2HZGA

Crystal structure of predicted mandelate racemase from rhodobacter sphaeroides
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
393
structure length
393
Chain Sequence
SLKIDAVDLFYLSMPEVTDAADGSQDALLVRVAAGGHIGWGECEAAPLPSIAAFVCPKSHGVCRPVSDSVLGQRLDGPDDIARIAALVGYNSMDLLQAPHMLSGIEMALWDLLGRRLSAPAWALLGYSASHGKRPYASLLFGDTPQETLERARAARRDGFAAVKFGWGPIGRGTVAADADQIMAAREGLGPDGDLMVDVGQIFGEDVEAAAARLPTLDAAGVLWLEEPFDAGALAAHAALAGRGARVRIAGGEAAHNFHMAQHLMDYGRIGFIQIDCGRIGGLGPAKRVADAAQARGITYVNHTFTSHLALSASLQPFAGLEADRICEYPAAPQQLALDITGDHIRPDAEGLIRAPEAPGLGLQVAASALRRYLVETEIRIGGQLIYRTPQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of predicted Mandelate racemase from Rhodobacter sphaeroides
rcsb
source organism Rhodobacter sphaeroides
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme/Enolase super
total genus 134
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2hzgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2hzgA01
4J1OA 4MMWA 1SJCA 3BOXA 3FVDA 4HPNA 2QJNA 3T9PA 2PTYA 3CXOA 2OZTA 1EBHA 4GGBA 7ENLA 3DG7A 3UCCA 2OZ8A 2GGIA 3R10A 2DW6A 4HN8A 3HPFA 3R0UA 4HNCA 3K1GA 3DFHA 3FV9A 3I4KA 3TJIA 2P3ZA 4HCHA 3QLDA 3P3BA 3CAWA 5BOFA 2HXUA 2PCEA 2P8CA 4IZGA 2FKPA 3R11A 4E4FA 2GDQA 5FJUA 2PP1A 1L8PA 3IJQA 2QJMA 3JZUA 1PDZA 3THUA 1R6WA 3ZVHA 3RITA 4H19A 5FJPA 3DERA 3PK7A 3DGBA 1KCZA 3QPEA 4GISA 3PWGA 2OX4A 2PTWA 3DIPA 2OLAA 1DTNA 1XS2A 2ZADA 3UJ2A 1EC8A 2CHRA 2PU0A 1JDFA 3S5SA 3P93A 3OW1A 3H12A 2MNRA 3V5FA 1MDLA 3TQPA 6ENLA 3SSZA 3MY9A 4GYPC 3IJLA 2XH2A 1ECQA 3ES7A 3S47A 4IP4A 3U4FA 2PTZA 3OZMA 3GY1A 3QKEA 4E5TA 3T4WA 1KKRA 1EC7A 4JN7A 2GSHA 2PU1A 1TKKA 3PFRA 3V5CA 2FYMA 4DHGA 2GL5A 2RDXA 4GMEA 4G7FA 3RCYA 3TJ4A 4H2HA 2HNEA 3RGTA 3VCNA 1ONEA 5ENLA 3CYJA 2PTXA 1XPYA 2MUCA 3TWAA 4K1WA 3U9IA 3VFCA 3KUMA 3VC5A 4HCLA 4FI4A 3GO2A 2AL1A 3FCPA 4E6MA 4FP1A 4H83A 2QDDA 3DG6A 3DEQA 4KEMA 4GFIA 1EC9A 4A6GA 4HYRA 2OG9A 3VDGA 3N4EA 3OZYA 3ES8A 4IHCA 4F4RA 2PPGA 4JN8A 4DN1A 2PGEA 1EBGA 4IP5A 3ENLA 3Q45A 1SJBA 3NXLA 1W6TA 2P8BA 3NO1A 3ZLFA 3VA8A 4DYEA 2GGJA 3I6EA 1BQGA 3JW7A 1NELA 4EWJA 2QGYA 2QDEA 3CK5A 3FXGA 5J04A 2PP0A 1ELSA 3DFYA 3BJSA 3DDMA 4G8TA 3MSYA 3DESA 1OEPA 3RR1A 5FJRA 1MNSA 1MDRA 3B97A 2QQ6A 5FJTA 3IJIA 3PWIA 1YEYA 3TW9A 2POZA 4DX3A 4MKSA 3QN3A 2P88A 3NFUA 2OKTA 2OQHA 3UCDA 3GD6A 4HCDA 4YWSA 1WUEA 2XH7A 3H8AA 3MUCA 3MWCA 2P0IA 3TOYA 3R1ZA 5FJOA 4K8GA 2HZGA 4J3ZA 3H70A 1P43A 2XH4A 1R0MA 3FJ4A 4A3RA 3BSMA 1JCTA 2XSXA 1TZZA 2HXTA 3ZLGA 4IT1A 2PA6A 4JHMA 4ROPA 3ZLHA 4GGHA 2O56A 3N4FA 4ZCWA 3UJEA 1WUFA 4H1ZA 3T6CA 3UJFA 3SN4A 1P48A 4IL2A 3TTEA 4KT2A 1IYXA 3V4BA 4ZA0A 4M0XA 4GIRA 2OQYA 4M6UA 2I5QA 4GYPA 1KD0A 3MKCA 1JPMA 4X2PA 2GGEA 1MRAA 3D47A 3SBFA 1E9IA 3R0KA 2XH0A 3EEZA 4K2SA 2PODA 3ZVIA 4Z1YA 2DW7A 5IDZA 4ENLA 3D46A 2GGHA 3SN0A 4E8GA 3FYYA 3UXLA 4IL0A 3JVAA 1NU5A 2QJJA 1SJDA 2OO6A 3SJNA 3MQTA 3N6HA 3OP2A 3UXKA 4KPLA 3STPA 4DWDA 3GC2A 3V3WA 2AL2B 2ZC8A 2OZ3A 3DG3A 1FHUA 1FHVA 4A35A 3CB3A 3CT2A 3R25A 3TWBA 3SN1A 2OVLA 1F9CA 4HNLA 2AKMA 1RVKA 3Q4DA 3RO6A 2NQLA 2OPJA 2XGZA 4Z17A 2AKZA 3RRAA 5EU9A 1SJAA 3QTPA 2PSNA 5BOEA 1JPDX 3N6JA 3VC6A 3I6TA 3EKGA 3TCSA 3H7VA 3UJRA 2PMQA 3SQSA 4E4UA 2ONEA 3OTRA 2QVHA 1KKOA 3UJSA 2OFJA 1MUCA 3T8QA 2PP3A 2GGGA 3IK4A 1TE6A 2AL2A 2PGWA 3UGVA 4MGGA 3P0WA 1BKHA 4KWSA 3VCCA 3MZNA 1PDYA 3OPSA 4DXKA 3NZGA 2PS2A 3ZVHB
chains in the Genus database with same CATH superfamily
1O5RA 3ITYA 3BOXA 4QG6A 3VOIA 4TVUA 4JTFA 3LHYA 3FX4A 7ENLA 3DG7A 4ZOCA 3I3DA 4X0VA 3IV3A 5BXSA 2A85A 3LDVA 1F6PA 4LFYA 3VIFA 4ZE4A 2BS9A 4QG9A 2BV9A 2R82A 4MJMA 4ACZB 4S2BA 5CEWA 1DE6A 3BMWA 4H01A 4LH8A 1C93A 1NHRA 3URHA 4WF7A 3WBAA 4UTJA 5GJMA 4HOWA 3ZYZA 2ZRZA 2PDYA 3WK0A 2H9AB 4IQEA 2BVYA 3UESA 4AZ6A 2UY5A 3VMOA 3MHUA 4JXCA 3IS4A 4RZ4A 4DNHA 3NQVA 4DM2A 3UQNA 4B5XA 2CZ5A 4QIUA 3BARA 1R7OA 2J8TA 3L9CA 1UR0A 3M0XA 3AALA 4P7NA 2J77A 3GG1A 1TWIA 3CEUA 1ICSA 2C13A 3GHUA 3N9SA 3KLJA 4RNJA 2Y7EA 2BVDA 5EMJA 3PG6A 5JBEA 3QHMA 2V6OA 3QEZA 1IT0A 1E40A 1YQZA 1T6MA 4ML9A 1LRQA 4AFYA 2WOVA 4UTWC 1F7BA 3MUXA 3RCNA 1JEHA 3T4WA 3LK6A 1EEPA 3GLCA 2FYMA 1VFFA 5HNRA 1E4LA 1SU5A 3QFAA 3W2LA 1FWHC 2B31A 5LA2A 1P0NA 1DNCA 1W9UA 3OGVA 1NP0A 5A2AA 2HWGA 4AEFA 3C86A 4AHPA 2XISA 2DSWA 1XXXA 5G1TA 1XRSA 4AD4A 4H4TA 1GCYA 1JR1A 4Q8VA 4FMVA 4EQXA 4GJJA 4NXSA 4EMJA 1US3A 2PB1A 3RLHA 1PL9A 4GFIA 1ZJAA 3A6OA 4W5ZA 1X7FA 1AJ0A 1Q13A 5L6UA 1EYWA 4U2ZA 3W7GA 3U57A 3VAVA 5D4YA 1I2QA 2PUZA 4I5UA 1XYFA 1Y0EA 3MDUA 3I68A 3G1AA 3VIOA 4LXFA 5KTLA 4Z2HA 4IP5A 2F6UA 4D6JA 3CGBA 3NVZB 3LPFA 1TVNA 1I2OA 1ITCA 1F3WA 1MYRA 3HPZA 2NVAA 4LF2A 2X41A 1P6CA 1VH7A 1EWEA 3P84A 3UVAA 2GUYA 3FXGA 4GA8A 4APNA 1BVZA 3VFLA 4G8TA 1TA3B 3S3GA 4L64A 1ZP3A 4EACA 1Z42A 1JG9A 3M1ZA 3VD4A 3C2EA 4I9TA 1EH9A 3QC0A 1TV3A 5FJRA 4NSBA 1Q7MA 3PBYA 1JFHA 5AHIA 1DXEA 5FESA 4W8AA 4PMQA 4Z0JA 1EJWC 1OCJA 3H6OA 5CBJA 3TTQA 2OYLA 1VQZA 1XLGA 3HMJG 2W92A 3F2DA 5FAGA 3GRTA 4UB9A 4ORMA 2DIJA 4R3UA 1CLKA 2YDAA 3TV8A 1KM1A 2ZQ0A 4GRSA 1CW2A 3AYVA 1GG0A 4RDWA 2PDHA 4UTMA 1ITQA 4F9JA 4B9YA 5GQBA 1W9DM 1ME7A 3EWZA 1IWBA 3EA2A 2C7FA 4M6PA 4JIHA 3S2LA 4CQCA 4H1ZA 3C2FA 4YHGA 1GVQA 4NNAA 2WMGA 2Q3RA 4LGXA 2AMGA 1G4PA 2XN2A 4ACZA 3LI1A 4O28A 1LQ2A 3M0LA 4MAVA 1JI1A 1E9IA 1EIXA 1S38A 1OFAA 2PLMA 2W63A 3PTDA 1X2GA 4M52A 5HR7A 2JF6A 3KEHA 1BTCA 4BF7A 4Z1DA 5AYYA 5IDZA 4W88A 4G6CA 1B90A 5I79A 4PMXA 3QV6A 5AYIA 1KWGA 1X39A 4ZFCA 3XINA 3GC5A 3GG0A 3SCRA 4IQLA 2OX1A 4ES4A 3BGGA 1VBJA 5E6YA 3AXHA 4FO4A 2YXXA 6TAAA 1QFEA 1V6TA 3SDOA 4UNIA 3C5QA 4IJRA 2TRSA 1XDJA 1TPDA 3EXTA 3E2QA 3II1A 3BH4A 2ISFA 4ZOEA 3W1QA 4YTSA 1JULA 3LV5A 2JIEA 3NDZA 1TPB1 3A3WA 4IUGA 3RF9A 3W3OA 2IKIA 1KRCC 4Q4RA 3B0XA 2J25A 1VRDA 1DWGM 4PGLA 1J11A 3LXDA 4H4PA 1ONRA 1LQ0A 2NXGA 2QJIA 3FK4A 1P6WA 2Z2AA 3DECA 3GQYA 4C6NA 3CAVA 4OQVA 4RK8A 3H7VA 4RXFA 1OYAA 1EFZA 2EG6A 4D6CA 1FBAA 4JQ1A 5MF5A 3Q6JA 3T0BA 4OJYA 5BZAA 3U2ZA 1MXDA 3T07A 2BODX 5LGZA 4HU3A 4C6QA 1V59A 4BQ3A 4UQAA 3NZPA 2O4QA 1V6XA 3S5ZA 2Z1XA 3A7AA 1YE4A 1N8WA 2ISVA 4GOAA 4PUJA 4K38A 4O1BA 1DJXA 3CZEA 3MZNA 1GVFA 3UG8A 3VGFA 2NX1A 4PL1A 4GX9A 4AW7A 4OBRA 4QXIA 5ABGA 3C3NA 1R3SA 3PTMA 1NF0A 2A3CA 3TYEA 5A6SA 2WLYA 3APYA 1UR2A 4J35A 4WD0A 4UZSA 4X0NA 3WUBA 3KW3A 3WLMA 5AHLA 3Q94A 5JQ9A 3MMTA 2D3LA 2OODA 1JD9A 1L0PA 1TJ0A 4H4XA 2QV5A 3GDRA 2Z1BA 2DW6A 2YYUA 4HTYA 3FV9A 1V6YA 3I3EA 3LU2A 1ZL1A 4EQWA 1MQRA 3BLEA 4FF7A 2OSXA 1VLIA 4XZHA 3KL0A 5REQA 1WDQA 4NT0A 4O53A 3DGHA 1YADA 3UBPC 3W24A 3LOTA 2A3BA 2PZ0A 1AH3A 1SYTA 1IT8A 5M1TA 2YL5A 4G9PA 4PUEA 1OIFA 3ATZA 3GXDA 1E73M 1MEHA 4H19A 3R2GA 4P7LA 3RPMA 4EWND 4LALA 3VTRA 1H3GA 3IARA 4XD5A 3CZ8A 4CNUA 1X1OA 3VIHA 1HP5A 1XS2A 1MFVA 3DYOA 2WP5A 4QEHA 6CGTA 2REQA 4CNSA 2XINA 4DJFC 3WUEA 1N5WC 1C91A 4MB4A 3W7MA 4LYPA 2XSAA 3QW4B 4H00A 1ECQA 4NX5A 4TU1A 2PDKA 3U4FA 5E6ZA 1XISA 3A4XA 5G4EA 3V36A 3GVGA 4YVXA 2BGQA 1T40A 2E6DA 1EC7A 4HKPA 5HWJA 3PFRA 4M7SA 2QR6A 2OEMA 3RJXA 1GZGA 1QI5A 2IKJA 2X1RA 1D3GA 4I7WA 5JCLA 2Z1WA 4LA1A 1QU4A 2HNEA 4ONVA 2YLAA 3ZT6A 4DO6A 5C70A 1XGZA 2V6AA 1E0XA 3QR3A 2VDGA 2XVGA 3CYJA 2R1KA 4U10A 3UYCA 2VC7A 5B7ZA 1Y5XA 2X99A 1C3FA 3GO2A 1ODUA 3CQKA 5DT5A 4DAFA 4HNVA 2VGIA 5EA9A 5CPNA 1Y65A 1HL8A 3AIUA 1EB3A 3LD5A 1AFSA 8XIMA 3BZJA 4DO4A 4PEKA 1P4CA 2W79A 3OIXA 1HKMA 1FHLA 3DG6A 4N4QA 1XH2A 5CC6A 2P1FA 4QJ4B 2VX7A 3C56A 2E40A 4S38A 4TUFA 5HOSA 2O9RA 3DN5A 1G6CA 3VDGA 2NUXA 4GNJA 1FFUC 1E55A 4MYXA 4O8AA 4EIVA 3GNXA 1N63C 1V8EA 4GCAA 4LUYA 1AQMA 2Z1KA 1BVNP 1BWLA 1SR0A 4C6EA 3DCPA 4K36A 4MKNA 5D9NA 3POCA 3REQA 1X8CA 3SURA 2ZFAA 1NOUA 2NV2A 1X6LA 4NIRA 5EBAA 3MSYA 4D8AA 3DI0A 4K8EA 1BHGA 3WNNA 4NASA 2HMCA 4ZQNA 5HXMA 4KF1A 2YW3A 3B97A 2BWGA 2CBIA 3LI0A 4KRZA 2POZA 3CHCA 3RNDA 1UD4A 4IFRA 4IJBA 2OKTA 1H50A 3MP5A 1L6FA 3NM1A 4F8XA 3IJ8A 1F76A 3ANYA 3CWNA 4ZO7A 1CGUA 5HPCA 2P5NA 1K8YA 4OU1A 3TOYA 4ML4A 3BAIA 1OFRA 1R0MA 2Y5SA 2VR5A 3VIMA 2ZZ5A 1GGOA 3ZLGA 1P0EA 3A5VA 1BYCA 1GQLA 4XAYA 2VNCA 4DYJA 2V68A 4J3VA 4GINA 1Z32X 3R13A 3TTEA 1D2KA 2HISA 4LT9A 2X8RA 2AAAA 4OIFA 4PE8A 1K02A 3GR8A 3S1GA 5AYBA 3SSJA 1W3JA 4NVTA 1KD0A 3MKCA 1JPMA 2O7QA 4A8NA 1HG3A 3EEZA 3ZZ1A 3LXAA 4AX7A 1I8JA 4JTAA 2CZEA 2QZRA 1AL8A 1IEVA 1KC7A 1P7TB 4GVIA 1L6WA 4XVEA 1JGMA 2VEFA 1O5QA 1PBGA 4E8GA 5A95A 1SGJA 3DOPA 5E0CA 1AL7A 1IEXA 3MVIA 1EJ7L 3PC0A 5DQPA 1LOSA 3DC0A 3A21A 3II4A 2PLCA 3LCHA 1YBQB 2BGSA 3K46A 2HPMA 1WDRA 1LQAA 5CLWA 1V6VA 3OO2A 1JZ2A 2VDHA 1IIHA 1KV5A 1LORA 1OIMA 3RX4A 1V79A 4O1DA 1KBLA 1UR3M 2XN0A 2G4FA 4G2DA 3ZJ7A 3R25A 5CGMA 5CC7A 4J28A 4KCVA 4IISA 2B7OA 4AQLA 3TUUA 2BC1A 3CZKA 1LOLA 1GQJA 1YE6A 4B2DD 4OOZA 1QI4A 4TIMA 1KTCA 2BOFX 3EWUA 4IIGA 4S23A 3UU0A 4J40A 2Y62A 1JCYA 3TCSA 3KOZA 4GABA 4HYVA 2HS6A 2OEJA 3GIQA 1A5OC 4Q4SA 3D3AA 1NF7A 2FHBA 5E0FA 5F7UA 2VENA 2Z00A 3FYPA 3L0KA 5TF0A 2UV8G 4JIQA 3GXPA 3W00A 1UD3A 3NTYA 1JZ8A 1W8GA 2V3DA 4W86A 2J79A 1JZ4A 4CN1A 4Q8TA 1ZGDA 3BGJA 5G5HB 1PTGA 2WMJA 2EF9A 1O4UA 3MMWA 2I1OA 4JFUA 3L2MA 1XRVA 1NFPA 1F2JA 4O16A 2DSVA 2OXNA 3V0UA 1UBPC 1WBHA 3ITOA 4Q8PA 2Q8XA 4KEUA 4DJED 3FJLA 3FYOA 3GZAA 3AXXA 2VGBA 2YIHA 3GNOA 3NQDA 4O54A 3R5EA 2GGIA 3OEXA 3MP4A 1W5NA 2IPGA 1FWGC 3B0VC 1H7NA 2YBTA 4LVFA 2UZ9A 1JRBA 3N4AA 1UWUA 1W3KA 2BXZA 4HK7A 3H22A 3QLDA 3CAWA 3AN1A 4JX5A 3AHTA 1E3XA 5EB8A 3BG5A 2VR4A 3ERPA 3W83A 4RV3A 4MPQA 1ONFA 5CZ0A 3C2OA 5I3KA 1XC6A 2BX7A 5T91A 5CKSA 3H53A 4FA3A 5FEZA 3KCLA 2FPTA 3BK0A 4TQTA 3QYSA 3REQB 1V7YA 4OGZA 1DXLA 1US0A 2EEXA 1TMQA 3OBAA 1UC4A 2D23A 3LADA 3IK2A 4WCJA 4UQDA 3IANA 4IGNA 4RPQA 5M3WA 4UQEA 3ID7A 2A3LA 1V3IA 1JCXA 1MDLA 3I7QA 4JAWA 1Z48A 4MWAC 3L5OA 3V16A 3WLTA 4KIEA 4DNMA 2ZWZA 1RBAA 2EPOA 5E93A 2WMKA 4CN4A 3UF9A 3I3BA 4BHYA 2G3NA 1J01A 4INFA 2GR0A 3O0FA 4X60A 4U5KA 1TKKA 2ADAA 2V5KA 4MUZA 5DEZA 4PMOA 3H2OA 2VFEA 4RDYA 2DQWA 1AQ0A 1EHNA 1E56A 3PY2A 2OO0A 3QF0A 1JZ6A 2B7PA 4LNCA 4CN6A 4BWLC 5ENLA 5EYWA 4IQDA 2CNCA 3KUMA 1SW7A 1G4TA 1V4YA 1Z69A 4U33A 1ML1A 1GYMA 1WXYA 4ZO8A 4YXGA 1OQFA 3FIGA 1OF8A 3WQDA 4IMEA 4KEMA 4AVOA 1TTPA 4YCOA 2WPCA 5A8NA 1PSCA 3M0VA 1F8MA 4UMCA 1RVGA 2GOKA 1UR9A 3O9NA 3SUUA 2ZICA 1N62C 4JY9A 1SJBA 5HANA 4DM1A 2GRTA 2XN1A 4IPPA 4JIIX 2PDBA 4XAFA 4HMEA 1HXJA 4DB7A 3G1DA 5AC7A 2ATMA 1UWTA 4REQB 1TSIA 1T3QC 1HKIA 2G3MA 1IXQA 2J7FA 3WMLA 4S3CA 4I3GA 4O8RA 5K2ZA 3GG8A 2VC6A 1QO5A 3WBWA 1SFLA 2OOGA 3CV7A 4CU6A 1PPIA 4AY7A 5D09A 2XHYA 1LRTA 2BXYA 1UWQA 3QN3A 1JF6A 1VP5A 1AW1A 2QT3A 3E0IA 3NFUA 4Q8OA 2D1ZA 1W2VA 3CO8A 4UOQA 3Q58A 1W3LA 1C8QA 3TN3A 3NZRA 1W9XA 1K70A 3WQ8A 4NI3A 4H4YA 4ZB2A 4Z2JA 2QDHA 4JTDA 4LEQA 1NOFA 1P43A 2NWRA 3UG5A 3T7VA 2XYLA 4GJ1A 2A3AA 1YKWA 4PTMA 1ZMDA 2NQZA 5JH2A 4XKYB 1S2WA 3E2RA 3IVTA 1ITXA 4IT1A 1EP1A 1QATA 1A0DA 4GYFA 1OY0A 3MSGA 3LHUA 4J5NA 2C18A 3GB6A 3GRIA 4EMWA 1JYVA 1LWIA 1ZJBA 5GPRA 5IOBA 1AK5A 1BRLA 1JROA 3B8UA 1QBAA 2X1TA 1DWFM 4UFMA 3BGAA 1YNYA 3B0UX 3WH8A 4EF9A 5A1AA 3CH9A 4O1FA 1TO3A 4MFDA 4RZBA 1ZBWA 3S2MA 4EM4A 2W91A 3T0CA 1SW0A 4RXGA 2ZRXA 4AVFA 4LQ1A 1VYSX 1JNEA 3GUWA 1F73A 3M0HA 2JK2A 5GNXA 3GM8A 1DWHM 4LY4A 3CMFA 2W27A 5EFFA 3SQLA 4R7WA 4DBEA 5KMYA 1VFTA 4YU1A 4ZB0A 4QISA 3UVIA 1R86A 1YYAA 2ZYFA 3UXDA 3W87A 1YNPA 1ZAHA 3CQIA 2XIMA 3N9KA 5CGTA 2VVSA 1MW2A 1G0CA 3BLIA 1ZBVA 4H6RA 3L21A 2VGFA 4RNHA 1NU5A 3S1XA 3BANA 5DCBA 1J9YA 1VRXA 4JHOA 1C29A 1W31A 3F4CA 3KOYA 3UXKA 3KS6A 3VO0A 2ZX8A 1R38A 2YCIX 2Z7KA 4LAKA 3RAOA 3C61A 3S46A 3NPXA 3KZPA 1PKYA 3KTXA 5ABFB 1FHVA 1B9ZA 4Q4OA 3E0FA 3UA3A 1V51A 3ARUA 4IIFA 3HGJA 2D22A 2OSWA 3SGZA 5ABHA 4PUDA 5CPMA 5DY2A 4PCPA 1XYBA 4JNZA 4GI9A 1KGWA 4PMNA 2XGZA 2AKZA 1KM5A 4HB7A 2PI6A 4EAMA 3WJZA 4L4LA 4G1NA 5JIWA 1VS1A 4Y2WA 3IJ9A 3TW7A 5I07A 3DKJA 4RUBA 1G7UA 4WDUA 2RKXA 3BJTA 1WNOA 4HMDA 4U5IA 1XYMA 4LBSA 5FIPA 4A2SA 1RP8A 3VD3A 2A3HA 1NWTA 1GNXA 5F4XA 1FA2A 3QV8A 3NO5A 2QCNA 2PDCA 3F2BA 1XSKA 5FF4A 3GDBA 4N9CA 4REQA 4YHEA 1BKHA 1YPXA 3DH7A 4U28A 3QGAC 4PUUA 4KW2A 2CDUA 4H04A 2REQB 3BAJA 2WM0A 1J6OA 4XG1A 3CHEA 2OYKA 1X6UA 3OU8A 1Q6OA 3P62A 5D8WA 2R1NA 3KOXA 4HPNA 2QJNA 1TR9A 5DANA 4QJ5B 3GBDA 3WNLA 2BSLA 2VFGA 1TWWA 3DXIA 3R10A 2IPWA 1WP6A 3WH5A 1UIOA 3IUIA 1XRTA 1JCMP 4K7VA 4HNCA 2CW6A 1AD1A 1R87A 3I4KA 4C6LA 4P7RA 3WDJA 3TOPA 1XANA 4ATDA 2J6XA 1BG4A 2QKFA 2WVUA 1QW7A 3IGXA 3W26A 5G1MA 1ZMCA 5D05A 4GUFA 1IXOA 3WDRA 2NXIA 2FFCA 3EOSA 2P8CA 4IZGA 1H4PA 3HIJA 1QASA 1XIIA 4HSNA 1DJGA 1EOKA 3RIKA 3IJQA 2J8GA 3L8KA 8TIMA 2PWUA 1K4HA 2QF7A 3PG8A 5HMEA 1L6GA 3CPGA 4UMBA 4DJDA 2WPFA 1XD0A 3DK8A 5D2TA 1ADSA 3PB2A 4QSHA 1JZ7A 3W7RA 2PBOA 3CV1A 3IGUA 3Q65A 4S3DA 1HJUA 3H12A 2G4JA 3V5FA 4RDZA 4Z2GA 4L9YA 1Q6LA 2TAAA 3QC3A 3IJLA 4LYKA 1GOQA 2G3FA 1D3CA 3GE7A 3W37A 5A6AA 4TVDA 2CITA 1AODA 1GQKA 2EJAA 1LL7A 2QS8A 3M16A 3KS5A 3TW6A 5CZJA 3ETRB 2BY2A 4FHAA 2ZTKA 3B4YA 2W9MA 2GJLA 4YLWA 4AXKA 7TIMA 5AYZA 3W81A 5G4WA 1KM6A 1J6PA 2E9BA 1ME9A 3WUGA 1ZJHA 3WFZA 1BQCA 3CUFA 3MSRA 4DUXA 1W91A 2VJXA 4HCLA 4D8ZA 1XIMA 1RSCA 2DT3A 4MZ1A 3G1SA 4F0LA 3E1F1 4N6FA 3SUVA 3DEQA 2BP1A 3CUIA 1S5MA 3UZYA 1HL9A 4MB5A 3I6RA 3G18A 2CXEA 3WJSA 3PBUA 3O1NA 4MIMA 4IHCA 1RBLA 3ZT5A 1I45A 2PPGA 3LLXA 2Q01A 4GKLA 4MVAA 1FQ0A 3UW6A 1FWAC 2E5CA 2E3TA 5EMKA 5H8MA 4FK9A 1PZ2A 1XIHA 1ZHAA 5BWFA 2WJEA 1NELA 4W7WA 1T96A 4CNPA 3TKFA 2GR1A 3GKAA 1XG3A 5TD4A 1RCXB 3ANVA 5HMDA 4O1EA 1P6BA 2DVXA 1WBJA 1H11A 4PFHA 4L65A 2BNJA 1U30A 2R9RA 2CLIA 4NU7A 1GQIA 3PWIA 4Z1CA 4I9JA 1O6IA 4XQ6A 2BHUA 3F4VA 2ZXAA 5AKQA 3W07A 4GQQA 4W8LA 3B04A 3QGVA 2F2HA 4YWSA 4E2BA 1NTHA 3CZJA 1JDDA 1QUMA 1IZJA 5TIMA 2EKCA 5I09A 4G1KA 3KVMA 1GYLA 2HXTA 3U2EA 1F4HA 3DHPA 5A6BD 4ZTYA 1HKJA 3GZ3A 4CVWA 1HGWA 3OIHA 2QCDB 3S6DA 4GGHA 2QUVA 5C5YA 3N4FA 5FAJA 1WUFA 4PUNA 3GTIA 4XTIA 2J7DA 5IBXA 1WCGA 4IIDA 4FZIA 2JQXA 2Z25A 4ZA0A 4M0XA 1A80A 1T99A 2OKOA 4US5D 5DO8A 1LDCA 1Y7VA 1R3RA 1ZKQA 1OX6A 3CEPA 1FCVA 2FIQA 3TC6A 3EMQA 4UQBA 2GGEA 2W61A 3N13A 1C8YA 4J9JA 1OJXA 1TPWA 4JKLA 2GQ3A 2PODA 1C8VA 3M0MA 4H8UA 4UTIA 1UUOA 1WXJA 2DW7A 1OK6A 1PHQA 3GFYA 3B8SA 4C6MA 4B5VA 3O0KA 3CIXA 2HK0A 3G1RA 1B3OA 3AQUA 3C8FA 3MC5A 1QPOA 1XLIA 3G1YA 3FLUA 4TOQA 1H1ZA 5B7YA 3ZSSA 2OO6A 4MY9A 2AL2B 4GKTA 2W0HA 3ARQA 4CU7A 5GRTA 3L65A 3SN1A 3EGJA 2OVLA 3PZGA 4AISA 1DV7A 1FFRA 2AKMA 4DBDA 2GVYA 1LRNA 1EJVC 4UUIA 5EL1A 5KETA 5IHRA 1VJIA 3EDKA 1W1A1 3O6AA 4F0KA 2X09A 1XLAA 3A4WA 4GNKB 1U5VA 4QNEA 2O92A 4MNMA 1XM3A 2V9DA 1GRGA 3W7OA 2YAUA 5D04C 2PSNA 3O3RA 3KOWA 4KFPA 2DJLA 3N04A 3EX3A 1VB9A 1FP9A 5ECUA 1G4EA 3E2VA 4L4OA 5I2UA 4CQAA 2E9LA 3V5OA 1QI0A 1AOGA 1V0MA 3PR2A 3WDIA 4L4PA 2OFJA 4A05A 7REQB 3WLOA 2JGYA 3NPVA 3N2MA 2V3AA 3O6DA 4IXXA 4MDPA 4NY2A 3VILA 1KB3A 2E3ZA 3VOFA 4HSOA 1EJSC 3UGVA 5EKYA 1Q2RA 3P0WA 3HQOA 3VCCA 3SRKA 3EMCA 1IEQA 3UWYA 3WO8A 3LCIA 2BG5A 4M29A 4DXKA 2C0HA 2E67A 3PNZA 5JCMA 3MP3A 1OYCA 3W6YA 3A9BA 5JCIA 5DRIA 3QZ6A 4HPGA 4LW7A 1S46A 2Q8ZA 2YXOA 5FMHA 2PDNA 2CLEA 4IMDA 4IQJA 4Y9OA 5JBFA 3HOJA 2QIWA 3NOYA 4YS1A 4KBXA 2YL8A 3NEHA 3B9EA 1XV8A 3N2XA 4LX4A 2NXHA 3W29A 3A4JA 5HNNA 1W2PA 4DI8A 3WL0A 4ZQOA 2WLZA 3A24A 1JAKA 1CYGA 1XLJA 3OZOA 3VK5A 1RH9A 4O19A 2KZHA 3ARWA 4OBTA 3VM7A 3DK4A 2WC3A 4PA8A 2NV1A 3IAQA 2FKPA 3E2SA 5FJUA 2PRMA 3L0NA 3ABQA 2PP1A 3U7VA 4CKQA 1RJPA 3D5HA 2NVDA 1XSIA 3JZEA 2Z26A 1JNDA 3W1XA 4C6KA 4HZ8A 3E3HA 3GKFA 2Q71A 3LGEA 1ISVA 3QQ0A 3KVLA 2GDUA 2ZXQA 2EAWA 3FAWA 1QDSA 4AD0A 5I02A 3PWGA 2JKAA 3PUDA 5G5IA 1FCBA 1UD2A 1JIBA 1DTNA 1HKKA 1GT8A 4ZTXA 1O5XA 4GQGA 4C6FA 1GRTA 4GUHA 1OCQA 2YKKA 1GOKA 1WDDA 1OT1A 4JDBA 3VDAA 1OB0A 2DZAA 5BWAA 1MO9A 4GQBA 1NSJA 3PB0A 4FLQA 4KRTA 5BRBA 4KFNA 3S47A 3QFWA 3P6LA 2R8WA 4TX9A 1HTIA 2X42A 5FJJA 3PJTA 4FNQA 4K68A 3M6DA 3E5PA 3EB3A 2F2KA 2FPVA 5DT7A 1F6KA 5KZDA 3O7UA 1M7XA 2V5JA 3LB8A 2HE5A 2YDQA 3TJ4A 1W17A 1XJBA 2X05A 3RGTA 2BBFA 2Q09A 3SRDA 3BLFA 4BI7A 2J9YA 4GE8A 3RUBL 4WSHA 4FNUA 4GIEA 3ZQ9A 1JDCA 4BWLA 1FECA 1QI3A 3GSMA 4RNIA 4C6JA 2QCHA 4C7GA 2DZUA 2WNZA 4FI4A 4ACYA 2GDVA 2VWSA 3UGRA 1E1CB 3W1AA 3ABSA 2ZRVA 1R5YA 1V03A 3D0CA 4AF0B 3M4HA 2GOUA 1EZWA 1R85A 4IICA 2YSWA 2W3SA 1Q4NX 2VDIA 3KDNA 4XZ9A 1E0UA 4A6GA 3C0JA 5C7VA 1XR2A 1RQEA 3EMZA 2TPSA 3FEQA 1ECEA 1OCNA 3W28A 2B0MA 3U8GA 2J4GA 4AVNA 1OJTA 1EBGA 4IPIA 5DFAA 1UCWA 1Q6DA 1LM1A 3SIMA 4BCEA 3QJAA 1W6TA 1WZLA 3BW3A 1XQLA 4LEFA 4I9MA 5KZMA 4GRTA 1JXJA 4GXPA 5E70A 5I3DA 4CQBA 2QGYA 3CAQA 4H9MA 3P2VA 3SGUA 1TYPA 4M3PA 1M5WA 3LCWA 4JYEA 1O5KA 5D30A 1CLVA 2PP0A 2Y8UA 3DFYA 2IXVA 3NVDA 1HO1A 3ABOA 3UETA 1ZLPA 4UTHA 1DXIA 1VFSA 3STEA 1M41A 1R7AA 1QPNA 1HT6A 2DH3A 4LYRA 5FJTA 3S9YA 4H4QA 3TW9A 1B3YA 3GVVA 1A5LC 2F7FA 2DIKA 4AUBA 4MKSA 3O6CA 1X8FA 3GYEA 2GJRA 4LCRA 1J8VA 4OVXA 1W8SA 4N9EA 1L6YA 5E9AA 4K8GA 2UY4A 4AYGA 4EP8C 1VQTA 1L2UA 5HINA 1JCTA 3RILA 1TZZA 2FGLA 4H9YA 4FALA 3TEVA 4OUIA 1UWAA 1NPXA 2CFYA 5HBFA 5DRCA 3ELFA 3TYZA 8RUCA 3PWAA 4ROPA 5J5RA 1P5BA 1UQZA 1V6UA 1BVWA 1LL4A 3UJFA 3F4WA 4I5RA 4IMCA 4K1GA 3BDKA 1KM4A 5KVHA 4J3XA 1QHOA 1KFCA 1IHIA 4GZEA 4GK8A 3V7PA 3S42A 4GIRA 4E8DA 1QNQA 1DIKA 5G1YA 2PD5A 4HNOA 4WK9A 4I8YA 4X2PA 3D47A 2INZA 3S2NA 1PAMA 3MBDA 4FF5A 2CWNA 1XX1A 3BG3A 4K2SA 4RE2A 4TTUA 4G5DA 1WO2A 4LPCA 3UERA 3A5FA 3VNDA 3GXFA 1W9VA 4Z0SA 5BXTA 3M9YA 3WD1A 2FGBA 3T4CA 4C6PA 3TDFA 3AXKA 5A2BA 1Q6QA 2ALRA 4WSKA 3PVFA 1CXEA 1D8WA 1LUCA 3TVAA 1DL3A 1CBGA 4HNTA 4MY1A 1D7KA 1GW9A 3AMLA 2P76A 1E6RA 2NWSA 2FMNA 3NYZA 4QQ3A 4V28A 5C2GA 1UWSA 1HNYA 3LRLA 4AAJA 3EDJA 4M7TA 4D2JA 3CASA 3GAYA 2R24A 4WIWA 1XLCA 4AZCB 3DJJA 4A3HA 1R3VA 4OUEA 1N2VA 2WNQA 4M1BA 1A0CA 4B90A 4M82A 1EGZA 1W1PA 4P5UA 1OX4A 1M6JA 1S2UA 2XSBA 3L4VA 1XBXA 2EPLX 5EMUA 5CAKA 4XBJA 1QOXA 1Z89A 1WA3A 1XINA 5CBBA 3H23A 1QJWA 3NZ1A 3QSTA 1WOBA 3RX2A 3IK4A 4CUCA 3KRSA 2W67A 1P1MA 1AD4A 1RV8A 5BRQA 5C9UA 1OCBA 1SR9A 4WRHA 2HRWA 5C7HA 1OABA 3EKZA 3BG9A 1YNQA 4AWTA 3STGA 5BMWA 1W0MA 3FVDA 1ZNNA 3MVTA 5DXYA 3R94A 1REQA 1TV8A 4XWUA 3IJ6A 3GIYA 3F7JA 4G7EA 3S4TA 4QQUA 3W73A 1W9BM 3WLJA 1DJZA 1KCKA 5BXPA 4F0SA 1LOQA 1G94A 4JIPA 4R9XA 4JHZA 3AIQA 1O1HA 3LBOA 3HPFA 2V3EA 1TJRA 1FFQA 2ON3A 3DFHA 1XLBA 3CU2A 4HZMA 4AHOA 3VKBA 2YCEA 3W7LA 1XIJA 2ESCA 1MI3A 1Q6CA 3L5LA 2HXUA 1WKEA 4Z2LA 3COTA 3DU0A 3TR2A 4HPJA 3RO8A 4HZ6A 4QDWA 1BYBA 3WNKA 1M1BA 3JZUA 3RG6A 4H4VA 4XKYA 2I9UA 2EPMX 2H6RA 3PSVA 3W88A 2O55A 3KHDA 5HK4A 3N14A 1ZXIC 4FNPA 3RU6A 2JK6A 4N2YA 4O0KA 2OLAA 4AMAA 1EC8A 3GVWA 5M2FX 1JDFA 2EQDA 3NQ6A 2FDMA 1XH0A 1TUXA 3CHFA 1LWHA 1RCOB 3GD4A 1LYXA 4WVXA 3QMTA 4MNLA 3P81A 3N15A 3MY9A 3E5BA 4GVGA 2XH2A 2DFAA 1E71M 1NDZA 3O07A 1UUMA 5AC5A 3M43A 4HPXA 1LROA 4GUGA 3VNLA 4AWUA 2WK2A 1HIZA 1E51A 2VCBA 4JCMA 1W1TA 5JBDA 3HJEA 4EAYA 1GORA 5CSSA 4JL2A 1KKRA 1FKXA 2GWNA 4GMEA 2XPKA 1M7JA 1UPMB 1JYXA 3VGDA 1FTXA 2PDJA 3DAQA 3BPWA 1UZ4A 4A3QA 4YYFA 4C1NB 2PWHA 4DZAA 7REQA 1FDJA 1P0DA 3GNDA 2CKRA 2VZUA 4W8BA 2DU2A 1NQKA 3XISA 1QPRA 2FJKA 3AISA 4HU8A 5CJMA 5BNKA 4JX6A 4L6DA 1J0YA 3FS2A 1E6NA 2NPXA 3AJXA 3CT7A 1E9ZB 5HNUA 5CSYA 2ZUTA 3WF2A 3CQHA 4RLIA 2R94A 4I90A 1C7SA 3P60A 3OZYA 2ZE0A 1EPVA 4HN4A 3MTWA 1JPIA 4AX6A 3GXIA 3S5OA 2XWEA 4GI6A 1ZK7A 3NXLA 1U1JA 3GH4A 2VTFA 4GYKA 1OYBA 2Z6IA 5GJNA 4MWAA 4AWSA 5A8GA 4L56A 2WHMA 2ZUSA 3WSUA 1TQJA 3QV9A 2IMRA 2ZZ3A 1H41A 1G4SA 5XINA 1LPFA 1CIUA 2NZLA 3E74A 4H9UA 4IMAA 1DQWA 2ZUWA 3EKLA 3SY8A 4Q4QA 5AHFA 5AB3A 1SO5A 2VHLA 3FFSA 1LLWA 3AHXA 3NVVB 1UZHA 4IH3A 3WBEA 1GYNA 4ICCX 4GLEA 1G5AA 2G3JA 1SB3B 2I16A 2CZDA 1W56A 1DWAM 4PB5A 2JEPA 3VNZA 3WJXA 1EX5A 1N82A 1KM0A 2CLFA 3FGCA 3MPGA 4N6EA 2W4XA 3HA1A 5I3FA 4NYUA 2Z24A 4FXJA 1NDYA 4E3TA 1TG7A 4DUWA 1WOAA 2RGMA 3H26A 4Z2KA 4LJ3A 2JIWA 4N02A 1CGVA 1I2RA 1MFUA 2INEA 2WHLA 3EX1A 3M0JA 1B3VA 3ITVA 3VMPA 4D6GA 4JOMA 3PUGA 1DHPA 3OZPA 4QM1A 3UR2A 1K9FA 3IGHX 1QXLA 6XIAA 4FOJA 1PEZA 2NX3A 2Z2BA 2XVNA 2PF8A 3QHNA 3NVWB 4HK5A 4LF1A 1UWIA 3PPCA 3WD4A 3RFAA 4BI6A 3W1RA 1A4LA 1OD0A 3W01A 3SECA 4GY7A 3ABRA 4LSBA 3TR9A 3T09A 4XUYA 1PX8A 1V7AA 3P67A 3TYDA 3WELA 9XIAA 3PJWA 5FF2A 1CI1A 3HQ1A 3RLGA 4AD5A 3MW7A 4ICMA 5A94A 5AHNA 1YXDA 1CGWA 3WLSA 1DQXA 2GQ9A 2ZDSA 1EXPA 2D0HA 1DJIA 4DPPA 1SJDA 1H0GA 4MOZA 1KCXA 2OMAA 5BYWA 3LM7A 1PS9A 1E4MM 2YBVA 2L5HA 1ZBKA 5TAOA 2HCVA 1V0LA 3XIMA 1OX5A 1TX0A 4UTLA 1JF5A 4JKKA 3A3XA 5FA5A 3KAOA 5FKYA 1B5TA 4K39A 3G1VA 4A3UA 3E0LA 3QM3A 5C9XA 4W84A 5JH1A 3CMJA 3EA1A 5F1VA 3MI3A 1VFOA 1JYNA 2PLKA 4YWIA 2OCZA 5AVNA 3WD0A 1RALA 1S5WA 4WR3A 4Y9NA 3CLWA 1TPC1 3EWCA 3TE9A 1JFXA 2PCQA 2PDQA 1O1ZA 1ICQA 5A6MA 3WD2A 3CAKA 1XIEA 2XVLA 3B03A 3BMXA 2WXDM 3LPPA 4WY0A 1KKOA 3BO9A 1XFBA 3B9AA 1GPFA 4FEZA 2ZX9A 4F2BA 4M24A 2PGWA 1PIIA 4X9SA 1BTMA 1KFBA 2GYIA 1HZYA 2RUSA 2CHNA 2NQ5A 4D1IA 4UXDA 4JYFA 2JEQA 5D38A 1E0WA 3T2OA 1HF6A 1RD5A 1GOWA 1J12A 1M01A 1BGAA 2ABAA 1UC5A 4MMWA 1KA9F 3R79A 3RLUA 3W7CA 3GWQA 3LGDA 3RYSA 3R4IA 3P5YA 1KRBC 4FX9A 1GVYA 5GJPA 3OLIA 1I60A 4IIBA 3S6OA 3UR7A 3VVGA 2QUNA 1UMYA 1KFWA 3U48A 2PAJA 3W2KA 3BCJA 2POTA 4JIRA 3W9ZA 2CBUA 2YA0A 3I4EA 1UIPA 3LHTA 2D20A 4YTRA 2G5WA 1H6VA 1OGBA 1UBSA 1VBGA 4XD6A 3RJYA 4RE0A 2CU0A 3WQVA 1Q8AA 3WQ5A 5FEPA 3G8RA 3L66A 4KWUA 4J3TA 4QCFA 1QRQA 4C6IA 3NXFA 1SSGA 5G5GB 3HBLA 1GW1A 2VRKA 4AZBA 1GSNA 2GZXA 3FHAA 2WKLA 2OLHA 1J18A 4US6A 4DJDC 4D72A 3VD7A 4GBDA 1H7XA 3EOLA 3ONBA 3SUTA 4ADTA 2WQPA 1M7OA 3M5ZA 3MS8A 1K4GA 3NQ2A 4O12A 2PTWA 3PZOA 1NY1A 4DBUA 2ZADA 3AIVA 2X2YA 2X8HA 4QLKA 4B91A 6ENLA 3LEPA 2Z4GA 4H4IA 2C3CA 3AS1A 4J56A 2E8ZA 4L5ZA 2ZUVA 3KL3A 2BDQA 3C0LA 2VM8A 4AB4A 1ZX9A 2GQWA 3GTXA 4PMZA 2VUYA 3GNRA 4B92A 1CXHA 2CLKA 1PCWA 2FFIA 2J9ZA 3VM5A 1DJQA 3AMCA 1DKWA 2JF7A 3FJNA 4EOUA 2XFRA 1JRPA 3FVMA 3KBSA 4IP7A 4P2VA 1DJHA 4GVFA 5AN7A 2P10A 3NEVA 3VCNA 1LBMA 2RDWA 1W3TA 1VGAA 1EP2A 3GXMA 2MUCA 1EHAA 3TWAA 1A5BA 3U9IA 3VFCA 4QDMA 4W7UA 4NILA 3SCQA 1B9BA 3VE9A 3K13A 2X40A 4PFMA 3I7RA 1BEUA 3G8EA 1EUNA 1ZZMA 2X0HA 2ZIDA 4F66A 5I3IA 2YYTA 4HNUA 5K7JA 1XCXA 1QNVA 4WXZA 2EG8A 3DI1A 4L1XA 3O6YX 5AFDA 3OHMB 2OJPA 4JTLA 4A3YA 2RABA 1F3EA 3VOHA 2CC0A 1R47A 4CGTA 3LN3A 2PGEA 3BLDA 1LWJA 3T42A 4AIOA 3NO1A 4X9YA 4NYYA 1NM9A 1TPH1 1GJPA 5FF7A 2WNNA 4E2OA 2GGJA 1BXNA 2W3RA 4O1AA 4J2PA 4WDTA 4EWJA 3W27A 5HMFA 3VE7A 1T41A 3JS3A 3UPBA 3WH7A 2ZZ7A 5FSEC 1XGEA 3ARYA 1SO4A 3H7UA 2ZKMX 4UR8A 4MYAA 3PNUA 4HT3A 3W7PA 2WZHA 4H4UA 3AWNA 5LIKX 5DCDA 4G56A 1PTAA 3O06A 3O15A 1K6WA 3G24A 4TMCA 1EQPA 1D8CA 3TTOA 1UR4A 1YTKA 5JU6A 2VCAA 3LMYA 4Z2IA 2AQVA 2WNWA 1VDVA 1S39A 1NP2A 2QCDA 2X2GA 3DUGA 4W85A 1J0KA 1Z41A 3BXWA 3VCRA 1J0JA 2ZA1A 4PEEA 5FJOA 1GEHA 5F2IA 1TA3A 2YBUA 1KO0A 2G97A 2ZBTA 3UNDA 3VI2A 5I03A 4YCPA 3NR0A 3T44A 4E3VA 4IJCA 2J27A 3RN6A 3TMQA 2X50A 2FVLA 4JHMA 2Y7FA 2A5HA 1H1YA 1TFVA 5KVIA 3AYSA 3CPUA 4LVAA 3SN4A 5U25A 1EEXA 4XZLX 4EKJA 1DTUA 3WD3A 4HHMA 1R2TA 1Y5VA 2Z1VA 2BVWA 4M80A 2O4MA 2F6XA 2R1MA 5CZSA 2MANA 2E9MA 1VCGA 2EGZA 4AC1X 1GRFA 1RY8A 5AOUA 4PCFA 2PEVA 4UR9A 4PBGA 4YTUA 2PDUA 2EPHA 2D24A 2WVVB 1I75A 3AI0A 1ME8A 5CC5A 5HR6A 5LIWX 2NVCA 4WY0F 4H4WA 1OWQA 2JE8A 4Y96A 3P61A 1MWOA 4LIIA 4NZ1A 3UWVA 4AH7A 3OA5A 2E09A 5LIXX 1IIGA 4PZVA 3GDMA 3IEBA 5JCKA 5BCAA 4D1JA 1KGXA 4MWAE 2ZE3A 3VNMA 1KTNA 2C0AA 4GZIA 3APTA 1Q45A 4NZJA 4WJ8A 3W2MA 4B5UA 3E6EA 4A8LA 1B0IA 3QYQA 4HHLA 4O4VA 4BJHA 2J7CA 3OC4A 4IGSA 2VXNA 2PDXA 4IF2A 4PTWA 2WC7A 1PHWA 5IM51 3N2OA 4J3WA 1TJPA 1OFBA 1F61A 3T2PA 5KZEA 4BURA 3AO0A 3CUHA 3EDDA 4I7VA 1FWNA 4UR7A 3SAZA 4GI8A 3FGCB 4FR6A 1KBBA 3EPOA 3G0SA 5L9FA 2DEPA 4K8DA 4JTRA 3FA3A 3WQFA 1DJYA 4OZOA 1HO4A 2ONEA 2VD9A 3M0ZA 4LVDA 2V8ZA 3ZMRA 3SCVA 1R3YA 1R8LA 5IHSA 4XUGA 1AJZA 2EQ9A 2PP3A 3LCGA 4KMQA 4EPDC 4R85A 1XIBA 5HNTA 3ARPA 2PDIA 1JOAA 3U2CA 3NQMA 1Z44A 4IMGA 3OLDA 3GTHA 3SUWA 3ARTA 4CNTA 1UUQA 4X3ZA 4HK6A 1OC7A 3KHJA 1B3XA 1MZRA 3W7QA 1NH6A 3A12A 5FI8A 2WSPA 3O05A 1SO3A 4UC5A 2ZRUA 2OGYA 1RLDA 2CZFA 2RDUA 2BOGX 1EBHA 3GDLA 1QHPA 7A3HA 1RA5A 1O68A 4LANA 1IXNA 1TIWA 1BFNA 2UBPC 4GWEA 1ODZA 1H7OA 5LGXA 3GR7A 4KWWA 3S9IA 1XI3A 4HCHA 4WXYA 4U31A 3ICJA 5BOFA 3PANA 3BMVA 4PMUA 4PB4A 2YB4A 1NOWA 3GHRA 3LGGA 2CLOA 5KZ6A 4E4FA 3CXBA 5LNUA 2PF0A 3ECQA 2NW0A 2XIIA 3SEPA 3BOLA 3FOKA 1J0IA 4XO7A 2G8ZA 5MKGA 2AAMA 4HZ7A 3GC4A 3PK7A 2Y70A 5D9MA 1J0ZA 2HV5A 1GVRA 3W7KA 3UZZA 3SY1A 1T8XA 1QW9A 2ATSA 2D2JA 3WNPA 3DIPA 2VVNA 1NHQA 4AEEA 2CPUA 1QWKA 2WBGA 2CHRA 1LT7A 2PU0A 4CEXC 2QJHA 3S5SA 3WNOA 3OW1A 3OJGA 3VXGA 1KXVA 4MADA 2ISWA 2MNRA 2FB2A 1IE7C 4JFSA 2ZXBA 1LVLA 2G95A 4MWAB 4WGHA 3QOMA 3PS7A 1GV4A 1XSJA 1HJXA 4TX6A 3QKEA 4ZENA 3R6IA 1OGSA 2XFYA 1H2JA 4FDCB 3FAXA 2J78A 1WKYA 3BSGA 3EANA 3GNNA 1ISYA 4H50A 4H4SA 1M6IA 1G67A 3CS2A 3QZAA 4UFJA 1KQYA 5REQB 4PRTA 4CU8A 1X97A 1MW3A 2AL1A 4B9ZA 3OHIA 2JGQA 2VRQA 4FP1A 5D2WA 4NI8A 4F40A 3VGEA 4MUPA 2X1IA 3VIPA 2VEGA 3K30A 1S2VA 3AFBA 1R3WA 2EQ7A 4TV5A 3OYZA 3KP1A 4YIWA 3BAKA 2DH2A 3UZ5A 1WPCA 5CPLA 1DPMA 4EANA 4I9AA 1KRAC 3K5XA 1TMHA 2FZBA 2D2HA 1Q4WA 1W5MA 2QCLA 1GJUA 4PMJA 2NQHA 1V77A 3WK3A 2A8XA 3LSCA 3EF6A 2QVNA 1ICPA 2GJXB 3M6YA 4RW3A 3QBUA 5AECA 3G1HA 4PSPA 2E6YA 2YCKX 3FY1A 4NEVA 2VOTA 3G77A 5J04A 9XIMA 4JD4A 3ITCA 1ADOA 4CCEA 2QMJA 2VZSA 2HSAA 3ABXA 5KITA 4PODA 1KLZA 3OBKA 5FL1A 2H9AA 2EBNA 1SMAA 2YW4A 3QOKA 1XUUA 1H7PA 3AUOA 2DSZA 1HJSA 2VZOA 2EHHA 1W1YA 3KRUA 1BZLA 2B4GA 4AMCA 2Y0FA 3LLDA 2VD8A 2C79A 4LU0A 3GD6A 1K77A 1V08A 3UZWA 3F5JA 1OD8A 3MHGA 1M03A 1ZBCA 1R30A 1OC6A 1X7IA 1OFQA 2PWGA 1GESA 3FJ4A 1GUVA 1KFEA 1IR1A 3BSMA 2I57A 1Q6RA 2ZZ2A 1D9EA 4EPEC 2RGLA 1RA0A 5H8UA 1UD5A 5BOOA 4DZIA 5C0QA 2G37A 1J5SA 4V33A 3GVQA 2OQLA 2V3GA 1R9YA 2Y7DA 2GH5A 4QLJA 2WANA 3BL3A 4DLFA 5C9RA 3HV9A 2ICSA 3AMKA 5K9CA 1EXBA 1PX4A 1TZ7A 4FNTA 3FN9A 4GYPA 4XIMA 3WK1A 3NYDA 2OU4A 2D2OA 4DJFA 1MQQA 4R34A 2DVTA 3MKVA 2I5GA 3OVRA 4RX0A 1C92A 2XFWA 1VKFA 4YWOA 1FWBC 4YVVA 4JCLA 1J10A 4N9BA 3MUIA 4L9XA 1KBIA 5E5CA 1EJRC 3KVKA 1H0IA 1VFMA 2Y88A 4DF2A 4JIEA 1W3HA 1JUEA 2YOCA 4QEEA 3TYUA 4KPLA 3U3HA 4DF1A 1PE1A 4HBKA 3STCA 4TX8A 1MO0A 3R89A 3WENA 5A6LA 1VBRA 2ZDRA 2Y5JA 1LJYA 4S39A 3CB3A 5CG0A 4D6FA 3M0KA 5ABFA 1R3TA 1EWDA 4HSHA 2P0OA 1XBVA 1KM2A 3TIMA 3PZUA 1MSSA 3BCDA 1HL2A 4N4PA 4IOTA 2J7HA 1Q5MA 1FWWA 4GBUA 4MSSA 2DUAA 3VDHA 3VC6A 3I6TA 3L4TA 3SQSA 1FFVC 1BPLB 4OT7A 4FXFA 1N7KA 1PZ3A 2R1LA 3H21A 3WMCA 5EGRA 2RAGA 4FXRA 1W1IE 3AOFA 1WYIA 4LC6A 4B4FA 3AMZA 2X1SA 1H63A 3WQEA 3WLHA 3DGRA 1PIFA 3W7DA 3OBEA 2AQOA 2VEKA 1CT5A 1F5ZA 3ARSA 2C14A 1CGYA 4WEVX 3W02A 3ZVHB 3CZLA 4X63A 4OV9A 2VO5A 4WDWA 4GO8A 3KBMA 5LSMA 4IPJA 2PTYA 2G41A 3LBCA 4F79A 1TRDA 5IBXC 1UWRA 3GS6A 3GU9A 3B8IA 4C7FA 1IQ8A 4ASTA 2NUYA 3LCXA 4UTTC 2NV9A 3SCUA 2WMIA 3EAUA 2A7RA 2RH9A 4H9TA 2XG9A 3NPUA 1US2A 5LNRA 2QCMA 3C52A 3SCTA 2FQIA 2PBGA 3CMGA 3M5VA 3V0SA 3QFEA 4H8HA 4EQSA 6TIMA 3ATYA 3H24A 4M6QA 4HA3A 3O2LA 1RM6B 2GDQA 4CEUC 3W38A 2QLYA 2Q6ZA 5CCZA 2YL9A 1FHDA 2QJGA 4MHBA 3URNA 3TN4A 4JFTA 3DERA 1I4NA 4LS0A 4W87A 3ITLA 3P74A 1H62A 1OVDA 4GZ7A 1XRFA 3WMBA 5HDRA 1OHLA 1UHVA 3HG2A 2OELA 3CNYA 3EAOA 2E4TA 3CH0A 4E4PA 5A5WA 2J13A 3FKKA 2W55A 3DHDA 1K6AA 5BMXA 3BAWA 1R3QA 1ENUA 4AF0A 1I1WA 3WY1A 5M5DA 3SSZA 1I9CB 1UJQA 4IM4A 4MB1A 4MZ8A 5K3VA 1YMYA 4GUJA 3TLQA 3SFKA 1LG2A 1L9WA 4GCXA 4DO5A 1VF8A 4N0RA 4WQ6A 1YXCA 5K4XA 3GH5A 3VUPA 1R9ZA 4PULA 2VKZG 5LIUX 3W4RA 1XDIA 3V5CA 5EFDA 4CD8A 2A6LA 1N60C 5DBUA 1HFBA 3GFXA 2XWDA 3V75A 1YHTA 4LUSB 1F4AA 2PTXA 2GK1B 4PL2A 4K1WA 4JQ2A 5C54A 1TWZA 2NT0A 5FS9A 5GNZA 1HKVA 3S5NA 3QPYA 2I9EA 3EOUA 1VYPX 2QDDA 4HMCA 1ZP4A 4ZFMA 1EC9A 1VJSA 3N18A 1PTDA 4HYRA 4MKVA 2DORA 1TELA 4XZIA 3N4EA 4GX8A 3ES8A 3HQNA 6ALDA 3LQGA 3ISIX 3IIPA 1JYWA 5CC3A 3KE0A 3FSUA 3HF3A 3SCWA 3R12A 1F8IA 3PTQA 2V81A 1JGIA 1EL3A 4V27A 5KSWA 3GX9A 4H4ZA 4A4AA 1ZAJA 3ZR6A 4V15A 3PG9A 1BLIA 2J6VA 1QBBA 4F2UA 5XIAA 1K4QA 2EJ1A 3G3MA 1PVNA 1RY0A 1VJZA 3N9RA 5FF3A 3PBWA 1A3HA 4CQ9A 3G0XA 2IPJA 4TVWA 1AA1B 4AZ7A 1Q6GA 6REQA 3DGZA 4DNAA 5T8GA 3N3MA 2YA1A 2W6RA 4QE4A 4QS6A 1YEYA 2XM2A 1AG1O 3VDCA 1T0OA 1VLWA 4JTEA 4LAZA 4PR4A 1RD6A 5LA1A 1V3LA 1N55A 3V0TA 4DZ5A 2CKSA 4Y9PA 3VD5A 3H8AA 2VI0A 2IUZA 4DLMA 1RK6A 4DUVA 1ESWA 3O0HA 3L68A 1S5VA 3U5UA 4DVOA 1SZEA 1RCQA 1NWSA 2WPEA 4I6KA 4L4MA 1YDNA 1E1EA 1XP3A 2GVEA 1HW6A 2FPYA 2R14A 2Z7GA 4X22A 5GVJA 2ZVRA 2QULA 3WDPP 4LBUA 4K3ZA 3AS3A 3WF1A 1MW1A 4B5TA 1QNSA 3C2YA 3F5LA 4U3AA 2ACSA 1JPHA 3MMDA 2BLEA 3MU7A 1AZ2A 4FLSA 4C6OA 2GJNA 4K7YA 1RR2A 5G2HA 4LBRA 4ZODA 3WIJA 2DPEA 2HQAA 1UA7A 2CFFA 5EMMA 3KBVA 2Y1HA 1XIDA 3ITGA 3QR1A 2TYSA 4QFUA 4P8XA 3SN0A 1OZMA 3LBMA 1FEBA 4ZSTA 2IKHA 1UH3A 1O12A 1IWPA 2WYSA 3SCPA 4HMNA 5FS8A 2V67A 1UKTA 4LUJA 1WDPA 3HZ3A 4ATWA 3T2QA 1TTIA 2F61A 3Q37A 2QPSA 3UNTA 1AMYA 3PBVA 3QY6A 4DWDA 3GC2A 5AC4A 5D32A 4S3FA 5CSUA 4C1KA 4GUIA 4UTKA 3CT2A 3VKKA 2JALA 3AHYA 3OYXA 5BXRA 3H54A 1TYGA 2B81A 1G01A 3AXIA 4GYJA 3GIPA 2E28A 1XYZA 4QX4A 3B9OA 4EX4A 1XLKA 2WCAA 5FACA 5HQEA 3AS0A 3W6MA 1W9PA 1EIBA 2YGYA 1UR8A 3N6JA 4XSLA 4BEQA 2FZDA 4ZQPA 2NLIA 2XZ9A 3CTTA 2PMQA 2OGJA 3URBA 2OEKA 3LZ3A 3HJZA 3QR0A 3W1TA 1E6SM 4W4QA 1ZY8A 3TC7A 3CL8A 2YJQA 2IXUA 3AZRA 5AY7A 1O94A 1TE6A 5EY5A 3N19B 1JZ5A 3LPGA 3RK8A 2PC8A 4YNGA 3WLIA 1THFD 4KWVA 5I06A 1M7PA 4BKNA 1W3NA 3WLLA 5LHFA 4FIQA 4TR9A 4PRRA 4PN2A 2PDWA 3M5XA 2V2CA 3NOEA 3T9PA 1E0TA 2WWCA 4CQ8A 3KLKA 2I56A 4GGBA 5FS7A 1ONXA 2OZ8A 4MB3A 3TJLA 2XDFA 3ITXA 3QTGA 1BAGA 4HN8A 1J2BA 2ZZ0A 3TROA 4IFKA 3G2GA 2X7WA 2Y89A 3TJIA 1M65A 5FJIA 4BK9A 2CBJA 3W1PA 4H8NA 4B5WA 4QBXA 1Q1WA 4J4KA 1FWFC 1AQFA 3BE7A 4Q8QA 4JL1A 1GONA 4KQNA 2G0WA 1A3WA 1Y5WA 3F03K 4HPHA 1RLCL 3H2EA 5F1UA 1TZ9A 5HMSA 1R6WA 1SM9A 4M56A 3ZXWA 3YPIA 1TX2A 3DHFA 3B40A 1PV8A 1K8CA 3IIVA 4H4RA 2G3IA 3LMZA 5C71A 3LS9A 3CJPA 1TIMA 5HWMA 1NDAA 3HRDC 1CCWB 1RZMA 5FEWA 4LY8A 3UJ2A 3WMSA 3ALFA 4F0HA 2HROA 4C7DA 3SGGA 2DV0A 5DN1A 1GVEA 4Y9AA 2XFFA 1E72M 1K7EA 2F9RA 4DO7A 2QEZA 4KS0A 2WPGA 1SO6A 4MM1A 4EQRA 5F2GA 3KWXA 1NFGA 4TXEA 2DUXA 2EKGA 3GDKA 1UP2A 3W72A 4ICNA 1S2TA 3LZ5A 4U4MA 1I0BA 1OG6A 1OX4B 4DHGA 3HGSA 2R6OA 3LG3A 4H6KA 1MXGA 4G7FA 2OOFA 4GR1A 2X8CA 4LUTB 1VCFA 4FNRA 2WVTA 2BFGA 1H5VA 3QSRA 3GU2A 5FCZA 4AD3A 1D7YA 4BQ4A 3SO7A 1XPYA 4E8CA 4KETA 3W76A 4AU0A 3THCA 2WOQA 1P0BA 3ONCA 4OE7A 2V38A 3EPMA 4KRUA 5F2MA 2NX9A 4MLRA 3WLQA 1VAHA 1QI2A 1EKOA 1JAEA 1TB3A 5T26A 3CHVA 3CIWA 4BEUA 1RAKA 3ZR5A 1JXKA 3W2UA 3POHA 1G9HA 1BWCA 2IQ0A 4RE3A 1KXQA 2FGZA 4UFKA 1TTJA 1BF6A 1GHRA 3P82A 1RQBA 2BC0A 2G96A 1TCDA 4PCTA 2X8GA 5DX7A 1FWDC 2D2GA 1YX1A 3ZLFA 1U22A 2VR2A 4H2CA 1FXQA 4RJEA 1NHSA 1KXHA 1JCJA 3WQOA 2QMKA 3M44A 5E9XA 3W6LA 2ZX6A 3GR4A 2BHZA 1XG4A 3AZTA 2E5DA 3DBPA 4LWWA 3W1UA 4YTQA 2PFHA 3WBXA 4ZMGA 4LCQA 2WCGA 2QQ6A 5A6KA 3NCOA 2VFIA 1DIEA 4W89A 1EJXC 3N73A 4O17A 2H8ZA 1GQNA 3N2BA 4EK7A 1Y8BA 3MWAA 4N7QA 3NIYA 3BJFA 4HCDA 3D9XA 1KFKA 4FX8A 2V63A 3QVQA 4Q8NA 3B9DA 3B8TA 2QCFA 1H51A 4DJDD 1DXFA 2XSXA 3ARRA 1IV8A 2XM1A 2IPFA 3QLLA 2NQ9A 2W62A 1UKOA 1ALDA 2DT1A 2O56A 2PWFA 3ARXA 4GIAA 4XSMA 2ZC1A 1DOSA 3W82A 1CDGA 4IMFA 5DMNA 3NSNA 1O95A 5XIMA 2D3NA 3MB9A 1C90A 2X16A 4M19A 4M6UA 3DC8A 3NL5A 3LRMA 5JMUA 1MRAA 2XH0A 5EBUA 2PZNA 1XDLA 1O7AA 1YLVA 4FLOA 1VC4A 1QVBA 4YJ5A 4S1FA 3GW3A 2WB5A 1I2PA 4UFHA 5F4WA 2GGHA 1YTDA 3UWUA 3TH6A 3TZNA 4PC8A 1TPUA 3GHSA 2LLEA 3WG6A 4JY8A 1PIGA 4MLJA 2Y8KA 2O7SA 4GG9A 3W0KA 4D8LA 1EGVA 5F2LA 3S8HA 3ALGA 1EP3A 3TA9A 3KTSA 3RM8A 4ZZ9A 1H7WA 2PWEA 1S3TC 3MYOA 3W23A 5LXXA 1TMLA 4XD4A 3RHGA 1F3XA 3OVQA 3C8NA 1K8ZA 3MJYA 1XYLA 1UOZA 3NUKA 1A50A 4DXXA 4LUTA 4C1LA 4HNLA 1GXFA 2CBVA 3L4ZA 2HK1A 2WSQA 5A8MA 1B4EA 4NX0A 2FZMA 4WZHA 4LVBA 1REQB 3L4UA 2WHKA 1POKA 4NAFA 4FR1A 3RX3A 3U4AA 3MKKA 1DVJA 1JPDX 3ZR4A 3KLLA 5F4SA 1LL6A 2HEJA 2VC5A 3WQWA 2JFEX 3W75A 1GK8A 4MAZA 3MSDA 5FL0A 2GVJA 1UZDA 4V1YA 1HJVA 1XHGA 3OTRA 1MW0A 4KEVA 3A64A 1TV4A 5FOOA 4Q8MA 5JIPA 2GVLA 2YX0A 5DMYA 2A2IA 3AMGA 3THQA 1W1B1 1F8WA 5AC6A 3QQWA 3KCOA 2AL2A 5ABTA 1FCQA 1K9TA 2Z28A 1STZA 2DDXA 1M53A 1FXPA 1TV2A 1SFTA 2CETA 4G7EB 2F38A 4FLRA 1GKQA 4HU4A 1E5NA 2J7EA 3EB4A 5CZTA 1M68A 3CV6A 3WFAA 1PKNA 2QHAA 4K7ZA 4J1OA 1OFPA 3BICA 4QROA 4Z1BA 2OLSA 5IRPA 1KLYA 4XTDA 4XAZA 3VX1A 2FHCA 2P53A 2FVMA 1UP3A 4AIBA 5HUPA 3EEGA 2YDSA 3CGCA 1W54A 3LNMA 1ZS2A 1J5TA 4OWGA 3R0UA 3BV4A 4KCWA 4S3AA 1FEAA 1A47A 4MWAD 4XKMA 4A8IA 2SFPA 3W1NA 2DGAA 5DBTA 1CXKA 5FF0A 4NRSA 5GNYA 1EJTC 1BRLB 3GTFA 1R2RA 5HPOA 4LCSA 4UOZA 2NT1A 3EPNA 4H7VA 5AC8A 1HP4A 3BUVA 4TTGA 1L8PA 5FS6A 2ACQA 4DJFD 1S1PA 4ILSA 5D33A 4LB4A 2GUBA 2D73A 5HATA 4RKAA 3UA4A 4C5YA 4WLCA 1VPYA 3QPEA 4EPBC 4JYDA 2V69A 3VGBA 2WO5A 3OGRA 3BZGA 1Q65A 1C7TA 3CV2A 4UQCA 1IWAA 3HV8A 2PE4A 4B2DA 4HVXA 1OK4A 3WH9A 1I2NA 3CQ0A 1A5AA 4IX0A 3BLKA 3VYLA 3ZM8A 3T0AA 3BOFA 3PUEA 4NJJA 1GRBA 1XKYA 5K9DA 2TODA 2WW5A 3T0TA 3TK7A 3L4WA 1XW8A 3N17A 4JPGA 4Z08A 1QK2A 1K9DA 4OOUA 4E5TA 2Y7GA 1NWRA 2GSHA 4J2MA 2ABBA 3CWOX 4WHBA 3APGA 3UR8A 3A7RA 2XGBA 1EDTA 2DZPA 3A4AA 4HA0A 1PZ1A 4W93A 1ONEA 2G50A 4ATLA 1KRMA 4NP7A 2E68A 2H8XA 4PCSA 5CGQA 5FEXA 3FNDA 1FH8A 1TQXA 1HUVA 3EB2A 2FVKA 4AXNA 1OZQA 1YQ2A 2WSRA 4FSAA 3PAOA 4C60A 1Q63A 4JTJA 3UPMA 2A3EA 4BFAA 4C1NA 2QW5A 4EXBA 4NHVA 3VNYA 3K4AA 1XCFA 2WM1A 5IXEA 2CESA 3MDWA 4E38A 1AQHA 3TJXA 2VRJA 1B57A 4JTQA 4J7RA 1UR1A 2E1DA 3VMNA 5CPOA 3UFYA 5MHBA 3H2AA 2A79A 3R8RA 3SCOA 2Y8VA 1UMLA 3BLOA 2GJXA 3USZA 1DWIM 3HU7A 1S5TA 4DYEA 1SVDA 2CWXA 2RDTA 3WDQA 1BQGA 3JW7A 2PDPA 1C8XA 1FWSA 1OM0A 3CK5A 4MPKA 4JTHA 1GZJA 3S1WA 2A6NA 3DDMA 4P61A 2C91A 4EXAA 4KH2A 3FSTA 4QP0A 2ZRYA 4GVHA 2GPTA 3WEMA 3UWWA 4M1RA 2WMIB 2WP6A 1UH4A 2I14A 1ITUA 7ODCA 1AH4A 1ZJIA 4C91A 3UYIA 1A5NC 1FCUA 2HPIA 2BCPA 1A5KC 2PDGA 5E09A 2GSEA 4O4WA 1E9LA 5SWUA 2WZTA 4WX2A 4Z42C 3P5ZA 3AXMA 3R1ZA 1HN1A 1X96A 3S9ZA 3HPXA 4US5A 5AYXA 1PB0A 4A3RA 2Z1SA 4O10A 4ZB5A 4DF0A 2OTDA 3PP7A 2YCLA 1WE5A 5G2WA 1WV2A 4DJEC 5CG7A 4FB7A 1VHNA 3K4DA 2XVPA 4PBFA 3W85A 5AHEA 4NG3A 2WBAA 3C2VA 3IPWA 2BOEX 3E12A 2XVKA 1P48A 2ZXDA 1TR1A 4FOKA 3C4UA 4PCNA 3R7MA 5DMLA 2EQ8A 4GJIA 7PTDA 1A53A 1EDQA 4J57A 4WKHA 1EUAA 1XGDA 1KCLA 1XLHA 2WAGA 1H2IA 4Q4MA 3ZIZA 4ZSUA 5A2CA 5EMLA 3N34A 4O18A 3CPRA 1PYMA 3IJ7A 1OT2A 3SB0A 3QFBA 4O52A 4GH1A 1XBYA 2I5IA 4ZOBA 3K8MA 4BV6A 3LB0A 3H2FA 3H2CA 2ZZ4A 4C6CA 3PZTA 1X1NA 2VFHA 2GQAA 3PTKA 2VX4A 3C0QA 4L7ZA 3EOOA 2C6QA 1VEOA 3MQTA 1WKFA 4UCGA 1KR0A 4JS3A 4H9XA 2ZC8A 3HPSA 5JVLA 1VENA 2ZX7A 2BVTA 3TNBA 2OZ3A 1K3UA 2E0PA 2V5BA 2HQMA 3H2NA 3AIWA 1F9CA 1S3HA 1X98A 1MEIA 4PMYA 3VPLA 3VNJA 4LV4A 2BY3A 4M6VA 4OBSA 5D2YA 2PRLA 1KV8A 2DT2A 3RRAA 1SJAA 3BWWA 1TTQA 3KBWA 3TN5A 1ONWA 4WJEA 1YIXA 5JCNA 3FJ6A 3TN6A 4DWSA 1GG1A 4BF9A 4DBWA 3S1UA 3HFTA 4WKAA 4NJHA 1UD6A 2ZZ1A 1OFOA 5U7SA 5LHEA 1PKLA 1S2AA 2DZWA 3GYCA 3H2MA 3NO3A 4UIOA 2R9ZA 2GGGA 4DAIA 3MMUA 5K4ZA 2VX6A 1XYCA 3RXZA 2YFOA 1RK5A 4GQRA 1WKDA 1PDYA 4PUWA 3NZQA 4NAEA 2PS2A 3FA4A 3EWDA 3VGHA 3L2IA 3SQPA 1TJ1A 3UZJA 3WQGA 4MJ4A 1W5PA 3IIZA 2GJPA 1W3IA 3GUGA 4WGXA 3AIRA 2BY0A 3CGEA 3JU2A 3IGSA 1X1ZA 1EO5A 4NXKA 2VL4A 5LIYX 2FH6A 5CZKA 4QSFA 1NAL1 2F6KA 1JQXA 4Q6JA 3CBWA 3QPZA 3PZIA 3KX6A 1XPGA 4XK2A 4HYWA 2YR1A 4UNKA 1FDYA 1GOXA 2WKGA 3KFTA 2ACUA 5DMMA 2H3BA 3WJWA 3OLEA 1PWMA 5DF0A 3HGOA 4FX7A 3R11A 2J66A 3W71A 4KCUA 3MT1A 3LERA 2J47A 4PBEA 1ZSXA 3EZ4A 4PMDA 5A6JA 1FUYA 4IUOA 3WX7A 1QW8A 4ZXOA 3WF0A 3IV8A 3NJ3A 1KCZA 1G1YA 1KM3A 4GISA 1SZNA 1QMLA 3MCMA 3S5YA 1V02A 3M47A 2WMHA 3Q67A 1VFHA 2RJHA 1XIFA 5PTDA 2RHGA 4UMAA 4O0ZA 1OC5A 4NZFA 5CPTA 5EPDA 3UWEA 4DI9A 1WAUA 3THAA 4H7ZA 4O50A 3BV7A 3I65A 4Q22A 4IFOA 4IX2A 2FTYA 3PJXA 1MMFA 2KX9A 3IRDA 1XUZA 1UASA 3NS1B 1MZHA 1B30A 4Y6GA 1U1UA 1TV7A 1UP0A 4U2YA 2PU1A 4JN7A 3WLKX 1JCNA 1FP8A 4XX6A 6A3HA 2RDXA 4F0RA 1T8QA 2E6FA 1U2YA 4S3EA 1KFJA 1X6NA 3RCYA 1YDOA 3ORWA 1SMDA 4QJ3B 1W5QA 2E6AA 1X38A 4GH3A 4Y90A 5CQ1A 3O16A 3CB8A 1MEWA 4N9DA 3S2JA 1MVYA 3KRZA 4B3ZA 5HQMA 2XGIA 3DYPA 4UZUA 1A5SA 3S1VA 3AAMA 3CUZA 4HNNA 4LAOA 4YMZA 1EOMA 1GEUA 3IVSA 2YDRA 4N42A 3DK9A 3OVGA 1CGXA 4Q7IA 4B4HA 4TO8A 3M46A 1GKPA 2D0GA 4AZGA 2PLJA 3G1XA 5G4HC 3HURA 1XFCA 1F07A 1BKSA 4D6DA 3AYRA 1A4MA 3S6TA 4LYQA 3QHOA 2C3DA 1WZMA 3PN8A 3BLLA 2WSKA 1KGUA 3OA3A 3VA8A 4ROQA 3QH2A 1TUFA 1E70M 4Y9MA 5TNVA 3TFCA 2ZUUA 2IQDA 1ELSA 3RRXA 4ZE5A 3AM9A 2WMFA 3L5MA 3AMDA 4OTKA 3V1HA 1CGTA 5FD0A 4JEJA 1M3UA 2HVNA 4ECLA 4IIHA 3VIIA 2VQUA 3RR1A 1POJA 3VZYA 3M64A 5DLCA 1MNSA 1D7FA 3FW6A 1JQVA 3MV01 1VBHA 1B2YA 3N6QA 4EF8A 2GFTA 3WCZA 3VOCA 1TJ2A 4H6QA 3GRSA 5HQLA 5LNSA 1M9HA 3ZJ6A 5CH9A 1QTWA 4DYKA 2OQHA 4P7OA 3UCDA 1H1NA 3TQKA 1WUEA 1AH0A 4PTDA 4Q4KA 4R53A 2V5CA 1N61C 2HZGA 3UEQA 1XBZA 3W7IA 3A13A 3T81A 2QPUA 1GVIA 3MJMA 2DJXA 3NGJA 1FWTA 1YBQA 3LM3A 1VBUA 2X30A 3E0WA 3PZQA 3VD9A 3DKLA 3T6CA 2ZZBA 1UB3A 1UW9A 3LX9A 3TTYA 3IJDA 1BWVA 4IL2A 2QUTA 1CPUA 2H3DA 2VP8A 3P8IA 1Q66A 3V4BA 2R91A 3NQ7A 2QUMA 3LSBA 1JRCA 3LHVA 1H61A 1MRQA 3HFYA 4Q6XA 4AY8A 2HNHA 5CJ5A 1TVPA 4IGHA 5LA0A 1OADA 2CLMA 2D0FA 1DEDA 1E5JA 3AZSA 4LRTA 4WOQA 3R58A 1JI2A 1MQPA 2UY3A 3C3UA 4UQ9A 1ISZA 4DWSC 3GD3A 3E38A 4D71A 4OKDA 1GREA 2YB1A 4DELA 3EWBX 4L1GA 1Q6EA 4RE4A 4A21A 4AC7C 2C8NA 3NQFA 3ITTA 4JQ4A 3SJNA 3N3TA 2VFFA 2HVOA 3OVPA 3HG3A 2OT1A 4X2RA 1IF2A 1KQZA 4XISA 1Z7AA 3O8AA 3DG3A 3GBEA 2CCRA 3W25A 4AIEA 3AU6A 2ZUNA 3UG3A 2QNEA 2UWFA 2XIJA 4D6EA 4QNWA 3RO6A 4D6IA 3OB8A 3DZ1A 4P8VA 3H4KA 4ADSA 4RR4A 1V6WA 4KESA 4KCTA 1ZB5A 1VEPA 4FOUA 3NQBA 2WQDA 2F8QA 3WLNA 1TE1A 1F6YA 2C1IA 2Y4SA 4NEWA 1X2HA 2J9XA 3ZO9A 3IIOA 5A8PA 2V30A 3QGKC 4EE9A 3SRHA 4EMIA 5C6MA 1K7XA 2P50A 3N2TA 4LOCA 1J96A 1ADDA 1V0NA 2F84A 3OODA 4LV9A 2QIIA 3WQ4A 2YCJA 2EQ6A 5D2XA 2ASHA 2Q3OA 1ZUAX 3L23A 2PDFA 3ZT7A 1CX9A 3SQMA 4QAIA 3RPDA 3HN3A 2CLLA 5DXXA 3TCEA 2XUCA 4M8UA 2WV8A 4ZOAA 3L67A 2CHOA 2YLLA 1ZENA 1XDMA 4BY3A 3RLVA 2HTMA 3QXBA 1Z6KA 5HJYA 3S0CA 1A3XA 4JQ3A 2OZTA 3DFPA 1W1ZA 4HOXA 2CEQA 3CWHA 3LTPA 3UCCA 2PWDA 3LLFA 2BTMA 3RU8X 2CXGA 3CTLA 4KWOA 3W2JA 3UPWA 1NJJA 1FKWA 4XV0A 3K1GA 1FWRA 1RXOB 2ISDA 1RJQA 3N29A 4XO6A 1KBJA 4J27A 4NNBA 5DELA 4WY0B 3B3DA 1XD1A 4XBSA 4J3SA 3RM4A 3QV7A 3HM7A 3H4WA 1LT8A 2HS8A 3UR5A 4UWMA 3B8DA 3EWWA 3FG2P 4S3KA 4FPSA 3BAYA 1H49A 2QAEA 3THUA 4H6EA 3QRHA 4ZO9A 3GK0A 4GHRA 2EPKX 1B3ZA 1MUMA 2KAUC 3U5YA 4TV6A 3T05A 1LUCB 2WKJA 3DGBA 2DUZA 1SUXA 3HQPA 4UCFA 2IW0A 3AICA 2OX4A 4BQ2A 1CEOA 2ANUA 3LENA 2DY3A 4AZCA 3S2CA 4E0CA 3P93A 1JEZA 1XIGA 5HULA 1PYFA 3W1MA 2VFDA 2GUUA 2DZVA 4UFIA 1V97A 3ES7A 3NSXA 3P7YA 1LBFA 3OZMA 3GY1A 4R88A 1TPEA 3LYEA 1QT1A 4Y7EA 3AC0A 2WWDA 3MO7A 1FVPA 4CNOA 1FOBA 5AHMA 1VHCA 1LBLA 2VZTA 3VNKA 1OINA 2YQUA 2RFGA 3CL7A 1K8XA 3NPWA 3MBFA 3LY0A 1ISWA 2CLPA 3W1LA 4FX6M 4TMBA 4NRRA 2Y2WA 1GVSA 1RP9A 1ISXA 3VC5A 1WB0A 2ZZ6A 3GVRA 2NQJA 3IUHA 2AQWA 3FCPA 4JICA 3NA8A 4O15A 2J7GA 2OSYA 1NARA 1UPPA 2VX5A 3VOJA 4S2CA 3OOQA 1JL8A 4GXMA 3R0DA 1W1VA 4PYSA 4R33A 4JZ5A 5CBIA 4WSJA 2PURA 4A8RA 2I7GA 3SW6A 2DSUA 2BXVA 2W3ZA 1UZ1A 3CGTA 4KFOA 4DN1A 3SCSA 1UYQA 3M0IA 3EX2A 4UFLA 2FZ9A 1YPFA 4YPJA 1FWJC 1OBAA 3SCNA 3NQEA 2O0TA 2YPIA 4H41A 4QDPA 4KKXA 2Y61A 5EBKA 1IXPA 4HHPA 3TP4A 3CYVA 3MUAA 1U5JA 3NQGA 3NQ8A 1QPQA 1L2QA 5A6BA 1Q3NA 5I78A 4NF7A 3VKAA 3W74A 3BURA 3DESA 3W7NA 4LUIA 3HG4A 3E02A 1PZ0A 3DFTA 1OEPA 4QJ1A 1XL9A 5CAHA 3T8LA 1HVXA 4DY1A 1E4IA 4JTKA 4HOZA 4LS1A 4XZMX 4MY8A 2DZTA 3C6CA 4JTCA 4J3UA 3WBYA 2YVFA 1PX3A 1KN0A 4NUWA 4B5SA 3VNIA 3BQ5A 5BROA 4ZR8A 1ZCCA 5I3GA 2XH7A 2VT0A 3TQ0A 4LAUA 4AZ5A 2VUNA 3VGGA 3MI6A 4IG2A 1VPQA 1F3TA 1WAWA 1RBOB 3PF3A 1UROA 1JZ3A 4CD7A 1PO9A 2EXOA 1JJKA 4JTIA 3SM0A 2XIOA 4S3BA 3NRZB 3ZLHA 4QR6A 3STFA 3SFWA 4OFCA 1FX6A 4ZCWA 2AMXA 1GEQA 3CUXA 3OLGA 3NWRA 4ADUA 4HQVA 3T08A 4HA1A 3Q2DA 4KT2A 1IYXA 1O66A 4MZYA 5ER0A 2OQYA 4DQWA 4C90A 2ZUMA 3DHUA 4A29A 4YN5A 3IAPA 3TYBA 1VD6A 3VKCA 5D9PA 2CIPA 2VQTA 4H9VA 2H90A 3NVTA 3LHZA 4B5NA 4AEOA 4Z1YA 4GACA 1UKPA 4XAGA 4DWSB 4C6DA 2VCCA 3WYZA 3PBGA 4JGDA 3F2CA 3IWPA 1WQ5A 2Z6JA 2DP3A 2WHJA 3EA3A 1VR6A 3TA6A 3LHWA 1VPXA 3VIJA 5U1OA 3WDHA 1S2CA 3NL6A 4GPNA 5BU6A 3PZNA 1KR1A 2Q02A 4NAFB 3U6WA 3TXZA 3W2NA 1LTDA 2E77A 4I6VA 3B8VA 3IACA 3R8GA 1ZU8A 5J8LA 3UG4A 1E1CA 3VUSA 4NAEB 1RVKA 4I8DA 4CCZA 1PXGA 3KL5A 3LXCA 1EF3A 3KRBA 3AU2A 3IC9A 1BD0A 1E6ZA 3KP0A 1IEWA 2WVVA 2ODOA 2ZWYA 3UY7A 1HKWA 3H4XA 3K8KA 4ZGYA 4BR1A 3QY7A 1J4EA 2ZTJA 3EKGA 1NEYA 3W7JA 3K8LA 1QNRA 2HJPA 3INPA 3PPHA 5HJLA 4JDRA 3C2RA 5AZ0A 1BSLA 3T8QA 4RL3A 2EPNA 1V93A 1DIDA 1JUBA 4AYSA 4KWSA 5CPSA 2BY1A 3GXTA 3MCNA 2GLKA 3KDOA 3TSBA 3M07A 3R43A 3G0UA 3ZJKA 3GDTA 2FB3A 1QAPA 3NZGA 1DBTA 3QKZA 2E5AA 3CLMA 1H60A 2DSKA 4PB3A 2O9PA 3BW4A 3NG3A 4LAMA 2W0UA 3AROA 5K9XA 1NIUA 1K1DA 1W5OA 3E96A 1WZKA 1MOKA 1S7MA 1TREA 3WUFA 3QQ1A 1TPVA 2ZOXA 3HG5A 3H4GA 1B1YA 3NM3A 1CENA 1RJRA 3WNMA 4NZ3A 1IR2A 4HU0A 1SFJA 4HP5A 3DENA 4XB3A 1KTBA 2P3ZA 3H7RA 2OYMA 4ZXLA 1UD8A 2JKEA 4L61A 3A7UA 2EO7A 1IGWA 1MXSA 9RUBA 4IIEA 5DCEA 4F48A 4JTSA 2XTKA 3LXBA 2Z0IA 3MZ2A 5HUOA 3A23A 4M81A 1VIWA 4W5UA 3HB9A 3WLRA 2XIBA 1ZY9A 2C16A 3DX5A 2RJGA 1YPIA 3TQVA 4XAPA 2NVKX 4ZQRA 4UTWA 3LQLA 5FJPA 1GTHA 1JUKA 1E6XM 4HHHA 3NGFA 2PWVA 1TCMA 5H6HA 3FEMA 2A21A 2C19A 3TNOA 1DJWA 2Y85A 3I7SA 4KIRA 1L6SA 1JDAA 1XLMA 2JKPA 3LA4A 3A9IA 1TRIA 5EMYA 2Y5EA 1EA0A 2UY2A 3TQPA 3G3DA 4CD6A 5H8PA 1GOIA 4GYPC 1E4NA 4GC4A 1EBDA 1YTEA 3F4NA 1EGMA 4NJGA 4JTTA 3EDFA 3PHAA 3USBA 3H55A 1RPXA 3T40A 3LUTA 3WEOA 4YYCA 1EQCA 8XIAA 2Z29A 4RZ5A 2OWXA 3K4WA 3P80A 2PTZA 1H09A 1RQHA 3M41A 4A22A 1NDVA 3GAKA 2TPRA 4AD1A 1HJQA 3E9AA 2C15A 2FLIA 3PM6A 4ZL1A 2QGHA 3TZFA 4RNFA 3T1GA 4CVUA 1V3JA 1UOKA 1FWEC 4H2HA 5I6SA 4HIBA 1WZAA 2WZIA 3MHFA 4B15A 3PUOA 3GXNA 5C9WA 1VIZA 1QNOA 4WKFA 3R8HA 2QCEA 3TYCA 2V2DA 1E6PA 3B9JB 1TYTA 3UWZA 4RZ6A 4HTBA 3L4YA 2W66A 4KPRA