1O5QA 1VC4A 3LEPA 1PB0A 1HZYA 4KPRA 4Q4OA 3BG3A 1Q13A 1DWHM 4XIAA 4R9XA 1YIXA 3ZWSA 1SMAA 4HZ6A 3L5LA 2VI0A 3BC9A 1UR2A 2WP6A 1JF5A 4L65A 5C55A 2PMQA 7TAAA 4EQSA 4MZ8A 1ZP3A 3GR7A 4ZOBA 3MUAA 1M6JA 4NJIA 2X1IA 3OHIA 3DG3A 4ZL1A 1MXDA 1HP4A 4FPSA 3SRFA 1TJ2A 1E4NA 2RDUA 1N55A 3E49A 1GSNA 1VYSX 2VQUA 1NFBA 5E6ZA 3GG8A 2DZVA 4PMJA 1W1VA 1EJSC 5AZ0A 4DYKA 2WC7A 2J78A 4FHAA 1FECA 3EWBX 3B40A 1XV8A 2YXXA 3GU9A 4C6JA 2W27A 4UTIA 2G50A 4DN1A 3DHFA 4KIEA 3UCDA 4QLJA 4JTJA 4QDMA 3W7GA 1XLFA 3VZYA 4NYYA 5E70A 3GTFA 4Q4MA 1UKPA 4I8YA 3VTRA 2WMFA 2IXUA 5C9RA 1K77A 3WNPA 1QNSA 3QEZA 3KVMA 2ISFA 5HANA 4EK7A 2BSLA 1TREA 3KP1A 1SQ7A 2JF7A 1QASA 1V0NA 2ZZ5A 5E93A 1W32A 4YWSA 1R87A 4ICNA 3RJXA 3GTHA 1TZZA 3TQPA 2ZZ1A 3JUGA 3UWYA 4IPLA 3KLKA 3FHAA 3WQ4A 3FK4A 3WSUA 5DMMA 2CLEA 2REQB 2YB1A 2YCIX 2V6AA 4IZGA 2QCLA 2V5LA 3SY8A 1OC6A 4RDWA 3FEMA 5HJYA 5FJPA 1BG4A 1UR3M 4JQAA 5C9WA 3T0TA 4KW2A 3QJAA 4H4UA 3WH7A 1XKYA 3OU8A 3CYJA 3UWUA 4GUHA 3H55A 4JEQA 1JXKA 3VYLA 4UQ9A 4IWWA 3NQGA 4GI8A 3BCFA 4R9OA 4GI4A 5C7VA 2YOCA 3K1GA 1F6KA 4IFRA 4ADTA 1Q6CA 3WO8A 1KM1A 1DNCA 2Y0FA 5G1MA 4K3ZA 1DIEA 4NJKA 5FEXA 3DFQA 2BFGA 3WD2A 1X97A 3O0KA 1FP9A 2HQMA 1ICQA 3IRSA 4US5D 4TVDA 1M9HA 4MADA 1RVGA 3N6HA 3WEZA 3SCTA 4MPQA 2VCBA 2PURA 3WQ8A 1LZOA 6TAAA 3NQMA 4MWAD 4CD4A 4FLQA 1ZDLA 1GQLA 4I5RA 3TJLA 3EOSA 5I06A 2ZFAA 3SRKA 3WH9A 1SUXA 2CBIA 1I8JA 1GRTA 4HA1A 2HE8A 2QZRA 3CGCA 4O16A 4IFOA 3TCEA 4KWSA 2XJ7A 3AIWA 3C4UA 3RLVA 1JYNA 1QJWA 2GJLA 1OB0A 4F2BA 4ZB0A 2E8YA 2DH3A 5H1WA 2HK0A 3UP8A 2V38A 5EY5A 1FEAA 3TJXA 3KRUA 4RKAA 3AROA 5FJRA 1CBGA 2ACUA 7TIMA 4E38A 1C9WA 3BO9A 2ZKMX 1JFXA 1K9EA 2CKSA 2OKOA 2PLMA 2CFFA 2VFHA 4HZMA 3GAYA 1TE6A 4OE7A 1UIPA 1SSGA 3IJQA 1SYTA 1KFBA 3S9YA 1EF2A 5CJ5A 3L5OA 4H4WA 1UJQA 2DV0A 3FKRA 4YWIA 3R25A 5F4XA 1GVOA 4XZNX 2NXGA 2TMDA 5HWNA 1FWIC 2X1UA 3WMSA 2IMRA 1FY6A 3A4AA 1JVNA 3ATYA 3G6LA 1JCJA 1CDGA 4QSFA 5EBUA 4TXEA 2Z1VA 4Y2WA 1K9TA 2V6OA 2CFYA 6PTDA 2CLMA 4FXJA 2J62A 4ZSTA 4QROA 1VRXA 2JE8A 1XQLA 2Q6ZA 3O3RA 3ZWTA 1DIDA 1YYAA 1T8XA 4G56A 4EKJA 4K38A 3T78A 4AY7A 2J9YA 2ZDRA 4Y6GA 4UQBA 2VEGA 3II1A 3NQ2A 1JZ7A 5LNSA 3UYCA 2OQYA 4CCDA 3DFPA 3WENA 3DK9A 1O6IA 2WKLA 1RPXA 4JY8A 2ZUVA 3GVRA 2AMXA 4DZIA 4UOZA 3RFAA 4ERGA 1B2YA 3GNPA 1KXQA 2JALA 2QVHA 4DNAA 4B5XA 3SRHA 3I65A 1ENUA 3ZFHA 1POJA 4LUSA 2Z29A 5IFPA 1QR7A 4OHQA 2YVJA 1TRDA 4F79A 2P8BA 4NUWA 1CGUA 4EPBC 2PDXA 3DCPA 1OFEA 5DF0A 4YL2A 2FGLA 1VEMA 2BZNA 3E0IA 3LG3A 2CZ5A 3NR0A 3H4XA 1E0WA 1DHKA 3DC8A 3LSBA 1FWBC 1N61C 1E70M 3CQJA 3GNRA 2A21A 3H7RA 1V3HA 1XLCA 1IEQA 3IWPA 1DWIM 1FWAC 2VYOA 1LOSA 2CZEA 3LDVA 3GWQA 3QZ6A 4QGCA 3P67A 4KT2A 3H54A 1UR8A 4ZOEA 2Y6ZA 3LZ3A 3MO7A 4ZR8A 3T2QA 1G01A 1GOWA 4JTSA 3TJIA 5A6SA 4HOXA 2EQ7A 4GH1A 4JYFA 2E68A 4AZCA 3VA8A 4B2DA 4QCFA 2VGFA 1MQPA 1LWHA 3W84A 3B03A 4HA0A 1U30A 5GQBA 4KCVA 3CS2A 3SECA 2C71A 4KKXA 3F1QA 3REQB 1REQA 4LBUA 2CLFA 3MCOA 5HNUA 1LL7A 4QBXA 3I7SA 4BZYA 1MNZA 3VGGA 3KX6A 3O2LA 1EQPA 3HQPA 3T9PA 4AD0A 3GD6A 3H26A 3G1FA 1IIGA 3A64A 3NOEA 2WMJA 1NFPA 1W17A 4J28A 5JXQA 1X1OA 2BGQA 3KLLA 3MWAA 3VPLA 2E4TA 3CQKA 3B06A 4LANA 4RV3A 3PG6A 4JNMA 1TG7A 2R1MA 1W5MA 3W29A 4L4PA 2C1HA 3CGDA 3KUMA 2VHLA 4A8IA 2JGYA 1V97A 4XSMA 4ACYA 3VUPA 2ZRZA 4JR5A 5EMKA 4H8NA 2R24A 3THCA 3TR9A 4NYUA 5AFDA 3UR2A 1CEOA 3SBFA 2YZRA 1MDRA 2HE5A 4YHEA 4C6QA 1LRTA 4ACZA 3M7SA 3QMTA 3NDOA 2W79A 2J9XA 1W5OA 3CHVA 5K2ZA 1C29A 1F6PA 4L4OA 1NFGA 3VGFA 4GMEA 1RV8A 3S1XA 4D6CA 3GDBA 1TV4A 3WDQA 2J47A 5AHFA 4O8AA 3C3UA 5D8ZA 4JTRA 1EPXA 3F4NA 3BLOA 2C7FA 3GFXA 3DK8A 2TSYA 4LYQA 3WJZA 3UEQA 1BRLB 1SJBA 3L5MA 3P0XA 3URNA 5LIUX 1N8WA 3TW6A 4AIOA 1JOAA 2E67A 5BNKA 1E9LA 1TV2A 2QJJA 4QG8A 3VZXA 3W24A 2QIWA 2PRHA 4JX5A 1M04A 4GRSA 1P1XA 4HCDA 4HHHA 1FH7A 3EXSA 1JUEA 2XH7A 4Z2GA 1W1B1 3BZJA 5AC7A 3VNLA 2DVTA 3W7MA 1JI1A 3M1ZA 3UVAA 2PSNA 4KPLA 3B0UX 2DJXA 3A3WA 2EJAA 3NVZB 4LXFA 1GPFA 1LTDA 2ANUA 5CPLA 1OFOA 5D30A 1KWGA 3B8SA 5T9CE 5G1YA 1K9FA 4JEJA 5JCMA 3ORWA 1EHAA 1BYDA 1R7OA 4AW7A 3A3HA 4WKHA 3OZPA 2RGMA 1GCYA 1NTHA 4NAFA 2V2HA 1K6WA 3KEHA 3CAQA 4QLKA 4E2VA 4FLSA 1AL8A 3L7RA 4IFKB 4M81A 1N63C 2G95A 1KM0A 4KFNA 1EC9A 1W5PA 3R13A 1A5SA 3KOFA 4WGXA 2O7QA 3M64A 5TR3A 3CZKA 3WD0A 9RUBA 3DH7A 2RKXA 4JPGA 1FHDA 1J0KA 1VPYA 2B81A 1W6TA 4E4UA 5KEZA 1R3VA 2PDMA 3KBJA 3DEQA 1ZB5A 1M53A 1H7RA 3UPBA 4K7VA 3BSHA 1FKXA 4JFUA 1B4EA 2CESA 2DT0A 3VCRA 2EQ8A 1CGVA 3A3XA 1XKJA 3W28A 3OC4A 3E9AA 2WNZA 4ZQPA 3M0YA 3D5HA 4JS3A 3PB2A 3IPWA 1Z6KA 3BAJA 4QCEA 4Z0SA 1LP6A 2QHAA 1K4QA 3EWUA 4JCLA 2DDXA 2YBUA 4RCXA 2OEKA 4B5WA 4C6IA 4XX6A 4JX6A 1KGXA 2RJGA 3TSBA 1R6WA 4U5KA 2HROA 3W2KA 2AL2A 4MB1A 4J9JA 3FA5A 4L5ZA 4EAMA 3GKFA 3GXTA 1RLCL 2PDIA 4HN4A 1HJUA 3TZFA 3M47A 3VC5A 4UTHA 3RDKA 2J8TA 1V6UA 1K8ZA 4L1WA 3W1TA 1AZ1A 4PTDA 2QPXA 5EGRA 3ABSA 4FLOA 2G3IA 2F6KA 3DFOA 2R14A 4Z1DA 4JQ9A 1YHTA 3W6LA 4YTSA 4L9YA 4HZ7A 1W3LA 2BXYA 1XGZA 2F61A 4XWUA 5E0FA 2GOKA 1AQHA 3MHFA 4X61A 1H2IA 4R33A 3UG5A 4QJ4B 1E6XM 3S4TA 2I5GA 4JIPA 1IIHA 4LSBA 3BUVA 2XIMA 5AYYA 1TYTA 4YTRA 2A8XA 3W02A 5F1UA 3N3MA 1XUUA 1HO4A 3IJLA 2BXZA 3NZRA 4J4KA 7REQB 4MZYA 1LDCA 4KWWA 3QRHA 4OUEA 5HQMA 1GVYA 2ZZ6A 1MXGA 3CQ0A 5G4EA 1VJIA 4OJYA 3BV4A 2QLYA 4M80A 3W1LA 3C2OA 3G1SA 1KLZA 1FRBA 3A6OA 4UTKA 1XIMA 4X63A 2IKGA 4H2HA 2J9ZA 4J40A 1P48A 3W87A 3RR1A 3MP5A 4WF7A 3E1F1 5D02A 3AMZA 3WK2A 2AQOA 1K1DA 1S5TA 4HT3A 3IARA 4GISA 4UFMA 2O7SA 4KS0A 5D8WA 4AZHA 1G94A 4AIBA 3UPWA 3OA3A 2CW6A 1YADA 1SW3A 4C6EA 1Q2RA 3NTYA 2XSAA 4CLMA 4B2DD 3CGTA 5HR7A 3CGBA 2PLKA 4ZO7A 4FDCB 5LXXA 4QS6A 4R3UA 2IQ0A 3FKKA 4DBEA 3BGJA 1FDYA 3JZUA 1UG6A 4AXNA 3IIPA 4ZSUA 2W3RA 1LLOA 1E6RA 4YTQA 2C16A 4KEMA 5T8GA 5AYBA 3U48A 1US2A 1PZ3A 1XCFA 2ABBA 2QCNA 2XHYA 3W1QA 5CSRA 1VFMA 1KFKA 2DSZA 3M43A 4WUIA 3PS7A 2CXGA 3VIIA 1EGVA 1LT7A 5JBDA 1UZ1A 5I0DA 4L6HA 1VEPA 2P8CA 3QR3A 4HSHA 1QNQA 3AQUA 3BLKA 4IF2A 4JIHA 5F4SA 4PEKA 3MUXA 3MI6A 1P0NA 4MF4A 1H1YA 3E96A 2YA1A 3OZOA 1Y7VA 5DY3A 1WUEA 1I45A 1Z41A 3SCPA 1ADDA 3GDLA 2HNEA 4ZTYA 1UIOA 5CCZA 2TYSA 3V0TA 2DFAA 3QF0A 4ALDA 3W7QA 5EMYA 2C6QA 4TTGA 3VE9A 4P7RA 2ZA3A 1F3XA 4A6GA 2PTXA 3EAUA 3LRMA 4WX2A 3LM7A 1XYAA 1BWCA 3S6DA 3BGGA 3FJ4A 1KXVA 3UG8A 4IGHA 3W27A 4JNYA 3O0HA 5HJXA 1XGDA 3URAA 3BOXA 4P8VA 1QNVA 2YFNA 3VFCA 3PK7A 2C79A 4BKNA 3IJDA 3A4WA 3CYVA 1GHRA 1OCBA 4MNJA 4L6OA 4Z1CA 4IMDA 2QMKA 3BANA 3UQNA 2XFWA 3S0CA 2RDTA 1N8FA 1W3HA 2ZUUA 5I77A 4LYPA 4M82A 1XLAA 1JZ3A 1J0JA 3RM8A 5A6AA 3NPUA 4LAKA 4BI6A 2Z1BA 4W93A 3CGEA 3KTSA 1WOAA 3N04A 4TVWA 1B31A 3HURA 4C6LA 3MUIA 1PDYA 2DUAA 1UUQA 5JIPA 4MHBA 2ISDA 5CLWA 2WC3A 2XIJA 3WFLA 2NX1A 3A47A 1E6NA 4OT7A 1PZ0A 5XIMA 1EQCA 4KEVA 2DT2A 2QJIA 2BVTA 4G9PA 4RX0A 4G6CA 4JIQA 1MW1A 4CNUA 2X0SA 3RILA 3IJ6A 3VKAA 2W91A 3AXXA 3RJYA 1VS1A 3ITCA 3WF4A 5KZMA 3TN4A 1GJUA 3BG5A 3E02A 6CGTA 5JUVA 2Y88A 2C3CA 3VOCA 2UY2A 4H9VA 4ZFCA 4FNUA 2E9LA 1QPOA 5IBXC 1R7AA 2GDVA 1MO9A 4O1CA 3TTOA 2NVDA 2VQTA 4PGLA 3WNLA 1W56A 5A8QA 4CKQA 3B8WA 4RL3A 2R91A 3KCOA 1FEBA 2DQXA 2V3FA 3FFSA 1GOXA 4UOJA 5CPSA 4MJ2A 3N4AA 1VFHA 4AEEA 4FAMA 5E9XA 3WQEA 1AH3A 2KX9A 3BQ5A 1CXKA 2BG5A 3KS6A 1IWAA 3OG3A 4O1FA 1CXIA 2VX5A 1YDVA 4GLEA 1JQVA 3HGOA 5IXEA 4R34A 4GJIA 3PNUA 4XTDA 5ABTA 3JU2A 2D1ZA 3FDKA 3T1GA 1S2CA 3S1UA 3UJRA 1U5JA 4HA4A 2CNCA 3NQDA 3E6EA 4NASA 2EQDA 1KR1A 1UR9A 4HU8A 3SZ8A 1VAHA 2PE4A 1XUZA 3FYPA 5G2HA 2D3LA 4I90A 5M17A 1U2YA 1XP3A 1PL9A 1ZNNA 1KGUA 1XPGA 3PBYA 3CPRA 3G8RA 1XDLA 5J5RA 3BK0A 2V8ZA 3BXWA 1U22A 4HMDA 3GIPA 3EOOA 2J27A 1C91A 1H5VA 1TJPA 4JFWA 1D7YA 1MMFA 3NM3A 1WZKA 9XIMA 2PZNA 4C5ZA 1XH2A 1TV7A 2F6XA 4J3XA 3RU8X 4HU4A 2G97A 1IEXA 4YPJA 3NL6A 4H4VA 3U2OA 4I9AA 4QFUA 3NZGA 3ARVA 3OQ8A 4XAGA 3UXIA 4A29A 4WIWA 2J79A 1A5AA 1IEVA 4H04A 3LMYA 1N5XA 3UR8A 2GSJA 3UCQA 2V2DA 2VRJA 4M52A 2BWGA 3KDNA 3VM5A 3WCZA 2IPWA 3B4YA 2Z2AA 3N9KA 2QXWA 4L64A 3RNMA 1OGSA 1DXLA 2X16A 4FSAA 2DZAA 1H63A 1V6YA 3MKCA 4ZGYA 3F4CA 3FSUA 1H6VA 3VKKA 3NEHA 3SJNA 3Q65A 1O1HA 3G1HA 1S2AA 3NURA 2FIQA 3KHDA 3N73A 3EEZA 4XTIA 1XRVA 4O53A 4IHCA 3CV2A 1ONRA 1FX6A 1AJ0A 3GKAA 3AHZA 4ZQCA 4NZ5A 1JCLA 3USBA 1XLJA 4Q8WA 2OYLA 3OLIA 6ENLA 3GZ3A 4XD6A 4TR9A 1KW1A 3TLLA 4BS0A 3W6YA 2Y89A 5CAKA 1LQ2A 2NVCA 3RHGA 1FWDC 1LQ0A 4H2CA 2FZDA 2RFGA 5HXMA 2BOGX 1LUCA 1V02A 3PULA 3AYSA 1YXYA 4IIFA 1QI0A 1O4UA 2XIOA 4QDPA 3LHTA 4HOZA 1TIMA 3UPMA 3VOJA 1UH4A 5FACA 2OPJA 3T81A 3APGA 3BICA 1HNYA 3LB0A 2QAEA 4GK8A 1TPWA 3TW9A 4LVGA 2EPMX 1I2NA 5E5CA 3LCWA 2PWEA 3S2JA 2X40A 4LNYA 1A5OC 2VUNA 3N6QA 1I4NA 5H6HA 3TUUA 1H41A 3T4CA 3NVVB 5AHMA 3TC6A 5HATA 2DW6A 2HVOA 2FJKA 4MDOA 2YKKA 2PWVA 1E55A 4ZENA 1W3JA 1ZP4A 3QPZA 2BP1A 2EPKX 1EF3A 1EP1A 3EB4A 4AZBA 1ME9A 2E28A 4TV5A 4F48A 2X42A 4FA3A 1ME7A 2OMAA 3U8GA 3EDEA 5K4ZA 3PJWA 2E40A 4F40A 3NVTA 1MNSA 4BA0A 1GOKA 1WX0A 4XD5A 2FMNA 1HG3A 3UU0A 4HNLA 1MEIA 3VXGA 4LUTB 1PIFA 1R47A 4LAZA 1OD0A 5I3DA 1E4LA 4L61A 1BGGA 1QVBA 1AW1A 1YPFA 5AOUA 2A1YA 2CCRA 4UTJA 4AVFA 4PB3A 1A3HA 1OFBA 1O5KA 3GO2A 4LB4A 5M03A 1XS2A 2XISA 5BMWA 1H7NA 3NQEA 3G18A 2BDQA 4AWEA 3QMRA 3CC1A 4NP7A 4OBTA 1MSSA 3W7DA 2AGTA 3GR4A 3CASA 4ORMA 3ITVA 2IPJA 1UROA 2NWRA 5HMFA 2VWTA 3UWWA 3WBEA 2AKMA 3UWQA 1GWJA 1HP5A 1MRQA 3CB8A 3ANUA 3UY8A 2PDHA 1VD6A 3BCDA 1NWUA 1E56A 1UHVA 2J75A 2OLHA 1LYXA 4GYPC 3L12A 4FXFA 4Q8PA 3GH4A 2VX6A 2WPCA 4PUMA 1XD1A 2PC4A 3NQAA 2P88A 3G2GA 4IXXA 4AQLA 1GVSA 1Z42A 3GH5A 3WQ6A 5IRPA 2PF0A 4GACA 4P7LA 3PY2A 1VQZA 1DIKA 5DFAA 2Z27A 3OYZA 4WSJA 4PUEA 3STFA 1ICPA 3DKLA 5C8BB 4YIWA 4ZB5A 1B3VA 1C90A 4GXWA 1ZHAA 4DUWA 1LORA 1SFSA 3ZVIA 3XISA 2YCEA 5I3IA 2VGBA 1EXPA 4CCCA 4ZB2A 5K9CA 4WY0A 2Y8VA 2PC8A 4GC3A 1YX1A 2GDQA 3SN1A 4CQAA 1QDSA 4CVWA 1Q45A 1RQEA 2XDFA 5CAHA 4C6NA 5IFTA 1FH8A 4XG1A 2VZUA 5BOOA 4HU3A 4H4TA 2BGSA 4HPNA 4IM4A 2D0GA 1FUYA 3AMCA 3MCMA 3PZNA 4IPJA 2YXGA 1PKLA 2X41A 4MMWA 3C2VA 3CUJA 3L0KA 1CZ1A 4IISA 4UUIA 2YL8A 2ZRVA 4HVXA 5DCBA 3H22A 4B5VA 2DZUA 3NUKA 2ZZCA 4B3KA 1BPLB 5ABHA 2J3NA 4FNPA 4E3VA 5GNYA 2PGRA 2WHMA 3FVMA 1LRQA 5LNRA 4GJ1A 4XZ9A 4OZOA 3V5OA 2PDLA 3W26A 2DUZA 4GNVA 5G5GB 1W9DM 1XWYA 4KH2A 5E0KA 3S46A 3W53A 1F8IA 1EYEA 2BHUA 4NEWA 1AA1B 3W7IA 2Z4GA 3N12A 3QGKC 3B97A 1DEDA 3R79A 4ROPA 1YXDA 4U2YA 4D6GA 3HPZA 4DO7A 3WLQA 3ITOA 4B9ZA 2XH0A 1KFCA 3UZZA 1B5TA 3W7NA 4N6FA 3TAOA 3BAIA 1JZ2A 4N6EA 5AHLA 3PJUA 5DXYA 3TVAA 3DZ1A 3PP7A 3C2RA 3SUVA 2YAUA 2PTDA 1GV4A 1PJ9A 4QEHA 1XIDA 3QFEA 4LCQA 4GY7A 3VKJA 4O15A 1K7EA 1JDDA 5LGXA 5D03A 4UTLA 2DSVA 2ACSA 2YX0A 2TPSA 4DY1A 5D37A 2HNHA 4JTUA 3H12A 1XIJA 3S1GA 4X2RA 1GESA 4EM4A 1ZUAX 4JXCA 2X2YA 3UNTA 1A4MA 1XYMA 2HBXA 1GKPA 3WQCA 4CEUC 1PS9A 3L67A 1ZJHA 1X1NA 3GQYA 4RNFA 1AQFA 5LYRA 1JD9A 3EDDA 3H7VA 3HMJG 3QV6A 3H2FA 3STGA 2YVGA 3TOPA 3W76A 2VC7A 1CENA 1E1CB 1JR1A 3L66A 1FHUA 1EPVA 1X8FA 1XLLA 3AOFA 1H62A 1Q7ZA 1UWRA 1CGWA 4OKDA 2YXOA 4GRTA 1WXYA 1LG2A 2BY3A 3WLHA 2EF9A 1X38A 1XL9A 9CGTA 3SIMA 1F74A 4DXVA 1MYRA 3LQLA 4HMEA 1FWCC 3W72A 1VFTA 2PP0A 3B8TA 4FX8A 2Z6JA 5I5RA 2QCFA 2YBVA 3PZUA 1DP0A 4M6QA 3DFNA 4Z0JA 3TYDA 1IXOA 5IM51 4C1NB 1DQWA 2F9RA 2E5DA 1JL8A 5A6TC 1UCWA 1WDRA 1O60A 3GBEA 1TO3A 3VOFA 4PZVA 3IJ8A 1LWJA 1E6PA 2WP5A 3E74A 2ISWA 3WLRA 1IXNA 1EJTC 3ISIX 3C0QA 1Q1WA 1KM5A 3AO0A 4G1NA 1JAEA 1T99A 4EXQA 3PWIA 1ME8A 3FGCA 3JVAA 3ABZA 1T5AA 4V33A 3GFYA 4DF1A 1GG1A 3TQVA 1KLYA 4WZHA 3ZVHB 4LT9A 1XICA 3JR2A 3W1UA 1HJVA 2QS8A 3QZAA 2W3SA 4XV0A 3DYOA 2H90A 3P3BA 3OGRA 1BWKA 1Q5MA 1RAKA 1VPXA 3NYDA 3C8FA 4FEZA 3G6MA 4L4MA 3L4ZA 3MP3A 1QK0A 4PRRA 1D8CA 1NJJA 4GUIA 1Z69A 1XLKA 5K9XA 1MI3A 3W0KA 1PVNA 1EWDA 3M5XA 4DXKA 3ZO9A 4H00A 1RBAA 5LA2A 3GXNA 1TMQA 1QOQA 2W67A 1FOBA 4AVOA 1WXJA 1PIGA 1K03A 4M1RA 2ZZ4A 1PWMA 3DFHA 2E0PA 4JYEA 4IIDA 1K7XA 1XJBA 3HW2A 3VZZA 1RHCA 1OX5A 1SZRA 1WZLA 2FQIA 3RXZA 3MMUA 5FJTA 1TFVA 3H4GA 4L1GA 2QAPA 3GSMA 2J13A 3TOYA 3WLJA 1D3CA 4JTGA 1GW1A 2JEPA 5M1TA 8TIMA 5HWJA 4AZ6A 1SJAA 4JTDA 2YLAA 3ES8A 3FYYA 1XSKA 1ZGDA 1KGWA 2ZDSA 3SADA 1W2VA 4FX6M 3KP0A 3S6OA 3SI9A 5U4NA 2G4JA 3LLDA 3TFXA 2XM2A 2DT1A 5E09A 3DHDA 5AHIA 5KSWA 2ZUNA 2EG8A 3TEVA 4TMCA 1XM3A 3TR2A 5U1OA 1I2RA 2JFEX 4EX4A 2YZ5A 3W73A 1K8CA 1AD1A 2B4GA 4OGZA 5EL1A 3PPGA 4CD5A 4POCA 2ZZBA 3OZYA 3IK4A 4XVDA 2ZE3A 2PDBA 3ERPA 5T91A 2CITA 2ZA2A 1MW3A 3G0SA 3ELFA 4KCUA 1HJQA 3KBMA 4PCTA 2WVVA 3GYEA 3GDMA 4EP8C 1R3SA 1JGIA 4BURA 3HA1A 4OVXA 1P0DA 2WMKA 5DMLA 3M16A 3SN4A 1W1YA 2OELA 4ERAA 2BY0A 2Q01A 4UFJA 4P2VA 4IJCA 1IEWA 2QEZA 3P5YA 4FX9A 3NXFA 3QV8A 1DJYA 2NXHA 2O92A 4EOUA 3WEMA 3HPSA 1GONA 1QNOA 3CEPA 1VLWA 1KRCC 2VX4A 4R7JA 3N25A 4S3JA 1LRNA 4GZIA 4PCFA 1ZTVA 3NOYA 2FFIA 4DWSA 2WQDA 2ZADA 1QATA 1SZFA 4IMFA 4YCPA 4V2XA 4AXKA 2WZMA 3THUA 3T08A 3B8DA 2CLLA 1PO9A 1TV8A 4I5XA 3N9RA 4IL2A 5CKSA 3MVIA 3C86A 3PUOA 2DY3A 1KR0A 3NGJA 3UG3A 2I17A 3K4AA 3WIJA 3WK1A 1IT8A 3V16A 1NDVA 3LM3A 2VFIA 3BLDA 3ZLGA 3OLDA 3W70A 4H6RA 3S83A 5J5DA 3UWEA 3G24A 3PZMA 2I56A 1I0BA 4U31A 4W4QA 2Q3RA 2OEMA 3LLFA 2C3DA 1TE1A 1VR6A 2ZZ3A 4AU0A 2WOIA 2G37A 2CZFA 1BWLA 4L9ZA 3T8QA 1UYQA 2A7RA 2QDEA 1F73A 4Z1AA 1LBFA 2X1RA 2V2CA 3HM7A 1GPWA 4K68A 4LS0A 5BZAA 5HMSA 2VEKA 2J7FA 4D8LA 4W7VA 3UERA 4A4AA 1Q6OA 1NELA 1EKOA 3P61A 3MMWA 1ZQ5A 1LLWA 4LVBA 4DO6A 3WZ0E 2RUSA 4A3QA 3KBSA 2PDKA 4N0RA 4HNUA 1YPIA 2GQ3A 4O52A 4UMCA 1RCXB 1R2SA 4K8GA 1UKOA 1AK5A 2B7PA 5F2GA 1MFVA 1QWGA 3NPWA 3VX0A 3E0LA 3K8KA 4WR3A 3VOIA 3T7VA 3CHCA 2E5BA 3QOMA 1TZ7A 4ZQOA 4HNCA 3A7AA 3IVSA 2HSAA 3W81A 1KRMA 1WDPA 5FSEC 3MUY1 3IUDA 1Q4NX 3WBYA 2FVKA 3CHEA 2XYLA 3L2IA 3OG2A 1X7IA 1A3WA 3UCCA 3ZJ7A 4KGJA 3QQ0A 3DFSA 1OFAA 3AI0A 3PBUA 4BF9A 1CXLA 1I9CB 2WJDA 4IQDA 4AZ5A 2OX4A 3ARPA 3BW4A 3RO8A 3WFAA 1A47A 4B5SA 1F2JA 2G0WA 3NO3A 2ZQ0A 3AXMA 1Y65A 2NT0A 2ZUMA 3GD4A 1HVXA 4LV9A 4PSRA 4M56A 1U33A 3V36A 4FNTA 1FQ0A 3PSWA 1SB3B 2G4FA 3TIMA 4GGBA 2AQWA 1OD8A 3EKLA 3LBCA 5I6SA 3KS5A 3V5CA 4PMXA 2WZHA 2DIEA 2C91A 3SFKA 1IT0A 2FTYA 4CU6A 3VMPA 1XHGA 3OGVA 1L6YA 1RA5A 2EXOA 2QVNA 3PWGA 3QZEA 4FXSA 1J79A 3PUGA 3R1ZA 2OGYA 3PZQA 4NAEA 4ZTXA 1OZQA 3ZR4A 4XKMA 3A9BA 4GWEA 5BWFA 2QDGA 1XRTA 1W9UA 1FWWA 5T26A 1W9VA 1KWKA 2CWNA 2PEVA 4REQA 1KM3A 4PN2A 4J57A 4DI9A 2EHHA 3OVGA 3QTGA 1U5VA 3FJLA 1VIZA 5DO8A 3T0BA 3D0CA 5D09A 3QMSA 2IQTA 4MUPA 3VGEA 1FDZA 5A2BA 1K7FA 2E5CA 3CWOX 2QGHA 1SZGA 4AZCB 1GYLA 3ARZA 5BRBA 2Z26A 1A5MC 3LBOA 3QW3A 2P3ZA 4KFOA 3H53A 3QC3A 3ZT5A 3FAWA 2E3ZA 2WJEA 2GL5A 5IOBA 1FWTA 3M5YA 4HOWA 4DWDA 2INFA 1PX4A 1REQB 1EDQA 4RLIA 3A5FA 3UZWA 4AEFA 4EF9A 4UCGA 3B0VC 3GR8A 2QYGA 3GE7A 3ARQA 3VIPA 3W23A 3D3AA 2ACQA 1AW2A 3OGSA 2J7EA 5DY2A 3BLIA 4NHVA 1YE6A 1ZK7A 1NPXA 3WL1A 5FL0A 3HG4A 4PUKA 1IWPA 3TN3A 2PP3A 2HZGA 1UH2A 2YW4A 1RJQA 2Z1KA 1JDCA 2MUCA 1DV7A 3AMGA 4C7FA 3CV1A 3GH7A 1CB7B 5F4WA 3NA8A 3RLGA 1HKKA 3I7RA 2EPHA 3W86A 2VOMA 4OFCA 2IQDA 3WJWA 3ITGA 1EEXA 5H2ZA 3PUEA 5DT7A 2B7NA 1V3IA 2E77A 2PLCA 4Y9PA 3AIBA 1UZDA 1R3QA 4PBFA 1FP8A 3QN3A 1J0IA 3C0JA 1BVNP 2HVMA 3RCNA 1D3GA 5CBJA 4JN7A 4UIOA 4UR9A 4F9DA 3SGGA 2Y61A 3L65A 1CI1A 1DVJA 2BX7A 4C1KA 3LOTA 1RCOB 2HQAA 3R94A 3C6CA 4B5TA 2Y7FA 3GTXA 1HKMA 3LN3A 1L2QA 3UXKA 4H4SA 2AL1A 3PZOA 3OEXA 2YPIA 2GSHA 4RZ5A 3ARRA 2A3CA 1FHLA 4F2UA 2KZHA 4DJEA 4RJEA 4X3ZA 3FW6A 5I02A 4H4QA 3UGRA 4DJEC 1XLDA 2O9RA 1V4YA 1FIQB 4FMVA 1ISVA 1FH9A 3QY7A 1WAWA 1H50A 4N9DA 3RRAA 2BC0A 1A0DA 2FVMA 3DX5A 1SJDA 1SZNA 2FPTA 1SO6A 4HHPA 4CU7A 3FYOA 4QNWA 4TMBA 2ZC8A 1O68A 1H7WA 1H11A 3O6AA 1OFDA 4AHOA 4XUGA 2WZIA 4UOQA 3URQA 1F3TA 5CG7A 1YKWA 1H51A 4RDVA 3B9OA 3AAMA 3B8UA 5AC6A 2JK2A 1E6SM 3PANA 3GD3A 4FF5A 1G4TA 3OVQA 4NAFB 2E5AA 4IMAA 4RE0A 1DXFA 4XB3A 2GGHA 3CLMA 3TX9A 3F4WA 3CXOA 4H4ZA 1DORA 1VPQA 3ITYA 4DYEA 2VMFA 1HJSA 3T4WA 1C7TA 1NQ6A 1ITUA 2JGQA 3UA3A 3M0XA 3STEA 3QFWA 2QJNA 1KKOA 1TPEA 3ZQ9A 1W3TA 1RJRA 4CD7A 5K9DA 3CTTA 2QJGA 5CC3A 3W2MA 2PI6A 3EA3A 3EA2A 3SCUA 2D69A 7ENLA 1UOZA 3CZEA 1ISZA 3PC0A 3IGSA 4MWAE 2J6XA 3O8AA 1IWBA 4OV9A 3GNOA 1UBSA 4RPPA 3OIXA 2OGJA 2BTMA 4ICCX 2WB5A 1JZ5A 4Q4KA 1QPNA 1KRAC 1P0KA 3R6IA 1ADSA 1KM4A 1W0MA 4M7TA 1VZWA 2O9TA 3EX2A 1XFCA 3MPGA 3MUCA 2BHZA 2WQPA 3F5LA 4GNJA 1TWIA 4JN8A 1UC4A 3DU0A 4O54A 4DUVA 4GYFA 4GUJA 2W63A 4IL0A 5D2XA 1R86A 1XF0A 4PRTA 1WKFA 1BTCA 2AL2B 2Z00A 3MV11 2WBAA 2A79A 3LX9A 1YMYA 3KLJA 1TIWA 2CBJA 1W31A 3VU2A 3BMWA 4YU1A 3HOJA 3IANA 2JKEA 1VQTA 4WGHA 4HJFA 3QPEA 1GEQA 1JRBA 2FZ9A 3OW1A 4OBSA 2YCKX 3RIKA 3QC0A 2NQ5A 2YL5A 1NOUA 5DBTA 3VD4A 4ZOCA 2VC5A 2ZXQA 6ALDA 3GX9A 3W01A 3UBPC 4LCRA 1FVPA 4GXMA 4IGSA 4O57A 1S38A 2I9EA 3W4RA 2VENA 4W9TA 2KAUC 3ZT6A 4BCEA 4EQWA 1JFHA 1MQQA 2YR1A 1Y8BA 3KBNA 5JU6A 3OTRA 1Z3NA 3VIFA 1ZY8A 4DI8A 3U5YA 3A9IA 3J7HA 4J2PA 1BLIA 3KCJA 3HPFA 1E71M 3LXDA 4ZCWA 1RP8A 1NDAA 2VEPA 1TSIA 3KE0A 3ZJKA 3E0FA 4UC5A 1OY0A 4JTCA 3W2UA 1E0TA 3EMCA 4JTQA 1W1ZA 3STCA 3URHA 2B7OA 1ZLPA 3SSZA 4JTKA 4HSNA 1V59A 1Z44A 4Q7NA 2GJPA 3BSGA 4HTBA 3TYBA 3EMZA 4YLWA 4IQEA 3EDFA 3N2TA 4WD0A 4Y7EA 3S3GA 3AYTA 4QTGA 1RVKA 1L6FA 4UTMA 2W61A 1TKKA 3BW2A 2GQWA 5A8MA 1WPCA 3BVJA 2XU2A 1YDYA 4NKCA 4Z2IA 3I68A 1A3XA 3PPCA 3WJSA 1XIGA 3VX1A 2A3HA 1EA9C 3RLUA 3R4IA 3L4VA 5HJLA 2TAAA 4I9TA 3BAXA 3BLPX 4JFSA 1BXBA 4B5NA 1GQIA 1T3QC 1EJVC 1EWEA 5GRTA 4DBWA 3HV8A 1J0ZA 3IIOA 2J7BA 2IS7A 1GJPA 3S5YA 1PTGA 1WQ5A 4GKTA 4Q7IA 3F5KA 4GCXA 1G69A 1JEZA 1DJNA 2D0HA 2G3MA 1V77A 5KTLA 2C15A 4GX8A 1K6AA 1G7VA 4X2PA 4N4QA 4ZFMA 3T55A 1Q1RA 5FMHA 4QEEA 3AIUA 3T0AA 2NT1A 4IIEA 4QRNA 4UCFA 1E5JA 1M7JA 4JQ1A 1LF1A 3S2CA 3W71A 3P8JA 2ZBTA 2P53A 3UT0A 2POZA 3RO6A 1MEHA 1XINA 2FDMA 5FS8A 4BR1A 2J8FA 4UTWA 3W74A 3DG7A 5HPCA 2TPRA 4ZBCA 5I03A 1XIEA 4UTWC 1JF6A 2WAGA 3MKKA 4N2YA 4Y96A 1GREA 5G2IA 4CCEA 1OX4A 1UWUA 4ZVJA 4W7UA 3VNIA 2PGWA 2VURA 3CUIA 2DEPA 2ZA1A 4B91A 3VDAA 2PWFA 5GNXA 5CC7A 4CNTA 1NHPA 3NVDA 3THDA 4WDXA 1NWRA 4R5EA 5LIKX 3ARSA 1WBHA 4R53A 3QGAC 1PEZA 3U57A 1XC6A 4DJED 1K8YA 3NPVA 1BSIA 1ODUA 1N82A 5D2YA 3TN5A 2ASHA 1P0EA 1CB2A 1BWVA 3QKZA 3H70A 1SZEA 1XLGA 3PB0A 3WF2A 1Q65A 1NHRA 1L9WA 1OK6A 3R5EA 1GRHA 5CLTA 5DT5A 2NUWA 1AVAA 2XIQA 3L2MA 4H9XA 2GVGA 1MUMA 4D72A 1XYCA 4DM1A 1VCFA 2CETA 3MI3A 4UR7A 1KCZA 4I9JA 5M3WA 2HISA 1ITCA 3GUGA 2PCQA 1CPUA 3P2VA 5C7HA 3N14A 4M6UA 4AHPA 1HO1A 1BVWA 4NJJA 2Y7GA 4RE3A 1YW1A 3BJTA 3PBVA 3WQFA 3TN6A 2RAGA 1ZS2A 4D6HA 4LRSA 3A4XA 3RX2A 2W6RA 1RA0A 1SR0A 1I2QA 3W7LA 2P50A 4ZXLA 2UV8G 4IJBA 5T9BG 3WKZA 1C93A 3AIVA 3VKCA 4H7CA 4JHMA 5EMMA 1J2BA 3ZXWA 1ZALA 2QQ6A 4UNKA 4CQDA 5HPOA 3B0YA 1ZBCA 3AXKA 1D9EA 1NSJA 3GU2A 4F2TA 3L5AA 3HJZA 2OSWA 1GJWA 1IZJA 2GZXA 3LSCA 4LH8A 1TMLA 4Z1BA 3W1RA 1Z8AA 2BXVA 1UPPA 1ONEA 3O0FA 5BMXA 1US0A 3OBKA 2PGFA 3KFTA 3L4UA 3TLQA 1RBLA 3FA3A 1MZHA 4E2OA 1QO2A 1LBLA 4NX0A 4AWTA 1KBBA 4LAUA 1DJWA 4UFLA 1E0XA 2VDHA 4NSBA 3AIEA 4D8ZA 2QULA 3USZA 4KF1A 4RNHA 3ATZA 1C8QA 3VIKA 4EQXA 4GPNA 3AALA 3ZIZA 4MUZA 1V5XA 3CT7A 3D9XA 3VKDA 1K3UA 4HPXA 3WLSA 1W8SA 2DH2A 3TSDA 4W86A 1B3YA 5A6KA 5HINA 1QU4A 1EA0A 2CBUA 2A3LA 4GIAA 2H3DA 1V08A 3S47A 1GK8A 1UB3A 3GXMA 3EWDA 1V79A 3M0LA 1VFSA 1EL3A 4U5IA 2QCCA 3H6OA 4ROQA 5JRBA 2A4AA 4QSHA 1FWJC 3I3BA 4PMDA 5D33A 2BC1A 2CZVA 2DSKA 1TTJA 3SGUA 1OEPA 1XANA 1VDVA 1TMHA 1SSDA 4AMCA 3DUGA 3PWAA 4UQEA 3TAKA 3CPGA 1WV2A 4HTYA 4GVGA 5MKGA 2V5CA 2BVWA 2VCAA 1QI3A 1JZ6A 4X0VA 1U1UA 2R8WA 1WNOA 1IE7C 3EGJA 4Z2JA 3P6LA 8CGTA 5RUBA 1OT1A 2HJPA 2EPLX 3RX4A 5C70A 2FZMA 1L2UA 3GVVA 1DYSA 4AFYA 5D38A 4GKLA 2OYMA 4IIHA 2EG7A 1PKNA 3RPMA 3H2MA 2BLEA 3JZEA 2V3BA 1TTQA 1A0CA 3EX1A 4Y90A 3TNBA 1IGWA 4TOQA 1RD6A 1TRIA 4FP1A 2Y5JA 1GQNA 1PE1A 3W7JA 2Y4SA 3W2LA 4LV4A 1DOSA 4MKNA 4J7RA 2JK6A 1JG9A 2WCSA 3ID7A 4UB9A 3TH6A 2PZ0A 4PTXA 2XPKA 5LNUA 1VBJA 3WLIA 1EO7A 4EWND 1S2TA 4IP5A 4LCSA 3NQFA 2ZUTA 2Y2WA 1S5WA 1WXZA 2V69A 3GC4A 4L9XA 1W5NA 4W5UA 3GIQA 3OVPA 3I6EA 5A6BA 1EOMA 3LLXA 3V7PA 1FCBA 1KCKA 3BJSA 1J6PA 2NXIA 4DPQA 1PIIA 4MSSA 1P6WA 4QIUA 5H8PA 4GXPA 2C18A 4V1YA 4O1BA 1F3PA 4IGMA 4KQNA 2D2HA 1VFFA 3LGGA 3LA4A 2QPSA 3QR1A 3RX3A 4BV6A 4LF1A 5I3HA 1LUCB 3HPAA 4ZEPA 4H01A 3QXBA 5BXSA 2GH5A 3W1PA 3WNNA 3NSNA 5I79A 2VD9A 1Q6GA 3RGTA 2Z7KA 4YWOA 4QAIA 2A5HA 3B9DA 1ICSA 1XPYA 3U3HA 4AAJA 4URIA 1GRAA 2Z0IA 2C14A 1V7YA 2DJLA 3PTDA 2CU0A 1EDTA 2ZTKA 4BEQA 3XINA 3GRIA 4I8DA 4WQ6A 2CIPA 4DO4A 3HFYA 1V93A 1T0OA 2D3NA 3N4EA 4DYJA 1P5BA 1VFUA 1UWQA 4WKAA 1KV8A 4HNOA 3NO1A 4E2BA 1VJZA 2ZX7A 4LVFA 3SSJA 2RDWA 3B9NA 4ORIA 5BU6A 4HGXA 2XUCA 4XISA 4LA1A 3BOLA 3LI0A 1Z7AA 4B3LA 1STZA 2XINA 1PTDA 1BKHA 3AS3A 1UMLA 4ZODA 2Z2BA 4MNKA 4B16A 1P7TB 5DMNA 4PEEA 4UQDA 5HK4A 4PMNA 4NI8A 3R8GA 3W1AA 4AD3A 2EO7A 3ES7A 1KXTA 3UWVA 1TV5A 4JKLA 3LHVA 1JROA 1JNDA 3VNDA 4KETA 2ZZ7A 1XDIA 4MZ1A 2I1OA 4EE9A 2PDUA 2WKJA 4GJJA 2GUYA 4QR6A 4YTUA 4BWLA 1IV8A 1NHSA 3SY1A 3M5ZA 4M7SA 1M1BA 5FS9A 3T09A 2OG9A 1DJIA 1E0VA 4BWLC 2ACRA 3B0PA 4B90A 1DXIA 5C2CA 4B15A 1TZ9A 1AQ0A 4ASTA 4K8DA 3MDWA 2FDSA 2OWXA 3VILA 4LW7A 4ERIA 1XBXA 1V0LA 1RK6A 3ABXA 2X0YA 1PAMA 3MS8A 1EH9A 5BU9A 1AD4A 2GGGA 2J6VA 3P7YA 3Q58A 1BKSA 2IW0A 3CK5A 2HK1A 1VBHA 4KWUA 4H50A 3RPTA 4ZE4A 1TA3A 1WE5A 2X05A 1UR0A 2AGKA 4I7UA 2VZTA 4GQGA 3O06A 3KZPA 2H3BA 4KIRA 1IF2A 3QVQA 4Q8NA 5KMYA 4H8VA 4JTEA 1M6IA 2A6NA 1FXQA 3VNYA 4A2RA 4N02A 1NAL1 3T42A 5FA5A 4OV4A 3PZVA 4F9JA 1SU5A 5G4HC 1WBJA 2PWHA 2W0HA 3R11A 2V5KA 5FJJA 1FFQA 2V0TA 1VHNA 2QKFA 1EOKA 3MSGA 1S39A 1Q6QA 2E1DA 1ZCOA 5CSSA 3SO7A 3DHUA 3SJ3A 4IIGA 4MY8A 5EKYA 4PTVA 3T40A 2POTA 3BAKA 1RJPA 3PPHA 4O0ZA 2YDSA 3N2XA 4WY0B 1EUAA 1Z48A 4WXZA 3W85A 4FR1A 4GQQA 1WOBA 1XBVA 3CT2A 2ZRXA 5EA9A 3BAWA 4B5UA 5AYIA 1CXEA 1ISXA 3U9IA 2ZXAA 1PX8A 4V15A 4AF0A 3RN6A 3FLUA 1J10A 2FB2A 2AKZA 1VIWA 4TV6A 2WWCA 1NDZA 1XBYA 2VEIA 3ARYA 1CLXA 2VELA 3M07A 5LA0A 3SM0A 3UETA 1G5AA 1CECA 5ABGA 4OTKA 4C6PA 3CAKA 3CUHA 3GDTA 1F3EA 3S9ZA 1TTIA 3E5PA 5E0CA 3VABA 1TR1A 3QW4B 1J12A 1A5UA 3KOZA 1QHOA 1TQXA 2GWNA 3AUOA 4S3BA 1QI4A 4QE5A 3TNOA 3CAWA 1KTBA 5C9UA 2E8ZA 1B57A 1GOIA 4LPCA 4XAZA 1T41A 3NQVA 4X9YA 3M0JA 4N9CA 1H1NA 3L8KA 3ARUA 1S2UA 3NJ3A 5PTDA 2R94A 3EPMA 2UBPC 2GPTA 2W66A 4XBSA 4Q8QA 3MHUA 5LHEA 3K8MA 4K39A 1GRFA 4G1KA 1Z9AA 3DGZA 1VFLA 2YLLA 3VMNA 3S2MA 4PBGA 3NNTA 1I60A 1WKEA 2G8ZA 4AZGA 3U7BA 3LPGA 4YTTA 3CAVA 3QLDA 3L4WA 1EBHA 2VCCA 1B3ZA 4H7VA 2WOVA 1HXJA 1D8WA 2CERA 2XFRA 1JCYA 1F5ZA 3ENLA 4DHGA 4QHRA 1KXHA 3DJGX 2GRTA 1R2TA 2OZTA 4CNOA 3IS4A 1OC7A 3NM1A 2AQVA 1YBQA 1TWDA 3AS2A 4MLRA 3BAYA 4DF2A 4M0XA 5D2VA 3HGSA 4OWGA 1EZWA 4GUGA 4D6DA 1VCVA 4B4FA 4IOTA 4D8AA 4OOUA 1N8IA 3UR5A 1JXJA 2R6OA 4LAMA 2W5FA 2I5IA 2VM8A 1QOPA 2C1IA 4IMCA 1TPVA 1Q63A 1DE5A 1G4EA 3CM4A 3FEQA 2DUXA 2FLIA 2EKGA 3K5XA 5AVHA 1HW6A 4H9ZA 4TIMA 4CQ8A 3I6TA 1ZX9A 1DIOA 4M51A 3II4A 1UD3A 4AY1A 2GGJA 2INZA 1DPMA 1ZAIA 5BW6A 3BJFA 4UFHA 4C7GA 3VD3A 4C5YA 1E4IA 1T6MA 4PE8A 4HA3A 1HKJA 1RSCA 2R1KA 4H4XA 4Y9OA 1U5HA 2CPUA 3LADA 2PLJA 1DJXA 1NDYA 4CVUA 5A94A 5BXPA 2YBTA 5A95A 1XLBA 1N2VA 3ARWA 3WUBA 4FLRA 1QBAA 3OIHA 4JNZA 3WQOA 4FALA 4I7VA 3MKVA 1YTEA 5EB8A 3NCOA 2Y5EA 1QHPA 1K4HA 4IX2A 1RH9A 1BVZA 4XQ6A 4P8XA 3CZLA 4JX4A 5I78A 1M68A 3LXAA 3BWWA 3WF3A 4DVOA 5HBFA 1V03A 2CKRA 3AIQA 2GVYA 5HDRA 3E38A 5REQA 1OFRA 3AYRA 3WDJA 3CMJA 2Q3OA 4MB3A 3O05A 3HIJA 1OT2A 1QW8A 2V63A 1NDWA 3BE7A 3RMEA 2PU1A 3CH0A 5DN1A 1XCXA 2R9ZA 1DXEA 5I7GA 3FGCB 2OZ3A 5I3FA 3NS1B 1U1HA 3LTYA 1GQKA 3AHYA 4ENLA 2W62A 4JTIA 3TJ4A 2IUZA 5TAOA 4DZAA 3GC2A 1Q6DA 4H4PA 2D2OA 3GIYA 4AIEA 1HKWA 5M5DA 1LWIA 2OO0A 5CPMA 4XO6A 2EPOA 4UTUA 3CBWA 3PPFA 4U2ZA 3WUFA 1XXXA 1MOKA 4DQWA 4ATLA 2CLHA 2ABAA 4WCJA 3RITA 2D73A 2GK1A 3HG5A 4PBEA 4XZBA 4AVNA 4DAIA 2PCEA 2DP3A 2DW7A 2QIIA 4O4VA 2FHCA 1L6GA 8A3HA 3VE7A 3D6NA 4GZ7A 3VDCA 3VD9A 2WPFA 3H24A 5KZDA 1W9XA 4N9BA 3IVTA 2VEFA 1OVDA 8RUCA 4BQ3A 2I57A 3T6CA 7CGTA 4DNHA 4R7WA 3UG4A 3VNKA 1E9YB 1OGGA 2A2IA 4GZEA 1B4KA 5EMJA 5AC8A 3PF3A 1R2RA 4HNTA 2WANA 4IP4A 3QSTA 3BPWA 5BXTA 4J3VA 2WWDA 1EFZA 1E6QM 3G1VA 4NXKA 3MY9A 3TTEA 1KFEA 4EXAA 5HWMA 3BSMA 1JZ4A 1HL8A 2HRWA 2X30A 1E73M 1EIXA 2JBMA 4B3ZA 1YQZA 5H8UA 4O28A 2YL6A 4RPQA 3W22A 2WNNA 3D46A 3WLOA 3PZIA 4GYKA 1QMLA 4RXGA 3EDKA 2VNCA 1R3YA 3HBLA 3WH6A 4MVAA 2QMJA 2VVSA 4O18A 1NWSA 2BBFA 4MIMA 1QPQA 3EPNA 4RW5A 3EX4A 2VR5A 3VD7A 4HD5A 5LXEA 1UH3A 1S3TC 1UKSA 1QI2A 1W3KA 3LI1A 1X96A 1ZMDA 2WVVB 5IHRA 2JQXA 4DEFA 4EAYA 1E9ZB 2VDIA 2WCAA 1LPFA 3IACA 1FA2A 4OBRA 3H2AA 6A3HA 4H9TA 1E0UA 3MSDA 3G1XA 4HHLA 3B05A 4MKVA 1D7KA 3H21A 3WNOA 5BRQA 1J0HA 2Y70A 3BMXA 2Q8XA 3VNJA 5EFDA 3DBNA 2X50A 2PWDA 1J8VA 2FHBA 1SM9A 4EWJA 2V5BA 1MW0A 1GGOA 4TVYA 4EXBA 3PBGA 2OFJA 3FVDA 2VRKA 5FJIA 4Y9NA 1I0DA 3PJXA 3NIYA 3NVWB 5C5YA 2PDJA 1RALA 1GXFA 3EMQA 4W89A 3PG8A 4AC1X 4JL1A 3R12A 4N9EA 3WQPA 3I10A 8XIMA 2CHRA 2FFCA 4PTWA 2XN1A 4DWSB 1S2WA 4MNMA 2YCJA 5IHSA 3IJ7A 2QJHA 5AB3A 3AC0A 3B4UA 4DZ5A 3DH9A 2YQUA 2JIEA 4J3SA 4ZOHB 3W9ZA 1EBGA 2ZX8A 1G0CA 4JFTA 3GBDA 3TE9A 4B4HA 1VBGA 3ABRA 5SWUA 3N1AA 3CMFA 2PU0A 2JIWA 4LYKA 2G5WA 1SFTA 1XG4A 4HZ8A 4K8EA 1KM6A 2F6UA 4JKMA 3PBWA 2Y85A 1NIUA 3OP2A 4QQUA 3TQKA 1H7XA 3MW7A 1M01A 3U0HA 4QJ3B 2ZUSA 4K7ZA 3TONA 4O4WA 3K1DA 3UZXA 3V18A 3IEBA 3H23A 3RCYA 4A21A 3K2GA 5HOSA 1GZJA 2PFHA 2WVTA 4XD3A 5ABFB 4DUOA 2DGAA 4CNPA 1MXSA 5J04A 3WQVA 1B0IA 1IXPA 2ALDA 4MWAA 5FEZA 7A3HA 2VL4A 2A7NA 1J11A 2CYGA 5BXRA 3TYZA 3WLPA 4DF0A 4HU0A 5G2WA 1TVLA 3AZRA 5KVHA 2I7GA 3RMJA 1R3TA 4H7ZA 3GU1A 3FS2A 3I6RA 1Q8AA 5CGTA 3EOEA 3WX7A 3WMCA 3AMDA 3N2CA 2PDYA 1SVDA 4PYSA 1ELSA 1M7XA 1YE4A 5DBUA 3TFCA 1IGSA 3KOWA 3O1NA 2XGZA 2OSYA 4U28A 4NL1A 4IPIA 4WSKA 3FJNA 4GABA 1XRFA 1F8WA 3NQ8A 4KEZA 4A2SA 4AISA