2I06A

Escherichia coli replication terminator protein (tus) complexed with dna- locked form
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
305
structure length
305
Chain Sequence
DLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQHACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polarity of Termination of DNA Replication in E. coli.
rcsb
source organism Escherichia coli
molecule tags Replication/dna
molecule keywords 5'-D(*T*TP*AP*GP*TP*TP*AP*CP*AP*AP*CP*AP*TP*AP*CP*T)-3'
total genus 86
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05472 Ter DNA replication terminus site-binding protein (Ter protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.10 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 2i06A02
3.50.14.10 Alpha Beta 3-Layer(bba) Sandwich Replication Terminator Protein (Tus); Chain A, domain 1 Replication terminator Tus, domain 1 superfamily/Replication terminator Tus 2i06A01
4XR3A 4XR1A 1ECRA 2EWJA 4XR2A 2I06A 4XR0A 2I05A
chains in the Genus database with same CATH superfamily
3WQZA 4XR1A 1WXOA 4XR2A 3RHUA 1ECRA 1V4PA 2ZZEA 2ZZFA 3RFNA 2I06A 4XR0A 2I05A 4XR3A 1V7OA 1WNUA 2EWJA 2ZTGA 1TKYA 1TKGA 1TKEA 1QF6A 1TJEA 2ZZGA
chains in the Genus database with same CATH topology
3WQZA 4XR1A 1WXOA 4XR2A 3RHUA 1ECRA 1V4PA 2ZZEA 2ZZFA 3RFNA 2I06A 4XR0A 2I05A 4XR3A 1V7OA 1WNUA 2EWJA 2ZTGA 1TKYA 1TKGA 1TKEA 1QF6A 1TJEA 2ZZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XR3 A;  4XR1 A;  1ECR A;  2EWJ A;  4XR2 A;  2I06 A;  4XR0 A;  2I05 A; 
#chains in the Genus database with same CATH topology
 3WQZ A;  4XR1 A;  1WXO A;  4XR2 A;  3RHU A;  1ECR A;  1V4P A;  2ZZE A;  2ZZF A;  3RFN A;  2I06 A;  4XR0 A;  2I05 A;  4XR3 A;  1V7O A;  1WNU A;  2EWJ A;  2ZTG A;  1TKY A;  1TKG A;  1TKE A;  1QF6 A;  1TJE A;  2ZZG A; 
#chains in the Genus database with same CATH homology
 3WQZ A;  4XR1 A;  1WXO A;  4XR2 A;  3RHU A;  1ECR A;  1V4P A;  2ZZE A;  2ZZF A;  3RFN A;  2I06 A;  4XR0 A;  2I05 A;  4XR3 A;  1V7O A;  1WNU A;  2EWJ A;  2ZTG A;  1TKY A;  1TKG A;  1TKE A;  1QF6 A;  1TJE A;  2ZZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...