2I0BA

Crystal structure of the glur6 ligand binding core elkq mutant dimer at 1.96 angstroms resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
254
structure length
254
Chain Sequence
RSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITLAILKLQEQGKLHMMKEKWWRGNGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational restriction blocks glutamate receptor desensitization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
total genus 86
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2i0bA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2i0bA02
4HW8A 2QSXA 3R26A 3RLFE 1SQYA 3CRBA 3OEMA 4H5FA 4U4XA 1MPBA 2REGA 2M8CA 3IJXB 4OEUA 4QSCA 4WEDA 3DP6A 4DE8A 5A5XA 5DT6A 2ZXTA 5HM4B 5CMKA 3THIA 3K2DA 1MS7A 4KHZE 2F78A 4ONYA 4ELPA 4E0XA 3QUFA 1M5DA 4F19A 1H45A 2D5WA 1DTGA 3A3CA 3K00A 4TOZA 4U4SA 4YB5A 3V89B 2Q8JA 2I49A 1Q35A 2ZMBA 1A7LA 5AA2D 1AH5A 1B5IA 3U92A 3H4ZA 3FVGA 1VFDA 1UTBA 3TFLA 3OOAA 4YKKA 3TCGA 4EF2A 5ITOA 4ZE9A 4KCCA 4X1BA 2O7IA 1ZMGA 1TXFA 4EXLA 1URSA 2THIA 1KWHA 3KSXA 3L6GA 2DWIA 3GZGA 4JB7A 4OENA 3SDFA 5CM6A 5I58B 1QJMA 5ELVA 4OZ9A 4YMBA 2NUVA 4GRKA 1I69A 4OETA 1A99A 3H6WA 3FIRA 3U93A 3UK4A 1POTA 2PBWA 3ZS6A 1B05A 2I3VA 2CMOA 5KCJA 4N13A 4GF8A 5A5XB 1MRPA 1MXWA 1NL5A 1UQWA 2XXRA 1NNFA 3KJTA 1DOTA 3H6VA 3IOUA 4I8CA 4LP2B 1POY1 1MDQA 2OWTA 5I2NB 3H6TA 1SW2A 3KSJA 3T9XB 1MM7A 3KEIA 2X7PA 2F7CA 1DPPA 1P1NA 2W7YA 5CC2A 4YB6A 3O6HA 2VD2A 4QRZA 4QSDA 1VFEA 1DMBA 1YCJA 3C33A 1OVTA 3O29A 5JTYB 1QUKA 2ANJA 5TPAB 3UORA 1A54A 4DXUA 3IB0A 1Y9UA 3LSLA 3MPKA 1FTMA 1IZ1A 1NKXA 2BJJX 3TAJA 5L9SA 1MXZA 4Z7EA 4K3FA 2OWSA 4X48A 5DTBA 1LAFE 2UYEA 3RT6B 4I1DA 3MQ9A 4LONB 3WAFA 4HS7A 4OYVA 2V3TA 4FE8A 3IOWA 2Y7KA 3FVOA 3G7WA 3G3GA 1ATGA 4JSOA 4QFPA 4E0WA 2O51A 1Y20A 1MY0A 2OLBA 4O3BA 2PVUA 4FEBA 4X9TA 1WDNA 4POWA 2OCUA 3Q25A 4UACA 3MBPA 4OTEA 5IAIA 3PPRA 5I2KB 5KDTB 4G4PA 4PQJA 1NNKA 2GH9A 4WEPA 2NVUB 2H4IA 1N7WA 5B7DA 4F22A 4RYAA 1N0TA 2F7AA 2PT1A 3IAZA 5I2KA 3MZ1A 3PD9A 4OFOA 1LCFA 2RKMA 4YKIA 5ISUA 2RCAA 2ZYOA 4BDQA 1I6QA 5FHOA 2FNCA 1DPEA 1SYIA 1XVYA 2V93A 4MF3A 1B40A 2V84A 3MC2A 2XXIA 1TWYA 4ZE8A 4POXA 5H8NA 1MXUA 2NXOA 4G8NA 2H98A 1VE4A 3FZVA 2ONRA 3G3KA 4DLDA 4F2OA 1FQCA 1FQFA 1O7TA 3GBAA 3KN8A 2H25A 2O7UA 3QYTA 3G3FA 4NMYA 4R6KA 3EHSA 5H8HA 3VLWA 2H9BA 1SI0A 4G68C 3KG2A 2D21A 1B1XA 3F11A 3PPNA 3PUVE 3HV1A 4PETA 4U23A 1ELJA 3I3VA 4NEDA 3T9UA 4Q8RA 2RF1A 4PFTA 4F31B 1HSEA 2R9JA 3MVXA 2OBGA 1Y1ZA 1PB7A 5F7VA 1PC3A 4R74A 1YAEA 1SI1A 1MQJA 3V5AA 2R6GE 2PX1A 4BDMA 4OQOA 3KFMA 4ELOA 4ZEBA 1HSLA 2F35A 4H6DA 4GL8A 1SD3A 1MDP1 3Q26A 4JSDA 5I56B 5I59A 2F97A 1LFHA 1FW0A 3FUZA 4NF5A 1EZOA 5BUUA 1A8EA 1OLAA 2DVZA 3R6UA 4RNSA 1N7XA 1YPNA 2OJTA 3ZKKA 4EF1A 3S9LC 3O28A 5CMCA 3FV1A 1NNPA 3EHTA 1Y4TA 2QMXA 4OHNA 4F1VA 2AL5A 1PB8A 1IITA 4EQBA 4H67A 3DM0A 4MH5A 3VLUA 5I57A 4AB5A 2Q89A 1IXHA 4DDDA 1B3GA 2Y7WA 4JWXA 4GFRA 3CI8A 4IO6A 3T22A 4OMBA 3OD7A 3EN3A 4NF4B 4LZ7A 4Z0IA 1A55A 4YB7A 4RA1A 4ZZAA 3O66A 3W9WA 3FJ7A 1ANFA 4YICA 3JYRA 3N94A 1OLCA 4H0WA 4G8HA 2PYYA 4G8MA 5FTHA 4P0GA 2QJEA 2XXWA 4GOTA 1NH7A 2ESNA 2FYIA 3FXRA 3EQ1A 3ODBA 3FD3A 5K2XA 2UVJA 1LFGA 1US4A 1Y3QA 4GWOA 2I4CA 2RC8A 4OVJA 4H65A 2A5TA 3OSQA 3DLNA 1SW5A 1UTBB 3IX1A 2F6GA 3VVDA 1AIVA 2Y7IA 5DVIA 1B6HA 1MQIA 1B7UA 3TELA 2Z22A 2B3FA 3ZSFA 1LAGE 5TP9A 1H3DA 1OQHA 2E0SA 1D9VA 2V3UA 1WVJA 2GHAA 1MM6A 2DE4A 3IOVA 2ONKE 3KJ7A 1GTKA 2DS9A 1XOCA 4KR5A 1FTKA 4RPNA 5FHMA 3TMGA 3N6TA 1R9QA 1M5BA 4PP0A 1VR5A 4ECFA 4IO3A 3TEPA 3VXCA 1OQGA 3CR9A 4KYEA 1NNTA 4IO5A 3T9HB 4H8JA 3R7XA 3S4UA 3PPQA 5CBRA 1Z7NE 4QHQA 4O3AA 5H8SA 3Q27A 3MWBA 3W9VA 4HTGA 3S9NC 1UTHA 1D9YA 3FJGA 3PGFA 4F1YA 4F2QA 2ZNSA 3TCHA 2XX8A 3VVFA 5ICQA 2XXXA 4PFWA 1DTZA 4TQUQ 2F7BA 3C35A 3UA8A 1EU8A 1QKBA 3O97A 4R6YA 3K1PA 4U1ZA 1B3HA 1DSNA 2P1SA 3KGCA 3K6VA 1JVYA 4N07A 2F36A 4DZ1A 4IO4A 3I5OA 3LC8A 3QSLA 4U21A 3MPLA 3RUMA 3FASA 3L6HA 4MLVA 4ZEKA 4IO7A 1BKAA 5AE4A 3QAXA 3CVGA 4LATA 4R2FA 1FQDA 1LLSA 4JXIA 4NF5B 5CMBA 4AB6A 3TPAA 4JDFA 4G2ZA 3M3LA 3TCFA 1LBCA 1QULA 3IK6B 3MVYA 3T93B 2XXPA 2RC7A 1S9TA 3OO9A 3CFXA 2PT2A 4NF8A 4BDRA 4H8IA 4N6PA 5AA4B 2QS1A 2REJA 5JTYA 4OWDA 1RKMA 5DYHA 4NF6B 1B32A 3K6WA 3KOTA 1SVXB 1XS5A 3OO7A 2ZNTA 5KDTA 3DELB 1QKAA 3PMXA 1B3FA 3SEYA 3PD8A 1RYXA 3BFUA 3G3HA 1LSTA 3SEXA 3TTMA 2I58A 1JEUA 2HEUA 1NH8A 2I4BA 4I62A 1AMFA 1GVCA 3C36A 3TKDA 3FVKA 4QF9A 3TQWA 1LAXA 5DVFA 4DCYA 2HCAA 4LA9A 2AYSA 4UA8A 3OENA 1M5FA 1MY4A 4EDPA 4OEVA 5AA2A 1AOVA 2RINA 2P0SA 3VV5A 4LUBA 2DP8A 1J1NA 1QUJA 2Y7RA 3SERA 4BLAA 1P1QA 2HZKA 3HCQA 3O6GA 5L9OA 2UVHA 2OK2A 3H06B 3BBRA 3M3FA 1XC1A 3HSTA 3GBBA 5J1DA 2X7QA 4KFQA 4NE4A 2DSFA 5CBSA 3T9VA 3TTKA 2Y7PA 2LAOA 4NWCA 3MJNA 1IEJA 1SW4A 1B1HA 2A5SA 2DWJA 2I0BA 2O6AA 3B6QA 3E3KA 3PPOA 4PFYA 1JW1A 4QFOA 4NF4A 5CRYA 4ZZEA 2ZYKA 5AA3A 5ITPA 3TDJA 4RY1A 3SESA 2DXRA 3UIFA 3FXQA 2RC9A 1PBPA 3A3UA 4ISUA 2ONSA 3A09A 3B6WA 4XIGQ 1T0KA 1BLFA 2XXYA 2XXVA 1ZTYA 1P1UA 4TLLB 4IY6A 1B7HA 1S7YA 2DQVA 2FA7A 4F29A 4ZEDA 1Y4CA 4MBPA 4ZECA 1MG1A 3KN7A 1PB9A 4OXVA 2F34A 3TODA 5CMMA 3MZBA 3IR1A 2YLNA 3MAMA 3GXAA 3S2VA 2DWHA 1FQBA 4DXCA 3IB2A 2Z8FA 4HCWA 5DEXA 3LSXA 3M3KA 5EHMA 5K2YA 4QFNA 3U8QA 4TLMB 3MZ9A 3RTFB 1B5JA 1N04A 3QIMA 4JBZA 3VDFA 1B7ZA 1Y1MA 4C0RA 4R6HA 3MVZA 2QMWA 2Z8DA 3PUWE 1MPDA 1FQEA 3MUQA 4FATA 1XVXA 3G3JA 2UVIA 3UP9A 1ZBMA 4FAJA 4OERA 4U1OA 1B58A 3MW0A 3KZGA 2YJPA 4JWYA 3MP8A 4FIMA 4R73A 5EYFA 3RT8A 3VXBA 5ICTA 5JK4A 3K01A 2ZYMA 3TYHA 4I9DA 5L9MA 1ZLQA 1H43A 1N76A 1AL3A 1P1OA 3OSRA 3GLBA 1MY3A 3ILUB 4NF6A 5TU0A 4KI0E 2DE3A 5DEXB 1SDXA 3K6UA 3SEUA 3FGSA 3VVEA 2DE2A 3P7IA 1MH3A 4YMAA 4LQ2A 4QFLA 3T66A 1SBPA 4C1TA 3H3GA 2XXTA 4KYSA 1D4NA 2H5YA 4BDNA 4DCXA 2G29A 5TP9B 3EF7A 1B0LA 4R72A 4FECA 4FEDA 2GHBA 4LVQA 4XKQA 2ABHA 3OELA 4F3BA 3LR1A 1QUIA 5H8HB 2AL4A 3USDA 1I6AA 3K6XA 4F3PA 4R2BA 1R1NA 2O1MA 3FATA 3K4UA 1P99A 2QS2A 3MVWA 4GQOA 4KPTA 4MFIA 4Q0CA 4GVOA 4RK2A 3D4CA 2ZNUA 5B70A 1SW1A 2QRYA 3TTNA 3IO6A 3IO4A 5M2VA 1LFIA 1ZIUA 4Q5TA 4ZEFA 4OFLA 1URGA 3IB1A 1B46A 4IGRA 1OVBA 2Q2CA 4QSEA 4EQ9A 2B3BA 2GRVA 4NTLA 3V8XB 4AQ4A 1R9LA 3H03A 4ELRA 1OIBA 1VSOA 5HPQA 3SEVA 1MQHA 2DVCA 1IQ7A 2ALUA 2O1LA 3ONMA 1I6BA 5I59B 2QS4A 1JQFA 2HAUA 4BDOA 1B4ZA 2RCBA 1FTJA 1SYHA 1NMUA 4U22A 5LOMA 3EHUA 3CFLA 2HZLA 3H7MA 5DVJA 3VE1B 3B6TA 3TQLA 3O2AA 3TTRA 3CG1A 3ZKLA 1B3LA 2WKYA 4RXLA 2HFBA 1L5TA 3VLVA 4ESWA 1M5CA 2V3QA 1UTHB 1O63A 1O64A 4L17A 1MH4A 1MXXA 3TUSA 3C9HA 4LZ8A 3QXMA 3HHGA 1N3WA 2XD3A 3BKIB 4XKRA 1Y3NA 2NOOA 3E9XA 5I56A 3FVNA 3C32A 2O84X 4GXSB 1MXYA 1R6ZA 2HXWA 1TT1A 3B7DA 3K02A 5EHSA 4C1UA 2B65A 2P2AA 2I6EA 2QL3A 2G93A 1UIVA 3CSBA 3IJOB 4LQ5A 2XXHA 3BFTA 2O68A 5L8DA 4OFJA 4PFUA 3SEWA 5H8NB 3IORA 1IXGA 4P0IA 1IXIA 3CFZA 1B9JA 1ZKBA 3LUYA 3V83A 1NFTA 3MP1A 5H8QB 1LAHE 1JNFA 1LBBA 1LCTA 3DP4A 3E13X 3HN0A 3HPIA 3K0VA 4IB2A 1TFDA 3FJMA 1GGGA 2H99A 3IL1B 3KN3A 4JWOA 3N26A 3PPPA 4BDLA 1RYOA 3K1NA 4WXJA 4F3SA 4EXKA 1N3XA 4XKPA 4F3GA 1LB8A 4LZ5A 4M4GA 4ZS9A 2F8DA 3ECRA 4DIGA 5I57B 4R9GA 3OEKA 1ZU0A 2I0CA 3EPEA 1P1WA 3OO6A 1Q1KA 2VOZA 1JEVA 2OZZA 3AXFA 3SKPA 5I2NA 4QFKA 1USYH 3HO7A 3QK6A 4P11A 2IA4A 4KCDA 4EUOA 1B2HA 3CIJA 1B0HA 2Q9TA 4DXBA 5H8FA 3T96B 3QUJA 3S9MC 4Q30B 1XHYA 1EZ9A 3LSFB 1IUDA 3M8UA 3PUXE 2DOJA 3HHFA 5H8FB 5TPAA 1EZPA 2XX9A 4FJPA 3U94A 4YAHX 2KLFA 1LB9A 4H1XA 4ESXA 1OMPA 1BTJA 4EQ7A 1LGBC 3Q29A 3N6UA 2X26A 1CB6A 4U2RA 1Z7ME 3OXNA 2QPQA 5JEIA 4XXUA 1QVSA 2AIXA 3FV2A 3H6UA 5F1QA 4F1UA 4G77A 2D3IA 2XXQA 3PUYE 3N5LA 2XX7A 3CG3A 4PE5B 1GR2A 3OMBA 3KOSA 3TTLA 3D4GA 3C34A 4R75A 1PEBA 2I3WA 1FTLA 5KCJB 1II5A 4KD5A 1BP5A 1JW4A 3RPWA 3MP6A 3RY3A 4HCYA 3PMVA 2HQ0A 2QS3A 2UXAA 3PU5A 2IEEA 2VGQA 3ILTB 3U72A 5AA4A 1Y3PA 4MLQA 2F5XA 1FQAA 4O3CA 4OESA 5HBCA 2VHAA 1GV8A 2YPNA 4RK9A 3UGWA 1QW0A 4GLIA 1US5A 1USYE 1MQGA 2UYFA 4XKNA 3E4RA 4YKPA 3RGYA 2A5TB 4G68A 3UN6A 2HAVA 2XHDA 1MY2A 1FTOA 3VFJA 1JVXA 2O69A 3PMWA 4IY5A 2NWJA 3W15C 2DXYA 2Y84A 1MPCA 3RNNA 3LBSA 2F6PA 4G68B 1B5HA 5FHNA 5IKBA 3C4MA 3KBRA 2Z23A 4NWDA 5I58A 2DYXA 2XD2A 4M1VA 3DP8A 4IO2A 4RJZA 1H44A 1CE2A 1WODA 2GFEA 4IGTA 4NF8B 4ELQA 3RQTA 1M5EA 4XTCQ 3O9PA 3RTWB 5H8QA 2DWAA 1MXVA 2VD3A 4KYDA 4R9FA 2R71A 4GD5A 3SETA 1MY1A 1URDA 2Q2AA 1EH3A 3FXUA 4GXAA 2XXUA 4H5GA 5FTIA 3Q28A 4FORA 5KZTA 1B4HA 4GL0A 4WKMA 4YKJA 3PV0E 2Z8EA 3U1OA 1BIYA 1FCKA 3K1MA 1MQDA 1XT8A 1B52A 2I48A 2Q88A 4RPOA 1JW5A 1PBQA 1YTVA 1IXCA 1F9BA 3JZJA 2V25A 3G3IA 1A40A 3I6VA 1A8FA 4ZDMA 4X1DA 3WAEA 5BWJA 1TFAA 3TZAA 4ND9A 4YZZA 1D3KA 3PUZE 1UIUA 4THIA 4GIZA 3OO8A 2UVGA 3S9EA 2VP1A 1B3EA 3C31A 3JV9A 4KQPA 3LSWA 4YU0A 1B51A 3CSGA 4ZEIA 3RN8A 5AA2B 1PDAA 1ZJLA 3IOTA 5I84A 2PMSA 1N84A 2ZYNA 1JETA 1IIWA 1HSJA 2E1SA 2CZLA 4F18A 1H76A 1S50A 5CI5A 5AA1A 3O6IA 4F39A
chains in the Genus database with same CATH superfamily
4JVCA 1SQYA 1MPBA 4OANA 3IJXB 4QSCA 5A5XA 2ZXTA 5HM4B 4KHZE 2PFZA 3A3CA 1DTGA 1A7LA 1AH5A 1VFDA 3TFLA 4KCCA 4PAFA 4X1BA 2O7IA 1TXFA 4JB7A 3L6GA 2CEYA 4GRKA 5EQ9A 1A99A 3U93A 1POTA 1B05A 4GF8A 1MRPA 1NL5A 4ONYA 1NNFA 1POY1 2X7PA 1FBEA 4YB6A 2VD2A 1DMBA 4DXUA 3IB0A 1MXZA 2UYEA 4PC9A 4LONB 4HS7A 3G3GA 1ATGA 2PVUA 4X9TA 1WDNA 4UACA 5IAIA 4N4UA 2F3BA 2H4IA 4RYAA 2PT1A 3IAZA 2RCAA 4BDQA 3MC2A 3G3KA 2ONRA 1FQFA 4R6KA 1K9YA 1SI0A 4PETA 3T9UA 4HXVA 4NEDA 2RF1A 3MVXA 1Y1ZA 1PB7A 1PC3A 4R74A 2R6GE 2F35A 1SD3A 4JSDA 3MYUA 4NF5A 2DVZA 3R6UA 4PE3A 2OJTA 5CMCA 3FV1A 1NNPA 4F1VA 4MNIA 1PB8A 4H67A 3VLUA 4AB5A 2P3VA 4GFRA 3CI8A 2JJKA 4OMBA 3OD7A 2HXRA 4Z0IA 1LBWA 3JYRA 5FTHA 3D1RA 3ODBA 2V4CA 2ZZWA 4GWOA 2I4CA 4OVJA 3OSQA 3DLNA 5DVIA 2B3FA 5IZ3B 4PCDA 2V3UA 5FHMA 1GTKA 2DS9A 4KR5A 4GBWA 3N6TA 1R9QA 4PP0A 4ECFA 1VR5A 2XWOA 3VXCA 3CR9A 3T9HB 3S4UA 1Z7NE 4O3AA 5H8SA 3MWBA 4F2QA 3VVFA 1DTZA 1EU8A 1DK4A 1JVYA 4DZ1A 1D9QA 3MPLA 3QAXA 3CVGA 4FBPA 4NF5B 2F3DA 4JDFA 4G2ZA 1RDZA 3TCFA 4BDRA 5AA4B 5JTYA 1RKMA 1B32A 3K6WA 3KOTA 1XS5A 1QKAA 3PMXA 3KC1A 3B8BA 3BFUA 4I62A 1GVCA 3TQWA 3TKDA 1LAXA 4DCYA 2KQZA 1J1NA 2Y7RA 4I3YA 3O6GA 3BBRA 5J1DA 5CBSA 4NE4A 3TTKA 5IM2A 4NWCA 2WX9A 2A5SA 5IZZA 2ZYKA 2DXRA 3FXQA 1T0KA 3A09A 2Y5LA 1P1UA 4IY6A 4F29A 4ZEDA 4ZECA 3NOHA 4OXVA 3IR1A 3S2VA 4DXCA 1FQBA 1CNQA 3LSXA 5EHMA 3MZ9A 4C0RA 4R6HA 3MVZA 2QMWA 2XWVA 3PUWE 1FQEA 4H46A 4FATA 3G3JA 1ZBMA 4OERA 4U1OA 5EYFA 4I9DA 3LV0A 2WBDA 2WEFA 3GLBA 1MY3A 5DEXB 1SDXA 3K6UA 2DE2A 3H3GA 4DCXA 3EF7A 2L5VA 4LVQA 3LR1A 1QUIA 2AL4A 1R1NA 3MVWA 5L9SA 4RK2A 2QS2A 4GWZA 2ZNUA 3TTNA 2FIEA 4Q5TA 4OFLA 1URGA 4IGRA 1B46A 4NTLA 1R9LA 3ONMA 1IQ7A 4NN3A 5I59B 1JQFA 2HAUA 1B4ZA 3CFLA 2HZLA 5DVJA 3TQLA 3O2AA 4RXLA 4LZ8A 1FPEA 3E9XA 1LEVA 5EHSA 4C1UA 2B65A 3SEWA 1JP4A 5J16A 1IXGA 4N81A 2CZIA 3LUYA 4GWUA 3DP4A 3E13X 3HPIA 4IB2A 3IL1B 3K1NA 2WYKA 1LB8A 4M4GA 4DIGA 3EPEA 1P1WA 1JEVA 2OZZA 2IA4A 4KCDA 1B0HA 4DXBA 3T96B 1FBDA 3QUJA 4Q30B 4I3EA 3PUXE 1YZ0A 3HHFA 3U94A 4YAHX 1BTJA 1Z7ME 3OXNA 1YYZA 2AIXA 4F1UA 2XXQA 4MMPA 1GR2A 3RPWA 4HCYA 3PMVA 4QXDA 4KXPA 3ILTB 4O3CA 4RK9A 4P56A 3T93B 3RGYA 1USYE 2UYFA 4XKNA 3E4RA 1MY2A 1FTOA 1MPCA 4G68B 1B5HA 5FHNA 2Z23A 4NWDA 5EQAA 2DYXA 1KA1A 2Q8MA 3RQTA 3O9PA 3RTWB 4OVPA 4OVTA 4R9FA 1URDA 2Q2AA 1EH3A 5FTIA 4H5GA 4WKMA 1FCKA 4MIJA 2Q88A 1XT8A 1YTVA 3JZJA 2QFLA 1EYIA 1FJ6A 4X1DA 3TZAA 4MAGA 2MKZA 4PBHA 2VP1A 4YU0A 3C31A 5AA2B 5B70A 4ZEIA 1ZJLA 3IOTA 5I84A 1N84A 2E1SA 1FPFA 4F18A 1H76A 4HW8A 3CRBA 3OEMA 4H5FA 2B4MA 4GWWA 4DE8A 4OEUA 3DP6A 1NV1A 5EQ7A 3QUFA 4F19A 1H45A 2I49A 1Q35A 1B5IA 3H4ZA 3FVGA 4EXLA 3KSXA 5IZ3A 5ESYA 4OETA 3H6WA 2PBWA 2CMOA 5A5XB 4I8CA 5I2NB 3H6VA 3IOUA 3KSJA 1MM7A 2HPGA 1SPIA 3KEIA 2F7CA 2W7YA 4QRZA 2B4LA 1VFEA 5JTYB 3C33A 2ANJA 3LSLA 3MPKA 1IZ1A 2BJJX 3CHGA 2OWSA 1LAFE 2OX3A 4QFPA 3HFUA 4XF5A 2OLBA 4O3BA 2KR0A 4POWA 3Q25A 4OTEA 3PPRA 2NVUB 1N7WA 2F7AA 5I2KA 3MZ1A 1LCFA 1I6QA 5T3JA 1SYIA 1XVYA 2V93A 4MF3A 1B40A 2V84A 2XXIA 1VE4A 1FQCA 4NMYA 5CI5A 4G68C 3KG2A 4NQ8A 2D21A 4F31B 5F7VA 1YAEA 1SI1A 4ZEBA 5I59A 3MSTA 1FW0A 4RNSA 1N7XA 3O28A 1FBGA 4OHNA 1IITA 1IXHA 2XA5A 1DBZA 2Y7WA 4IO6A 4NF4B 1ANFA 1EYKA 2PYYA 4P0GA 2XXWA 1NH7A 4N8YA 3EQ1A 3FD3A 2UVJA 5ET8A 2RC8A 4O7IA 5LTCA 1RDYA 1UTBB 3IX1A 1AIVA 1B7UA 3FXBA 3TELA 2Z22A 5TP9A 1H3DA 1OQHA 3RLFE 1MM6A 3IOVA 3PTYA 5EYHA 3TEPA 1OQGA 4HE2A 5CBRA 4QHQA 3Q27A 2XXXA 2F7BA 3C35A 3UA8A 1QKBA 4U1ZA 3O97A 3K1PA 1DSNA 2P1SA 2F36A 4U21A 4QBAA 3RUMA 4MLVA 1BKAA 4R2FA 5CMBA 4AB6A 1LBCA 3OO9A 4PBQA 5DYHA 3OO7A 5KDTA 3DELB 3PD8A 3SEXA 1LSTA 1JEUA 2HEUA 1NH8A 2I4BA 3U8QA 3FVKA 5DVFA 2HCAA 3OENA 1M5FA 4EDPA 5AA2A 2P0SA 3BIGA 1P1QA 2HZKA 3H06B 2OK2A 2DSFA 2I0BA 3PPOA 3E3KA 4QFOA 5CRYA 3UIFA 1NV2A 1PBPA 4ISUA 1RDXA 1BLFA 4PAKA 4TLLB 2FA7A 1Y4CA 4GX3A 2QVRA 1XI6A 1PB9A 1FJ9A 3TODA 3MZBA 2YLNA 1LBYA 1B5JA 3QIMA 3VDFA 4JBZA 1B7ZA 1KA0A 1Y1MA 2Z8DA 1MPDA 4NF0A 3UP9A 2UVIA 4FAJA 3MW0A 4JWYA 5JK4A 4R73A 3RT8A 5ICTA 3K01A 3TYHA 4MJOA 1H43A 1N76A 4N15A 1FTAA 5I3SA 3SEUA 4PFBA 3VVEA 1SBPA 4C1TA 4GBVA 3T1BA 2G29A 4NAPA 1B0LA 4XKQA 3OELA 4F3BA 4F3PA 3FATA 3K4UA 4Q0CA 2QRYA 4QSEA 3FBPA 1VSOA 2O1LA 4BDOA 2RCBA 3KBZA 4ESWA 1B3LA 2WKYA 3VLVA 1M5CA 1UTHB 1O64A 1MH4A 2P3NA 4XKRA 1TT1A 2I6EA 2QL3A 3IJOB 4PFUA 1NV3A 1B9JA 1NFTA 3MP1A 1LAHE 1LCTA 4YZZA 3K0VA 2H99A 4JWOA 4P3LA 1RYOA 4WXJA 4EXKA 1N3XA 4XKPA 4LZ5A 4ZS9A 1FPLA 2F8DA 4R9GA 2I0CA 3AXFA 4QFKA 3CIJA 2FVZA 2OWZA 3S9MC 3LSFB 2DOJA 2XWIA 4DI4B 4H1XA 1OMPA 3Q29A 2X26A 1CB6A 5JEIA 2QPQA 1QVSA 2XX7A 3D4GA 3C34A 1PEBA 2I3WA 1FTLA 1II5A 4KD5A 2HQ0A 3PU5A 2IEEA 3U72A 4OESA 4PDDA 5HBCA 1GV8A 4AS5A 1US5A 3UN6A 4G68A 3VFJA 3PMWA 2NWJA 2DXYA 2Y84A 3C4MA 2XD2A 1H44A 5H8QA 4KYDA 1MXVA 4I40A 3Q28A 5KZTA 2GQ1A 4YKJA 3PV0E 3U1OA 4NX1A 4RPOA 1NUYA 1FPBA 1LBXA 1PBQA 2V25A 2FIXA 3G3IA 1A40A 3WAEA 1TFAA 3OO8A 3S9EA 4KQPA 2PMSA 5IZ1A 1IIWA 2CZLA 1NV0A 2QSXA 4U4XA 2CZKA 2REGA 4AS4A 4DI3D 5DT6A 3THIA 3K2DA 4E0XA 2D5WA 3V89B 4YB5A 2Q8JA 1IMEA 2BJIA 4YKKA 4ZE9A 5ITOA 1URSA 2THIA 3SDFA 4OENA 2DWIA 1QJMA 4OZ9A 1I69A 3ZS6A 2I3VA 1NUZA 5KCJA 4N13A 1IMBA 1MXWA 3KJTA 4LP2B 1MDQA 4GWXA 3T9XB 3GYYA 5CC2A 1YCJA 3O29A 1OVTA 1EYJA 1QUKA 5TPAB 3UORA 1FTMA 1NKXA 3E79A 3TAJA 4Z7EA 4X48A 3A29A 4I1DA 3G7WA 4JSOA 4OVQA 1MY0A 3MBPA 4G4PA 2GH9A 4OFOA 2XWKA 4YKIA 2ZYOA 1TWYA 4POXA 5H8NA 2NXOA 4G8NA 3FZVA 4DLDA 3GBAA 3EHSA 4MHFA 2H9BA 1B1XA 3PUVE 3I3VA 5I5PA 3V5AA 4PF6A 2PX1A 4OQOA 4ELOA 1HSLA 4H6DA 5I56B 2F97A 1LFHA 3FUZA 1EZOA 1A8EA 1OLAA 4EF1A 3S9LC 1YPNA 2AL5A 4MH5A 4PFRA 5I57A 2Q89A 3IFAA 3T22A 3EN3A 4ZZAA 4YB7A 4RA1A 3W9WA 3FJ7A 3N94A 2QJEA 4GOTA 3T0JA 5K2XA 1Y3QA 1US4A 1AWBA 2A5TA 1SW5A 2F6GA 1LAGE 5I58A 2E0SA 5AE4A 3PD9A 3KJ7A 2FHYA 3ISPA 2ZZVA 4RPNA 1XOCA 3TMGA 1M5BA 4IO3A 5I7IA 3PPQA 2CEXA 3W9VA 3S9NC 1D9YA 4X8RA 4F1YA 2ZNSA 3TCHA 5ICQA 4TQUQ 5LDZA 4N17A 4R6YA 1FBPA 3FASA 3L6HA 4IO7A 1FSAA 4JXIA 3TPAA 4MNPA 3RPLB 3MVYA 2XXPA 2RC7A 4PTKA 1K9ZA 3CFXA 2PT2A 4H8IA 2QS1A 2REJA 4OWDA 4NF6B 4PGNA 1SVXB 1INPA 1RYXA 3TTMA 1AMFA 4QF9A 2AYSA 4UA8A 1MY4A 4OEVA 1AOVA 2RINA 3VV5A 2DP8A 4PDHA 1QUJA 3SERA 5L9OA 4BLAA 3HCQA 3HSTA 2X7QA 4KFQA 2QVUA 5DW8A 1SW4A 4PFYA 1B1HA 2DWJA 2O6AA 3B6QA 1JW1A 4MNCA 4ZZEA 4RY1A 3SESA 5ET5A 2ONSA 2Y5KA 1NV4A 2XXYA 1ZTYA 4MBPA 1NV6A 3KN7A 5CMMA 3MAMA 3GXAA 3IB2A 5DEXA 5K2YA 3M3KA 5ET6A 1XVXA 1G0HA 2YJPA 3RPLA 3VXBA 2ZYMA 1ZLQA 4NF6A 5TU0A 3P7IA 4YMAA 4BDNA 2H5YA 4O8MA 2R8TA 2FBPA 4R72A 4FECA 2ABHA 5H8HB 3USDA 3SETA 4MFIA 1IMAA 2O1MA 4GQOA 1P99A 4KPTA 4GVOA 1SW1A 4MX6A 3IO6A 3IO4A 1LFIA 1ZIUA 2Q2CA 4EQ9A 4AQ4A 3H03A 5HPQA 4O7MA 1MQHA 4JVDA 1FPDA 2QS4A 1NMUA 5LOMA 1FBFA 3H7MA 3VE1B 3TTRA 2HFBA 2V3QA 1O63A 4L17A 3TUSA 3QXMA 3HHGA 2XD3A 3BKIB 4P47A 5I56A 3FVNA 1MXYA 2HXWA 3B7DA 4OA4A 1UIVA 2O68A 5L8DA 5H8NB 4PGPA 3IORA 1FPKA 4P0IA 5H8QB 4MEVA 3FJMA 1FBHA 4F3GA 1Q9DA 5I57B 3OEKA 1ZU0A 2PCRA 3SKPA 5I2NA 1KZ8A 3HO7A 3QK6A 1B2HA 1YXIA 1XHYA 1EZ9A 1IUDA 2VPOA 5H8FB 4FJPA 4ESXA 4EQ7A 3N6UA 4U2RA 3FV2A 5F1QA 2VPNA 3N5LA 4OVRA 3OMBA 1FPGA 3KOSA 3TTLA 4R75A 1BP5A 1JW4A 2UXAA 2F5XA 1FQAA 3UGWA 5A5LA 2YPNA 2A5TB 2XHDA 3W15C 1JVXA 2O69A 4IY5A 3LUZA 3LBSA 5IKBA 1LBZA 4RJZA 1CE2A 1WODA 4IGTA 1M5EA 1MY1A 3RYDA 4FORA 1B4HA 4GL0A 2QVVA 2Z8EA 1BIYA 1B52A 1JW5A 1F9BA 1A8FA 5BWJA 4ND9A 1D3KA 4THIA 1UIUA 4GIZA 2UVGA 4Q8RA 3JV9A 3LSWA 3CSGA 1JETA 1S50A 5AA1A 3R26A 4GWSA 2M8CA 4WEDA 5CMKA 1MS7A 4ELPA 2F78A 1M5DA 4U4SA 3K00A 4TOZA 1IMFA 2ZMBA 5AA2D 3U92A 1UTBA 4EF2A 3OOAA 4N6KA 3TCGA 1ZMGA 4P8BA 4GX4A 1KWHA 5CM6A 5I58B 3GZGA 5ELVA 4YMBA 2NUVA 3UK4A 3FIRA 4XFEA 1UQWA 2XXRA 4QFLA 1DOTA 2OWTA 3H6TA 1SW2A 1DPPA 1P1NA 3O6HA 2HHMA 4QSDA 4H45A 1A54A 2VT5A 1NV5A 1Y9UA 2XXKA 4K3FA 5DTBA 3RT6B 3MQ9A 3WAFA 4OYVA 2V3TA 4FE8A 3IOWA 2Y7KA 3FVOA 4E0WA 2O51A 1Y20A 4FEBA 4X04A 2OCUA 5I2KB 5KDTB 4PQJA 1NNKA 4WEPA 5B7DA 4F22A 1N0TA 2RKMA 5ISUA 5FHOA 2FNCA 1DPEA 1IMCA 4ZE8A 1MXUA 2H98A 4F2OA 1O7TA 3KN8A 3QYTA 2H25A 2O7UA 3G3FA 5H8HA 3VLWA 3F11A 3PPNA 1NUWA 3HV1A 4U23A 1ELJA 3B50A 4PFTA 1HSEA 2R9JA 2OBGA 4N6DA 1MQJA 4BDMA 3KFMA 4GL8A 3Q26A 1MDP1 2CZHA 5BUUA 3EKIA 3ZKKA 3EHTA 1Y4TA 2QMXA 4EQBA 3DM0A 4DDDA 1B3GA 4JWXA 1QGXA 4LZ7A 1A55A 3O66A 4N8GA 4YICA 4O94A 4H0WA 1OLCA 4GWYA 3BIHA 4G8HA 4G8MA 2ESNA 2FYIA 3FXRA 5EQ8A 1LFGA 4H65A 3VVDA 2Y7IA 4HE0A 1B6HA 1MQIA 3ZSFA 4XEQA 1D9VA 1WVJA 2GHAA 2DE4A 2WYPA 2ONKE 1FTKA 2DDKA 1NUXA 4KYEA 1NNTA 4IO5A 4H8JA 3R7XA 1BK4A 4HTGA 1UTHA 3FJGA 3PGFA 2XX8A 4PFWA 4MCOA 1B3HA 3KGCA 3K6VA 4GX6A 4N07A 4IO4A 3I5OA 3LC8A 3QSLA 4ZEKA 4LATA 1FQDA 1LLSA 3U65A 3M3LA 1QULA 3IK6B 1S9TA 4NF8A 4N6PA 4P1LA 2ZNTA 1B3FA 3SEYA 3G3HA 2I58A 3C36A 4LA9A 1NI9A 4LUBA 2UVHA 3M3FA 1XC1A 3GBBA 3T9VA 2Y7PA 2LAOA 3MJNA 1IEJA 2PFYA 4NF4A 5AA3A 5ITPA 3TDJA 2RC9A 3A3UA 3B6WA 4XIGQ 2XXVA 1B7HA 1S7YA 2DQVA 1MG1A 2F34A 2DWHA 5EYGA 2Z8FA 3KC0A 4HCWA 4QFNA 4TLMB 3RTFB 1N04A 4PAIA 2Q74A 3MUQA 1NV7A 3ROJA 1B58A 3KZGA 3MP8A 4FIMA 5FBPA 5L9MA 4PF8A 1AL3A 1P1OA 3OSRA 3IFCA 3ILUB 4KI0E 1FRPA 2DE3A 3FGSA 1MH3A 1FPJA 4LQ2A 3T66A 2XXTA 4KYSA 1D4NA 5TP9B 4FEDA 2GHBA 1FPIA 1I6AA 3K6XA 4R2BA 4G61A 3D4CA 5M2VA 4ZEFA 3E78A 3IB1A 1OVBA 2B3BA 2GRVA 3V8XB 5ET7A 4ELRA 4JVIA 1OIBA 4PFIA 3SEVA 2DVCA 2ALUA 1I6BA 1FTJA 1SYHA 4U22A 3EHUA 3B6TA 3ZKLA 3CG1A 1L5TA 1MXXA 3C9HA 1N3WA 4NGUA 1Y3NA 1VDWA 2NOOA 3C32A 2O84X 4GXSB 1R6ZA 3K02A 2P2AA 2G93A 3CSBA 4IR8A 4LQ5A 2XXHA 3BFTA 4OFJA 1IXIA 3CFZA 1ZKBA 3V83A 4NG7A 1JNFA 1LBBA 3HN0A 1TFDA 1GGGA 3KN3A 3N26A 3PPPA 4BDLA 4F3SA 4P9KA 5IGAA 3ECRA 3OO6A 1Q1KA 2VOZA 4N91A 1USYH 4P11A 4EUOA 1G0IA 2Q9TA 5H8FA 3M8UA 5TPAA 1EZPA 2XX9A 2KLFA 1IMDA 1LB9A 4NHBA 4P1EA 1LGBC 3QMFA 4XXUA 3H6UA 4G77A 2D3IA 4OVSA 3PUYE 3CG3A 4PE5B 1DCUA 5KCJB 3RY3A 3MP6A 2QS3A 2VGQA 5F24A 1Y3PA 4MLQA 5AA4A 2VHAA 1QW0A 4GLIA 1MQGA 4HE1A 4YKPA 1FBCA 2HAVA 3RNNA 2F6PA 3KBRA 4M1VA 3DP8A 4IO2A 3SZPA 2GFEA 4NF8B 4ELQA 4XTCQ 2DWAA 2VD3A 2R71A 4GD5A 3FXUA 4GXAA 2XXUA 4UABA 3K1MA 1MQDA 2I48A 1LBVA 1IXCA 2ZZXA 3I6VA 4ZDMA 3PUZE 1B3EA 3RN8A 1B51A 1PDAA 2ZYNA 1HSJA 4LN5A 2WBBA 3O6IA 4F39A
chains in the Genus database with same CATH topology
4HW8A 2QSXA 3R26A 3RLFE 1SQYA 3CRBA 3OEMA 4H5FA 4U4XA 1MPBA 2REGA 2M8CA 3IJXB 4OEUA 4QSCA 4WEDA 3DP6A 4DE8A 5A5XA 5DT6A 2ZXTA 5HM4B 5CMKA 3THIA 3K2DA 1MS7A 4KHZE 2F78A 4ONYA 4ELPA 4E0XA 3QUFA 1M5DA 4F19A 1H45A 2D5WA 1DTGA 3A3CA 3K00A 4TOZA 4U4SA 4YB5A 3V89B 2Q8JA 2I49A 1Q35A 2ZMBA 1A7LA 5AA2D 1AH5A 1B5IA 3U92A 3H4ZA 3FVGA 1VFDA 1UTBA 3TFLA 3OOAA 4YKKA 3TCGA 4EF2A 5ITOA 4ZE9A 4KCCA 4X1BA 2O7IA 1ZMGA 1TXFA 4EXLA 1URSA 2THIA 1KWHA 3KSXA 3L6GA 2DWIA 3GZGA 4JB7A 4OENA 3SDFA 5CM6A 5I58B 1QJMA 5ELVA 4OZ9A 4YMBA 2NUVA 4GRKA 1I69A 4OETA 1A99A 3H6WA 3FIRA 3U93A 3UK4A 1POTA 2PBWA 3ZS6A 1B05A 2I3VA 2CMOA 5KCJA 4N13A 4GF8A 5A5XB 1MRPA 1MXWA 1NL5A 1UQWA 2XXRA 1NNFA 3KJTA 1DOTA 3H6VA 3IOUA 4I8CA 4LP2B 1POY1 1MDQA 2OWTA 5I2NB 3H6TA 1SW2A 3KSJA 3T9XB 1MM7A 3KEIA 2X7PA 2F7CA 1DPPA 1P1NA 2W7YA 5CC2A 4YB6A 3O6HA 2VD2A 4QRZA 4QSDA 1VFEA 1DMBA 1YCJA 3C33A 1OVTA 3O29A 5JTYB 1QUKA 2ANJA 5TPAB 3UORA 1A54A 4DXUA 3IB0A 1Y9UA 3LSLA 3MPKA 1FTMA 1IZ1A 1NKXA 2BJJX 3TAJA 5L9SA 1MXZA 4Z7EA 4K3FA 2OWSA 4X48A 5DTBA 1LAFE 2UYEA 3RT6B 4I1DA 3MQ9A 4LONB 3WAFA 4HS7A 4OYVA 2V3TA 4FE8A 3IOWA 2Y7KA 3FVOA 3G7WA 3G3GA 1ATGA 4JSOA 4QFPA 4E0WA 2O51A 1Y20A 1MY0A 2OLBA 4O3BA 2PVUA 4FEBA 4X9TA 1WDNA 4POWA 2OCUA 3Q25A 4UACA 3MBPA 4OTEA 5IAIA 3PPRA 5I2KB 5KDTB 4G4PA 4PQJA 1NNKA 2GH9A 4WEPA 2NVUB 2H4IA 1N7WA 5B7DA 4F22A 4RYAA 1N0TA 2F7AA 2PT1A 3IAZA 5I2KA 3MZ1A 3PD9A 4OFOA 1LCFA 2RKMA 4YKIA 5ISUA 2RCAA 2ZYOA 4BDQA 1I6QA 5FHOA 2FNCA 1DPEA 1SYIA 1XVYA 2V93A 4MF3A 1B40A 2V84A 3MC2A 2XXIA 1TWYA 4ZE8A 4POXA 5H8NA 1MXUA 2NXOA 4G8NA 2H98A 1VE4A 3FZVA 2ONRA 3G3KA 4DLDA 4F2OA 1FQCA 1FQFA 1O7TA 3GBAA 3KN8A 2H25A 2O7UA 3QYTA 3G3FA 4NMYA 4R6KA 3EHSA 5H8HA 3VLWA 2H9BA 1SI0A 4G68C 3KG2A 2D21A 1B1XA 3F11A 3PPNA 3PUVE 3HV1A 4PETA 4U23A 1ELJA 3I3VA 4NEDA 3T9UA 4Q8RA 2RF1A 4PFTA 4F31B 1HSEA 2R9JA 3MVXA 2OBGA 1Y1ZA 1PB7A 5F7VA 1PC3A 4R74A 1YAEA 1SI1A 1MQJA 3V5AA 2R6GE 2PX1A 4BDMA 4OQOA 3KFMA 4ELOA 4ZEBA 1HSLA 2F35A 4H6DA 4GL8A 1SD3A 1MDP1 3Q26A 4JSDA 5I56B 5I59A 2F97A 1LFHA 1FW0A 3FUZA 4NF5A 1EZOA 5BUUA 1A8EA 1OLAA 2DVZA 3R6UA 4RNSA 1N7XA 1YPNA 2OJTA 3ZKKA 4EF1A 3S9LC 3O28A 5CMCA 3FV1A 1NNPA 3EHTA 1Y4TA 2QMXA 4OHNA 4F1VA 2AL5A 1PB8A 1IITA 4EQBA 4H67A 3DM0A 4MH5A 3VLUA 5I57A 4AB5A 2Q89A 1IXHA 4DDDA 1B3GA 2Y7WA 4JWXA 4GFRA 3CI8A 4IO6A 3T22A 4OMBA 3OD7A 3EN3A 4NF4B 4LZ7A 4Z0IA 1A55A 4YB7A 4RA1A 4ZZAA 3O66A 3W9WA 3FJ7A 1ANFA 4YICA 3JYRA 3N94A 1OLCA 4H0WA 4G8HA 2PYYA 4G8MA 5FTHA 4P0GA 2QJEA 2XXWA 4GOTA 1NH7A 2ESNA 2FYIA 3FXRA 3EQ1A 3ODBA 3FD3A 5K2XA 2UVJA 1LFGA 1US4A 1Y3QA 4GWOA 2I4CA 2RC8A 4OVJA 4H65A 2A5TA 3OSQA 3DLNA 1SW5A 1UTBB 3IX1A 2F6GA 3VVDA 1AIVA 2Y7IA 5DVIA 1B6HA 1MQIA 1B7UA 3TELA 2Z22A 2B3FA 3ZSFA 1LAGE 5TP9A 1H3DA 1OQHA 2E0SA 1D9VA 2V3UA 1WVJA 2GHAA 1MM6A 2DE4A 3IOVA 2ONKE 3KJ7A 1GTKA 2DS9A 1XOCA 4KR5A 1FTKA 4RPNA 5FHMA 3TMGA 3N6TA 1R9QA 1M5BA 4PP0A 1VR5A 4ECFA 4IO3A 3TEPA 3VXCA 1OQGA 3CR9A 4KYEA 1NNTA 4IO5A 3T9HB 4H8JA 3R7XA 3S4UA 3PPQA 5CBRA 1Z7NE 4QHQA 4O3AA 5H8SA 3Q27A 3MWBA 3W9VA 4HTGA 3S9NC 1UTHA 1D9YA 3FJGA 3PGFA 4F1YA 4F2QA 2ZNSA 3TCHA 2XX8A 3VVFA 5ICQA 2XXXA 4PFWA 1DTZA 4TQUQ 2F7BA 3C35A 3UA8A 1EU8A 1QKBA 3O97A 4R6YA 3K1PA 4U1ZA 1B3HA 1DSNA 2P1SA 3KGCA 3K6VA 1JVYA 4N07A 2F36A 4DZ1A 4IO4A 3I5OA 3LC8A 3QSLA 4U21A 3MPLA 3RUMA 3FASA 3L6HA 4MLVA 4ZEKA 4IO7A 1BKAA 5AE4A 3QAXA 3CVGA 4LATA 4R2FA 1FQDA 1LLSA 4JXIA 4NF5B 5CMBA 4AB6A 3TPAA 4JDFA 4G2ZA 3M3LA 3TCFA 1LBCA 1QULA 3IK6B 3MVYA 3T93B 2XXPA 2RC7A 1S9TA 3OO9A 3CFXA 2PT2A 4NF8A 4BDRA 4H8IA 4N6PA 5AA4B 2QS1A 2REJA 5JTYA 4OWDA 1RKMA 5DYHA 4NF6B 1B32A 3K6WA 3KOTA 1SVXB 1XS5A 3OO7A 2ZNTA 5KDTA 3DELB 1QKAA 3PMXA 1B3FA 3SEYA 3PD8A 1RYXA 3BFUA 3G3HA 1LSTA 3SEXA 3TTMA 2I58A 1JEUA 2HEUA 1NH8A 2I4BA 4I62A 1AMFA 1GVCA 3C36A 3TKDA 3FVKA 4QF9A 3TQWA 1LAXA 5DVFA 4DCYA 2HCAA 4LA9A 2AYSA 4UA8A 3OENA 1M5FA 1MY4A 4EDPA 4OEVA 5AA2A 1AOVA 2RINA 2P0SA 3VV5A 4LUBA 2DP8A 1J1NA 1QUJA 2Y7RA 3SERA 4BLAA 1P1QA 2HZKA 3HCQA 3O6GA 5L9OA 2UVHA 2OK2A 3H06B 3BBRA 3M3FA 1XC1A 3HSTA 3GBBA 5J1DA 2X7QA 4KFQA 4NE4A 2DSFA 5CBSA 3T9VA 3TTKA 2Y7PA 2LAOA 4NWCA 3MJNA 1IEJA 1SW4A 1B1HA 2A5SA 2DWJA 2I0BA 2O6AA 3B6QA 3E3KA 3PPOA 4PFYA 1JW1A 4QFOA 4NF4A 5CRYA 4ZZEA 2ZYKA 5AA3A 5ITPA 3TDJA 4RY1A 3SESA 2DXRA 3UIFA 3FXQA 2RC9A 1PBPA 3A3UA 4ISUA 2ONSA 3A09A 3B6WA 4XIGQ 1T0KA 1BLFA 2XXYA 2XXVA 1ZTYA 1P1UA 4TLLB 4IY6A 1B7HA 1S7YA 2DQVA 2FA7A 4F29A 4ZEDA 1Y4CA 4MBPA 4ZECA 1MG1A 3KN7A 1PB9A 4OXVA 2F34A 3TODA 5CMMA 3MZBA 3IR1A 2YLNA 3MAMA 3GXAA 3S2VA 2DWHA 1FQBA 4DXCA 3IB2A 2Z8FA 4HCWA 5DEXA 3LSXA 3M3KA 5EHMA 5K2YA 4QFNA 3U8QA 4TLMB 3MZ9A 3RTFB 1B5JA 1N04A 3QIMA 4JBZA 3VDFA 1B7ZA 1Y1MA 4C0RA 4R6HA 3MVZA 2QMWA 2Z8DA 3PUWE 1MPDA 1FQEA 3MUQA 4FATA 1XVXA 3G3JA 2UVIA 3UP9A 1ZBMA 4FAJA 4OERA 4U1OA 1B58A 3MW0A 3KZGA 2YJPA 4JWYA 3MP8A 4FIMA 4R73A 5EYFA 3RT8A 3VXBA 5ICTA 5JK4A 3K01A 2ZYMA 3TYHA 4I9DA 5L9MA 1ZLQA 1H43A 1N76A 1AL3A 1P1OA 3OSRA 3GLBA 1MY3A 3ILUB 4NF6A 5TU0A 4KI0E 2DE3A 5DEXB 1SDXA 3K6UA 3SEUA 3FGSA 3VVEA 2DE2A 3P7IA 1MH3A 4YMAA 4LQ2A 4QFLA 3T66A 1SBPA 4C1TA 3H3GA 2XXTA 4KYSA 1D4NA 2H5YA 4BDNA 4DCXA 2G29A 5TP9B 3EF7A 1B0LA 4R72A 4FECA 4FEDA 2GHBA 4LVQA 4XKQA 2ABHA 3OELA 4F3BA 3LR1A 1QUIA 5H8HB 2AL4A 3USDA 1I6AA 3K6XA 4F3PA 4R2BA 1R1NA 2O1MA 3FATA 3K4UA 1P99A 2QS2A 3MVWA 4GQOA 4KPTA 4MFIA 4Q0CA 4GVOA 4RK2A 3D4CA 2ZNUA 5B70A 1SW1A 2QRYA 3TTNA 3IO6A 3IO4A 5M2VA 1LFIA 1ZIUA 4Q5TA 4ZEFA 4OFLA 1URGA 3IB1A 1B46A 4IGRA 1OVBA 2Q2CA 4QSEA 4EQ9A 2B3BA 2GRVA 4NTLA 3V8XB 4AQ4A 1R9LA 3H03A 4ELRA 1OIBA 1VSOA 5HPQA 3SEVA 1MQHA 2DVCA 1IQ7A 2ALUA 2O1LA 3ONMA 1I6BA 5I59B 2QS4A 1JQFA 2HAUA 4BDOA 1B4ZA 2RCBA 1FTJA 1SYHA 1NMUA 4U22A 5LOMA 3EHUA 3CFLA 2HZLA 3H7MA 5DVJA 3VE1B 3B6TA 3TQLA 3O2AA 3TTRA 3CG1A 3ZKLA 1B3LA 2WKYA 4RXLA 2HFBA 1L5TA 3VLVA 4ESWA 1M5CA 2V3QA 1UTHB 1O63A 1O64A 4L17A 1MH4A 1MXXA 3TUSA 3C9HA 4LZ8A 3QXMA 3HHGA 1N3WA 2XD3A 3BKIB 4XKRA 1Y3NA 2NOOA 3E9XA 5I56A 3FVNA 3C32A 2O84X 4GXSB 1MXYA 1R6ZA 2HXWA 1TT1A 3B7DA 3K02A 5EHSA 4C1UA 2B65A 2P2AA 2I6EA 2QL3A 2G93A 1UIVA 3CSBA 3IJOB 4LQ5A 2XXHA 3BFTA 2O68A 5L8DA 4OFJA 4PFUA 3SEWA 5H8NB 3IORA 1IXGA 4P0IA 1IXIA 3CFZA 1B9JA 1ZKBA 3LUYA 3V83A 1NFTA 3MP1A 5H8QB 1LAHE 1JNFA 1LBBA 1LCTA 3DP4A 3E13X 3HN0A 3HPIA 3K0VA 4IB2A 1TFDA 3FJMA 1GGGA 2H99A 3IL1B 3KN3A 4JWOA 3N26A 3PPPA 4BDLA 1RYOA 3K1NA 4WXJA 4F3SA 4EXKA 1N3XA 4XKPA 4F3GA 1LB8A 4LZ5A 4M4GA 4ZS9A 2F8DA 3ECRA 4DIGA 5I57B 4R9GA 3OEKA 1ZU0A 2I0CA 3EPEA 1P1WA 3OO6A 1Q1KA 2VOZA 1JEVA 2OZZA 3AXFA 3SKPA 5I2NA 4QFKA 1USYH 3HO7A 3QK6A 4P11A 2IA4A 4KCDA 4EUOA 1B2HA 3CIJA 1B0HA 2Q9TA 4DXBA 5H8FA 3T96B 3QUJA 3S9MC 4Q30B 1XHYA 1EZ9A 3LSFB 1IUDA 3M8UA 3PUXE 2DOJA 3HHFA 5H8FB 5TPAA 1EZPA 2XX9A 4FJPA 3U94A 4YAHX 2KLFA 1LB9A 4H1XA 4ESXA 1OMPA 1BTJA 4EQ7A 1LGBC 3Q29A 3N6UA 2X26A 1CB6A 4U2RA 1Z7ME 3OXNA 2QPQA 5JEIA 4XXUA 1QVSA 2AIXA 3FV2A 3H6UA 5F1QA 4F1UA 4G77A 2D3IA 2XXQA 3PUYE 3N5LA 2XX7A 3CG3A 4PE5B 1GR2A 3OMBA 3KOSA 3TTLA 3D4GA 3C34A 4R75A 1PEBA 2I3WA 1FTLA 5KCJB 1II5A 4KD5A 1BP5A 1JW4A 3RPWA 3MP6A 3RY3A 4HCYA 3PMVA 2HQ0A 2QS3A 2UXAA 3PU5A 2IEEA 2VGQA 3ILTB 3U72A 5AA4A 1Y3PA 4MLQA 2F5XA 1FQAA 4O3CA 4OESA 5HBCA 2VHAA 1GV8A 2YPNA 4RK9A 3UGWA 1QW0A 4GLIA 1US5A 1USYE 1MQGA 2UYFA 4XKNA 3E4RA 4YKPA 3RGYA 2A5TB 4G68A 3UN6A 2HAVA 2XHDA 1MY2A 1FTOA 3VFJA 1JVXA 2O69A 3PMWA 4IY5A 2NWJA 3W15C 2DXYA 2Y84A 1MPCA 3RNNA 3LBSA 2F6PA 4G68B 1B5HA 5FHNA 5IKBA 3C4MA 3KBRA 2Z23A 4NWDA 5I58A 2DYXA 2XD2A 4M1VA 3DP8A 4IO2A 4RJZA 1H44A 1CE2A 1WODA 2GFEA 4IGTA 4NF8B 4ELQA 3RQTA 1M5EA 4XTCQ 3O9PA 3RTWB 5H8QA 2DWAA 1MXVA 2VD3A 4KYDA 4R9FA 2R71A 4GD5A 3SETA 1MY1A 1URDA 2Q2AA 1EH3A 3FXUA 4GXAA 2XXUA 4H5GA 5FTIA 3Q28A 4FORA 5KZTA 1B4HA 4GL0A 4WKMA 4YKJA 3PV0E 2Z8EA 3U1OA 1BIYA 1FCKA 3K1MA 1MQDA 1XT8A 1B52A 2I48A 2Q88A 4RPOA 1JW5A 1PBQA 1YTVA 1IXCA 1F9BA 3JZJA 2V25A 3G3IA 1A40A 3I6VA 1A8FA 4ZDMA 4X1DA 3WAEA 5BWJA 1TFAA 3TZAA 4ND9A 4YZZA 1D3KA 3PUZE 1UIUA 4THIA 4GIZA 3OO8A 2UVGA 3S9EA 2VP1A 1B3EA 3C31A 3JV9A 4KQPA 3LSWA 4YU0A 1B51A 3CSGA 4ZEIA 3RN8A 5AA2B 1PDAA 1ZJLA 3IOTA 5I84A 2PMSA 1N84A 2ZYNA 1JETA 1IIWA 1HSJA 2E1SA 2CZLA 4F18A 1H76A 1S50A 5CI5A 5AA1A 3O6IA 4F39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HW8 A;  2QSX A;  3R26 A;  3RLF E;  1SQY A;  3CRB A;  3OEM A;  4H5F A;  4U4X A;  1MPB A;  2REG A;  2M8C A;  3IJX B;  4OEU A;  4QSC A;  4WED A;  3DP6 A;  4DE8 A;  5A5X A;  5DT6 A;  2ZXT A;  5HM4 B;  5CMK A;  3THI A;  3K2D A;  1MS7 A;  4KHZ E;  2F78 A;  4ONY A;  4ELP A;  4E0X A;  3QUF A;  1M5D A;  4F19 A;  1H45 A;  2D5W A;  1DTG A;  3A3C A;  3K00 A;  4TOZ A;  4U4S A;  4YB5 A;  3V89 B;  2Q8J A;  2I49 A;  1Q35 A;  2ZMB A;  1A7L A;  5AA2 D;  1AH5 A;  1B5I A;  3U92 A;  3H4Z A;  3FVG A;  1VFD A;  1UTB A;  3TFL A;  3OOA A;  4YKK A;  3TCG A;  4EF2 A;  5ITO A;  4ZE9 A;  4KCC A;  4X1B A;  2O7I A;  1ZMG A;  1TXF A;  4EXL A;  1URS A;  2THI A;  1KWH A;  3KSX A;  3L6G A;  2DWI A;  3GZG A;  4JB7 A;  4OEN A;  3SDF A;  5CM6 A;  5I58 B;  1QJM A;  5ELV A;  4OZ9 A;  4YMB A;  2NUV A;  4GRK A;  1I69 A;  4OET A;  1A99 A;  3H6W A;  3FIR A;  3U93 A;  3UK4 A;  1POT A;  2PBW A;  3ZS6 A;  1B05 A;  2I3V A;  2CMO A;  5KCJ A;  4N13 A;  4GF8 A;  5A5X B;  1MRP A;  1MXW A;  1NL5 A;  1UQW A;  2XXR A;  1NNF A;  3KJT A;  1DOT A;  3H6V A;  3IOU A;  4I8C A;  4LP2 B;  1POY 1;  1MDQ A;  2OWT A;  5I2N B;  3H6T A;  1SW2 A;  3KSJ A;  3T9X B;  1MM7 A;  3KEI A;  2X7P A;  2F7C A;  1DPP A;  1P1N A;  2W7Y A;  5CC2 A;  4YB6 A;  3O6H A;  2VD2 A;  4QRZ A;  4QSD A;  1VFE A;  1DMB A;  1YCJ A;  3C33 A;  1OVT A;  3O29 A;  5JTY B;  1QUK A;  2ANJ A;  5TPA B;  3UOR A;  1A54 A;  4DXU A;  3IB0 A;  1Y9U A;  3LSL A;  3MPK A;  1FTM A;  1IZ1 A;  1NKX A;  2BJJ X;  3TAJ A;  5L9S A;  1MXZ A;  4Z7E A;  4K3F A;  2OWS A;  4X48 A;  5DTB A;  1LAF E;  2UYE A;  3RT6 B;  4I1D A;  3MQ9 A;  4LON B;  3WAF A;  4HS7 A;  4OYV A;  2V3T A;  4FE8 A;  3IOW A;  2Y7K A;  3FVO A;  3G7W A;  3G3G A;  1ATG A;  4JSO A;  4QFP A;  4E0W A;  2O51 A;  1Y20 A;  1MY0 A;  2OLB A;  4O3B A;  2PVU A;  4FEB A;  4X9T A;  1WDN A;  4POW A;  2OCU A;  3Q25 A;  4UAC A;  3MBP A;  4OTE A;  5IAI A;  3PPR A;  5I2K B;  5KDT B;  4G4P A;  4PQJ A;  1NNK A;  2GH9 A;  4WEP A;  2NVU B;  2H4I A;  1N7W A;  5B7D A;  4F22 A;  4RYA A;  1N0T A;  2F7A A;  2PT1 A;  3IAZ A;  5I2K A;  3MZ1 A;  3PD9 A;  4OFO A;  1LCF A;  2RKM A;  4YKI A;  5ISU A;  2RCA A;  2ZYO A;  4BDQ A;  1I6Q A;  5FHO A;  2FNC A;  1DPE A;  1SYI A;  1XVY A;  2V93 A;  4MF3 A;  1B40 A;  2V84 A;  3MC2 A;  2XXI A;  1TWY A;  4ZE8 A;  4POX A;  5H8N A;  1MXU A;  2NXO A;  4G8N A;  2H98 A;  1VE4 A;  3FZV A;  2ONR A;  3G3K A;  4DLD A;  4F2O A;  1FQC A;  1FQF A;  1O7T A;  3GBA A;  3KN8 A;  2H25 A;  2O7U A;  3QYT A;  3G3F A;  4NMY A;  4R6K A;  3EHS A;  5H8H A;  3VLW A;  2H9B A;  1SI0 A;  4G68 C;  3KG2 A;  2D21 A;  1B1X A;  3F11 A;  3PPN A;  3PUV E;  3HV1 A;  4PET A;  4U23 A;  1ELJ A;  3I3V A;  4NED A;  3T9U A;  4Q8R A;  2RF1 A;  4PFT A;  4F31 B;  1HSE A;  2R9J A;  3MVX A;  2OBG A;  1Y1Z A;  1PB7 A;  5F7V A;  1PC3 A;  4R74 A;  1YAE A;  1SI1 A;  1MQJ A;  3V5A A;  2R6G E;  2PX1 A;  4BDM A;  4OQO A;  3KFM A;  4ELO A;  4ZEB A;  1HSL A;  2F35 A;  4H6D A;  4GL8 A;  1SD3 A;  1MDP 1;  3Q26 A;  4JSD A;  5I56 B;  5I59 A;  2F97 A;  1LFH A;  1FW0 A;  3FUZ A;  4NF5 A;  1EZO A;  5BUU A;  1A8E A;  1OLA A;  2DVZ A;  3R6U A;  4RNS A;  1N7X A;  1YPN A;  2OJT A;  3ZKK A;  4EF1 A;  3S9L C;  3O28 A;  5CMC A;  3FV1 A;  1NNP A;  3EHT A;  1Y4T A;  2QMX A;  4OHN A;  4F1V A;  2AL5 A;  1PB8 A;  1IIT A;  4EQB A;  4H67 A;  3DM0 A;  4MH5 A;  3VLU A;  5I57 A;  4AB5 A;  2Q89 A;  1IXH A;  4DDD A;  1B3G A;  2Y7W A;  4JWX A;  4GFR A;  3CI8 A;  4IO6 A;  3T22 A;  4OMB A;  3OD7 A;  3EN3 A;  4NF4 B;  4LZ7 A;  4Z0I A;  1A55 A;  4YB7 A;  4RA1 A;  4ZZA A;  3O66 A;  3W9W A;  3FJ7 A;  1ANF A;  4YIC A;  3JYR A;  3N94 A;  1OLC A;  4H0W A;  4G8H A;  2PYY A;  4G8M A;  5FTH A;  4P0G A;  2QJE A;  2XXW A;  4GOT A;  1NH7 A;  2ESN A;  2FYI A;  3FXR A;  3EQ1 A;  3ODB A;  3FD3 A;  5K2X A;  2UVJ A;  1LFG A;  1US4 A;  1Y3Q A;  4GWO A;  2I4C A;  2RC8 A;  4OVJ A;  4H65 A;  2A5T A;  3OSQ A;  3DLN A;  1SW5 A;  1UTB B;  3IX1 A;  2F6G A;  3VVD A;  1AIV A;  2Y7I A;  5DVI A;  1B6H A;  1MQI A;  1B7U A;  3TEL A;  2Z22 A;  2B3F A;  3ZSF A;  1LAG E;  5TP9 A;  1H3D A;  1OQH A;  2E0S A;  1D9V A;  2V3U A;  1WVJ A;  2GHA A;  1MM6 A;  2DE4 A;  3IOV A;  2ONK E;  3KJ7 A;  1GTK A;  2DS9 A;  1XOC A;  4KR5 A;  1FTK A;  4RPN A;  5FHM A;  3TMG A;  3N6T A;  1R9Q A;  1M5B A;  4PP0 A;  1VR5 A;  4ECF A;  4IO3 A;  3TEP A;  3VXC A;  1OQG A;  3CR9 A;  4KYE A;  1NNT A;  4IO5 A;  3T9H B;  4H8J A;  3R7X A;  3S4U A;  3PPQ A;  5CBR A;  1Z7N E;  4QHQ A;  4O3A A;  5H8S A;  3Q27 A;  3MWB A;  3W9V A;  4HTG A;  3S9N C;  1UTH A;  1D9Y A;  3FJG A;  3PGF A;  4F1Y A;  4F2Q A;  2ZNS A;  3TCH A;  2XX8 A;  3VVF A;  5ICQ A;  2XXX A;  4PFW A;  1DTZ A;  4TQU Q;  2F7B A;  3C35 A;  3UA8 A;  1EU8 A;  1QKB A;  3O97 A;  4R6Y A;  3K1P A;  4U1Z A;  1B3H A;  1DSN A;  2P1S A;  3KGC A;  3K6V A;  1JVY A;  4N07 A;  2F36 A;  4DZ1 A;  4IO4 A;  3I5O A;  3LC8 A;  3QSL A;  4U21 A;  3MPL A;  3RUM A;  3FAS A;  3L6H A;  4MLV A;  4ZEK A;  4IO7 A;  1BKA A;  5AE4 A;  3QAX A;  3CVG A;  4LAT A;  4R2F A;  1FQD A;  1LLS A;  4JXI A;  4NF5 B;  5CMB A;  4AB6 A;  3TPA A;  4JDF A;  4G2Z A;  3M3L A;  3TCF A;  1LBC A;  1QUL A;  3IK6 B;  3MVY A;  3T93 B;  2XXP A;  2RC7 A;  1S9T A;  3OO9 A;  3CFX A;  2PT2 A;  4NF8 A;  4BDR A;  4H8I A;  4N6P A;  5AA4 B;  2QS1 A;  2REJ A;  5JTY A;  4OWD A;  1RKM A;  5DYH A;  4NF6 B;  1B32 A;  3K6W A;  3KOT A;  1SVX B;  1XS5 A;  3OO7 A;  2ZNT A;  5KDT A;  3DEL B;  1QKA A;  3PMX A;  1B3F A;  3SEY A;  3PD8 A;  1RYX A;  3BFU A;  3G3H A;  1LST A;  3SEX A;  3TTM A;  2I58 A;  1JEU A;  2HEU A;  1NH8 A;  2I4B A;  4I62 A;  1AMF A;  1GVC A;  3C36 A;  3TKD A;  3FVK A;  4QF9 A;  3TQW A;  1LAX A;  5DVF A;  4DCY A;  2HCA A;  4LA9 A;  2AYS A;  4UA8 A;  3OEN A;  1M5F A;  1MY4 A;  4EDP A;  4OEV A;  5AA2 A;  1AOV A;  2RIN A;  2P0S A;  3VV5 A;  4LUB A;  2DP8 A;  1J1N A;  1QUJ A;  2Y7R A;  3SER A;  4BLA A;  1P1Q A;  2HZK A;  3HCQ A;  3O6G A;  5L9O A;  2UVH A;  2OK2 A;  3H06 B;  3BBR A;  3M3F A;  1XC1 A;  3HST A;  3GBB A;  5J1D A;  2X7Q A;  4KFQ A;  4NE4 A;  2DSF A;  5CBS A;  3T9V A;  3TTK A;  2Y7P A;  2LAO A;  4NWC A;  3MJN A;  1IEJ A;  1SW4 A;  1B1H A;  2A5S A;  2DWJ A;  2I0B A;  2O6A A;  3B6Q A;  3E3K A;  3PPO A;  4PFY A;  1JW1 A;  4QFO A;  4NF4 A;  5CRY A;  4ZZE A;  2ZYK A;  5AA3 A;  5ITP A;  3TDJ A;  4RY1 A;  3SES A;  2DXR A;  3UIF A;  3FXQ A;  2RC9 A;  1PBP A;  3A3U A;  4ISU A;  2ONS A;  3A09 A;  3B6W A;  4XIG Q;  1T0K A;  1BLF A;  2XXY A;  2XXV A;  1ZTY A;  1P1U A;  4TLL B;  4IY6 A;  1B7H A;  1S7Y A;  2DQV A;  2FA7 A;  4F29 A;  4ZED A;  1Y4C A;  4MBP A;  4ZEC A;  1MG1 A;  3KN7 A;  1PB9 A;  4OXV A;  2F34 A;  3TOD A;  5CMM A;  3MZB A;  3IR1 A;  2YLN A;  3MAM A;  3GXA A;  3S2V A;  2DWH A;  1FQB A;  4DXC A;  3IB2 A;  2Z8F A;  4HCW A;  5DEX A;  3LSX A;  3M3K A;  5EHM A;  5K2Y A;  4QFN A;  3U8Q A;  4TLM B;  3MZ9 A;  3RTF B;  1B5J A;  1N04 A;  3QIM A;  4JBZ A;  3VDF A;  1B7Z A;  1Y1M A;  4C0R A;  4R6H A;  3MVZ A;  2QMW A;  2Z8D A;  3PUW E;  1MPD A;  1FQE A;  3MUQ A;  4FAT A;  1XVX A;  3G3J A;  2UVI A;  3UP9 A;  1ZBM A;  4FAJ A;  4OER A;  4U1O A;  1B58 A;  3MW0 A;  3KZG A;  2YJP A;  4JWY A;  3MP8 A;  4FIM A;  4R73 A;  5EYF A;  3RT8 A;  3VXB A;  5ICT A;  5JK4 A;  3K01 A;  2ZYM A;  3TYH A;  4I9D A;  5L9M A;  1ZLQ A;  1H43 A;  1N76 A;  1AL3 A;  1P1O A;  3OSR A;  3GLB A;  1MY3 A;  3ILU B;  4NF6 A;  5TU0 A;  4KI0 E;  2DE3 A;  5DEX B;  1SDX A;  3K6U A;  3SEU A;  3FGS A;  3VVE A;  2DE2 A;  3P7I A;  1MH3 A;  4YMA A;  4LQ2 A;  4QFL A;  3T66 A;  1SBP A;  4C1T A;  3H3G A;  2XXT A;  4KYS A;  1D4N A;  2H5Y A;  4BDN A;  4DCX A;  2G29 A;  5TP9 B;  3EF7 A;  1B0L A;  4R72 A;  4FEC A;  4FED A;  2GHB A;  4LVQ A;  4XKQ A;  2ABH A;  3OEL A;  4F3B A;  3LR1 A;  1QUI A;  5H8H B;  2AL4 A;  3USD A;  1I6A A;  3K6X A;  4F3P A;  4R2B A;  1R1N A;  2O1M A;  3FAT A;  3K4U A;  1P99 A;  2QS2 A;  3MVW A;  4GQO A;  4KPT A;  4MFI A;  4Q0C A;  4GVO A;  4RK2 A;  3D4C A;  2ZNU A;  5B70 A;  1SW1 A;  2QRY A;  3TTN A;  3IO6 A;  3IO4 A;  5M2V A;  1LFI A;  1ZIU A;  4Q5T A;  4ZEF A;  4OFL A;  1URG A;  3IB1 A;  1B46 A;  4IGR A;  1OVB A;  2Q2C A;  4QSE A;  4EQ9 A;  2B3B A;  2GRV A;  4NTL A;  3V8X B;  4AQ4 A;  1R9L A;  3H03 A;  4ELR A;  1OIB A;  1VSO A;  5HPQ A;  3SEV A;  1MQH A;  2DVC A;  1IQ7 A;  2ALU A;  2O1L A;  3ONM A;  1I6B A;  5I59 B;  2QS4 A;  1JQF A;  2HAU A;  4BDO A;  1B4Z A;  2RCB A;  1FTJ A;  1SYH A;  1NMU A;  4U22 A;  5LOM A;  3EHU A;  3CFL A;  2HZL A;  3H7M A;  5DVJ A;  3VE1 B;  3B6T A;  3TQL A;  3O2A A;  3TTR A;  3CG1 A;  3ZKL A;  1B3L A;  2WKY A;  4RXL A;  2HFB A;  1L5T A;  3VLV A;  4ESW A;  1M5C A;  2V3Q A;  1UTH B;  1O63 A;  1O64 A;  4L17 A;  1MH4 A;  1MXX A;  3TUS A;  3C9H A;  4LZ8 A;  3QXM A;  3HHG A;  1N3W A;  2XD3 A;  3BKI B;  4XKR A;  1Y3N A;  2NOO A;  3E9X A;  5I56 A;  3FVN A;  3C32 A;  2O84 X;  4GXS B;  1MXY A;  1R6Z A;  2HXW A;  1TT1 A;  3B7D A;  3K02 A;  5EHS A;  4C1U A;  2B65 A;  2P2A A;  2I6E A;  2QL3 A;  2G93 A;  1UIV A;  3CSB A;  3IJO B;  4LQ5 A;  2XXH A;  3BFT A;  2O68 A;  5L8D A;  4OFJ A;  4PFU A;  3SEW A;  5H8N B;  3IOR A;  1IXG A;  4P0I A;  1IXI A;  3CFZ A;  1B9J A;  1ZKB A;  3LUY A;  3V83 A;  1NFT A;  3MP1 A;  5H8Q B;  1LAH E;  1JNF A;  1LBB A;  1LCT A;  3DP4 A;  3E13 X;  3HN0 A;  3HPI A;  3K0V A;  4IB2 A;  1TFD A;  3FJM A;  1GGG A;  2H99 A;  3IL1 B;  3KN3 A;  4JWO A;  3N26 A;  3PPP A;  4BDL A;  1RYO A;  3K1N A;  4WXJ A;  4F3S A;  4EXK A;  1N3X A;  4XKP A;  4F3G A;  1LB8 A;  4LZ5 A;  4M4G A;  4ZS9 A;  2F8D A;  3ECR A;  4DIG A;  5I57 B;  4R9G A;  3OEK A;  1ZU0 A;  2I0C A;  3EPE A;  1P1W A;  3OO6 A;  1Q1K A;  2VOZ A;  1JEV A;  2OZZ A;  3AXF A;  3SKP A;  5I2N A;  4QFK A;  1USY H;  3HO7 A;  3QK6 A;  4P11 A;  2IA4 A;  4KCD A;  4EUO A;  1B2H A;  3CIJ A;  1B0H A;  2Q9T A;  4DXB A;  5H8F A;  3T96 B;  3QUJ A;  3S9M C;  4Q30 B;  1XHY A;  1EZ9 A;  3LSF B;  1IUD A;  3M8U A;  3PUX E;  2DOJ A;  3HHF A;  5H8F B;  5TPA A;  1EZP A;  2XX9 A;  4FJP A;  3U94 A;  4YAH X;  2KLF A;  1LB9 A;  4H1X A;  4ESX A;  1OMP A;  1BTJ A;  4EQ7 A;  1LGB C;  3Q29 A;  3N6U A;  2X26 A;  1CB6 A;  4U2R A;  1Z7M E;  3OXN A;  2QPQ A;  5JEI A;  4XXU A;  1QVS A;  2AIX A;  3FV2 A;  3H6U A;  5F1Q A;  4F1U A;  4G77 A;  2D3I A;  2XXQ A;  3PUY E;  3N5L A;  2XX7 A;  3CG3 A;  4PE5 B;  1GR2 A;  3OMB A;  3KOS A;  3TTL A;  3D4G A;  3C34 A;  4R75 A;  1PEB A;  2I3W A;  1FTL A;  5KCJ B;  1II5 A;  4KD5 A;  1BP5 A;  1JW4 A;  3RPW A;  3MP6 A;  3RY3 A;  4HCY A;  3PMV A;  2HQ0 A;  2QS3 A;  2UXA A;  3PU5 A;  2IEE A;  2VGQ A;  3ILT B;  3U72 A;  5AA4 A;  1Y3P A;  4MLQ A;  2F5X A;  1FQA A;  4O3C A;  4OES A;  5HBC A;  2VHA A;  1GV8 A;  2YPN A;  4RK9 A;  3UGW A;  1QW0 A;  4GLI A;  1US5 A;  1USY E;  1MQG A;  2UYF A;  4XKN A;  3E4R A;  4YKP A;  3RGY A;  2A5T B;  4G68 A;  3UN6 A;  2HAV A;  2XHD A;  1MY2 A;  1FTO A;  3VFJ A;  1JVX A;  2O69 A;  3PMW A;  4IY5 A;  2NWJ A;  3W15 C;  2DXY A;  2Y84 A;  1MPC A;  3RNN A;  3LBS A;  2F6P A;  4G68 B;  1B5H A;  5FHN A;  5IKB A;  3C4M A;  3KBR A;  2Z23 A;  4NWD A;  5I58 A;  2DYX A;  2XD2 A;  4M1V A;  3DP8 A;  4IO2 A;  4RJZ A;  1H44 A;  1CE2 A;  1WOD A;  2GFE A;  4IGT A;  4NF8 B;  4ELQ A;  3RQT A;  1M5E A;  4XTC Q;  3O9P A;  3RTW B;  5H8Q A;  2DWA A;  1MXV A;  2VD3 A;  4KYD A;  4R9F A;  2R71 A;  4GD5 A;  3SET A;  1MY1 A;  1URD A;  2Q2A A;  1EH3 A;  3FXU A;  4GXA A;  2XXU A;  4H5G A;  5FTI A;  3Q28 A;  4FOR A;  5KZT A;  1B4H A;  4GL0 A;  4WKM A;  4YKJ A;  3PV0 E;  2Z8E A;  3U1O A;  1BIY A;  1FCK A;  3K1M A;  1MQD A;  1XT8 A;  1B52 A;  2I48 A;  2Q88 A;  4RPO A;  1JW5 A;  1PBQ A;  1YTV A;  1IXC A;  1F9B A;  3JZJ A;  2V25 A;  3G3I A;  1A40 A;  3I6V A;  1A8F A;  4ZDM A;  4X1D A;  3WAE A;  5BWJ A;  1TFA A;  3TZA A;  4ND9 A;  4YZZ A;  1D3K A;  3PUZ E;  1UIU A;  4THI A;  4GIZ A;  3OO8 A;  2UVG A;  3S9E A;  2VP1 A;  1B3E A;  3C31 A;  3JV9 A;  4KQP A;  3LSW A;  4YU0 A;  1B51 A;  3CSG A;  4ZEI A;  3RN8 A;  5AA2 B;  1PDA A;  1ZJL A;  3IOT A;  5I84 A;  2PMS A;  1N84 A;  2ZYN A;  1JET A;  1IIW A;  1HSJ A;  2E1S A;  2CZL A;  4F18 A;  1H76 A;  1S50 A;  5CI5 A;  5AA1 A;  3O6I A;  4F39 A; 
#chains in the Genus database with same CATH topology
 4JVC A;  1SQY A;  1MPB A;  4OAN A;  3IJX B;  4QSC A;  5A5X A;  2ZXT A;  5HM4 B;  4KHZ E;  2PFZ A;  3A3C A;  1DTG A;  1A7L A;  1AH5 A;  1VFD A;  3TFL A;  4KCC A;  4PAF A;  4X1B A;  2O7I A;  1TXF A;  4JB7 A;  3L6G A;  2CEY A;  4GRK A;  5EQ9 A;  1A99 A;  3U93 A;  1POT A;  1B05 A;  4GF8 A;  1MRP A;  1NL5 A;  4ONY A;  1NNF A;  1POY 1;  2X7P A;  1FBE A;  4YB6 A;  2VD2 A;  1DMB A;  4DXU A;  3IB0 A;  1MXZ A;  2UYE A;  4PC9 A;  4LON B;  4HS7 A;  3G3G A;  1ATG A;  2PVU A;  4X9T A;  1WDN A;  4UAC A;  5IAI A;  4N4U A;  2F3B A;  2H4I A;  4RYA A;  2PT1 A;  3IAZ A;  2RCA A;  4BDQ A;  3MC2 A;  3G3K A;  2ONR A;  1FQF A;  4R6K A;  1K9Y A;  1SI0 A;  4PET A;  3T9U A;  4HXV A;  4NED A;  2RF1 A;  3MVX A;  1Y1Z A;  1PB7 A;  1PC3 A;  4R74 A;  2R6G E;  2F35 A;  1SD3 A;  4JSD A;  3MYU A;  4NF5 A;  2DVZ A;  3R6U A;  4PE3 A;  2OJT A;  5CMC A;  3FV1 A;  1NNP A;  4F1V A;  4MNI A;  1PB8 A;  4H67 A;  3VLU A;  4AB5 A;  2P3V A;  4GFR A;  3CI8 A;  2JJK A;  4OMB A;  3OD7 A;  2HXR A;  4Z0I A;  1LBW A;  3JYR A;  5FTH A;  3D1R A;  3ODB A;  2V4C A;  2ZZW A;  4GWO A;  2I4C A;  4OVJ A;  3OSQ A;  3DLN A;  5DVI A;  2B3F A;  5IZ3 B;  4PCD A;  2V3U A;  5FHM A;  1GTK A;  2DS9 A;  4KR5 A;  4GBW A;  3N6T A;  1R9Q A;  4PP0 A;  4ECF A;  1VR5 A;  2XWO A;  3VXC A;  3CR9 A;  3T9H B;  3S4U A;  1Z7N E;  4O3A A;  5H8S A;  3MWB A;  4F2Q A;  3VVF A;  1DTZ A;  1EU8 A;  1DK4 A;  1JVY A;  4DZ1 A;  1D9Q A;  3MPL A;  3QAX A;  3CVG A;  4FBP A;  4NF5 B;  2F3D A;  4JDF A;  4G2Z A;  1RDZ A;  3TCF A;  4BDR A;  5AA4 B;  5JTY A;  1RKM A;  1B32 A;  3K6W A;  3KOT A;  1XS5 A;  1QKA A;  3PMX A;  3KC1 A;  3B8B A;  3BFU A;  4I62 A;  1GVC A;  3TQW A;  3TKD A;  1LAX A;  4DCY A;  2KQZ A;  1J1N A;  2Y7R A;  4I3Y A;  3O6G A;  3BBR A;  5J1D A;  5CBS A;  4NE4 A;  3TTK A;  5IM2 A;  4NWC A;  2WX9 A;  2A5S A;  5IZZ A;  2ZYK A;  2DXR A;  3FXQ A;  1T0K A;  3A09 A;  2Y5L A;  1P1U A;  4IY6 A;  4F29 A;  4ZED A;  4ZEC A;  3NOH A;  4OXV A;  3IR1 A;  3S2V A;  4DXC A;  1FQB A;  1CNQ A;  3LSX A;  5EHM A;  3MZ9 A;  4C0R A;  4R6H A;  3MVZ A;  2QMW A;  2XWV A;  3PUW E;  1FQE A;  4H46 A;  4FAT A;  3G3J A;  1ZBM A;  4OER A;  4U1O A;  5EYF A;  4I9D A;  3LV0 A;  2WBD A;  2WEF A;  3GLB A;  1MY3 A;  5DEX B;  1SDX A;  3K6U A;  2DE2 A;  3H3G A;  4DCX A;  3EF7 A;  2L5V A;  4LVQ A;  3LR1 A;  1QUI A;  2AL4 A;  1R1N A;  3MVW A;  5L9S A;  4RK2 A;  2QS2 A;  4GWZ A;  2ZNU A;  3TTN A;  2FIE A;  4Q5T A;  4OFL A;  1URG A;  4IGR A;  1B46 A;  4NTL A;  1R9L A;  3ONM A;  1IQ7 A;  4NN3 A;  5I59 B;  1JQF A;  2HAU A;  1B4Z A;  3CFL A;  2HZL A;  5DVJ A;  3TQL A;  3O2A A;  4RXL A;  4LZ8 A;  1FPE A;  3E9X A;  1LEV A;  5EHS A;  4C1U A;  2B65 A;  3SEW A;  1JP4 A;  5J16 A;  1IXG A;  4N81 A;  2CZI A;  3LUY A;  4GWU A;  3DP4 A;  3E13 X;  3HPI A;  4IB2 A;  3IL1 B;  3K1N A;  2WYK A;  1LB8 A;  4M4G A;  4DIG A;  3EPE A;  1P1W A;  1JEV A;  2OZZ A;  2IA4 A;  4KCD A;  1B0H A;  4DXB A;  3T96 B;  1FBD A;  3QUJ A;  4Q30 B;  4I3E A;  3PUX E;  1YZ0 A;  3HHF A;  3U94 A;  4YAH X;  1BTJ A;  1Z7M E;  3OXN A;  1YYZ A;  2AIX A;  4F1U A;  2XXQ A;  4MMP A;  1GR2 A;  3RPW A;  4HCY A;  3PMV A;  4QXD A;  4KXP A;  3ILT B;  4O3C A;  4RK9 A;  4P56 A;  3T93 B;  3RGY A;  1USY E;  2UYF A;  4XKN A;  3E4R A;  1MY2 A;  1FTO A;  1MPC A;  4G68 B;  1B5H A;  5FHN A;  2Z23 A;  4NWD A;  5EQA A;  2DYX A;  1KA1 A;  2Q8M A;  3RQT A;  3O9P A;  3RTW B;  4OVP A;  4OVT A;  4R9F A;  1URD A;  2Q2A A;  1EH3 A;  5FTI A;  4H5G A;  4WKM A;  1FCK A;  4MIJ A;  2Q88 A;  1XT8 A;  1YTV A;  3JZJ A;  2QFL A;  1EYI A;  1FJ6 A;  4X1D A;  3TZA A;  4MAG A;  2MKZ A;  4PBH A;  2VP1 A;  4YU0 A;  3C31 A;  5AA2 B;  5B70 A;  4ZEI A;  1ZJL A;  3IOT A;  5I84 A;  1N84 A;  2E1S A;  1FPF A;  4F18 A;  1H76 A;  4HW8 A;  3CRB A;  3OEM A;  4H5F A;  2B4M A;  4GWW A;  4DE8 A;  4OEU A;  3DP6 A;  1NV1 A;  5EQ7 A;  3QUF A;  4F19 A;  1H45 A;  2I49 A;  1Q35 A;  1B5I A;  3H4Z A;  3FVG A;  4EXL A;  3KSX A;  5IZ3 A;  5ESY A;  4OET A;  3H6W A;  2PBW A;  2CMO A;  5A5X B;  4I8C A;  5I2N B;  3H6V A;  3IOU A;  3KSJ A;  1MM7 A;  2HPG A;  1SPI A;  3KEI A;  2F7C A;  2W7Y A;  4QRZ A;  2B4L A;  1VFE A;  5JTY B;  3C33 A;  2ANJ A;  3LSL A;  3MPK A;  1IZ1 A;  2BJJ X;  3CHG A;  2OWS A;  1LAF E;  2OX3 A;  4QFP A;  3HFU A;  4XF5 A;  2OLB A;  4O3B A;  2KR0 A;  4POW A;  3Q25 A;  4OTE A;  3PPR A;  2NVU B;  1N7W A;  2F7A A;  5I2K A;  3MZ1 A;  1LCF A;  1I6Q A;  5T3J A;  1SYI A;  1XVY A;  2V93 A;  4MF3 A;  1B40 A;  2V84 A;  2XXI A;  1VE4 A;  1FQC A;  4NMY A;  5CI5 A;  4G68 C;  3KG2 A;  4NQ8 A;  2D21 A;  4F31 B;  5F7V A;  1YAE A;  1SI1 A;  4ZEB A;  5I59 A;  3MST A;  1FW0 A;  4RNS A;  1N7X A;  3O28 A;  1FBG A;  4OHN A;  1IIT A;  1IXH A;  2XA5 A;  1DBZ A;  2Y7W A;  4IO6 A;  4NF4 B;  1ANF A;  1EYK A;  2PYY A;  4P0G A;  2XXW A;  1NH7 A;  4N8Y A;  3EQ1 A;  3FD3 A;  2UVJ A;  5ET8 A;  2RC8 A;  4O7I A;  5LTC A;  1RDY A;  1UTB B;  3IX1 A;  1AIV A;  1B7U A;  3FXB A;  3TEL A;  2Z22 A;  5TP9 A;  1H3D A;  1OQH A;  3RLF E;  1MM6 A;  3IOV A;  3PTY A;  5EYH A;  3TEP A;  1OQG A;  4HE2 A;  5CBR A;  4QHQ A;  3Q27 A;  2XXX A;  2F7B A;  3C35 A;  3UA8 A;  1QKB A;  4U1Z A;  3O97 A;  3K1P A;  1DSN A;  2P1S A;  2F36 A;  4U21 A;  4QBA A;  3RUM A;  4MLV A;  1BKA A;  4R2F A;  5CMB A;  4AB6 A;  1LBC A;  3OO9 A;  4PBQ A;  5DYH A;  3OO7 A;  5KDT A;  3DEL B;  3PD8 A;  3SEX A;  1LST A;  1JEU A;  2HEU A;  1NH8 A;  2I4B A;  3U8Q A;  3FVK A;  5DVF A;  2HCA A;  3OEN A;  1M5F A;  4EDP A;  5AA2 A;  2P0S A;  3BIG A;  1P1Q A;  2HZK A;  3H06 B;  2OK2 A;  2DSF A;  2I0B A;  3PPO A;  3E3K A;  4QFO A;  5CRY A;  3UIF A;  1NV2 A;  1PBP A;  4ISU A;  1RDX A;  1BLF A;  4PAK A;  4TLL B;  2FA7 A;  1Y4C A;  4GX3 A;  2QVR A;  1XI6 A;  1PB9 A;  1FJ9 A;  3TOD A;  3MZB A;  2YLN A;  1LBY A;  1B5J A;  3QIM A;  3VDF A;  4JBZ A;  1B7Z A;  1KA0 A;  1Y1M A;  2Z8D A;  1MPD A;  4NF0 A;  3UP9 A;  2UVI A;  4FAJ A;  3MW0 A;  4JWY A;  5JK4 A;  4R73 A;  3RT8 A;  5ICT A;  3K01 A;  3TYH A;  4MJO A;  1H43 A;  1N76 A;  4N15 A;  1FTA A;  5I3S A;  3SEU A;  4PFB A;  3VVE A;  1SBP A;  4C1T A;  4GBV A;  3T1B A;  2G29 A;  4NAP A;  1B0L A;  4XKQ A;  3OEL A;  4F3B A;  4F3P A;  3FAT A;  3K4U A;  4Q0C A;  2QRY A;  4QSE A;  3FBP A;  1VSO A;  2O1L A;  4BDO A;  2RCB A;  3KBZ A;  4ESW A;  1B3L A;  2WKY A;  3VLV A;  1M5C A;  1UTH B;  1O64 A;  1MH4 A;  2P3N A;  4XKR A;  1TT1 A;  2I6E A;  2QL3 A;  3IJO B;  4PFU A;  1NV3 A;  1B9J A;  1NFT A;  3MP1 A;  1LAH E;  1LCT A;  4YZZ A;  3K0V A;  2H99 A;  4JWO A;  4P3L A;  1RYO A;  4WXJ A;  4EXK A;  1N3X A;  4XKP A;  4LZ5 A;  4ZS9 A;  1FPL A;  2F8D A;  4R9G A;  2I0C A;  3AXF A;  4QFK A;  3CIJ A;  2FVZ A;  2OWZ A;  3S9M C;  3LSF B;  2DOJ A;  2XWI A;  4DI4 B;  4H1X A;  1OMP A;  3Q29 A;  2X26 A;  1CB6 A;  5JEI A;  2QPQ A;  1QVS A;  2XX7 A;  3D4G A;  3C34 A;  1PEB A;  2I3W A;  1FTL A;  1II5 A;  4KD5 A;  2HQ0 A;  3PU5 A;  2IEE A;  3U72 A;  4OES A;  4PDD A;  5HBC A;  1GV8 A;  4AS5 A;  1US5 A;  3UN6 A;  4G68 A;  3VFJ A;  3PMW A;  2NWJ A;  2DXY A;  2Y84 A;  3C4M A;  2XD2 A;  1H44 A;  5H8Q A;  4KYD A;  1MXV A;  4I40 A;  3Q28 A;  5KZT A;  2GQ1 A;  4YKJ A;  3PV0 E;  3U1O A;  4NX1 A;  4RPO A;  1NUY A;  1FPB A;  1LBX A;  1PBQ A;  2V25 A;  2FIX A;  3G3I A;  1A40 A;  3WAE A;  1TFA A;  3OO8 A;  3S9E A;  4KQP A;  2PMS A;  5IZ1 A;  1IIW A;  2CZL A;  1NV0 A;  2QSX A;  4U4X A;  2CZK A;  2REG A;  4AS4 A;  4DI3 D;  5DT6 A;  3THI A;  3K2D A;  4E0X A;  2D5W A;  3V89 B;  4YB5 A;  2Q8J A;  1IME A;  2BJI A;  4YKK A;  4ZE9 A;  5ITO A;  1URS A;  2THI A;  3SDF A;  4OEN A;  2DWI A;  1QJM A;  4OZ9 A;  1I69 A;  3ZS6 A;  2I3V A;  1NUZ A;  5KCJ A;  4N13 A;  1IMB A;  1MXW A;  3KJT A;  4LP2 B;  1MDQ A;  4GWX A;  3T9X B;  3GYY A;  5CC2 A;  1YCJ A;  3O29 A;  1OVT A;  1EYJ A;  1QUK A;  5TPA B;  3UOR A;  1FTM A;  1NKX A;  3E79 A;  3TAJ A;  4Z7E A;  4X48 A;  3A29 A;  4I1D A;  3G7W A;  4JSO A;  4OVQ A;  1MY0 A;  3MBP A;  4G4P A;  2GH9 A;  4OFO A;  2XWK A;  4YKI A;  2ZYO A;  1TWY A;  4POX A;  5H8N A;  2NXO A;  4G8N A;  3FZV A;  4DLD A;  3GBA A;  3EHS A;  4MHF A;  2H9B A;  1B1X A;  3PUV E;  3I3V A;  5I5P A;  3V5A A;  4PF6 A;  2PX1 A;  4OQO A;  4ELO A;  1HSL A;  4H6D A;  5I56 B;  2F97 A;  1LFH A;  3FUZ A;  1EZO A;  1A8E A;  1OLA A;  4EF1 A;  3S9L C;  1YPN A;  2AL5 A;  4MH5 A;  4PFR A;  5I57 A;  2Q89 A;  3IFA A;  3T22 A;  3EN3 A;  4ZZA A;  4YB7 A;  4RA1 A;  3W9W A;  3FJ7 A;  3N94 A;  2QJE A;  4GOT A;  3T0J A;  5K2X A;  1Y3Q A;  1US4 A;  1AWB A;  2A5T A;  1SW5 A;  2F6G A;  1LAG E;  5I58 A;  2E0S A;  5AE4 A;  3PD9 A;  3KJ7 A;  2FHY A;  3ISP A;  2ZZV A;  4RPN A;  1XOC A;  3TMG A;  1M5B A;  4IO3 A;  5I7I A;  3PPQ A;  2CEX A;  3W9V A;  3S9N C;  1D9Y A;  4X8R A;  4F1Y A;  2ZNS A;  3TCH A;  5ICQ A;  4TQU Q;  5LDZ A;  4N17 A;  4R6Y A;  1FBP A;  3FAS A;  3L6H A;  4IO7 A;  1FSA A;  4JXI A;  3TPA A;  4MNP A;  3RPL B;  3MVY A;  2XXP A;  2RC7 A;  4PTK A;  1K9Z A;  3CFX A;  2PT2 A;  4H8I A;  2QS1 A;  2REJ A;  4OWD A;  4NF6 B;  4PGN A;  1SVX B;  1INP A;  1RYX A;  3TTM A;  1AMF A;  4QF9 A;  2AYS A;  4UA8 A;  1MY4 A;  4OEV A;  1AOV A;  2RIN A;  3VV5 A;  2DP8 A;  4PDH A;  1QUJ A;  3SER A;  5L9O A;  4BLA A;  3HCQ A;  3HST A;  2X7Q A;  4KFQ A;  2QVU A;  5DW8 A;  1SW4 A;  4PFY A;  1B1H A;  2DWJ A;  2O6A A;  3B6Q A;  1JW1 A;  4MNC A;  4ZZE A;  4RY1 A;  3SES A;  5ET5 A;  2ONS A;  2Y5K A;  1NV4 A;  2XXY A;  1ZTY A;  4MBP A;  1NV6 A;  3KN7 A;  5CMM A;  3MAM A;  3GXA A;  3IB2 A;  5DEX A;  5K2Y A;  3M3K A;  5ET6 A;  1XVX A;  1G0H A;  2YJP A;  3RPL A;  3VXB A;  2ZYM A;  1ZLQ A;  4NF6 A;  5TU0 A;  3P7I A;  4YMA A;  4BDN A;  2H5Y A;  4O8M A;  2R8T A;  2FBP A;  4R72 A;  4FEC A;  2ABH A;  5H8H B;  3USD A;  3SET A;  4MFI A;  1IMA A;  2O1M A;  4GQO A;  1P99 A;  4KPT A;  4GVO A;  1SW1 A;  4MX6 A;  3IO6 A;  3IO4 A;  1LFI A;  1ZIU A;  2Q2C A;  4EQ9 A;  4AQ4 A;  3H03 A;  5HPQ A;  4O7M A;  1MQH A;  4JVD A;  1FPD A;  2QS4 A;  1NMU A;  5LOM A;  1FBF A;  3H7M A;  3VE1 B;  3TTR A;  2HFB A;  2V3Q A;  1O63 A;  4L17 A;  3TUS A;  3QXM A;  3HHG A;  2XD3 A;  3BKI B;  4P47 A;  5I56 A;  3FVN A;  1MXY A;  2HXW A;  3B7D A;  4OA4 A;  1UIV A;  2O68 A;  5L8D A;  5H8N B;  4PGP A;  3IOR A;  1FPK A;  4P0I A;  5H8Q B;  4MEV A;  3FJM A;  1FBH A;  4F3G A;  1Q9D A;  5I57 B;  3OEK A;  1ZU0 A;  2PCR A;  3SKP A;  5I2N A;  1KZ8 A;  3HO7 A;  3QK6 A;  1B2H A;  1YXI A;  1XHY A;  1EZ9 A;  1IUD A;  2VPO A;  5H8F B;  4FJP A;  4ESX A;  4EQ7 A;  3N6U A;  4U2R A;  3FV2 A;  5F1Q A;  2VPN A;  3N5L A;  4OVR A;  3OMB A;  1FPG A;  3KOS A;  3TTL A;  4R75 A;  1BP5 A;  1JW4 A;  2UXA A;  2F5X A;  1FQA A;  3UGW A;  5A5L A;  2YPN A;  2A5T B;  2XHD A;  3W15 C;  1JVX A;  2O69 A;  4IY5 A;  3LUZ A;  3LBS A;  5IKB A;  1LBZ A;  4RJZ A;  1CE2 A;  1WOD A;  4IGT A;  1M5E A;  1MY1 A;  3RYD A;  4FOR A;  1B4H A;  4GL0 A;  2QVV A;  2Z8E A;  1BIY A;  1B52 A;  1JW5 A;  1F9B A;  1A8F A;  5BWJ A;  4ND9 A;  1D3K A;  4THI A;  1UIU A;  4GIZ A;  2UVG A;  4Q8R A;  3JV9 A;  3LSW A;  3CSG A;  1JET A;  1S50 A;  5AA1 A;  3R26 A;  4GWS A;  2M8C A;  4WED A;  5CMK A;  1MS7 A;  4ELP A;  2F78 A;  1M5D A;  4U4S A;  3K00 A;  4TOZ A;  1IMF A;  2ZMB A;  5AA2 D;  3U92 A;  1UTB A;  4EF2 A;  3OOA A;  4N6K A;  3TCG A;  1ZMG A;  4P8B A;  4GX4 A;  1KWH A;  5CM6 A;  5I58 B;  3GZG A;  5ELV A;  4YMB A;  2NUV A;  3UK4 A;  3FIR A;  4XFE A;  1UQW A;  2XXR A;  4QFL A;  1DOT A;  2OWT A;  3H6T A;  1SW2 A;  1DPP A;  1P1N A;  3O6H A;  2HHM A;  4QSD A;  4H45 A;  1A54 A;  2VT5 A;  1NV5 A;  1Y9U A;  2XXK A;  4K3F A;  5DTB A;  3RT6 B;  3MQ9 A;  3WAF A;  4OYV A;  2V3T A;  4FE8 A;  3IOW A;  2Y7K A;  3FVO A;  4E0W A;  2O51 A;  1Y20 A;  4FEB A;  4X04 A;  2OCU A;  5I2K B;  5KDT B;  4PQJ A;  1NNK A;  4WEP A;  5B7D A;  4F22 A;  1N0T A;  2RKM A;  5ISU A;  5FHO A;  2FNC A;  1DPE A;  1IMC A;  4ZE8 A;  1MXU A;  2H98 A;  4F2O A;  1O7T A;  3KN8 A;  3QYT A;  2H25 A;  2O7U A;  3G3F A;  5H8H A;  3VLW A;  3F11 A;  3PPN A;  1NUW A;  3HV1 A;  4U23 A;  1ELJ A;  3B50 A;  4PFT A;  1HSE A;  2R9J A;  2OBG A;  4N6D A;  1MQJ A;  4BDM A;  3KFM A;  4GL8 A;  3Q26 A;  1MDP 1;  2CZH A;  5BUU A;  3EKI A;  3ZKK A;  3EHT A;  1Y4T A;  2QMX A;  4EQB A;  3DM0 A;  4DDD A;  1B3G A;  4JWX A;  1QGX A;  4LZ7 A;  1A55 A;  3O66 A;  4N8G A;  4YIC A;  4O94 A;  4H0W A;  1OLC A;  4GWY A;  3BIH A;  4G8H A;  4G8M A;  2ESN A;  2FYI A;  3FXR A;  5EQ8 A;  1LFG A;  4H65 A;  3VVD A;  2Y7I A;  4HE0 A;  1B6H A;  1MQI A;  3ZSF A;  4XEQ A;  1D9V A;  1WVJ A;  2GHA A;  2DE4 A;  2WYP A;  2ONK E;  1FTK A;  2DDK A;  1NUX A;  4KYE A;  1NNT A;  4IO5 A;  4H8J A;  3R7X A;  1BK4 A;  4HTG A;  1UTH A;  3FJG A;  3PGF A;  2XX8 A;  4PFW A;  4MCO A;  1B3H A;  3KGC A;  3K6V A;  4GX6 A;  4N07 A;  4IO4 A;  3I5O A;  3LC8 A;  3QSL A;  4ZEK A;  4LAT A;  1FQD A;  1LLS A;  3U65 A;  3M3L A;  1QUL A;  3IK6 B;  1S9T A;  4NF8 A;  4N6P A;  4P1L A;  2ZNT A;  1B3F A;  3SEY A;  3G3H A;  2I58 A;  3C36 A;  4LA9 A;  1NI9 A;  4LUB A;  2UVH A;  3M3F A;  1XC1 A;  3GBB A;  3T9V A;  2Y7P A;  2LAO A;  3MJN A;  1IEJ A;  2PFY A;  4NF4 A;  5AA3 A;  5ITP A;  3TDJ A;  2RC9 A;  3A3U A;  3B6W A;  4XIG Q;  2XXV A;  1B7H A;  1S7Y A;  2DQV A;  1MG1 A;  2F34 A;  2DWH A;  5EYG A;  2Z8F A;  3KC0 A;  4HCW A;  4QFN A;  4TLM B;  3RTF B;  1N04 A;  4PAI A;  2Q74 A;  3MUQ A;  1NV7 A;  3ROJ A;  1B58 A;  3KZG A;  3MP8 A;  4FIM A;  5FBP A;  5L9M A;  4PF8 A;  1AL3 A;  1P1O A;  3OSR A;  3IFC A;  3ILU B;  4KI0 E;  1FRP A;  2DE3 A;  3FGS A;  1MH3 A;  1FPJ A;  4LQ2 A;  3T66 A;  2XXT A;  4KYS A;  1D4N A;  5TP9 B;  4FED A;  2GHB A;  1FPI A;  1I6A A;  3K6X A;  4R2B A;  4G61 A;  3D4C A;  5M2V A;  4ZEF A;  3E78 A;  3IB1 A;  1OVB A;  2B3B A;  2GRV A;  3V8X B;  5ET7 A;  4ELR A;  4JVI A;  1OIB A;  4PFI A;  3SEV A;  2DVC A;  2ALU A;  1I6B A;  1FTJ A;  1SYH A;  4U22 A;  3EHU A;  3B6T A;  3ZKL A;  3CG1 A;  1L5T A;  1MXX A;  3C9H A;  1N3W A;  4NGU A;  1Y3N A;  1VDW A;  2NOO A;  3C32 A;  2O84 X;  4GXS B;  1R6Z A;  3K02 A;  2P2A A;  2G93 A;  3CSB A;  4IR8 A;  4LQ5 A;  2XXH A;  3BFT A;  4OFJ A;  1IXI A;  3CFZ A;  1ZKB A;  3V83 A;  4NG7 A;  1JNF A;  1LBB A;  3HN0 A;  1TFD A;  1GGG A;  3KN3 A;  3N26 A;  3PPP A;  4BDL A;  4F3S A;  4P9K A;  5IGA A;  3ECR A;  3OO6 A;  1Q1K A;  2VOZ A;  4N91 A;  1USY H;  4P11 A;  4EUO A;  1G0I A;  2Q9T A;  5H8F A;  3M8U A;  5TPA A;  1EZP A;  2XX9 A;  2KLF A;  1IMD A;  1LB9 A;  4NHB A;  4P1E A;  1LGB C;  3QMF A;  4XXU A;  3H6U A;  4G77 A;  2D3I A;  4OVS A;  3PUY E;  3CG3 A;  4PE5 B;  1DCU A;  5KCJ B;  3RY3 A;  3MP6 A;  2QS3 A;  2VGQ A;  5F24 A;  1Y3P A;  4MLQ A;  5AA4 A;  2VHA A;  1QW0 A;  4GLI A;  1MQG A;  4HE1 A;  4YKP A;  1FBC A;  2HAV A;  3RNN A;  2F6P A;  3KBR A;  4M1V A;  3DP8 A;  4IO2 A;  3SZP A;  2GFE A;  4NF8 B;  4ELQ A;  4XTC Q;  2DWA A;  2VD3 A;  2R71 A;  4GD5 A;  3FXU A;  4GXA A;  2XXU A;  4UAB A;  3K1M A;  1MQD A;  2I48 A;  1LBV A;  1IXC A;  2ZZX A;  3I6V A;  4ZDM A;  3PUZ E;  1B3E A;  3RN8 A;  1B51 A;  1PDA A;  2ZYN A;  1HSJ A;  4LN5 A;  2WBB A;  3O6I A;  4F39 A; 
#chains in the Genus database with same CATH homology
 4HW8 A;  2QSX A;  3R26 A;  3RLF E;  1SQY A;  3CRB A;  3OEM A;  4H5F A;  4U4X A;  1MPB A;  2REG A;  2M8C A;  3IJX B;  4OEU A;  4QSC A;  4WED A;  3DP6 A;  4DE8 A;  5A5X A;  5DT6 A;  2ZXT A;  5HM4 B;  5CMK A;  3THI A;  3K2D A;  1MS7 A;  4KHZ E;  2F78 A;  4ONY A;  4ELP A;  4E0X A;  3QUF A;  1M5D A;  4F19 A;  1H45 A;  2D5W A;  1DTG A;  3A3C A;  3K00 A;  4TOZ A;  4U4S A;  4YB5 A;  3V89 B;  2Q8J A;  2I49 A;  1Q35 A;  2ZMB A;  1A7L A;  5AA2 D;  1AH5 A;  1B5I A;  3U92 A;  3H4Z A;  3FVG A;  1VFD A;  1UTB A;  3TFL A;  3OOA A;  4YKK A;  3TCG A;  4EF2 A;  5ITO A;  4ZE9 A;  4KCC A;  4X1B A;  2O7I A;  1ZMG A;  1TXF A;  4EXL A;  1URS A;  2THI A;  1KWH A;  3KSX A;  3L6G A;  2DWI A;  3GZG A;  4JB7 A;  4OEN A;  3SDF A;  5CM6 A;  5I58 B;  1QJM A;  5ELV A;  4OZ9 A;  4YMB A;  2NUV A;  4GRK A;  1I69 A;  4OET A;  1A99 A;  3H6W A;  3FIR A;  3U93 A;  3UK4 A;  1POT A;  2PBW A;  3ZS6 A;  1B05 A;  2I3V A;  2CMO A;  5KCJ A;  4N13 A;  4GF8 A;  5A5X B;  1MRP A;  1MXW A;  1NL5 A;  1UQW A;  2XXR A;  1NNF A;  3KJT A;  1DOT A;  3H6V A;  3IOU A;  4I8C A;  4LP2 B;  1POY 1;  1MDQ A;  2OWT A;  5I2N B;  3H6T A;  1SW2 A;  3KSJ A;  3T9X B;  1MM7 A;  3KEI A;  2X7P A;  2F7C A;  1DPP A;  1P1N A;  2W7Y A;  5CC2 A;  4YB6 A;  3O6H A;  2VD2 A;  4QRZ A;  4QSD A;  1VFE A;  1DMB A;  1YCJ A;  3C33 A;  1OVT A;  3O29 A;  5JTY B;  1QUK A;  2ANJ A;  5TPA B;  3UOR A;  1A54 A;  4DXU A;  3IB0 A;  1Y9U A;  3LSL A;  3MPK A;  1FTM A;  1IZ1 A;  1NKX A;  2BJJ X;  3TAJ A;  5L9S A;  1MXZ A;  4Z7E A;  4K3F A;  2OWS A;  4X48 A;  5DTB A;  1LAF E;  2UYE A;  3RT6 B;  4I1D A;  3MQ9 A;  4LON B;  3WAF A;  4HS7 A;  4OYV A;  2V3T A;  4FE8 A;  3IOW A;  2Y7K A;  3FVO A;  3G7W A;  3G3G A;  1ATG A;  4JSO A;  4QFP A;  4E0W A;  2O51 A;  1Y20 A;  1MY0 A;  2OLB A;  4O3B A;  2PVU A;  4FEB A;  4X9T A;  1WDN A;  4POW A;  2OCU A;  3Q25 A;  4UAC A;  3MBP A;  4OTE A;  5IAI A;  3PPR A;  5I2K B;  5KDT B;  4G4P A;  4PQJ A;  1NNK A;  2GH9 A;  4WEP A;  2NVU B;  2H4I A;  1N7W A;  5B7D A;  4F22 A;  4RYA A;  1N0T A;  2F7A A;  2PT1 A;  3IAZ A;  5I2K A;  3MZ1 A;  3PD9 A;  4OFO A;  1LCF A;  2RKM A;  4YKI A;  5ISU A;  2RCA A;  2ZYO A;  4BDQ A;  1I6Q A;  5FHO A;  2FNC A;  1DPE A;  1SYI A;  1XVY A;  2V93 A;  4MF3 A;  1B40 A;  2V84 A;  3MC2 A;  2XXI A;  1TWY A;  4ZE8 A;  4POX A;  5H8N A;  1MXU A;  2NXO A;  4G8N A;  2H98 A;  1VE4 A;  3FZV A;  2ONR A;  3G3K A;  4DLD A;  4F2O A;  1FQC A;  1FQF A;  1O7T A;  3GBA A;  3KN8 A;  2H25 A;  2O7U A;  3QYT A;  3G3F A;  4NMY A;  4R6K A;  3EHS A;  5H8H A;  3VLW A;  2H9B A;  1SI0 A;  4G68 C;  3KG2 A;  2D21 A;  1B1X A;  3F11 A;  3PPN A;  3PUV E;  3HV1 A;  4PET A;  4U23 A;  1ELJ A;  3I3V A;  4NED A;  3T9U A;  4Q8R A;  2RF1 A;  4PFT A;  4F31 B;  1HSE A;  2R9J A;  3MVX A;  2OBG A;  1Y1Z A;  1PB7 A;  5F7V A;  1PC3 A;  4R74 A;  1YAE A;  1SI1 A;  1MQJ A;  3V5A A;  2R6G E;  2PX1 A;  4BDM A;  4OQO A;  3KFM A;  4ELO A;  4ZEB A;  1HSL A;  2F35 A;  4H6D A;  4GL8 A;  1SD3 A;  1MDP 1;  3Q26 A;  4JSD A;  5I56 B;  5I59 A;  2F97 A;  1LFH A;  1FW0 A;  3FUZ A;  4NF5 A;  1EZO A;  5BUU A;  1A8E A;  1OLA A;  2DVZ A;  3R6U A;  4RNS A;  1N7X A;  1YPN A;  2OJT A;  3ZKK A;  4EF1 A;  3S9L C;  3O28 A;  5CMC A;  3FV1 A;  1NNP A;  3EHT A;  1Y4T A;  2QMX A;  4OHN A;  4F1V A;  2AL5 A;  1PB8 A;  1IIT A;  4EQB A;  4H67 A;  3DM0 A;  4MH5 A;  3VLU A;  5I57 A;  4AB5 A;  2Q89 A;  1IXH A;  4DDD A;  1B3G A;  2Y7W A;  4JWX A;  4GFR A;  3CI8 A;  4IO6 A;  3T22 A;  4OMB A;  3OD7 A;  3EN3 A;  4NF4 B;  4LZ7 A;  4Z0I A;  1A55 A;  4YB7 A;  4RA1 A;  4ZZA A;  3O66 A;  3W9W A;  3FJ7 A;  1ANF A;  4YIC A;  3JYR A;  3N94 A;  1OLC A;  4H0W A;  4G8H A;  2PYY A;  4G8M A;  5FTH A;  4P0G A;  2QJE A;  2XXW A;  4GOT A;  1NH7 A;  2ESN A;  2FYI A;  3FXR A;  3EQ1 A;  3ODB A;  3FD3 A;  5K2X A;  2UVJ A;  1LFG A;  1US4 A;  1Y3Q A;  4GWO A;  2I4C A;  2RC8 A;  4OVJ A;  4H65 A;  2A5T A;  3OSQ A;  3DLN A;  1SW5 A;  1UTB B;  3IX1 A;  2F6G A;  3VVD A;  1AIV A;  2Y7I A;  5DVI A;  1B6H A;  1MQI A;  1B7U A;  3TEL A;  2Z22 A;  2B3F A;  3ZSF A;  1LAG E;  5TP9 A;  1H3D A;  1OQH A;  2E0S A;  1D9V A;  2V3U A;  1WVJ A;  2GHA A;  1MM6 A;  2DE4 A;  3IOV A;  2ONK E;  3KJ7 A;  1GTK A;  2DS9 A;  1XOC A;  4KR5 A;  1FTK A;  4RPN A;  5FHM A;  3TMG A;  3N6T A;  1R9Q A;  1M5B A;  4PP0 A;  1VR5 A;  4ECF A;  4IO3 A;  3TEP A;  3VXC A;  1OQG A;  3CR9 A;  4KYE A;  1NNT A;  4IO5 A;  3T9H B;  4H8J A;  3R7X A;  3S4U A;  3PPQ A;  5CBR A;  1Z7N E;  4QHQ A;  4O3A A;  5H8S A;  3Q27 A;  3MWB A;  3W9V A;  4HTG A;  3S9N C;  1UTH A;  1D9Y A;  3FJG A;  3PGF A;  4F1Y A;  4F2Q A;  2ZNS A;  3TCH A;  2XX8 A;  3VVF A;  5ICQ A;  2XXX A;  4PFW A;  1DTZ A;  4TQU Q;  2F7B A;  3C35 A;  3UA8 A;  1EU8 A;  1QKB A;  3O97 A;  4R6Y A;  3K1P A;  4U1Z A;  1B3H A;  1DSN A;  2P1S A;  3KGC A;  3K6V A;  1JVY A;  4N07 A;  2F36 A;  4DZ1 A;  4IO4 A;  3I5O A;  3LC8 A;  3QSL A;  4U21 A;  3MPL A;  3RUM A;  3FAS A;  3L6H A;  4MLV A;  4ZEK A;  4IO7 A;  1BKA A;  5AE4 A;  3QAX A;  3CVG A;  4LAT A;  4R2F A;  1FQD A;  1LLS A;  4JXI A;  4NF5 B;  5CMB A;  4AB6 A;  3TPA A;  4JDF A;  4G2Z A;  3M3L A;  3TCF A;  1LBC A;  1QUL A;  3IK6 B;  3MVY A;  3T93 B;  2XXP A;  2RC7 A;  1S9T A;  3OO9 A;  3CFX A;  2PT2 A;  4NF8 A;  4BDR A;  4H8I A;  4N6P A;  5AA4 B;  2QS1 A;  2REJ A;  5JTY A;  4OWD A;  1RKM A;  5DYH A;  4NF6 B;  1B32 A;  3K6W A;  3KOT A;  1SVX B;  1XS5 A;  3OO7 A;  2ZNT A;  5KDT A;  3DEL B;  1QKA A;  3PMX A;  1B3F A;  3SEY A;  3PD8 A;  1RYX A;  3BFU A;  3G3H A;  1LST A;  3SEX A;  3TTM A;  2I58 A;  1JEU A;  2HEU A;  1NH8 A;  2I4B A;  4I62 A;  1AMF A;  1GVC A;  3C36 A;  3TKD A;  3FVK A;  4QF9 A;  3TQW A;  1LAX A;  5DVF A;  4DCY A;  2HCA A;  4LA9 A;  2AYS A;  4UA8 A;  3OEN A;  1M5F A;  1MY4 A;  4EDP A;  4OEV A;  5AA2 A;  1AOV A;  2RIN A;  2P0S A;  3VV5 A;  4LUB A;  2DP8 A;  1J1N A;  1QUJ A;  2Y7R A;  3SER A;  4BLA A;  1P1Q A;  2HZK A;  3HCQ A;  3O6G A;  5L9O A;  2UVH A;  2OK2 A;  3H06 B;  3BBR A;  3M3F A;  1XC1 A;  3HST A;  3GBB A;  5J1D A;  2X7Q A;  4KFQ A;  4NE4 A;  2DSF A;  5CBS A;  3T9V A;  3TTK A;  2Y7P A;  2LAO A;  4NWC A;  3MJN A;  1IEJ A;  1SW4 A;  1B1H A;  2A5S A;  2DWJ A;  2I0B A;  2O6A A;  3B6Q A;  3E3K A;  3PPO A;  4PFY A;  1JW1 A;  4QFO A;  4NF4 A;  5CRY A;  4ZZE A;  2ZYK A;  5AA3 A;  5ITP A;  3TDJ A;  4RY1 A;  3SES A;  2DXR A;  3UIF A;  3FXQ A;  2RC9 A;  1PBP A;  3A3U A;  4ISU A;  2ONS A;  3A09 A;  3B6W A;  4XIG Q;  1T0K A;  1BLF A;  2XXY A;  2XXV A;  1ZTY A;  1P1U A;  4TLL B;  4IY6 A;  1B7H A;  1S7Y A;  2DQV A;  2FA7 A;  4F29 A;  4ZED A;  1Y4C A;  4MBP A;  4ZEC A;  1MG1 A;  3KN7 A;  1PB9 A;  4OXV A;  2F34 A;  3TOD A;  5CMM A;  3MZB A;  3IR1 A;  2YLN A;  3MAM A;  3GXA A;  3S2V A;  2DWH A;  1FQB A;  4DXC A;  3IB2 A;  2Z8F A;  4HCW A;  5DEX A;  3LSX A;  3M3K A;  5EHM A;  5K2Y A;  4QFN A;  3U8Q A;  4TLM B;  3MZ9 A;  3RTF B;  1B5J A;  1N04 A;  3QIM A;  4JBZ A;  3VDF A;  1B7Z A;  1Y1M A;  4C0R A;  4R6H A;  3MVZ A;  2QMW A;  2Z8D A;  3PUW E;  1MPD A;  1FQE A;  3MUQ A;  4FAT A;  1XVX A;  3G3J A;  2UVI A;  3UP9 A;  1ZBM A;  4FAJ A;  4OER A;  4U1O A;  1B58 A;  3MW0 A;  3KZG A;  2YJP A;  4JWY A;  3MP8 A;  4FIM A;  4R73 A;  5EYF A;  3RT8 A;  3VXB A;  5ICT A;  5JK4 A;  3K01 A;  2ZYM A;  3TYH A;  4I9D A;  5L9M A;  1ZLQ A;  1H43 A;  1N76 A;  1AL3 A;  1P1O A;  3OSR A;  3GLB A;  1MY3 A;  3ILU B;  4NF6 A;  5TU0 A;  4KI0 E;  2DE3 A;  5DEX B;  1SDX A;  3K6U A;  3SEU A;  3FGS A;  3VVE A;  2DE2 A;  3P7I A;  1MH3 A;  4YMA A;  4LQ2 A;  4QFL A;  3T66 A;  1SBP A;  4C1T A;  3H3G A;  2XXT A;  4KYS A;  1D4N A;  2H5Y A;  4BDN A;  4DCX A;  2G29 A;  5TP9 B;  3EF7 A;  1B0L A;  4R72 A;  4FEC A;  4FED A;  2GHB A;  4LVQ A;  4XKQ A;  2ABH A;  3OEL A;  4F3B A;  3LR1 A;  1QUI A;  5H8H B;  2AL4 A;  3USD A;  1I6A A;  3K6X A;  4F3P A;  4R2B A;  1R1N A;  2O1M A;  3FAT A;  3K4U A;  1P99 A;  2QS2 A;  3MVW A;  4GQO A;  4KPT A;  4MFI A;  4Q0C A;  4GVO A;  4RK2 A;  3D4C A;  2ZNU A;  5B70 A;  1SW1 A;  2QRY A;  3TTN A;  3IO6 A;  3IO4 A;  5M2V A;  1LFI A;  1ZIU A;  4Q5T A;  4ZEF A;  4OFL A;  1URG A;  3IB1 A;  1B46 A;  4IGR A;  1OVB A;  2Q2C A;  4QSE A;  4EQ9 A;  2B3B A;  2GRV A;  4NTL A;  3V8X B;  4AQ4 A;  1R9L A;  3H03 A;  4ELR A;  1OIB A;  1VSO A;  5HPQ A;  3SEV A;  1MQH A;  2DVC A;  1IQ7 A;  2ALU A;  2O1L A;  3ONM A;  1I6B A;  5I59 B;  2QS4 A;  1JQF A;  2HAU A;  4BDO A;  1B4Z A;  2RCB A;  1FTJ A;  1SYH A;  1NMU A;  4U22 A;  5LOM A;  3EHU A;  3CFL A;  2HZL A;  3H7M A;  5DVJ A;  3VE1 B;  3B6T A;  3TQL A;  3O2A A;  3TTR A;  3CG1 A;  3ZKL A;  1B3L A;  2WKY A;  4RXL A;  2HFB A;  1L5T A;  3VLV A;  4ESW A;  1M5C A;  2V3Q A;  1UTH B;  1O63 A;  1O64 A;  4L17 A;  1MH4 A;  1MXX A;  3TUS A;  3C9H A;  4LZ8 A;  3QXM A;  3HHG A;  1N3W A;  2XD3 A;  3BKI B;  4XKR A;  1Y3N A;  2NOO A;  3E9X A;  5I56 A;  3FVN A;  3C32 A;  2O84 X;  4GXS B;  1MXY A;  1R6Z A;  2HXW A;  1TT1 A;  3B7D A;  3K02 A;  5EHS A;  4C1U A;  2B65 A;  2P2A A;  2I6E A;  2QL3 A;  2G93 A;  1UIV A;  3CSB A;  3IJO B;  4LQ5 A;  2XXH A;  3BFT A;  2O68 A;  5L8D A;  4OFJ A;  4PFU A;  3SEW A;  5H8N B;  3IOR A;  1IXG A;  4P0I A;  1IXI A;  3CFZ A;  1B9J A;  1ZKB A;  3LUY A;  3V83 A;  1NFT A;  3MP1 A;  5H8Q B;  1LAH E;  1JNF A;  1LBB A;  1LCT A;  3DP4 A;  3E13 X;  3HN0 A;  3HPI A;  3K0V A;  4IB2 A;  1TFD A;  3FJM A;  1GGG A;  2H99 A;  3IL1 B;  3KN3 A;  4JWO A;  3N26 A;  3PPP A;  4BDL A;  1RYO A;  3K1N A;  4WXJ A;  4F3S A;  4EXK A;  1N3X A;  4XKP A;  4F3G A;  1LB8 A;  4LZ5 A;  4M4G A;  4ZS9 A;  2F8D A;  3ECR A;  4DIG A;  5I57 B;  4R9G A;  3OEK A;  1ZU0 A;  2I0C A;  3EPE A;  1P1W A;  3OO6 A;  1Q1K A;  2VOZ A;  1JEV A;  2OZZ A;  3AXF A;  3SKP A;  5I2N A;  4QFK A;  1USY H;  3HO7 A;  3QK6 A;  4P11 A;  2IA4 A;  4KCD A;  4EUO A;  1B2H A;  3CIJ A;  1B0H A;  2Q9T A;  4DXB A;  5H8F A;  3T96 B;  3QUJ A;  3S9M C;  4Q30 B;  1XHY A;  1EZ9 A;  3LSF B;  1IUD A;  3M8U A;  3PUX E;  2DOJ A;  3HHF A;  5H8F B;  5TPA A;  1EZP A;  2XX9 A;  4FJP A;  3U94 A;  4YAH X;  2KLF A;  1LB9 A;  4H1X A;  4ESX A;  1OMP A;  1BTJ A;  4EQ7 A;  1LGB C;  3Q29 A;  3N6U A;  2X26 A;  1CB6 A;  4U2R A;  1Z7M E;  3OXN A;  2QPQ A;  5JEI A;  4XXU A;  1QVS A;  2AIX A;  3FV2 A;  3H6U A;  5F1Q A;  4F1U A;  4G77 A;  2D3I A;  2XXQ A;  3PUY E;  3N5L A;  2XX7 A;  3CG3 A;  4PE5 B;  1GR2 A;  3OMB A;  3KOS A;  3TTL A;  3D4G A;  3C34 A;  4R75 A;  1PEB A;  2I3W A;  1FTL A;  5KCJ B;  1II5 A;  4KD5 A;  1BP5 A;  1JW4 A;  3RPW A;  3MP6 A;  3RY3 A;  4HCY A;  3PMV A;  2HQ0 A;  2QS3 A;  2UXA A;  3PU5 A;  2IEE A;  2VGQ A;  3ILT B;  3U72 A;  5AA4 A;  1Y3P A;  4MLQ A;  2F5X A;  1FQA A;  4O3C A;  4OES A;  5HBC A;  2VHA A;  1GV8 A;  2YPN A;  4RK9 A;  3UGW A;  1QW0 A;  4GLI A;  1US5 A;  1USY E;  1MQG A;  2UYF A;  4XKN A;  3E4R A;  4YKP A;  3RGY A;  2A5T B;  4G68 A;  3UN6 A;  2HAV A;  2XHD A;  1MY2 A;  1FTO A;  3VFJ A;  1JVX A;  2O69 A;  3PMW A;  4IY5 A;  2NWJ A;  3W15 C;  2DXY A;  2Y84 A;  1MPC A;  3RNN A;  3LBS A;  2F6P A;  4G68 B;  1B5H A;  5FHN A;  5IKB A;  3C4M A;  3KBR A;  2Z23 A;  4NWD A;  5I58 A;  2DYX A;  2XD2 A;  4M1V A;  3DP8 A;  4IO2 A;  4RJZ A;  1H44 A;  1CE2 A;  1WOD A;  2GFE A;  4IGT A;  4NF8 B;  4ELQ A;  3RQT A;  1M5E A;  4XTC Q;  3O9P A;  3RTW B;  5H8Q A;  2DWA A;  1MXV A;  2VD3 A;  4KYD A;  4R9F A;  2R71 A;  4GD5 A;  3SET A;  1MY1 A;  1URD A;  2Q2A A;  1EH3 A;  3FXU A;  4GXA A;  2XXU A;  4H5G A;  5FTI A;  3Q28 A;  4FOR A;  5KZT A;  1B4H A;  4GL0 A;  4WKM A;  4YKJ A;  3PV0 E;  2Z8E A;  3U1O A;  1BIY A;  1FCK A;  3K1M A;  1MQD A;  1XT8 A;  1B52 A;  2I48 A;  2Q88 A;  4RPO A;  1JW5 A;  1PBQ A;  1YTV A;  1IXC A;  1F9B A;  3JZJ A;  2V25 A;  3G3I A;  1A40 A;  3I6V A;  1A8F A;  4ZDM A;  4X1D A;  3WAE A;  5BWJ A;  1TFA A;  3TZA A;  4ND9 A;  4YZZ A;  1D3K A;  3PUZ E;  1UIU A;  4THI A;  4GIZ A;  3OO8 A;  2UVG A;  3S9E A;  2VP1 A;  1B3E A;  3C31 A;  3JV9 A;  4KQP A;  3LSW A;  4YU0 A;  1B51 A;  3CSG A;  4ZEI A;  3RN8 A;  5AA2 B;  1PDA A;  1ZJL A;  3IOT A;  5I84 A;  2PMS A;  1N84 A;  2ZYN A;  1JET A;  1IIW A;  1HSJ A;  2E1S A;  2CZL A;  4F18 A;  1H76 A;  1S50 A;  5CI5 A;  5AA1 A;  3O6I A;  4F39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...