2I0CA

Crystal structure of the glur6 ligand binding core dimer crosslinked by disulfide bonds between y490c and l752c at 2.25 angstroms resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
257
structure length
257
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITCVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAICQLQEEGKLHMMKEKWWRGNGCPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Conformational restriction blocks glutamate receptor desensitization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 83
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2i0cA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2i0cA02
4U4SA 1I69A 4R6HA 1MS7A 1XVXA 2VP1A 1MY0A 4LUBA 2AYSA 2ZYNA 3G3HA 2H5YA 1LAHE 1UTHB 1N84A 1OLCA 3GLBA 4IO6A 3BBRA 5AA4B 3F11A 2W7YA 4E0WA 3IO6A 4F3PA 3HN0A 3N26A 3K6UA 2HZKA 4JWXA 5F1QA 1ANFA 3R6UA 3OELA 1B4ZA 4NF4B 5H8QB 4R2BA 1ELJA 5HPQA 2DWHA 2REGA 4R74A 3MWBA 2ZMBA 4PP0A 4LQ5A 1OLAA 1H44A 1N7XA 1EZ9A 4YB6A 3ILTB 2Y7PA 5A5XA 2O84X 3K4UA 4IY6A 4GRKA 1B05A 3TEPA 4ZEFA 1SQYA 3MZ9A 4BDOA 1A8EA 4XKPA 5H8HB 3CSBA 5TPAA 2Q8JA 2QMWA 2HEUA 2F97A 3S2VA 4ELQA 3TTLA 2FA7A 1A8FA 4MF3A 2DWIA 1Q35A 4R72A 1EH3A 5I59A 1B3FA 5ICTA 4N07A 1URGA 3O6GA 2Z8DA 5CMCA 4FJPA 4OVJA 1B3GA 1PEBA 1PDAA 4RYAA 3MPKA 4QFNA 3N6UA 3PGFA 5TP9A 4XXUA 1UTBB 4NF8A 4NF5A 4RNSA 2RF1A 4GLIA 4EQ9A 1NNFA 3T9HB 2DYXA 3CSGA 1N04A 5CMKA 1MY2A 1ZBMA 3EHTA 1URDA 3T9UA 3EQ1A 2GHAA 4YKJA 4KPTA 3MP6A 4G68C 1B7ZA 4I1DA 5KCJA 2GFEA 3DELB 4LATA 2F7AA 1PC3A 3LUYA 2OWSA 1A99A 3RPWA 3VVFA 3Q27A 1LCTA 1USYH 2O51A 1LCFA 5JTYB 3USDA 2ONSA 1IQ7A 2ALUA 4XKQA 4H65A 1LB9A 4NE4A 5FHMA 4F39A 3KSJA 4G8MA 1MQGA 4YKPA 2Z23A 3V8XB 4MLVA 4OXVA 4OFLA 2Y7RA 5FTHA 4QSEA 1JNFA 1RYXA 2X7PA 3PPPA 5A5XB 5AA2D 2VD2A 4YB7A 3N5LA 1OIBA 3B6WA 3RLFE 1VFDA 4TLMB 3WAEA 4I62A 4KQPA 5B7DA 4MFIA 4RPOA 4GL8A 1GGGA 4BDRA 5AA2B 2I4CA 4GFRA 3UP9A 1YCJA 5KDTB 4LP2B 3TAJA 3T22A 2ZNSA 2B3FA 2E1SA 1OMPA 2Q88A 3PD8A 3C35A 3UK4A 3MP1A 1IXCA 3RNNA 5TP9B 1Y1ZA 3RUMA 2E0SA 1DTZA 2XXXA 2XXUA 5DT6A 1MQIA 2HXWA 2Y84A 3TMGA 4NF5B 3K2DA 1B0HA 3MQ9A 4JSDA 2UVGA 3TFLA 2AL5A 2ZYKA 2ABHA 1GR2A 2HQ0A 2ZYMA 3MPLA 2ONRA 5DVFA 1P1WA 3VXCA 5CMMA 3K00A 2ZXTA 4BDLA 2NWJA 3TTMA 3ZKLA 4BDNA 1XOCA 2QRYA 3KOTA 3T96B 3FVGA 3B6TA 2QL3A 4F3SA 3RY3A 3QYTA 1Y3PA 2XXTA 3Q28A 4BLAA 4R2FA 3O6HA 2IA4A 1NNPA 1PBQA 4XKRA 3M3FA 3B6QA 2H25A 1NMUA 1CE2A 3MC2A 4M1VA 5CI5A 3Q29A 5I57A 4LONB 3ECRA 1IITA 1LB8A 2QSXA 1POTA 3A09A 2HFBA 2D5WA 3CIJA 3QIMA 3JZJA 3UA8A 3TCHA 5DEXB 1EZOA 2Y7KA 2FNCA 3RGYA 3S9EA 1D4NA 3IO4A 2PBWA 4DZ1A 2R71A 2UXAA 2CZLA 2I6EA 1B51A 4C1UA 3O6IA 1N7WA 4TLLB 1MM6A 3MJNA 3FIRA 4LVQA 3V5AA 2GH9A 1MY4A 4QFPA 1JW1A 2DXYA 3IJXB 4TQUQ 3FVOA 3ILUB 1FTLA 1IXGA 4HS7A 1IUDA 3UORA 4NMYA 4I8CA 1AIVA 1M5FA 1CB6A 3K0VA 1LFHA 3H6WA 4C0RA 2P0SA 4XKNA 4Q8RA 3UGWA 2I58A 1SI0A 1TFAA 4EXLA 4O3CA 4LA9A 1JVYA 5BWJA 3R7XA 2FYIA 3I3VA 4EQ7A 4KHZE 3M3LA 3H4ZA 2I49A 1WDNA 2B3BA 1VE4A 2F7CA 1POY1 4ELOA 1BTJA 1MXZA 2R6GE 2DE2A 4F29A 1N3WA 3KN3A 1WODA 4GOTA 2DE4A 2VOZA 2OBGA 1M5CA 1JEVA 5I56A 3H6TA 5I2KA 2F6PA 3G3IA 4BDMA 3U1OA 1N76A 2DS9A 4GXSB 1M5EA 3VVEA 3RT6B 3OENA 1RYOA 4POXA 2I0CA 1DMBA 4FORA 1UIUA 4XTCQ 2O68A 1FQEA 1GV8A 2XXQA 4FEBA 2M8CA 4F3BA 3A3CA 3O9PA 5DTBA 4QSCA 2I3WA 2V3UA 4ZEKA 3IOTA 3C34A 1Y4CA 1B40A 4U1OA 3H6UA 2PT1A 2O1LA 4ZEDA 5HM4B 4M4GA 4NWDA 4OQOA 4DDDA 4ZE9A 3SETA 5FHOA 4AB6A 4OESA 4YZZA 1OQHA 5DVIA 3K1MA 1B1XA 2Y7WA 1SW1A 1SVXB 1LAGE 4RPNA 3MVZA 2A5TA 1QUIA 1TFDA 2OWTA 1N3XA 3MP8A 4NEDA 4RA1A 3MBPA 1JEUA 1BLFA 3GZGA 4U4XA 4EQBA 4F1UA 4R9FA 4R6KA 1B58A 5KZTA 4E0XA 2V25A 1Z7ME 2Z8EA 4F31B 4G4PA 3SEVA 1ZKBA 1SW4A 2O6AA 3KOSA 4OHNA 3VDFA 4HTGA 1QULA 4ESWA 4HW8A 5H8SA 4OETA 4IY5A 4TOZA 1HSJA 2RCBA 3MZBA 1B3HA 1A55A 3QSLA 2UVHA 3HHFA 3FD3A 3MVWA 2QS3A 2XHDA 4F2QA 4F1VA 3VFJA 1ZLQA 4H8IA 1FTJA 4PFYA 4GIZA 1B5HA 1SDXA 3GBAA 1SI1A 1JQFA 4N13A 2PVUA 3TTRA 1BKAA 4NF6A 3C36A 4Z0IA 1MH3A 3VV5A 3FZVA 4ESXA 3IL1B 4HCYA 2VHAA 1PB8A 4JXIA 1B3LA 1P99A 3OMBA 4GD5A 5JEIA 3FV2A 3TTNA 5CMBA 1FQDA 4GXAA 4G8NA 4FATA 4ELRA 2PT2A 5F7VA 2Z8FA 2NXOA 3FGSA 3TELA 3N94A 1EZPA 4ONYA 2Z22A 3PUYE 2A5TB 2KLFA 3PMWA 2R9JA 3LSXA 1H3DA 3PPRA 4YMAA 4Z7EA 3UIFA 4X48A 4GWOA 4DXBA 5IAIA 3FASA 2NVUB 5DVJA 1LFGA 4QRZA 1XC1A 5H8FA 4KYSA 4DXUA 1B52A 1A54A 4U22A 3SDFA 4BDQA 3O97A 4K3FA 2H98A 1T0KA 3FUZA 3K6WA 2XX9A 4MBPA 1XVYA 1OVTA 1SYHA 4X1BA 3MAMA 3VXBA 1OQGA 4OMBA 3FVKA 1B0LA 3FXRA 1US5A 4IGRA 3L6HA 2UVIA 3LSLA 3TZAA 4YAHX 3T93B 3HCQA 4R73A 1O63A 5TPAB 1SW2A 1D9YA 3IX1A 3T9VA 3DM0A 4IB2A 3G3GA 3K6VA 4OEUA 4F19A 3M8UA 1UIVA 3KJTA 5I59B 3TQLA 1US4A 1XHYA 4NF6B 1AOVA 1ATGA 5TU0A 4G8HA 1FTKA 1ZIUA 3GBBA 2X26A 5AA1A 2O7UA 3TTKA 3ONMA 3RT8A 1N0TA 5B70A 1UQWA 2YJPA 4NF8B 3ZS6A 1PB7A 3HPIA 1S50A 3PU5A 1AH5A 3MVXA 3O2AA 3SKPA 5I84A 4P0IA 4UACA 1D9VA 2D21A 1QVSA 2REJA 4ZDMA 3KN8A 3TUSA 2XXVA 1R9LA 1LLSA 1GVCA 5KCJB 3BKIB 1FQCA 3A3UA 5BUUA 5CBRA 3SEUA 4F3GA 2GHBA 5I2NA 3EN3A 1B5IA 5ITOA 2Q89A 4F1YA 2F36A 1H76A 1Y9UA 4ELPA 3G7WA 4PFUA 5M2VA 1P1QA 2DXRA 1VR5A 1YPNA 4Q5TA 1FCKA 3TYHA 2Q2AA 3TCGA 4WXJA 4KD5A 1A7LA 2D3IA 2DE3A 1XT8A 1DOTA 4EF2A 5I58A 2F35A 3E13X 1D3KA 3IK6B 3ZKKA 4O3BA 2DOJA 5CRYA 4IO4A 1MG1A 1DSNA 4U2RA 1H43A 2O69A 3SEWA 1LBCA 1MQDA 3DP8A 1Y1MA 3WAFA 5L9OA 4QFLA 3B7DA 4IO7A 3IOVA 2ZNTA 1II5A 3BFTA 2XXIA 3OO8A 3MZ1A 3CI8A 3V83A 2XXRA 2ZYOA 1R1NA 1MQJA 2HAUA 2G29A 4RK2A 1FW0A 2OK2A 2BJJX 3KG2A 3CG3A 5AA3A 4MLQA 4F22A 4RXLA 3EF7A 1I6AA 3FJ7A 2DWAA 4C1TA 1Y3NA 2DWJA 2V3QA 3C9HA 4H6DA 1ZU0A 3IOUA 5CC2A 1QJMA 3RTWB 2A5SA 3KGCA 3OEMA 4RJZA 1MPBA 4WEPA 4X1DA 2P2AA 1FTOA 4OERA 3UN6A 4ISUA 4FEDA 3H7MA 3PV0E 1MXUA 1S7YA 3FXQA 4Q0CA 3TODA 1SBPA 4JWOA 1SW5A 1M5BA 5CBSA 1ZJLA 4NF4A 3SESA 1DPPA 2GRVA 3KSXA 3H03A 5J1DA 4RY1A 2CMOA 1SD3A 2QMXA 3C32A 3H6VA 1MQHA 1F9BA 2F34A 3S9LC 3E9XA 4I9DA 1B7UA 2XX7A 3IORA 4NWCA 3Q26A 4H67A 4OFJA 3W9WA 3O28A 1MM7A 2G93A 3CR9A 2V93A 4KR5A 2PMSA 1B6HA 4IO3A 4R6YA 5I57B 5ISUA 4LZ5A 2DVZA 3HSTA 3FATA 2B65A 2F8DA 4G2ZA 4KYDA 4JSOA 4LZ7A 4ND9A 3N6TA 3IB2A 4U23A 2WKYA 3L6GA 3O66A 3U72A 4N6PA 4GQOA 3OOAA 5L9MA 3QUJA 1AL3A 1SYIA 3EHUA 1NKXA 1O64A 4EUOA 1QKAA 5ICQA 2XXPA 3IJOB 3MUQA 1FQBA 4F2OA 3MVYA 1LFIA 4PETA 3FVNA 5EHSA 2H4IA 2QJEA 2XX8A 2ZNUA 4DLDA 1NH8A 4POWA 2RC7A 5AE4A 2RC9A 2AIXA 2UYFA 2V3TA 2YPNA 4MH5A 4U1ZA 4HCWA 2H99A 4WEDA 1JW4A 3OD7A 5JTYA 1B32A 1URSA 4KFQA 4Q30B 1TWYA 3G3FA 2XXWA 4QFKA 5ELVA 1GTKA 3FV1A 3HO7A 5I56B 4U21A 4EXKA 1NH7A 5I2KB 5FHNA 2ANJA 2I4BA 1R9QA 3DLNA 2Y7IA 3RN8A 1LBBA 1AMFA 3E3KA 3P7IA 1HSEA 1VFEA 1PB9A 4YKKA 3KEIA 2QPQA 3G3JA 1YTVA 4ZEBA 5L8DA 2H9BA 4EF1A 1JVXA 4PFWA 1ZTYA 3KN7A 3QAXA 1B4HA 4OZ9A 4ZE8A 2XXYA 4QFOA 3C4MA 5AA2A 1PBPA 1QUJA 4PE5B 5KDTA 3W15C 3K6XA 1WVJA 4IO2A 2VD3A 1B1HA 1DTGA 5L9SA 1B2HA 4R9GA 5JK4A 4ZZAA 2NOOA 2THIA 3SEYA 4UA8A 2QS4A 1IEJA 1P1NA 2I3VA 3PPNA 3C33A 3U94A 2HAVA 4QSDA 3IB1A 3FJMA 3SEXA 4ECFA 3I5OA 1RKMA 3ZSFA 4EDPA 3HV1A 3S4UA 2X7QA 2RINA 3EPEA 1FQFA 2VGQA 2O1MA 4FIMA 3VLVA 5HBCA 4THIA 2DVCA 2F78A 3S9NC 3D4GA 3LBSA 2I0BA 4OTEA 4OEVA 3EHSA 2UYEA 4OWDA 4YB5A 3CFXA 4FE8A 2P1SA 3K02A 4OYVA 3I6VA 4FECA 1B46A 2ONKE 1I6QA 1XS5A 1VSOA 2AL4A 3TQWA 3T9XB 3E4RA 3OSRA 3TCFA 4QHQA 3SERA 1LAXA 3PUVE 1DPEA 1J1NA 1MY1A 4FAJA 4XIGQ 4PFTA 4YICA 3VVDA 1IZ1A 3ODBA 3OO7A 1JW5A 4DE8A 1NFTA 1Q1KA 3LSWA 3G3KA 2QS1A 1B3EA 1MXWA 4KYEA 3W9VA 1O7TA 2UVJA 3OO6A 1NNKA 3IR1A 2NUVA 3OXNA 4JBZA 4KI0E 4O3AA 1QUKA 2LAOA 5K2YA 3MW0A 4RK9A 3PPQA 3IAZA 3CFLA 3LR1A 2F5XA 1Z7NE 4H1XA 4JDFA 3U8QA 5DEXA 2F6GA 1L5TA 1MH4A 3K1NA 3RQTA 1R6ZA 4H5FA 4DCYA 1LSTA 4AQ4A 1A40A 2HZLA 3LSFB 4P0GA 3KFMA 3M3KA 1B7HA 5H8NA 1QW0A 4YU0A 3TKDA 1Y4TA 1B5JA 4IGTA 1Y20A 1P1OA 3CVGA 2V84A 1Y3QA 2Q2CA 5ITPA 4YKIA 2RKMA 4G68A 3VLWA 3AXFA 3OO9A 3PUXE 5H8FB 2IEEA 3DP6A 1TT1A 1TXFA 3PMXA 1IXIA 4DIGA 4GVOA 3THIA 1MPCA 3FXUA 1NL5A 1MPDA 3BFUA 2HCAA 4L17A 4DXCA 5K2XA 4ZZEA 3RTFB 1NNTA 4G77A 4AB5A 1QKBA 4YMBA 3PPOA 4KCDA 1MXVA 1EU8A 1KWHA 3K01A 3CFZA 2OZZA 2PYYA 2XD3A 4JWYA 4KCCA 1FQAA 5EYFA 3CG1A 3T66A 4OENA 3U93A 5EHMA 1B9JA 4ZS9A 3GXAA 4WKMA 5FTIA 1IIWA 3FJGA 3CRBA 3D4CA 3V89B 2OCUA 4H5GA 1MXXA 3KJ7A 3DP4A 3QUFA 4IO5A 4ZEIA 4JB7A 1LAFE 2DP8A 2XD2A 5LOMA 4OFOA 1OVBA 1BIYA 3KBRA 3K1PA 3C31A 1S9TA 1HSLA 1YAEA 1UTHA 5H8NB 1BP5A 5AA4A 2ESNA 4H8JA 3VLUA 4GL0A 3VE1B 3IB0A 1ZMGA 1USYE 3OEKA 3Q25A 2RCAA 3KZGA 1IXHA 5I2NB 1JETA 4G68B 3TPAA 3U92A 4PQJA 3OSQA 3PUZE 4NTLA 3R26A 2O7IA 3PMVA 5H8QA 1FTMA 1M5DA 1MDP1 4H0WA 2I48A 3LC8A 2QS2A 4LQ2A 4R75A 1H45A 3H3GA 3S9MC 2PX1A 5I58B 2RC8A 1P1UA 3TDJA 5H8HA 3JYRA 2DSFA 3O29A 4ZECA 1MXYA 2OJTA 5CM6A 1MY3A 2YLNA 3QXMA 2OLBA 4P11A 4QF9A 1LGBC 2F7BA 4F18A 5IKBA 3HHGA 3QK6A 1I6BA 4DCXA 3PUWE 4LZ8A 1MDQA 4X9TA 3IOWA 1MRPA 2Q9TA 2DQVA 5DYHA 3JV9A 3PD9A 1UTBA 4GF8A 3H06B 2XXHA
chains in the Genus database with same CATH superfamily
4U4SA 1I69A 4R6HA 1MS7A 1XVXA 2VP1A 1RDXA 4GWUA 1MY0A 4LUBA 4MNCA 1NV7A 5IZZA 2AYSA 2ZYNA 3G3HA 2H5YA 1LAHE 1UTHB 4QBAA 1N84A 1OLCA 3GLBA 4IO6A 3BBRA 4I3YA 5AA4B 3F11A 2W7YA 4E0WA 1VDWA 3IO6A 4F3PA 3HN0A 3N26A 3K6UA 2HZKA 4JWXA 1NV6A 3MSTA 4NX1A 4NQ8A 5F1QA 1ANFA 3R6UA 3OELA 1B4ZA 4NF4B 5H8QB 4R2BA 1ELJA 5HPQA 1IMBA 5ESYA 2DWHA 2REGA 1YZ0A 4R74A 3MWBA 2ZMBA 4PP0A 4LQ5A 1OLAA 1H44A 1N7XA 1EZ9A 4YB6A 3ILTB 2Y7PA 5A5XA 2O84X 3K4UA 4IY6A 4GRKA 1B05A 3TEPA 4ZEFA 2Y5KA 1SQYA 3MZ9A 4BDOA 1A8EA 4XKPA 5H8HB 3CSBA 5TPAA 2Q8JA 2QMWA 2HEUA 2F97A 3S2VA 4ELQA 3TTLA 5ET8A 2FA7A 2Q8MA 4XEQA 1A8FA 4MF3A 3KBZA 2DWIA 2JJKA 1Q35A 4R72A 1EH3A 4NHBA 1B3FA 5I59A 5ICTA 4N07A 1FPLA 1URGA 3O6GA 2Z8DA 5CMCA 4FJPA 4OVJA 1B3GA 1PEBA 1PDAA 4RYAA 3MPKA 4QFNA 3N6UA 3PGFA 5TP9A 1EYJA 4XXUA 1UTBB 4NF8A 4NF5A 4RNSA 2RF1A 4GLIA 4EQ9A 1NNFA 3T9HB 2DYXA 4NF0A 4MCOA 2VPNA 3CSGA 1N04A 5CMKA 1MY2A 1ZBMA 2WYKA 3EHTA 1URDA 3T9UA 3EQ1A 2GHAA 4YKJA 4KPTA 1FPDA 1NUWA 3MP6A 4G68C 1B7ZA 4I1DA 5KCJA 2GFEA 3DELB 4LATA 2F7AA 5LDZA 1PC3A 3LUYA 2OWSA 1A99A 3RPWA 3VVFA 3Q27A 1LCTA 1USYH 5EYGA 2O51A 1LCFA 5JTYB 3USDA 1FBEA 2ONSA 1FPKA 1IQ7A 2ALUA 4XKQA 4H65A 1LB9A 4NE4A 5FHMA 4F39A 3KSJA 4G8MA 1MQGA 4YKPA 2Z23A 5ET7A 1G0IA 4PE3A 3V8XB 4MLVA 4OXVA 4OFLA 2Y7RA 4G61A 4GX3A 5FTHA 4QSEA 1JNFA 1RYXA 1G0HA 2X7PA 3PPPA 5A5XB 5AA2D 2VD2A 5EYHA 2HPGA 4YB7A 3N5LA 1OIBA 1NUZA 4NGUA 3B6WA 3RLFE 1VFDA 4TLMB 3WAEA 4I62A 4KQPA 5B7DA 4MFIA 4RPOA 2CZHA 4GL8A 5IZ3A 2BJIA 4P56A 1GGGA 4BDRA 5AA2B 1FBDA 2WBDA 1NV0A 2I4CA 4GFRA 3UP9A 4N81A 1YCJA 5KDTB 4H45A 4LP2B 3TAJA 3T22A 2ZNSA 2B3FA 2E1SA 1OMPA 2Q88A 3PD8A 3C35A 3UK4A 3MP1A 1KZ8A 1IXCA 3RNNA 5TP9B 1Y1ZA 3RUMA 2E0SA 1DTZA 2XXXA 2XXUA 5DT6A 1NUYA 1D9QA 1MQIA 2HXWA 2Y84A 4DI4B 3TMGA 4NF5B 3K2DA 1B0HA 4MIJA 3MQ9A 4JSDA 2UVGA 3TFLA 2AL5A 2ZYKA 2ABHA 1GR2A 2HQ0A 2ZYMA 3MPLA 2ONRA 5DVFA 1P1WA 3VXCA 5CMMA 5J16A 3K00A 4N6DA 2ZXTA 4BDLA 1FPFA 2NWJA 3TTMA 4OVPA 1NUXA 3ZKLA 4BDNA 1FRPA 4X04A 1XOCA 2QRYA 2WYPA 3KOTA 3T96B 1YYZA 3FVGA 3B6TA 2ZZVA 2QL3A 4F3SA 3RY3A 3QYTA 1Y3PA 2KR0A 4PDHA 2XXTA 3Q28A 4BLAA 4R2FA 3O6HA 2IA4A 1NNPA 1PBQA 1LEVA 4XKRA 3M3FA 3B6QA 2H25A 1NMUA 1CE2A 3MC2A 4M1VA 5CI5A 2B4LA 3Q29A 5I57A 4LONB 3ECRA 5IZ3B 1IITA 1LB8A 2QSXA 1POTA 3A09A 2HFBA 2D5WA 3CIJA 3QIMA 3JZJA 3UA8A 3TCHA 5DEXB 1EZOA 2Y7KA 2FNCA 1FPBA 2MKZA 3RGYA 3S9EA 1D4NA 3IO4A 3PTYA 2PBWA 4DZ1A 2R71A 2UXAA 2CZLA 4PF8A 2I6EA 1NV2A 1B51A 4C1UA 3O6IA 2B4MA 1N7WA 4TLLB 4NG7A 1MM6A 4PBQA 3MJNA 3FIRA 4LVQA 3V5AA 2GH9A 1MY4A 4QFPA 1JW1A 5DW8A 2DXYA 3IJXB 4TQUQ 3FVOA 3ILUB 1FTLA 2XWIA 1IXGA 4HS7A 1IUDA 3UORA 4NMYA 4I8CA 1AIVA 1M5FA 1CB6A 2HXRA 3K0VA 3H6WA 1LFHA 4C0RA 2P0SA 4XKNA 4Q8RA 3UGWA 2I58A 1LBWA 1SI0A 1TFAA 4EXLA 4O3CA 4LA9A 1JVYA 5BWJA 3R7XA 2FYIA 3I3VA 3RYDA 4KHZE 4EQ7A 3M3LA 3H4ZA 2I49A 1WDNA 4GWYA 2B3BA 1VE4A 2F7CA 1POY1 4ELOA 1BTJA 1MXZA 2R6GE 2DE2A 4F29A 1N3WA 3KN3A 1WODA 4GOTA 2DE4A 2VOZA 2OBGA 1M5CA 1JEVA 2ZZWA 5I56A 3H6TA 5I2KA 2VPOA 2F6PA 1YXIA 3G3IA 4BDMA 4NAPA 3U1OA 1N76A 2DS9A 4GXSB 1M5EA 3VVEA 3RT6B 3OENA 1RYOA 4POXA 2I0CA 1DMBA 4FORA 1UIUA 4XTCQ 2O68A 4N8GA 1FQEA 1GV8A 2XXQA 4FEBA 2M8CA 4F3BA 3A3CA 3O9PA 5DTBA 4QSCA 2I3WA 2V3UA 4ZEKA 1EYKA 3IOTA 3C34A 1Y4CA 1B40A 4MX6A 4GX6A 4U1OA 3H6UA 2PT1A 4PGPA 2O1LA 4ZEDA 5HM4B 4M4GA 4NWDA 4OQOA 4DDDA 4ZE9A 3SETA 1LBVA 5FHOA 4AB6A 4OESA 4YZZA 1OQHA 5DVIA 3K1MA 1B1XA 2Y7WA 4PDDA 1SW1A 1SVXB 2CZKA 1FJ6A 3MYUA 1LAGE 4RPNA 3MVZA 1QGXA 2A5TA 1QUIA 1DCUA 2P3VA 1TFDA 1RDYA 2OWTA 1N3XA 3MP8A 4NEDA 4RA1A 3MBPA 5LTCA 1JEUA 1BLFA 3GZGA 4U4XA 4EQBA 4F1UA 1INPA 4R9FA 4R6KA 1B58A 5KZTA 3E79A 4E0XA 2V25A 1Z7ME 1FBGA 2Z8EA 4F31B 4G4PA 3SEVA 1ZKBA 1SW4A 2O6AA 3KOSA 4OHNA 2FHYA 3VDFA 4HTGA 1QULA 4ESWA 4HW8A 5H8SA 4OETA 4IY5A 4TOZA 1HSJA 4OANA 2RCBA 3MZBA 1B3HA 2CEYA 1A55A 3QSLA 4P3LA 4PTKA 2UVHA 3HHFA 3FD3A 1FTAA 3MVWA 2QS3A 2XHDA 4F2QA 4F1VA 3VFJA 1ZLQA 4H8IA 1FTJA 4PFYA 4GIZA 1B5HA 1SDXA 3GBAA 2CZIA 5ET5A 4O7IA 2XA5A 1SI1A 5IGAA 1JQFA 4N13A 2PVUA 1IMEA 3TTRA 1BKAA 4NF6A 4AS5A 3IFAA 2XWOA 3C36A 4Z0IA 1MH3A 3VV5A 3FXBA 3FZVA 4ESXA 3IL1B 4HCYA 2VHAA 1PB8A 4JXIA 1B3LA 1P99A 3OMBA 4GD5A 5JEIA 3FV2A 3TTNA 5CMBA 4HE0A 1FQDA 4GXAA 4G8NA 5EQAA 4FATA 4ELRA 2PT2A 5F7VA 3D1RA 2Z8FA 2NXOA 3FGSA 2PCRA 3TELA 3N94A 1EZPA 4ONYA 2Z22A 3PUYE 2A5TB 2KLFA 3PMWA 2R9JA 3LSXA 1H3DA 3PPRA 4YMAA 4Z7EA 3UIFA 4X48A 4GWOA 4DXBA 3ROJA 4MHFA 5IAIA 3FASA 2NVUB 3A29A 5DVJA 1LFGA 4QRZA 1XC1A 1XI6A 5H8FA 1Q9DA 3GYYA 4KYSA 4DXUA 1B52A 3CHGA 1A54A 4U22A 3SDFA 4BDQA 3O97A 4K3FA 2H98A 1T0KA 4P1LA 1KA0A 3FUZA 3K6WA 2XX9A 4MBPA 1XVYA 1OVTA 3KC0A 1SYHA 4X1BA 3MAMA 3VXBA 1OQGA 4OMBA 3FVKA 1B0LA 3FXRA 1US5A 4IGRA 3L6HA 2UVIA 3LSLA 3TZAA 4YAHX 3T93B 3HCQA 4R73A 1O63A 4PFBA 5TPAB 1IMAA 1SW2A 2L5VA 1D9YA 3IX1A 3T9VA 3DM0A 4IB2A 3G3GA 3K6VA 4OEUA 4PAIA 4F19A 3M8UA 4LN5A 1UIVA 5A5LA 3KC1A 3KJTA 5I59B 3TQLA 1US4A 1XHYA 4NF6B 1AOVA 1ATGA 5TU0A 4G8HA 1KA1A 1FTKA 4PAFA 1ZIUA 3GBBA 2X26A 5AA1A 2O7UA 3TTKA 3T0JA 3ONMA 3RT8A 1N0TA 5B70A 1UQWA 2YJPA 4NF8B 3IFCA 3ZS6A 1PB7A 3HPIA 1S50A 3PU5A 5ET6A 3HFUA 1AH5A 3MVXA 4PCDA 3O2AA 3SKPA 5I84A 2HHMA 4P0IA 4UACA 1D9VA 2D21A 1QVSA 2REJA 4ZDMA 3KN8A 3TUSA 2XXVA 1R9LA 2QVRA 4N17A 4PAKA 1LLSA 1GVCA 5KCJB 3BKIB 1FQCA 3A3UA 5BUUA 5CBRA 3SEUA 4F3GA 2GHBA 5I2NA 4MMPA 3EN3A 1B5IA 4PGNA 5ITOA 4HE1A 2Q89A 4F1YA 2F36A 1H76A 1Y9UA 4ELPA 3G7WA 4PFUA 5M2VA 1P1QA 2DXRA 1VR5A 1YPNA 4Q5TA 1FCKA 1DK4A 3TYHA 2Q2AA 3TCGA 4WXJA 4MNIA 4KD5A 1A7LA 2D3IA 2DE3A 1XT8A 1DOTA 4EF2A 5I58A 2F35A 4IR8A 3E13X 2R8TA 3NOHA 1D3KA 3IK6B 3ZKKA 4O3BA 2DOJA 5CRYA 4IO4A 1MG1A 1DSNA 4U2RA 1H43A 2O69A 1FBFA 1NV3A 3SEWA 1LBCA 1MQDA 3DP8A 1Y1MA 3WAFA 5L9OA 4QFLA 3B7DA 4IO7A 3IOVA 2ZNTA 1II5A 3BFTA 2XXIA 3OO8A 3MZ1A 3CI8A 4GWSA 3V83A 2WX9A 2XXRA 2ZYOA 1R1NA 1MQJA 2HAUA 2G29A 4RK2A 1FW0A 1FJ9A 2OK2A 2FBPA 2BJJX 3KG2A 2XWVA 3CG3A 5AA3A 4MLQA 4F22A 4RXLA 4XF5A 3EF7A 1I6AA 3FJ7A 2DWAA 4C1TA 3RPLA 4H46A 1Y3NA 2DWJA 2V3QA 4QXDA 4PBHA 3C9HA 4H6DA 1ZU0A 2WEFA 3IOUA 5CC2A 4UABA 1QJMA 4I40A 3RTWB 2A5SA 3KGCA 3OEMA 4RJZA 1MPBA 4WEPA 4X1DA 2P2AA 4X8RA 1FTOA 4P1EA 4OERA 3UN6A 1NV5A 4FBPA 4ISUA 4FEDA 3H7MA 3PV0E 1MXUA 1RDZA 1S7YA 3FXQA 4Q0CA 3TODA 1SBPA 2OWZA 4JWOA 1SW5A 1M5BA 5CBSA 1ZJLA 1FBCA 4NF4A 3SESA 1DPPA 2GRVA 3KSXA 3H03A 5J1DA 4RY1A 2CMOA 3U65A 1SD3A 2QMXA 3C32A 3H6VA 1FPJA 1MQHA 1F9BA 2F34A 2Y5LA 3S9LC 3E9XA 4I9DA 1B7UA 4OA4A 2XX7A 3IORA 4NWCA 3Q26A 4H67A 4OFJA 3W9WA 3O28A 1MM7A 2G93A 2F3BA 3CR9A 2V93A 1CNQA 4KR5A 2PMSA 1B6HA 4IO3A 4R6YA 2WBBA 5I57B 4LZ5A 5ISUA 4OVSA 4GBVA 1K9ZA 1IMFA 4HE2A 2DVZA 3HSTA 3FATA 2B65A 2F8DA 4G2ZA 4KYDA 2QFLA 4JSOA 4LZ7A 4ND9A 3N6TA 3IB2A 4U23A 2WKYA 3L6GA 3O66A 3U72A 4N6PA 4GQOA 3ISPA 3OOAA 3SZPA 5L9MA 3QUJA 1AL3A 1SYIA 3EHUA 1NKXA 1LBYA 1O64A 4EUOA 1QKAA 5ICQA 2XXPA 3LV0A 3IJOB 3MUQA 2FIXA 1FQBA 4JVIA 4F2OA 3RPLB 3MVYA 1LFIA 4XFEA 4PETA 3FVNA 5EHSA 2H4IA 2QJEA 1SPIA 2XX8A 2ZNUA 4DLDA 1NH8A 4POWA 2RC7A 5AE4A 2RC9A 2AIXA 2UYFA 2V3TA 2YPNA 4MH5A 4U1ZA 4HCWA 1EYIA 2H99A 4WEDA 1JW4A 3OD7A 5EQ7A 1FSAA 5JTYA 4MAGA 1B32A 1URSA 4KFQA 4MJOA 4Q30B 1TWYA 3G3FA 2XXWA 5EQ9A 4QFKA 5ELVA 1GTKA 3FV1A 5I5PA 3HO7A 5I56B 1IMDA 4U21A 4EXKA 1NH7A 5I2KB 5FHNA 2ANJA 2XWKA 2I4BA 1LBZA 1R9QA 3DLNA 4P8BA 2Y7IA 3RN8A 1LBBA 1AMFA 3E3KA 3P7IA 1HSEA 1VFEA 1PB9A 4YKKA 3KEIA 1NV1A 2QPQA 3EKIA 1NV4A 3G3JA 1YTVA 4ZEBA 5L8DA 2H9BA 4EF1A 1JVXA 4PFWA 1ZTYA 3KN7A 3QAXA 1B4HA 4OZ9A 4ZE8A 4QFOA 2XXYA 4N15A 2P3NA 3C4MA 5AA2A 1PBPA 1QUJA 4PE5B 3FBPA 5KDTA 3W15C 4MNPA 3K6XA 1WVJA 4IO2A 2VD3A 1B1HA 1DTGA 5L9SA 1B2HA 4R9GA 2KQZA 5JK4A 4ZZAA 2NOOA 2THIA 3SEYA 4UA8A 2QS4A 1IEJA 1P1NA 2I3VA 3PPNA 3C33A 3U94A 2HAVA 4GX4A 1FPEA 4QSDA 3IB1A 3FJMA 3SEXA 4ECFA 3I5OA 1RKMA 4PF6A 3ZSFA 4EDPA 3HV1A 3S4UA 2X7QA 2RINA 3EPEA 1FQFA 2VGQA 2O1MA 4FIMA 3VLVA 4N91A 5HBCA 4THIA 2DVCA 2F78A 3S9NC 3D4GA 3LBSA 2I0BA 4OTEA 4OEVA 3EHSA 2UYEA 5I7IA 4OWDA 4O7MA 4YB5A 3CFXA 4FE8A 2XXKA 2P1SA 3K02A 4AS4A 4N8YA 4OYVA 5EQ8A 3I6VA 4FECA 1B46A 2ONKE 1I6QA 1XS5A 1VSOA 2AL4A 3TQWA 3T9XB 3E4RA 3OSRA 4OVRA 1DBZA 3TCFA 4QHQA 3SERA 1LAXA 3PUVE 1DPEA 1J1NA 1MY1A 4XIGQ 4YICA 4PFTA 2QVUA 4FAJA 3VVDA 1IZ1A 3ODBA 3OO7A 1JW5A 4DE8A 1NFTA 3E78A 1Q1KA 3LSWA 3G3KA 4OVTA 2QS1A 1B3EA 4PC9A 1MXWA 4KYEA 3W9VA 1O7TA 2UVJA 3OO6A 1NNKA 4KXPA 3IR1A 2NUVA 3OXNA 4JBZA 4KI0E 4PFRA 4O3AA 1QUKA 2LAOA 5K2YA 3MW0A 4RK9A 3PPQA 3IAZA 3CFLA 4JVDA 3LR1A 2F5XA 1Z7NE 4H1XA 4JDFA 3U8QA 5DEXA 2F6GA 1FBHA 1L5TA 5I3SA 1MH4A 3K1NA 3RQTA 1R6ZA 2QVVA 4H5FA 4DCYA 1LSTA 4AQ4A 1A40A 2HZLA 3LSFB 4P0GA 3KFMA 4GBWA 3M3KA 1B7HA 4O8MA 5H8NA 2PFYA 1QW0A 4YU0A 4P47A 3TKDA 1Y4TA 1B5JA 4IGTA 1JP4A 1Y20A 1P1OA 3CVGA 2V84A 2OX3A 1Y3QA 2Q2CA 5ITPA 4NN3A 4YKIA 2RKMA 4G68A 3VLWA 3AXFA 3OO9A 3PUXE 2V4CA 5H8FB 1FBPA 2IEEA 3DP6A 1TT1A 1TXFA 3PMXA 1IXIA 4DIGA 5IZ1A 4GVOA 3THIA 1MPCA 3FXUA 1NL5A 1MPDA 3BFUA 2HCAA 1BK4A 4L17A 2CEXA 4DXCA 5K2XA 4PFIA 4ZZEA 3RTFB 1NNTA 4G77A 2DDKA 1LBXA 4AB5A 3T1BA 1QKBA 4YMBA 3PPOA 4KCDA 1MXVA 1EU8A 1KWHA 3K01A 3CFZA 2OZZA 2PYYA 2XD3A 4JWYA 4KCCA 1IMCA 1FQAA 5EYFA 3CG1A 3B8BA 3T66A 4OENA 3U93A 5EHMA 1B9JA 4ZS9A 2Q74A 3GXAA 1AWBA 4WKMA 5FTIA 1IIWA 3FJGA 3CRBA 3BIGA 3D4CA 3V89B 2OCUA 4H5GA 1MXXA 3BIHA 3KJ7A 3DP4A 3QUFA 4IO5A 4ZEIA 4JB7A 1LAFE 2DP8A 2XD2A 5LOMA 2FIEA 4OFOA 1OVBA 1BIYA 3KBRA 2VT5A 3K1PA 5FBPA 3C31A 4N4UA 1S9TA 1HSLA 1YAEA 1UTHA 4GWWA 5H8NB 2F3DA 1BP5A 2FVZA 4MEVA 5AA4A 4I3EA 2ESNA 4H8JA 3VLUA 1K9YA 4GL0A 3VE1B 4GWXA 3IB0A 1ZMGA 2GQ1A 1USYE 3OEKA 3Q25A 2RCAA 3KZGA 1IXHA 5I2NB 1JETA 4N6KA 4G68B 3TPAA 3U92A 4OVQA 4PQJA 3OSQA 3PUZE 4NTLA 4O94A 3R26A 2O7IA 4GWZA 3PMVA 5H8QA 2ZZXA 1FTMA 5IM2A 1M5DA 1FPGA 1MDP1 4H0WA 3B50A 2I48A 3LC8A 2QS2A 4LQ2A 4R75A 1H45A 4P9KA 3H3GA 3S9MC 2PX1A 5I58B 2PFZA 1FPIA 1P1UA 2RC8A 3TDJA 5H8HA 3JYRA 5T3JA 2DSFA 3O29A 4ZECA 5F24A 1MXYA 2OJTA 5CM6A 1MY3A 2YLNA 3QXMA 2OLBA 4P11A 4DI3D 4QF9A 1LGBC 2F7BA 4F18A 5IKBA 3HHGA 3QK6A 1I6BA 3PUWE 4DCXA 4LZ8A 1MDQA 4X9TA 3IOWA 3QMFA 4HXVA 1NI9A 4JVCA 1MRPA 2Q9TA 2DQVA 5DYHA 3JV9A 3PD9A 1UTBA 4GF8A 3H06B 3LUZA 2XXHA
chains in the Genus database with same CATH topology
4U4SA 1I69A 4R6HA 1MS7A 1XVXA 2VP1A 1MY0A 4LUBA 2AYSA 2ZYNA 3G3HA 2H5YA 1LAHE 1UTHB 1N84A 1OLCA 3GLBA 4IO6A 3BBRA 5AA4B 3F11A 2W7YA 4E0WA 3IO6A 4F3PA 3HN0A 3N26A 3K6UA 2HZKA 4JWXA 5F1QA 1ANFA 3R6UA 3OELA 1B4ZA 4NF4B 5H8QB 4R2BA 1ELJA 5HPQA 2DWHA 2REGA 4R74A 3MWBA 2ZMBA 4PP0A 4LQ5A 1OLAA 1H44A 1N7XA 1EZ9A 4YB6A 3ILTB 2Y7PA 5A5XA 2O84X 3K4UA 4IY6A 4GRKA 1B05A 3TEPA 4ZEFA 1SQYA 3MZ9A 4BDOA 1A8EA 4XKPA 5H8HB 3CSBA 5TPAA 2Q8JA 2QMWA 2HEUA 2F97A 3S2VA 4ELQA 3TTLA 2FA7A 1A8FA 4MF3A 2DWIA 1Q35A 4R72A 1EH3A 5I59A 1B3FA 5ICTA 4N07A 1URGA 3O6GA 2Z8DA 5CMCA 4FJPA 4OVJA 1B3GA 1PEBA 1PDAA 4RYAA 3MPKA 4QFNA 3N6UA 3PGFA 5TP9A 4XXUA 1UTBB 4NF8A 4NF5A 4RNSA 2RF1A 4GLIA 4EQ9A 1NNFA 3T9HB 2DYXA 3CSGA 1N04A 5CMKA 1MY2A 1ZBMA 3EHTA 1URDA 3T9UA 3EQ1A 2GHAA 4YKJA 4KPTA 3MP6A 4G68C 1B7ZA 4I1DA 5KCJA 2GFEA 3DELB 4LATA 2F7AA 1PC3A 3LUYA 2OWSA 1A99A 3RPWA 3VVFA 3Q27A 1LCTA 1USYH 2O51A 1LCFA 5JTYB 3USDA 2ONSA 1IQ7A 2ALUA 4XKQA 4H65A 1LB9A 4NE4A 5FHMA 4F39A 3KSJA 4G8MA 1MQGA 4YKPA 2Z23A 3V8XB 4MLVA 4OXVA 4OFLA 2Y7RA 5FTHA 4QSEA 1JNFA 1RYXA 2X7PA 3PPPA 5A5XB 5AA2D 2VD2A 4YB7A 3N5LA 1OIBA 3B6WA 3RLFE 1VFDA 4TLMB 3WAEA 4I62A 4KQPA 5B7DA 4MFIA 4RPOA 4GL8A 1GGGA 4BDRA 5AA2B 2I4CA 4GFRA 3UP9A 1YCJA 5KDTB 4LP2B 3TAJA 3T22A 2ZNSA 2B3FA 2E1SA 1OMPA 2Q88A 3PD8A 3C35A 3UK4A 3MP1A 1IXCA 3RNNA 5TP9B 1Y1ZA 3RUMA 2E0SA 1DTZA 2XXXA 2XXUA 5DT6A 1MQIA 2HXWA 2Y84A 3TMGA 4NF5B 3K2DA 1B0HA 3MQ9A 4JSDA 2UVGA 3TFLA 2AL5A 2ZYKA 2ABHA 1GR2A 2HQ0A 2ZYMA 3MPLA 2ONRA 5DVFA 1P1WA 3VXCA 5CMMA 3K00A 2ZXTA 4BDLA 2NWJA 3TTMA 3ZKLA 4BDNA 1XOCA 2QRYA 3KOTA 3T96B 3FVGA 3B6TA 2QL3A 4F3SA 3RY3A 3QYTA 1Y3PA 2XXTA 3Q28A 4BLAA 4R2FA 3O6HA 2IA4A 1NNPA 1PBQA 4XKRA 3M3FA 3B6QA 2H25A 1NMUA 1CE2A 3MC2A 4M1VA 5CI5A 3Q29A 5I57A 4LONB 3ECRA 1IITA 1LB8A 2QSXA 1POTA 3A09A 2HFBA 2D5WA 3CIJA 3QIMA 3JZJA 3UA8A 3TCHA 5DEXB 1EZOA 2Y7KA 2FNCA 3RGYA 3S9EA 1D4NA 3IO4A 2PBWA 4DZ1A 2R71A 2UXAA 2CZLA 2I6EA 1B51A 4C1UA 3O6IA 1N7WA 4TLLB 1MM6A 3MJNA 3FIRA 4LVQA 3V5AA 2GH9A 1MY4A 4QFPA 1JW1A 2DXYA 3IJXB 4TQUQ 3FVOA 3ILUB 1FTLA 1IXGA 4HS7A 1IUDA 3UORA 4NMYA 4I8CA 1AIVA 1M5FA 1CB6A 3K0VA 1LFHA 3H6WA 4C0RA 2P0SA 4XKNA 4Q8RA 3UGWA 2I58A 1SI0A 1TFAA 4EXLA 4O3CA 4LA9A 1JVYA 5BWJA 3R7XA 2FYIA 3I3VA 4EQ7A 4KHZE 3M3LA 3H4ZA 2I49A 1WDNA 2B3BA 1VE4A 2F7CA 1POY1 4ELOA 1BTJA 1MXZA 2R6GE 2DE2A 4F29A 1N3WA 3KN3A 1WODA 4GOTA 2DE4A 2VOZA 2OBGA 1M5CA 1JEVA 5I56A 3H6TA 5I2KA 2F6PA 3G3IA 4BDMA 3U1OA 1N76A 2DS9A 4GXSB 1M5EA 3VVEA 3RT6B 3OENA 1RYOA 4POXA 2I0CA 1DMBA 4FORA 1UIUA 4XTCQ 2O68A 1FQEA 1GV8A 2XXQA 4FEBA 2M8CA 4F3BA 3A3CA 3O9PA 5DTBA 4QSCA 2I3WA 2V3UA 4ZEKA 3IOTA 3C34A 1Y4CA 1B40A 4U1OA 3H6UA 2PT1A 2O1LA 4ZEDA 5HM4B 4M4GA 4NWDA 4OQOA 4DDDA 4ZE9A 3SETA 5FHOA 4AB6A 4OESA 4YZZA 1OQHA 5DVIA 3K1MA 1B1XA 2Y7WA 1SW1A 1SVXB 1LAGE 4RPNA 3MVZA 2A5TA 1QUIA 1TFDA 2OWTA 1N3XA 3MP8A 4NEDA 4RA1A 3MBPA 1JEUA 1BLFA 3GZGA 4U4XA 4EQBA 4F1UA 4R9FA 4R6KA 1B58A 5KZTA 4E0XA 2V25A 1Z7ME 2Z8EA 4F31B 4G4PA 3SEVA 1ZKBA 1SW4A 2O6AA 3KOSA 4OHNA 3VDFA 4HTGA 1QULA 4ESWA 4HW8A 5H8SA 4OETA 4IY5A 4TOZA 1HSJA 2RCBA 3MZBA 1B3HA 1A55A 3QSLA 2UVHA 3HHFA 3FD3A 3MVWA 2QS3A 2XHDA 4F2QA 4F1VA 3VFJA 1ZLQA 4H8IA 1FTJA 4PFYA 4GIZA 1B5HA 1SDXA 3GBAA 1SI1A 1JQFA 4N13A 2PVUA 3TTRA 1BKAA 4NF6A 3C36A 4Z0IA 1MH3A 3VV5A 3FZVA 4ESXA 3IL1B 4HCYA 2VHAA 1PB8A 4JXIA 1B3LA 1P99A 3OMBA 4GD5A 5JEIA 3FV2A 3TTNA 5CMBA 1FQDA 4GXAA 4G8NA 4FATA 4ELRA 2PT2A 5F7VA 2Z8FA 2NXOA 3FGSA 3TELA 3N94A 1EZPA 4ONYA 2Z22A 3PUYE 2A5TB 2KLFA 3PMWA 2R9JA 3LSXA 1H3DA 3PPRA 4YMAA 4Z7EA 3UIFA 4X48A 4GWOA 4DXBA 5IAIA 3FASA 2NVUB 5DVJA 1LFGA 4QRZA 1XC1A 5H8FA 4KYSA 4DXUA 1B52A 1A54A 4U22A 3SDFA 4BDQA 3O97A 4K3FA 2H98A 1T0KA 3FUZA 3K6WA 2XX9A 4MBPA 1XVYA 1OVTA 1SYHA 4X1BA 3MAMA 3VXBA 1OQGA 4OMBA 3FVKA 1B0LA 3FXRA 1US5A 4IGRA 3L6HA 2UVIA 3LSLA 3TZAA 4YAHX 3T93B 3HCQA 4R73A 1O63A 5TPAB 1SW2A 1D9YA 3IX1A 3T9VA 3DM0A 4IB2A 3G3GA 3K6VA 4OEUA 4F19A 3M8UA 1UIVA 3KJTA 5I59B 3TQLA 1US4A 1XHYA 4NF6B 1AOVA 1ATGA 5TU0A 4G8HA 1FTKA 1ZIUA 3GBBA 2X26A 5AA1A 2O7UA 3TTKA 3ONMA 3RT8A 1N0TA 5B70A 1UQWA 2YJPA 4NF8B 3ZS6A 1PB7A 3HPIA 1S50A 3PU5A 1AH5A 3MVXA 3O2AA 3SKPA 5I84A 4P0IA 4UACA 1D9VA 2D21A 1QVSA 2REJA 4ZDMA 3KN8A 3TUSA 2XXVA 1R9LA 1LLSA 1GVCA 5KCJB 3BKIB 1FQCA 3A3UA 5BUUA 5CBRA 3SEUA 4F3GA 2GHBA 5I2NA 3EN3A 1B5IA 5ITOA 2Q89A 4F1YA 2F36A 1H76A 1Y9UA 4ELPA 3G7WA 4PFUA 5M2VA 1P1QA 2DXRA 1VR5A 1YPNA 4Q5TA 1FCKA 3TYHA 2Q2AA 3TCGA 4WXJA 4KD5A 1A7LA 2D3IA 2DE3A 1XT8A 1DOTA 4EF2A 5I58A 2F35A 3E13X 1D3KA 3IK6B 3ZKKA 4O3BA 2DOJA 5CRYA 4IO4A 1MG1A 1DSNA 4U2RA 1H43A 2O69A 3SEWA 1LBCA 1MQDA 3DP8A 1Y1MA 3WAFA 5L9OA 4QFLA 3B7DA 4IO7A 3IOVA 2ZNTA 1II5A 3BFTA 2XXIA 3OO8A 3MZ1A 3CI8A 3V83A 2XXRA 2ZYOA 1R1NA 1MQJA 2HAUA 2G29A 4RK2A 1FW0A 2OK2A 2BJJX 3KG2A 3CG3A 5AA3A 4MLQA 4F22A 4RXLA 3EF7A 1I6AA 3FJ7A 2DWAA 4C1TA 1Y3NA 2DWJA 2V3QA 3C9HA 4H6DA 1ZU0A 3IOUA 5CC2A 1QJMA 3RTWB 2A5SA 3KGCA 3OEMA 4RJZA 1MPBA 4WEPA 4X1DA 2P2AA 1FTOA 4OERA 3UN6A 4ISUA 4FEDA 3H7MA 3PV0E 1MXUA 1S7YA 3FXQA 4Q0CA 3TODA 1SBPA 4JWOA 1SW5A 1M5BA 5CBSA 1ZJLA 4NF4A 3SESA 1DPPA 2GRVA 3KSXA 3H03A 5J1DA 4RY1A 2CMOA 1SD3A 2QMXA 3C32A 3H6VA 1MQHA 1F9BA 2F34A 3S9LC 3E9XA 4I9DA 1B7UA 2XX7A 3IORA 4NWCA 3Q26A 4H67A 4OFJA 3W9WA 3O28A 1MM7A 2G93A 3CR9A 2V93A 4KR5A 2PMSA 1B6HA 4IO3A 4R6YA 5I57B 5ISUA 4LZ5A 2DVZA 3HSTA 3FATA 2B65A 2F8DA 4G2ZA 4KYDA 4JSOA 4LZ7A 4ND9A 3N6TA 3IB2A 4U23A 2WKYA 3L6GA 3O66A 3U72A 4N6PA 4GQOA 3OOAA 5L9MA 3QUJA 1AL3A 1SYIA 3EHUA 1NKXA 1O64A 4EUOA 1QKAA 5ICQA 2XXPA 3IJOB 3MUQA 1FQBA 4F2OA 3MVYA 1LFIA 4PETA 3FVNA 5EHSA 2H4IA 2QJEA 2XX8A 2ZNUA 4DLDA 1NH8A 4POWA 2RC7A 5AE4A 2RC9A 2AIXA 2UYFA 2V3TA 2YPNA 4MH5A 4U1ZA 4HCWA 2H99A 4WEDA 1JW4A 3OD7A 5JTYA 1B32A 1URSA 4KFQA 4Q30B 1TWYA 3G3FA 2XXWA 4QFKA 5ELVA 1GTKA 3FV1A 3HO7A 5I56B 4U21A 4EXKA 1NH7A 5I2KB 5FHNA 2ANJA 2I4BA 1R9QA 3DLNA 2Y7IA 3RN8A 1LBBA 1AMFA 3E3KA 3P7IA 1HSEA 1VFEA 1PB9A 4YKKA 3KEIA 2QPQA 3G3JA 1YTVA 4ZEBA 5L8DA 2H9BA 4EF1A 1JVXA 4PFWA 1ZTYA 3KN7A 3QAXA 1B4HA 4OZ9A 4ZE8A 2XXYA 4QFOA 3C4MA 5AA2A 1PBPA 1QUJA 4PE5B 5KDTA 3W15C 3K6XA 1WVJA 4IO2A 2VD3A 1B1HA 1DTGA 5L9SA 1B2HA 4R9GA 5JK4A 4ZZAA 2NOOA 2THIA 3SEYA 4UA8A 2QS4A 1IEJA 1P1NA 2I3VA 3PPNA 3C33A 3U94A 2HAVA 4QSDA 3IB1A 3FJMA 3SEXA 4ECFA 3I5OA 1RKMA 3ZSFA 4EDPA 3HV1A 3S4UA 2X7QA 2RINA 3EPEA 1FQFA 2VGQA 2O1MA 4FIMA 3VLVA 5HBCA 4THIA 2DVCA 2F78A 3S9NC 3D4GA 3LBSA 2I0BA 4OTEA 4OEVA 3EHSA 2UYEA 4OWDA 4YB5A 3CFXA 4FE8A 2P1SA 3K02A 4OYVA 3I6VA 4FECA 1B46A 2ONKE 1I6QA 1XS5A 1VSOA 2AL4A 3TQWA 3T9XB 3E4RA 3OSRA 3TCFA 4QHQA 3SERA 1LAXA 3PUVE 1DPEA 1J1NA 1MY1A 4FAJA 4XIGQ 4PFTA 4YICA 3VVDA 1IZ1A 3ODBA 3OO7A 1JW5A 4DE8A 1NFTA 1Q1KA 3LSWA 3G3KA 2QS1A 1B3EA 1MXWA 4KYEA 3W9VA 1O7TA 2UVJA 3OO6A 1NNKA 3IR1A 2NUVA 3OXNA 4JBZA 4KI0E 4O3AA 1QUKA 2LAOA 5K2YA 3MW0A 4RK9A 3PPQA 3IAZA 3CFLA 3LR1A 2F5XA 1Z7NE 4H1XA 4JDFA 3U8QA 5DEXA 2F6GA 1L5TA 1MH4A 3K1NA 3RQTA 1R6ZA 4H5FA 4DCYA 1LSTA 4AQ4A 1A40A 2HZLA 3LSFB 4P0GA 3KFMA 3M3KA 1B7HA 5H8NA 1QW0A 4YU0A 3TKDA 1Y4TA 1B5JA 4IGTA 1Y20A 1P1OA 3CVGA 2V84A 1Y3QA 2Q2CA 5ITPA 4YKIA 2RKMA 4G68A 3VLWA 3AXFA 3OO9A 3PUXE 5H8FB 2IEEA 3DP6A 1TT1A 1TXFA 3PMXA 1IXIA 4DIGA 4GVOA 3THIA 1MPCA 3FXUA 1NL5A 1MPDA 3BFUA 2HCAA 4L17A 4DXCA 5K2XA 4ZZEA 3RTFB 1NNTA 4G77A 4AB5A 1QKBA 4YMBA 3PPOA 4KCDA 1MXVA 1EU8A 1KWHA 3K01A 3CFZA 2OZZA 2PYYA 2XD3A 4JWYA 4KCCA 1FQAA 5EYFA 3CG1A 3T66A 4OENA 3U93A 5EHMA 1B9JA 4ZS9A 3GXAA 4WKMA 5FTIA 1IIWA 3FJGA 3CRBA 3D4CA 3V89B 2OCUA 4H5GA 1MXXA 3KJ7A 3DP4A 3QUFA 4IO5A 4ZEIA 4JB7A 1LAFE 2DP8A 2XD2A 5LOMA 4OFOA 1OVBA 1BIYA 3KBRA 3K1PA 3C31A 1S9TA 1HSLA 1YAEA 1UTHA 5H8NB 1BP5A 5AA4A 2ESNA 4H8JA 3VLUA 4GL0A 3VE1B 3IB0A 1ZMGA 1USYE 3OEKA 3Q25A 2RCAA 3KZGA 1IXHA 5I2NB 1JETA 4G68B 3TPAA 3U92A 4PQJA 3OSQA 3PUZE 4NTLA 3R26A 2O7IA 3PMVA 5H8QA 1FTMA 1M5DA 1MDP1 4H0WA 2I48A 3LC8A 2QS2A 4LQ2A 4R75A 1H45A 3H3GA 3S9MC 2PX1A 5I58B 2RC8A 1P1UA 3TDJA 5H8HA 3JYRA 2DSFA 3O29A 4ZECA 1MXYA 2OJTA 5CM6A 1MY3A 2YLNA 3QXMA 2OLBA 4P11A 4QF9A 1LGBC 2F7BA 4F18A 5IKBA 3HHGA 3QK6A 1I6BA 4DCXA 3PUWE 4LZ8A 1MDQA 4X9TA 3IOWA 1MRPA 2Q9TA 2DQVA 5DYHA 3JV9A 3PD9A 1UTBA 4GF8A 3H06B 2XXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U4S A;  1I69 A;  4R6H A;  1MS7 A;  1XVX A;  2VP1 A;  1MY0 A;  4LUB A;  2AYS A;  2ZYN A;  3G3H A;  2H5Y A;  1LAH E;  1UTH B;  1N84 A;  1OLC A;  3GLB A;  4IO6 A;  3BBR A;  5AA4 B;  3F11 A;  2W7Y A;  4E0W A;  3IO6 A;  4F3P A;  3HN0 A;  3N26 A;  3K6U A;  2HZK A;  4JWX A;  5F1Q A;  1ANF A;  3R6U A;  3OEL A;  1B4Z A;  4NF4 B;  5H8Q B;  4R2B A;  1ELJ A;  5HPQ A;  2DWH A;  2REG A;  4R74 A;  3MWB A;  2ZMB A;  4PP0 A;  4LQ5 A;  1OLA A;  1H44 A;  1N7X A;  1EZ9 A;  4YB6 A;  3ILT B;  2Y7P A;  5A5X A;  2O84 X;  3K4U A;  4IY6 A;  4GRK A;  1B05 A;  3TEP A;  4ZEF A;  1SQY A;  3MZ9 A;  4BDO A;  1A8E A;  4XKP A;  5H8H B;  3CSB A;  5TPA A;  2Q8J A;  2QMW A;  2HEU A;  2F97 A;  3S2V A;  4ELQ A;  3TTL A;  2FA7 A;  1A8F A;  4MF3 A;  2DWI A;  1Q35 A;  4R72 A;  1EH3 A;  5I59 A;  1B3F A;  5ICT A;  4N07 A;  1URG A;  3O6G A;  2Z8D A;  5CMC A;  4FJP A;  4OVJ A;  1B3G A;  1PEB A;  1PDA A;  4RYA A;  3MPK A;  4QFN A;  3N6U A;  3PGF A;  5TP9 A;  4XXU A;  1UTB B;  4NF8 A;  4NF5 A;  4RNS A;  2RF1 A;  4GLI A;  4EQ9 A;  1NNF A;  3T9H B;  2DYX A;  3CSG A;  1N04 A;  5CMK A;  1MY2 A;  1ZBM A;  3EHT A;  1URD A;  3T9U A;  3EQ1 A;  2GHA A;  4YKJ A;  4KPT A;  3MP6 A;  4G68 C;  1B7Z A;  4I1D A;  5KCJ A;  2GFE A;  3DEL B;  4LAT A;  2F7A A;  1PC3 A;  3LUY A;  2OWS A;  1A99 A;  3RPW A;  3VVF A;  3Q27 A;  1LCT A;  1USY H;  2O51 A;  1LCF A;  5JTY B;  3USD A;  2ONS A;  1IQ7 A;  2ALU A;  4XKQ A;  4H65 A;  1LB9 A;  4NE4 A;  5FHM A;  4F39 A;  3KSJ A;  4G8M A;  1MQG A;  4YKP A;  2Z23 A;  3V8X B;  4MLV A;  4OXV A;  4OFL A;  2Y7R A;  5FTH A;  4QSE A;  1JNF A;  1RYX A;  2X7P A;  3PPP A;  5A5X B;  5AA2 D;  2VD2 A;  4YB7 A;  3N5L A;  1OIB A;  3B6W A;  3RLF E;  1VFD A;  4TLM B;  3WAE A;  4I62 A;  4KQP A;  5B7D A;  4MFI A;  4RPO A;  4GL8 A;  1GGG A;  4BDR A;  5AA2 B;  2I4C A;  4GFR A;  3UP9 A;  1YCJ A;  5KDT B;  4LP2 B;  3TAJ A;  3T22 A;  2ZNS A;  2B3F A;  2E1S A;  1OMP A;  2Q88 A;  3PD8 A;  3C35 A;  3UK4 A;  3MP1 A;  1IXC A;  3RNN A;  5TP9 B;  1Y1Z A;  3RUM A;  2E0S A;  1DTZ A;  2XXX A;  2XXU A;  5DT6 A;  1MQI A;  2HXW A;  2Y84 A;  3TMG A;  4NF5 B;  3K2D A;  1B0H A;  3MQ9 A;  4JSD A;  2UVG A;  3TFL A;  2AL5 A;  2ZYK A;  2ABH A;  1GR2 A;  2HQ0 A;  2ZYM A;  3MPL A;  2ONR A;  5DVF A;  1P1W A;  3VXC A;  5CMM A;  3K00 A;  2ZXT A;  4BDL A;  2NWJ A;  3TTM A;  3ZKL A;  4BDN A;  1XOC A;  2QRY A;  3KOT A;  3T96 B;  3FVG A;  3B6T A;  2QL3 A;  4F3S A;  3RY3 A;  3QYT A;  1Y3P A;  2XXT A;  3Q28 A;  4BLA A;  4R2F A;  3O6H A;  2IA4 A;  1NNP A;  1PBQ A;  4XKR A;  3M3F A;  3B6Q A;  2H25 A;  1NMU A;  1CE2 A;  3MC2 A;  4M1V A;  5CI5 A;  3Q29 A;  5I57 A;  4LON B;  3ECR A;  1IIT A;  1LB8 A;  2QSX A;  1POT A;  3A09 A;  2HFB A;  2D5W A;  3CIJ A;  3QIM A;  3JZJ A;  3UA8 A;  3TCH A;  5DEX B;  1EZO A;  2Y7K A;  2FNC A;  3RGY A;  3S9E A;  1D4N A;  3IO4 A;  2PBW A;  4DZ1 A;  2R71 A;  2UXA A;  2CZL A;  2I6E A;  1B51 A;  4C1U A;  3O6I A;  1N7W A;  4TLL B;  1MM6 A;  3MJN A;  3FIR A;  4LVQ A;  3V5A A;  2GH9 A;  1MY4 A;  4QFP A;  1JW1 A;  2DXY A;  3IJX B;  4TQU Q;  3FVO A;  3ILU B;  1FTL A;  1IXG A;  4HS7 A;  1IUD A;  3UOR A;  4NMY A;  4I8C A;  1AIV A;  1M5F A;  1CB6 A;  3K0V A;  1LFH A;  3H6W A;  4C0R A;  2P0S A;  4XKN A;  4Q8R A;  3UGW A;  2I58 A;  1SI0 A;  1TFA A;  4EXL A;  4O3C A;  4LA9 A;  1JVY A;  5BWJ A;  3R7X A;  2FYI A;  3I3V A;  4EQ7 A;  4KHZ E;  3M3L A;  3H4Z A;  2I49 A;  1WDN A;  2B3B A;  1VE4 A;  2F7C A;  1POY 1;  4ELO A;  1BTJ A;  1MXZ A;  2R6G E;  2DE2 A;  4F29 A;  1N3W A;  3KN3 A;  1WOD A;  4GOT A;  2DE4 A;  2VOZ A;  2OBG A;  1M5C A;  1JEV A;  5I56 A;  3H6T A;  5I2K A;  2F6P A;  3G3I A;  4BDM A;  3U1O A;  1N76 A;  2DS9 A;  4GXS B;  1M5E A;  3VVE A;  3RT6 B;  3OEN A;  1RYO A;  4POX A;  2I0C A;  1DMB A;  4FOR A;  1UIU A;  4XTC Q;  2O68 A;  1FQE A;  1GV8 A;  2XXQ A;  4FEB A;  2M8C A;  4F3B A;  3A3C A;  3O9P A;  5DTB A;  4QSC A;  2I3W A;  2V3U A;  4ZEK A;  3IOT A;  3C34 A;  1Y4C A;  1B40 A;  4U1O A;  3H6U A;  2PT1 A;  2O1L A;  4ZED A;  5HM4 B;  4M4G A;  4NWD A;  4OQO A;  4DDD A;  4ZE9 A;  3SET A;  5FHO A;  4AB6 A;  4OES A;  4YZZ A;  1OQH A;  5DVI A;  3K1M A;  1B1X A;  2Y7W A;  1SW1 A;  1SVX B;  1LAG E;  4RPN A;  3MVZ A;  2A5T A;  1QUI A;  1TFD A;  2OWT A;  1N3X A;  3MP8 A;  4NED A;  4RA1 A;  3MBP A;  1JEU A;  1BLF A;  3GZG A;  4U4X A;  4EQB A;  4F1U A;  4R9F A;  4R6K A;  1B58 A;  5KZT A;  4E0X A;  2V25 A;  1Z7M E;  2Z8E A;  4F31 B;  4G4P A;  3SEV A;  1ZKB A;  1SW4 A;  2O6A A;  3KOS A;  4OHN A;  3VDF A;  4HTG A;  1QUL A;  4ESW A;  4HW8 A;  5H8S A;  4OET A;  4IY5 A;  4TOZ A;  1HSJ A;  2RCB A;  3MZB A;  1B3H A;  1A55 A;  3QSL A;  2UVH A;  3HHF A;  3FD3 A;  3MVW A;  2QS3 A;  2XHD A;  4F2Q A;  4F1V A;  3VFJ A;  1ZLQ A;  4H8I A;  1FTJ A;  4PFY A;  4GIZ A;  1B5H A;  1SDX A;  3GBA A;  1SI1 A;  1JQF A;  4N13 A;  2PVU A;  3TTR A;  1BKA A;  4NF6 A;  3C36 A;  4Z0I A;  1MH3 A;  3VV5 A;  3FZV A;  4ESX A;  3IL1 B;  4HCY A;  2VHA A;  1PB8 A;  4JXI A;  1B3L A;  1P99 A;  3OMB A;  4GD5 A;  5JEI A;  3FV2 A;  3TTN A;  5CMB A;  1FQD A;  4GXA A;  4G8N A;  4FAT A;  4ELR A;  2PT2 A;  5F7V A;  2Z8F A;  2NXO A;  3FGS A;  3TEL A;  3N94 A;  1EZP A;  4ONY A;  2Z22 A;  3PUY E;  2A5T B;  2KLF A;  3PMW A;  2R9J A;  3LSX A;  1H3D A;  3PPR A;  4YMA A;  4Z7E A;  3UIF A;  4X48 A;  4GWO A;  4DXB A;  5IAI A;  3FAS A;  2NVU B;  5DVJ A;  1LFG A;  4QRZ A;  1XC1 A;  5H8F A;  4KYS A;  4DXU A;  1B52 A;  1A54 A;  4U22 A;  3SDF A;  4BDQ A;  3O97 A;  4K3F A;  2H98 A;  1T0K A;  3FUZ A;  3K6W A;  2XX9 A;  4MBP A;  1XVY A;  1OVT A;  1SYH A;  4X1B A;  3MAM A;  3VXB A;  1OQG A;  4OMB A;  3FVK A;  1B0L A;  3FXR A;  1US5 A;  4IGR A;  3L6H A;  2UVI A;  3LSL A;  3TZA A;  4YAH X;  3T93 B;  3HCQ A;  4R73 A;  1O63 A;  5TPA B;  1SW2 A;  1D9Y A;  3IX1 A;  3T9V A;  3DM0 A;  4IB2 A;  3G3G A;  3K6V A;  4OEU A;  4F19 A;  3M8U A;  1UIV A;  3KJT A;  5I59 B;  3TQL A;  1US4 A;  1XHY A;  4NF6 B;  1AOV A;  1ATG A;  5TU0 A;  4G8H A;  1FTK A;  1ZIU A;  3GBB A;  2X26 A;  5AA1 A;  2O7U A;  3TTK A;  3ONM A;  3RT8 A;  1N0T A;  5B70 A;  1UQW A;  2YJP A;  4NF8 B;  3ZS6 A;  1PB7 A;  3HPI A;  1S50 A;  3PU5 A;  1AH5 A;  3MVX A;  3O2A A;  3SKP A;  5I84 A;  4P0I A;  4UAC A;  1D9V A;  2D21 A;  1QVS A;  2REJ A;  4ZDM A;  3KN8 A;  3TUS A;  2XXV A;  1R9L A;  1LLS A;  1GVC A;  5KCJ B;  3BKI B;  1FQC A;  3A3U A;  5BUU A;  5CBR A;  3SEU A;  4F3G A;  2GHB A;  5I2N A;  3EN3 A;  1B5I A;  5ITO A;  2Q89 A;  4F1Y A;  2F36 A;  1H76 A;  1Y9U A;  4ELP A;  3G7W A;  4PFU A;  5M2V A;  1P1Q A;  2DXR A;  1VR5 A;  1YPN A;  4Q5T A;  1FCK A;  3TYH A;  2Q2A A;  3TCG A;  4WXJ A;  4KD5 A;  1A7L A;  2D3I A;  2DE3 A;  1XT8 A;  1DOT A;  4EF2 A;  5I58 A;  2F35 A;  3E13 X;  1D3K A;  3IK6 B;  3ZKK A;  4O3B A;  2DOJ A;  5CRY A;  4IO4 A;  1MG1 A;  1DSN A;  4U2R A;  1H43 A;  2O69 A;  3SEW A;  1LBC A;  1MQD A;  3DP8 A;  1Y1M A;  3WAF A;  5L9O A;  4QFL A;  3B7D A;  4IO7 A;  3IOV A;  2ZNT A;  1II5 A;  3BFT A;  2XXI A;  3OO8 A;  3MZ1 A;  3CI8 A;  3V83 A;  2XXR A;  2ZYO A;  1R1N A;  1MQJ A;  2HAU A;  2G29 A;  4RK2 A;  1FW0 A;  2OK2 A;  2BJJ X;  3KG2 A;  3CG3 A;  5AA3 A;  4MLQ A;  4F22 A;  4RXL A;  3EF7 A;  1I6A A;  3FJ7 A;  2DWA A;  4C1T A;  1Y3N A;  2DWJ A;  2V3Q A;  3C9H A;  4H6D A;  1ZU0 A;  3IOU A;  5CC2 A;  1QJM A;  3RTW B;  2A5S A;  3KGC A;  3OEM A;  4RJZ A;  1MPB A;  4WEP A;  4X1D A;  2P2A A;  1FTO A;  4OER A;  3UN6 A;  4ISU A;  4FED A;  3H7M A;  3PV0 E;  1MXU A;  1S7Y A;  3FXQ A;  4Q0C A;  3TOD A;  1SBP A;  4JWO A;  1SW5 A;  1M5B A;  5CBS A;  1ZJL A;  4NF4 A;  3SES A;  1DPP A;  2GRV A;  3KSX A;  3H03 A;  5J1D A;  4RY1 A;  2CMO A;  1SD3 A;  2QMX A;  3C32 A;  3H6V A;  1MQH A;  1F9B A;  2F34 A;  3S9L C;  3E9X A;  4I9D A;  1B7U A;  2XX7 A;  3IOR A;  4NWC A;  3Q26 A;  4H67 A;  4OFJ A;  3W9W A;  3O28 A;  1MM7 A;  2G93 A;  3CR9 A;  2V93 A;  4KR5 A;  2PMS A;  1B6H A;  4IO3 A;  4R6Y A;  5I57 B;  5ISU A;  4LZ5 A;  2DVZ A;  3HST A;  3FAT A;  2B65 A;  2F8D A;  4G2Z A;  4KYD A;  4JSO A;  4LZ7 A;  4ND9 A;  3N6T A;  3IB2 A;  4U23 A;  2WKY A;  3L6G A;  3O66 A;  3U72 A;  4N6P A;  4GQO A;  3OOA A;  5L9M A;  3QUJ A;  1AL3 A;  1SYI A;  3EHU A;  1NKX A;  1O64 A;  4EUO A;  1QKA A;  5ICQ A;  2XXP A;  3IJO B;  3MUQ A;  1FQB A;  4F2O A;  3MVY A;  1LFI A;  4PET A;  3FVN A;  5EHS A;  2H4I A;  2QJE A;  2XX8 A;  2ZNU A;  4DLD A;  1NH8 A;  4POW A;  2RC7 A;  5AE4 A;  2RC9 A;  2AIX A;  2UYF A;  2V3T A;  2YPN A;  4MH5 A;  4U1Z A;  4HCW A;  2H99 A;  4WED A;  1JW4 A;  3OD7 A;  5JTY A;  1B32 A;  1URS A;  4KFQ A;  4Q30 B;  1TWY A;  3G3F A;  2XXW A;  4QFK A;  5ELV A;  1GTK A;  3FV1 A;  3HO7 A;  5I56 B;  4U21 A;  4EXK A;  1NH7 A;  5I2K B;  5FHN A;  2ANJ A;  2I4B A;  1R9Q A;  3DLN A;  2Y7I A;  3RN8 A;  1LBB A;  1AMF A;  3E3K A;  3P7I A;  1HSE A;  1VFE A;  1PB9 A;  4YKK A;  3KEI A;  2QPQ A;  3G3J A;  1YTV A;  4ZEB A;  5L8D A;  2H9B A;  4EF1 A;  1JVX A;  4PFW A;  1ZTY A;  3KN7 A;  3QAX A;  1B4H A;  4OZ9 A;  4ZE8 A;  2XXY A;  4QFO A;  3C4M A;  5AA2 A;  1PBP A;  1QUJ A;  4PE5 B;  5KDT A;  3W15 C;  3K6X A;  1WVJ A;  4IO2 A;  2VD3 A;  1B1H A;  1DTG A;  5L9S A;  1B2H A;  4R9G A;  5JK4 A;  4ZZA A;  2NOO A;  2THI A;  3SEY A;  4UA8 A;  2QS4 A;  1IEJ A;  1P1N A;  2I3V A;  3PPN A;  3C33 A;  3U94 A;  2HAV A;  4QSD A;  3IB1 A;  3FJM A;  3SEX A;  4ECF A;  3I5O A;  1RKM A;  3ZSF A;  4EDP A;  3HV1 A;  3S4U A;  2X7Q A;  2RIN A;  3EPE A;  1FQF A;  2VGQ A;  2O1M A;  4FIM A;  3VLV A;  5HBC A;  4THI A;  2DVC A;  2F78 A;  3S9N C;  3D4G A;  3LBS A;  2I0B A;  4OTE A;  4OEV A;  3EHS A;  2UYE A;  4OWD A;  4YB5 A;  3CFX A;  4FE8 A;  2P1S A;  3K02 A;  4OYV A;  3I6V A;  4FEC A;  1B46 A;  2ONK E;  1I6Q A;  1XS5 A;  1VSO A;  2AL4 A;  3TQW A;  3T9X B;  3E4R A;  3OSR A;  3TCF A;  4QHQ A;  3SER A;  1LAX A;  3PUV E;  1DPE A;  1J1N A;  1MY1 A;  4FAJ A;  4XIG Q;  4PFT A;  4YIC A;  3VVD A;  1IZ1 A;  3ODB A;  3OO7 A;  1JW5 A;  4DE8 A;  1NFT A;  1Q1K A;  3LSW A;  3G3K A;  2QS1 A;  1B3E A;  1MXW A;  4KYE A;  3W9V A;  1O7T A;  2UVJ A;  3OO6 A;  1NNK A;  3IR1 A;  2NUV A;  3OXN A;  4JBZ A;  4KI0 E;  4O3A A;  1QUK A;  2LAO A;  5K2Y A;  3MW0 A;  4RK9 A;  3PPQ A;  3IAZ A;  3CFL A;  3LR1 A;  2F5X A;  1Z7N E;  4H1X A;  4JDF A;  3U8Q A;  5DEX A;  2F6G A;  1L5T A;  1MH4 A;  3K1N A;  3RQT A;  1R6Z A;  4H5F A;  4DCY A;  1LST A;  4AQ4 A;  1A40 A;  2HZL A;  3LSF B;  4P0G A;  3KFM A;  3M3K A;  1B7H A;  5H8N A;  1QW0 A;  4YU0 A;  3TKD A;  1Y4T A;  1B5J A;  4IGT A;  1Y20 A;  1P1O A;  3CVG A;  2V84 A;  1Y3Q A;  2Q2C A;  5ITP A;  4YKI A;  2RKM A;  4G68 A;  3VLW A;  3AXF A;  3OO9 A;  3PUX E;  5H8F B;  2IEE A;  3DP6 A;  1TT1 A;  1TXF A;  3PMX A;  1IXI A;  4DIG A;  4GVO A;  3THI A;  1MPC A;  3FXU A;  1NL5 A;  1MPD A;  3BFU A;  2HCA A;  4L17 A;  4DXC A;  5K2X A;  4ZZE A;  3RTF B;  1NNT A;  4G77 A;  4AB5 A;  1QKB A;  4YMB A;  3PPO A;  4KCD A;  1MXV A;  1EU8 A;  1KWH A;  3K01 A;  3CFZ A;  2OZZ A;  2PYY A;  2XD3 A;  4JWY A;  4KCC A;  1FQA A;  5EYF A;  3CG1 A;  3T66 A;  4OEN A;  3U93 A;  5EHM A;  1B9J A;  4ZS9 A;  3GXA A;  4WKM A;  5FTI A;  1IIW A;  3FJG A;  3CRB A;  3D4C A;  3V89 B;  2OCU A;  4H5G A;  1MXX A;  3KJ7 A;  3DP4 A;  3QUF A;  4IO5 A;  4ZEI A;  4JB7 A;  1LAF E;  2DP8 A;  2XD2 A;  5LOM A;  4OFO A;  1OVB A;  1BIY A;  3KBR A;  3K1P A;  3C31 A;  1S9T A;  1HSL A;  1YAE A;  1UTH A;  5H8N B;  1BP5 A;  5AA4 A;  2ESN A;  4H8J A;  3VLU A;  4GL0 A;  3VE1 B;  3IB0 A;  1ZMG A;  1USY E;  3OEK A;  3Q25 A;  2RCA A;  3KZG A;  1IXH A;  5I2N B;  1JET A;  4G68 B;  3TPA A;  3U92 A;  4PQJ A;  3OSQ A;  3PUZ E;  4NTL A;  3R26 A;  2O7I A;  3PMV A;  5H8Q A;  1FTM A;  1M5D A;  1MDP 1;  4H0W A;  2I48 A;  3LC8 A;  2QS2 A;  4LQ2 A;  4R75 A;  1H45 A;  3H3G A;  3S9M C;  2PX1 A;  5I58 B;  2RC8 A;  1P1U A;  3TDJ A;  5H8H A;  3JYR A;  2DSF A;  3O29 A;  4ZEC A;  1MXY A;  2OJT A;  5CM6 A;  1MY3 A;  2YLN A;  3QXM A;  2OLB A;  4P11 A;  4QF9 A;  1LGB C;  2F7B A;  4F18 A;  5IKB A;  3HHG A;  3QK6 A;  1I6B A;  4DCX A;  3PUW E;  4LZ8 A;  1MDQ A;  4X9T A;  3IOW A;  1MRP A;  2Q9T A;  2DQV A;  5DYH A;  3JV9 A;  3PD9 A;  1UTB A;  4GF8 A;  3H06 B;  2XXH A; 
#chains in the Genus database with same CATH topology
 4U4S A;  1I69 A;  4R6H A;  1MS7 A;  1XVX A;  2VP1 A;  1RDX A;  4GWU A;  1MY0 A;  4LUB A;  4MNC A;  1NV7 A;  5IZZ A;  2AYS A;  2ZYN A;  3G3H A;  2H5Y A;  1LAH E;  1UTH B;  4QBA A;  1N84 A;  1OLC A;  3GLB A;  4IO6 A;  3BBR A;  4I3Y A;  5AA4 B;  3F11 A;  2W7Y A;  4E0W A;  1VDW A;  3IO6 A;  4F3P A;  3HN0 A;  3N26 A;  3K6U A;  2HZK A;  4JWX A;  1NV6 A;  3MST A;  4NX1 A;  4NQ8 A;  5F1Q A;  1ANF A;  3R6U A;  3OEL A;  1B4Z A;  4NF4 B;  5H8Q B;  4R2B A;  1ELJ A;  5HPQ A;  1IMB A;  5ESY A;  2DWH A;  2REG A;  1YZ0 A;  4R74 A;  3MWB A;  2ZMB A;  4PP0 A;  4LQ5 A;  1OLA A;  1H44 A;  1N7X A;  1EZ9 A;  4YB6 A;  3ILT B;  2Y7P A;  5A5X A;  2O84 X;  3K4U A;  4IY6 A;  4GRK A;  1B05 A;  3TEP A;  4ZEF A;  2Y5K A;  1SQY A;  3MZ9 A;  4BDO A;  1A8E A;  4XKP A;  5H8H B;  3CSB A;  5TPA A;  2Q8J A;  2QMW A;  2HEU A;  2F97 A;  3S2V A;  4ELQ A;  3TTL A;  5ET8 A;  2FA7 A;  2Q8M A;  4XEQ A;  1A8F A;  4MF3 A;  3KBZ A;  2DWI A;  2JJK A;  1Q35 A;  4R72 A;  1EH3 A;  4NHB A;  1B3F A;  5I59 A;  5ICT A;  4N07 A;  1FPL A;  1URG A;  3O6G A;  2Z8D A;  5CMC A;  4FJP A;  4OVJ A;  1B3G A;  1PEB A;  1PDA A;  4RYA A;  3MPK A;  4QFN A;  3N6U A;  3PGF A;  5TP9 A;  1EYJ A;  4XXU A;  1UTB B;  4NF8 A;  4NF5 A;  4RNS A;  2RF1 A;  4GLI A;  4EQ9 A;  1NNF A;  3T9H B;  2DYX A;  4NF0 A;  4MCO A;  2VPN A;  3CSG A;  1N04 A;  5CMK A;  1MY2 A;  1ZBM A;  2WYK A;  3EHT A;  1URD A;  3T9U A;  3EQ1 A;  2GHA A;  4YKJ A;  4KPT A;  1FPD A;  1NUW A;  3MP6 A;  4G68 C;  1B7Z A;  4I1D A;  5KCJ A;  2GFE A;  3DEL B;  4LAT A;  2F7A A;  5LDZ A;  1PC3 A;  3LUY A;  2OWS A;  1A99 A;  3RPW A;  3VVF A;  3Q27 A;  1LCT A;  1USY H;  5EYG A;  2O51 A;  1LCF A;  5JTY B;  3USD A;  1FBE A;  2ONS A;  1FPK A;  1IQ7 A;  2ALU A;  4XKQ A;  4H65 A;  1LB9 A;  4NE4 A;  5FHM A;  4F39 A;  3KSJ A;  4G8M A;  1MQG A;  4YKP A;  2Z23 A;  5ET7 A;  1G0I A;  4PE3 A;  3V8X B;  4MLV A;  4OXV A;  4OFL A;  2Y7R A;  4G61 A;  4GX3 A;  5FTH A;  4QSE A;  1JNF A;  1RYX A;  1G0H A;  2X7P A;  3PPP A;  5A5X B;  5AA2 D;  2VD2 A;  5EYH A;  2HPG A;  4YB7 A;  3N5L A;  1OIB A;  1NUZ A;  4NGU A;  3B6W A;  3RLF E;  1VFD A;  4TLM B;  3WAE A;  4I62 A;  4KQP A;  5B7D A;  4MFI A;  4RPO A;  2CZH A;  4GL8 A;  5IZ3 A;  2BJI A;  4P56 A;  1GGG A;  4BDR A;  5AA2 B;  1FBD A;  2WBD A;  1NV0 A;  2I4C A;  4GFR A;  3UP9 A;  4N81 A;  1YCJ A;  5KDT B;  4H45 A;  4LP2 B;  3TAJ A;  3T22 A;  2ZNS A;  2B3F A;  2E1S A;  1OMP A;  2Q88 A;  3PD8 A;  3C35 A;  3UK4 A;  3MP1 A;  1KZ8 A;  1IXC A;  3RNN A;  5TP9 B;  1Y1Z A;  3RUM A;  2E0S A;  1DTZ A;  2XXX A;  2XXU A;  5DT6 A;  1NUY A;  1D9Q A;  1MQI A;  2HXW A;  2Y84 A;  4DI4 B;  3TMG A;  4NF5 B;  3K2D A;  1B0H A;  4MIJ A;  3MQ9 A;  4JSD A;  2UVG A;  3TFL A;  2AL5 A;  2ZYK A;  2ABH A;  1GR2 A;  2HQ0 A;  2ZYM A;  3MPL A;  2ONR A;  5DVF A;  1P1W A;  3VXC A;  5CMM A;  5J16 A;  3K00 A;  4N6D A;  2ZXT A;  4BDL A;  1FPF A;  2NWJ A;  3TTM A;  4OVP A;  1NUX A;  3ZKL A;  4BDN A;  1FRP A;  4X04 A;  1XOC A;  2QRY A;  2WYP A;  3KOT A;  3T96 B;  1YYZ A;  3FVG A;  3B6T A;  2ZZV A;  2QL3 A;  4F3S A;  3RY3 A;  3QYT A;  1Y3P A;  2KR0 A;  4PDH A;  2XXT A;  3Q28 A;  4BLA A;  4R2F A;  3O6H A;  2IA4 A;  1NNP A;  1PBQ A;  1LEV A;  4XKR A;  3M3F A;  3B6Q A;  2H25 A;  1NMU A;  1CE2 A;  3MC2 A;  4M1V A;  5CI5 A;  2B4L A;  3Q29 A;  5I57 A;  4LON B;  3ECR A;  5IZ3 B;  1IIT A;  1LB8 A;  2QSX A;  1POT A;  3A09 A;  2HFB A;  2D5W A;  3CIJ A;  3QIM A;  3JZJ A;  3UA8 A;  3TCH A;  5DEX B;  1EZO A;  2Y7K A;  2FNC A;  1FPB A;  2MKZ A;  3RGY A;  3S9E A;  1D4N A;  3IO4 A;  3PTY A;  2PBW A;  4DZ1 A;  2R71 A;  2UXA A;  2CZL A;  4PF8 A;  2I6E A;  1NV2 A;  1B51 A;  4C1U A;  3O6I A;  2B4M A;  1N7W A;  4TLL B;  4NG7 A;  1MM6 A;  4PBQ A;  3MJN A;  3FIR A;  4LVQ A;  3V5A A;  2GH9 A;  1MY4 A;  4QFP A;  1JW1 A;  5DW8 A;  2DXY A;  3IJX B;  4TQU Q;  3FVO A;  3ILU B;  1FTL A;  2XWI A;  1IXG A;  4HS7 A;  1IUD A;  3UOR A;  4NMY A;  4I8C A;  1AIV A;  1M5F A;  1CB6 A;  2HXR A;  3K0V A;  3H6W A;  1LFH A;  4C0R A;  2P0S A;  4XKN A;  4Q8R A;  3UGW A;  2I58 A;  1LBW A;  1SI0 A;  1TFA A;  4EXL A;  4O3C A;  4LA9 A;  1JVY A;  5BWJ A;  3R7X A;  2FYI A;  3I3V A;  3RYD A;  4KHZ E;  4EQ7 A;  3M3L A;  3H4Z A;  2I49 A;  1WDN A;  4GWY A;  2B3B A;  1VE4 A;  2F7C A;  1POY 1;  4ELO A;  1BTJ A;  1MXZ A;  2R6G E;  2DE2 A;  4F29 A;  1N3W A;  3KN3 A;  1WOD A;  4GOT A;  2DE4 A;  2VOZ A;  2OBG A;  1M5C A;  1JEV A;  2ZZW A;  5I56 A;  3H6T A;  5I2K A;  2VPO A;  2F6P A;  1YXI A;  3G3I A;  4BDM A;  4NAP A;  3U1O A;  1N76 A;  2DS9 A;  4GXS B;  1M5E A;  3VVE A;  3RT6 B;  3OEN A;  1RYO A;  4POX A;  2I0C A;  1DMB A;  4FOR A;  1UIU A;  4XTC Q;  2O68 A;  4N8G A;  1FQE A;  1GV8 A;  2XXQ A;  4FEB A;  2M8C A;  4F3B A;  3A3C A;  3O9P A;  5DTB A;  4QSC A;  2I3W A;  2V3U A;  4ZEK A;  1EYK A;  3IOT A;  3C34 A;  1Y4C A;  1B40 A;  4MX6 A;  4GX6 A;  4U1O A;  3H6U A;  2PT1 A;  4PGP A;  2O1L A;  4ZED A;  5HM4 B;  4M4G A;  4NWD A;  4OQO A;  4DDD A;  4ZE9 A;  3SET A;  1LBV A;  5FHO A;  4AB6 A;  4OES A;  4YZZ A;  1OQH A;  5DVI A;  3K1M A;  1B1X A;  2Y7W A;  4PDD A;  1SW1 A;  1SVX B;  2CZK A;  1FJ6 A;  3MYU A;  1LAG E;  4RPN A;  3MVZ A;  1QGX A;  2A5T A;  1QUI A;  1DCU A;  2P3V A;  1TFD A;  1RDY A;  2OWT A;  1N3X A;  3MP8 A;  4NED A;  4RA1 A;  3MBP A;  5LTC A;  1JEU A;  1BLF A;  3GZG A;  4U4X A;  4EQB A;  4F1U A;  1INP A;  4R9F A;  4R6K A;  1B58 A;  5KZT A;  3E79 A;  4E0X A;  2V25 A;  1Z7M E;  1FBG A;  2Z8E A;  4F31 B;  4G4P A;  3SEV A;  1ZKB A;  1SW4 A;  2O6A A;  3KOS A;  4OHN A;  2FHY A;  3VDF A;  4HTG A;  1QUL A;  4ESW A;  4HW8 A;  5H8S A;  4OET A;  4IY5 A;  4TOZ A;  1HSJ A;  4OAN A;  2RCB A;  3MZB A;  1B3H A;  2CEY A;  1A55 A;  3QSL A;  4P3L A;  4PTK A;  2UVH A;  3HHF A;  3FD3 A;  1FTA A;  3MVW A;  2QS3 A;  2XHD A;  4F2Q A;  4F1V A;  3VFJ A;  1ZLQ A;  4H8I A;  1FTJ A;  4PFY A;  4GIZ A;  1B5H A;  1SDX A;  3GBA A;  2CZI A;  5ET5 A;  4O7I A;  2XA5 A;  1SI1 A;  5IGA A;  1JQF A;  4N13 A;  2PVU A;  1IME A;  3TTR A;  1BKA A;  4NF6 A;  4AS5 A;  3IFA A;  2XWO A;  3C36 A;  4Z0I A;  1MH3 A;  3VV5 A;  3FXB A;  3FZV A;  4ESX A;  3IL1 B;  4HCY A;  2VHA A;  1PB8 A;  4JXI A;  1B3L A;  1P99 A;  3OMB A;  4GD5 A;  5JEI A;  3FV2 A;  3TTN A;  5CMB A;  4HE0 A;  1FQD A;  4GXA A;  4G8N A;  5EQA A;  4FAT A;  4ELR A;  2PT2 A;  5F7V A;  3D1R A;  2Z8F A;  2NXO A;  3FGS A;  2PCR A;  3TEL A;  3N94 A;  1EZP A;  4ONY A;  2Z22 A;  3PUY E;  2A5T B;  2KLF A;  3PMW A;  2R9J A;  3LSX A;  1H3D A;  3PPR A;  4YMA A;  4Z7E A;  3UIF A;  4X48 A;  4GWO A;  4DXB A;  3ROJ A;  4MHF A;  5IAI A;  3FAS A;  2NVU B;  3A29 A;  5DVJ A;  1LFG A;  4QRZ A;  1XC1 A;  1XI6 A;  5H8F A;  1Q9D A;  3GYY A;  4KYS A;  4DXU A;  1B52 A;  3CHG A;  1A54 A;  4U22 A;  3SDF A;  4BDQ A;  3O97 A;  4K3F A;  2H98 A;  1T0K A;  4P1L A;  1KA0 A;  3FUZ A;  3K6W A;  2XX9 A;  4MBP A;  1XVY A;  1OVT A;  3KC0 A;  1SYH A;  4X1B A;  3MAM A;  3VXB A;  1OQG A;  4OMB A;  3FVK A;  1B0L A;  3FXR A;  1US5 A;  4IGR A;  3L6H A;  2UVI A;  3LSL A;  3TZA A;  4YAH X;  3T93 B;  3HCQ A;  4R73 A;  1O63 A;  4PFB A;  5TPA B;  1IMA A;  1SW2 A;  2L5V A;  1D9Y A;  3IX1 A;  3T9V A;  3DM0 A;  4IB2 A;  3G3G A;  3K6V A;  4OEU A;  4PAI A;  4F19 A;  3M8U A;  4LN5 A;  1UIV A;  5A5L A;  3KC1 A;  3KJT A;  5I59 B;  3TQL A;  1US4 A;  1XHY A;  4NF6 B;  1AOV A;  1ATG A;  5TU0 A;  4G8H A;  1KA1 A;  1FTK A;  4PAF A;  1ZIU A;  3GBB A;  2X26 A;  5AA1 A;  2O7U A;  3TTK A;  3T0J A;  3ONM A;  3RT8 A;  1N0T A;  5B70 A;  1UQW A;  2YJP A;  4NF8 B;  3IFC A;  3ZS6 A;  1PB7 A;  3HPI A;  1S50 A;  3PU5 A;  5ET6 A;  3HFU A;  1AH5 A;  3MVX A;  4PCD A;  3O2A A;  3SKP A;  5I84 A;  2HHM A;  4P0I A;  4UAC A;  1D9V A;  2D21 A;  1QVS A;  2REJ A;  4ZDM A;  3KN8 A;  3TUS A;  2XXV A;  1R9L A;  2QVR A;  4N17 A;  4PAK A;  1LLS A;  1GVC A;  5KCJ B;  3BKI B;  1FQC A;  3A3U A;  5BUU A;  5CBR A;  3SEU A;  4F3G A;  2GHB A;  5I2N A;  4MMP A;  3EN3 A;  1B5I A;  4PGN A;  5ITO A;  4HE1 A;  2Q89 A;  4F1Y A;  2F36 A;  1H76 A;  1Y9U A;  4ELP A;  3G7W A;  4PFU A;  5M2V A;  1P1Q A;  2DXR A;  1VR5 A;  1YPN A;  4Q5T A;  1FCK A;  1DK4 A;  3TYH A;  2Q2A A;  3TCG A;  4WXJ A;  4MNI A;  4KD5 A;  1A7L A;  2D3I A;  2DE3 A;  1XT8 A;  1DOT A;  4EF2 A;  5I58 A;  2F35 A;  4IR8 A;  3E13 X;  2R8T A;  3NOH A;  1D3K A;  3IK6 B;  3ZKK A;  4O3B A;  2DOJ A;  5CRY A;  4IO4 A;  1MG1 A;  1DSN A;  4U2R A;  1H43 A;  2O69 A;  1FBF A;  1NV3 A;  3SEW A;  1LBC A;  1MQD A;  3DP8 A;  1Y1M A;  3WAF A;  5L9O A;  4QFL A;  3B7D A;  4IO7 A;  3IOV A;  2ZNT A;  1II5 A;  3BFT A;  2XXI A;  3OO8 A;  3MZ1 A;  3CI8 A;  4GWS A;  3V83 A;  2WX9 A;  2XXR A;  2ZYO A;  1R1N A;  1MQJ A;  2HAU A;  2G29 A;  4RK2 A;  1FW0 A;  1FJ9 A;  2OK2 A;  2FBP A;  2BJJ X;  3KG2 A;  2XWV A;  3CG3 A;  5AA3 A;  4MLQ A;  4F22 A;  4RXL A;  4XF5 A;  3EF7 A;  1I6A A;  3FJ7 A;  2DWA A;  4C1T A;  3RPL A;  4H46 A;  1Y3N A;  2DWJ A;  2V3Q A;  4QXD A;  4PBH A;  3C9H A;  4H6D A;  1ZU0 A;  2WEF A;  3IOU A;  5CC2 A;  4UAB A;  1QJM A;  4I40 A;  3RTW B;  2A5S A;  3KGC A;  3OEM A;  4RJZ A;  1MPB A;  4WEP A;  4X1D A;  2P2A A;  4X8R A;  1FTO A;  4P1E A;  4OER A;  3UN6 A;  1NV5 A;  4FBP A;  4ISU A;  4FED A;  3H7M A;  3PV0 E;  1MXU A;  1RDZ A;  1S7Y A;  3FXQ A;  4Q0C A;  3TOD A;  1SBP A;  2OWZ A;  4JWO A;  1SW5 A;  1M5B A;  5CBS A;  1ZJL A;  1FBC A;  4NF4 A;  3SES A;  1DPP A;  2GRV A;  3KSX A;  3H03 A;  5J1D A;  4RY1 A;  2CMO A;  3U65 A;  1SD3 A;  2QMX A;  3C32 A;  3H6V A;  1FPJ A;  1MQH A;  1F9B A;  2F34 A;  2Y5L A;  3S9L C;  3E9X A;  4I9D A;  1B7U A;  4OA4 A;  2XX7 A;  3IOR A;  4NWC A;  3Q26 A;  4H67 A;  4OFJ A;  3W9W A;  3O28 A;  1MM7 A;  2G93 A;  2F3B A;  3CR9 A;  2V93 A;  1CNQ A;  4KR5 A;  2PMS A;  1B6H A;  4IO3 A;  4R6Y A;  2WBB A;  5I57 B;  4LZ5 A;  5ISU A;  4OVS A;  4GBV A;  1K9Z A;  1IMF A;  4HE2 A;  2DVZ A;  3HST A;  3FAT A;  2B65 A;  2F8D A;  4G2Z A;  4KYD A;  2QFL A;  4JSO A;  4LZ7 A;  4ND9 A;  3N6T A;  3IB2 A;  4U23 A;  2WKY A;  3L6G A;  3O66 A;  3U72 A;  4N6P A;  4GQO A;  3ISP A;  3OOA A;  3SZP A;  5L9M A;  3QUJ A;  1AL3 A;  1SYI A;  3EHU A;  1NKX A;  1LBY A;  1O64 A;  4EUO A;  1QKA A;  5ICQ A;  2XXP A;  3LV0 A;  3IJO B;  3MUQ A;  2FIX A;  1FQB A;  4JVI A;  4F2O A;  3RPL B;  3MVY A;  1LFI A;  4XFE A;  4PET A;  3FVN A;  5EHS A;  2H4I A;  2QJE A;  1SPI A;  2XX8 A;  2ZNU A;  4DLD A;  1NH8 A;  4POW A;  2RC7 A;  5AE4 A;  2RC9 A;  2AIX A;  2UYF A;  2V3T A;  2YPN A;  4MH5 A;  4U1Z A;  4HCW A;  1EYI A;  2H99 A;  4WED A;  1JW4 A;  3OD7 A;  5EQ7 A;  1FSA A;  5JTY A;  4MAG A;  1B32 A;  1URS A;  4KFQ A;  4MJO A;  4Q30 B;  1TWY A;  3G3F A;  2XXW A;  5EQ9 A;  4QFK A;  5ELV A;  1GTK A;  3FV1 A;  5I5P A;  3HO7 A;  5I56 B;  1IMD A;  4U21 A;  4EXK A;  1NH7 A;  5I2K B;  5FHN A;  2ANJ A;  2XWK A;  2I4B A;  1LBZ A;  1R9Q A;  3DLN A;  4P8B A;  2Y7I A;  3RN8 A;  1LBB A;  1AMF A;  3E3K A;  3P7I A;  1HSE A;  1VFE A;  1PB9 A;  4YKK A;  3KEI A;  1NV1 A;  2QPQ A;  3EKI A;  1NV4 A;  3G3J A;  1YTV A;  4ZEB A;  5L8D A;  2H9B A;  4EF1 A;  1JVX A;  4PFW A;  1ZTY A;  3KN7 A;  3QAX A;  1B4H A;  4OZ9 A;  4ZE8 A;  4QFO A;  2XXY A;  4N15 A;  2P3N A;  3C4M A;  5AA2 A;  1PBP A;  1QUJ A;  4PE5 B;  3FBP A;  5KDT A;  3W15 C;  4MNP A;  3K6X A;  1WVJ A;  4IO2 A;  2VD3 A;  1B1H A;  1DTG A;  5L9S A;  1B2H A;  4R9G A;  2KQZ A;  5JK4 A;  4ZZA A;  2NOO A;  2THI A;  3SEY A;  4UA8 A;  2QS4 A;  1IEJ A;  1P1N A;  2I3V A;  3PPN A;  3C33 A;  3U94 A;  2HAV A;  4GX4 A;  1FPE A;  4QSD A;  3IB1 A;  3FJM A;  3SEX A;  4ECF A;  3I5O A;  1RKM A;  4PF6 A;  3ZSF A;  4EDP A;  3HV1 A;  3S4U A;  2X7Q A;  2RIN A;  3EPE A;  1FQF A;  2VGQ A;  2O1M A;  4FIM A;  3VLV A;  4N91 A;  5HBC A;  4THI A;  2DVC A;  2F78 A;  3S9N C;  3D4G A;  3LBS A;  2I0B A;  4OTE A;  4OEV A;  3EHS A;  2UYE A;  5I7I A;  4OWD A;  4O7M A;  4YB5 A;  3CFX A;  4FE8 A;  2XXK A;  2P1S A;  3K02 A;  4AS4 A;  4N8Y A;  4OYV A;  5EQ8 A;  3I6V A;  4FEC A;  1B46 A;  2ONK E;  1I6Q A;  1XS5 A;  1VSO A;  2AL4 A;  3TQW A;  3T9X B;  3E4R A;  3OSR A;  4OVR A;  1DBZ A;  3TCF A;  4QHQ A;  3SER A;  1LAX A;  3PUV E;  1DPE A;  1J1N A;  1MY1 A;  4XIG Q;  4YIC A;  4PFT A;  2QVU A;  4FAJ A;  3VVD A;  1IZ1 A;  3ODB A;  3OO7 A;  1JW5 A;  4DE8 A;  1NFT A;  3E78 A;  1Q1K A;  3LSW A;  3G3K A;  4OVT A;  2QS1 A;  1B3E A;  4PC9 A;  1MXW A;  4KYE A;  3W9V A;  1O7T A;  2UVJ A;  3OO6 A;  1NNK A;  4KXP A;  3IR1 A;  2NUV A;  3OXN A;  4JBZ A;  4KI0 E;  4PFR A;  4O3A A;  1QUK A;  2LAO A;  5K2Y A;  3MW0 A;  4RK9 A;  3PPQ A;  3IAZ A;  3CFL A;  4JVD A;  3LR1 A;  2F5X A;  1Z7N E;  4H1X A;  4JDF A;  3U8Q A;  5DEX A;  2F6G A;  1FBH A;  1L5T A;  5I3S A;  1MH4 A;  3K1N A;  3RQT A;  1R6Z A;  2QVV A;  4H5F A;  4DCY A;  1LST A;  4AQ4 A;  1A40 A;  2HZL A;  3LSF B;  4P0G A;  3KFM A;  4GBW A;  3M3K A;  1B7H A;  4O8M A;  5H8N A;  2PFY A;  1QW0 A;  4YU0 A;  4P47 A;  3TKD A;  1Y4T A;  1B5J A;  4IGT A;  1JP4 A;  1Y20 A;  1P1O A;  3CVG A;  2V84 A;  2OX3 A;  1Y3Q A;  2Q2C A;  5ITP A;  4NN3 A;  4YKI A;  2RKM A;  4G68 A;  3VLW A;  3AXF A;  3OO9 A;  3PUX E;  2V4C A;  5H8F B;  1FBP A;  2IEE A;  3DP6 A;  1TT1 A;  1TXF A;  3PMX A;  1IXI A;  4DIG A;  5IZ1 A;  4GVO A;  3THI A;  1MPC A;  3FXU A;  1NL5 A;  1MPD A;  3BFU A;  2HCA A;  1BK4 A;  4L17 A;  2CEX A;  4DXC A;  5K2X A;  4PFI A;  4ZZE A;  3RTF B;  1NNT A;  4G77 A;  2DDK A;  1LBX A;  4AB5 A;  3T1B A;  1QKB A;  4YMB A;  3PPO A;  4KCD A;  1MXV A;  1EU8 A;  1KWH A;  3K01 A;  3CFZ A;  2OZZ A;  2PYY A;  2XD3 A;  4JWY A;  4KCC A;  1IMC A;  1FQA A;  5EYF A;  3CG1 A;  3B8B A;  3T66 A;  4OEN A;  3U93 A;  5EHM A;  1B9J A;  4ZS9 A;  2Q74 A;  3GXA A;  1AWB A;  4WKM A;  5FTI A;  1IIW A;  3FJG A;  3CRB A;  3BIG A;  3D4C A;  3V89 B;  2OCU A;  4H5G A;  1MXX A;  3BIH A;  3KJ7 A;  3DP4 A;  3QUF A;  4IO5 A;  4ZEI A;  4JB7 A;  1LAF E;  2DP8 A;  2XD2 A;  5LOM A;  2FIE A;  4OFO A;  1OVB A;  1BIY A;  3KBR A;  2VT5 A;  3K1P A;  5FBP A;  3C31 A;  4N4U A;  1S9T A;  1HSL A;  1YAE A;  1UTH A;  4GWW A;  5H8N B;  2F3D A;  1BP5 A;  2FVZ A;  4MEV A;  5AA4 A;  4I3E A;  2ESN A;  4H8J A;  3VLU A;  1K9Y A;  4GL0 A;  3VE1 B;  4GWX A;  3IB0 A;  1ZMG A;  2GQ1 A;  1USY E;  3OEK A;  3Q25 A;  2RCA A;  3KZG A;  1IXH A;  5I2N B;  1JET A;  4N6K A;  4G68 B;  3TPA A;  3U92 A;  4OVQ A;  4PQJ A;  3OSQ A;  3PUZ E;  4NTL A;  4O94 A;  3R26 A;  2O7I A;  4GWZ A;  3PMV A;  5H8Q A;  2ZZX A;  1FTM A;  5IM2 A;  1M5D A;  1FPG A;  1MDP 1;  4H0W A;  3B50 A;  2I48 A;  3LC8 A;  2QS2 A;  4LQ2 A;  4R75 A;  1H45 A;  4P9K A;  3H3G A;  3S9M C;  2PX1 A;  5I58 B;  2PFZ A;  1FPI A;  1P1U A;  2RC8 A;  3TDJ A;  5H8H A;  3JYR A;  5T3J A;  2DSF A;  3O29 A;  4ZEC A;  5F24 A;  1MXY A;  2OJT A;  5CM6 A;  1MY3 A;  2YLN A;  3QXM A;  2OLB A;  4P11 A;  4DI3 D;  4QF9 A;  1LGB C;  2F7B A;  4F18 A;  5IKB A;  3HHG A;  3QK6 A;  1I6B A;  3PUW E;  4DCX A;  4LZ8 A;  1MDQ A;  4X9T A;  3IOW A;  3QMF A;  4HXV A;  1NI9 A;  4JVC A;  1MRP A;  2Q9T A;  2DQV A;  5DYH A;  3JV9 A;  3PD9 A;  1UTB A;  4GF8 A;  3H06 B;  3LUZ A;  2XXH A; 
#chains in the Genus database with same CATH homology
 4U4S A;  1I69 A;  4R6H A;  1MS7 A;  1XVX A;  2VP1 A;  1MY0 A;  4LUB A;  2AYS A;  2ZYN A;  3G3H A;  2H5Y A;  1LAH E;  1UTH B;  1N84 A;  1OLC A;  3GLB A;  4IO6 A;  3BBR A;  5AA4 B;  3F11 A;  2W7Y A;  4E0W A;  3IO6 A;  4F3P A;  3HN0 A;  3N26 A;  3K6U A;  2HZK A;  4JWX A;  5F1Q A;  1ANF A;  3R6U A;  3OEL A;  1B4Z A;  4NF4 B;  5H8Q B;  4R2B A;  1ELJ A;  5HPQ A;  2DWH A;  2REG A;  4R74 A;  3MWB A;  2ZMB A;  4PP0 A;  4LQ5 A;  1OLA A;  1H44 A;  1N7X A;  1EZ9 A;  4YB6 A;  3ILT B;  2Y7P A;  5A5X A;  2O84 X;  3K4U A;  4IY6 A;  4GRK A;  1B05 A;  3TEP A;  4ZEF A;  1SQY A;  3MZ9 A;  4BDO A;  1A8E A;  4XKP A;  5H8H B;  3CSB A;  5TPA A;  2Q8J A;  2QMW A;  2HEU A;  2F97 A;  3S2V A;  4ELQ A;  3TTL A;  2FA7 A;  1A8F A;  4MF3 A;  2DWI A;  1Q35 A;  4R72 A;  1EH3 A;  5I59 A;  1B3F A;  5ICT A;  4N07 A;  1URG A;  3O6G A;  2Z8D A;  5CMC A;  4FJP A;  4OVJ A;  1B3G A;  1PEB A;  1PDA A;  4RYA A;  3MPK A;  4QFN A;  3N6U A;  3PGF A;  5TP9 A;  4XXU A;  1UTB B;  4NF8 A;  4NF5 A;  4RNS A;  2RF1 A;  4GLI A;  4EQ9 A;  1NNF A;  3T9H B;  2DYX A;  3CSG A;  1N04 A;  5CMK A;  1MY2 A;  1ZBM A;  3EHT A;  1URD A;  3T9U A;  3EQ1 A;  2GHA A;  4YKJ A;  4KPT A;  3MP6 A;  4G68 C;  1B7Z A;  4I1D A;  5KCJ A;  2GFE A;  3DEL B;  4LAT A;  2F7A A;  1PC3 A;  3LUY A;  2OWS A;  1A99 A;  3RPW A;  3VVF A;  3Q27 A;  1LCT A;  1USY H;  2O51 A;  1LCF A;  5JTY B;  3USD A;  2ONS A;  1IQ7 A;  2ALU A;  4XKQ A;  4H65 A;  1LB9 A;  4NE4 A;  5FHM A;  4F39 A;  3KSJ A;  4G8M A;  1MQG A;  4YKP A;  2Z23 A;  3V8X B;  4MLV A;  4OXV A;  4OFL A;  2Y7R A;  5FTH A;  4QSE A;  1JNF A;  1RYX A;  2X7P A;  3PPP A;  5A5X B;  5AA2 D;  2VD2 A;  4YB7 A;  3N5L A;  1OIB A;  3B6W A;  3RLF E;  1VFD A;  4TLM B;  3WAE A;  4I62 A;  4KQP A;  5B7D A;  4MFI A;  4RPO A;  4GL8 A;  1GGG A;  4BDR A;  5AA2 B;  2I4C A;  4GFR A;  3UP9 A;  1YCJ A;  5KDT B;  4LP2 B;  3TAJ A;  3T22 A;  2ZNS A;  2B3F A;  2E1S A;  1OMP A;  2Q88 A;  3PD8 A;  3C35 A;  3UK4 A;  3MP1 A;  1IXC A;  3RNN A;  5TP9 B;  1Y1Z A;  3RUM A;  2E0S A;  1DTZ A;  2XXX A;  2XXU A;  5DT6 A;  1MQI A;  2HXW A;  2Y84 A;  3TMG A;  4NF5 B;  3K2D A;  1B0H A;  3MQ9 A;  4JSD A;  2UVG A;  3TFL A;  2AL5 A;  2ZYK A;  2ABH A;  1GR2 A;  2HQ0 A;  2ZYM A;  3MPL A;  2ONR A;  5DVF A;  1P1W A;  3VXC A;  5CMM A;  3K00 A;  2ZXT A;  4BDL A;  2NWJ A;  3TTM A;  3ZKL A;  4BDN A;  1XOC A;  2QRY A;  3KOT A;  3T96 B;  3FVG A;  3B6T A;  2QL3 A;  4F3S A;  3RY3 A;  3QYT A;  1Y3P A;  2XXT A;  3Q28 A;  4BLA A;  4R2F A;  3O6H A;  2IA4 A;  1NNP A;  1PBQ A;  4XKR A;  3M3F A;  3B6Q A;  2H25 A;  1NMU A;  1CE2 A;  3MC2 A;  4M1V A;  5CI5 A;  3Q29 A;  5I57 A;  4LON B;  3ECR A;  1IIT A;  1LB8 A;  2QSX A;  1POT A;  3A09 A;  2HFB A;  2D5W A;  3CIJ A;  3QIM A;  3JZJ A;  3UA8 A;  3TCH A;  5DEX B;  1EZO A;  2Y7K A;  2FNC A;  3RGY A;  3S9E A;  1D4N A;  3IO4 A;  2PBW A;  4DZ1 A;  2R71 A;  2UXA A;  2CZL A;  2I6E A;  1B51 A;  4C1U A;  3O6I A;  1N7W A;  4TLL B;  1MM6 A;  3MJN A;  3FIR A;  4LVQ A;  3V5A A;  2GH9 A;  1MY4 A;  4QFP A;  1JW1 A;  2DXY A;  3IJX B;  4TQU Q;  3FVO A;  3ILU B;  1FTL A;  1IXG A;  4HS7 A;  1IUD A;  3UOR A;  4NMY A;  4I8C A;  1AIV A;  1M5F A;  1CB6 A;  3K0V A;  1LFH A;  3H6W A;  4C0R A;  2P0S A;  4XKN A;  4Q8R A;  3UGW A;  2I58 A;  1SI0 A;  1TFA A;  4EXL A;  4O3C A;  4LA9 A;  1JVY A;  5BWJ A;  3R7X A;  2FYI A;  3I3V A;  4EQ7 A;  4KHZ E;  3M3L A;  3H4Z A;  2I49 A;  1WDN A;  2B3B A;  1VE4 A;  2F7C A;  1POY 1;  4ELO A;  1BTJ A;  1MXZ A;  2R6G E;  2DE2 A;  4F29 A;  1N3W A;  3KN3 A;  1WOD A;  4GOT A;  2DE4 A;  2VOZ A;  2OBG A;  1M5C A;  1JEV A;  5I56 A;  3H6T A;  5I2K A;  2F6P A;  3G3I A;  4BDM A;  3U1O A;  1N76 A;  2DS9 A;  4GXS B;  1M5E A;  3VVE A;  3RT6 B;  3OEN A;  1RYO A;  4POX A;  2I0C A;  1DMB A;  4FOR A;  1UIU A;  4XTC Q;  2O68 A;  1FQE A;  1GV8 A;  2XXQ A;  4FEB A;  2M8C A;  4F3B A;  3A3C A;  3O9P A;  5DTB A;  4QSC A;  2I3W A;  2V3U A;  4ZEK A;  3IOT A;  3C34 A;  1Y4C A;  1B40 A;  4U1O A;  3H6U A;  2PT1 A;  2O1L A;  4ZED A;  5HM4 B;  4M4G A;  4NWD A;  4OQO A;  4DDD A;  4ZE9 A;  3SET A;  5FHO A;  4AB6 A;  4OES A;  4YZZ A;  1OQH A;  5DVI A;  3K1M A;  1B1X A;  2Y7W A;  1SW1 A;  1SVX B;  1LAG E;  4RPN A;  3MVZ A;  2A5T A;  1QUI A;  1TFD A;  2OWT A;  1N3X A;  3MP8 A;  4NED A;  4RA1 A;  3MBP A;  1JEU A;  1BLF A;  3GZG A;  4U4X A;  4EQB A;  4F1U A;  4R9F A;  4R6K A;  1B58 A;  5KZT A;  4E0X A;  2V25 A;  1Z7M E;  2Z8E A;  4F31 B;  4G4P A;  3SEV A;  1ZKB A;  1SW4 A;  2O6A A;  3KOS A;  4OHN A;  3VDF A;  4HTG A;  1QUL A;  4ESW A;  4HW8 A;  5H8S A;  4OET A;  4IY5 A;  4TOZ A;  1HSJ A;  2RCB A;  3MZB A;  1B3H A;  1A55 A;  3QSL A;  2UVH A;  3HHF A;  3FD3 A;  3MVW A;  2QS3 A;  2XHD A;  4F2Q A;  4F1V A;  3VFJ A;  1ZLQ A;  4H8I A;  1FTJ A;  4PFY A;  4GIZ A;  1B5H A;  1SDX A;  3GBA A;  1SI1 A;  1JQF A;  4N13 A;  2PVU A;  3TTR A;  1BKA A;  4NF6 A;  3C36 A;  4Z0I A;  1MH3 A;  3VV5 A;  3FZV A;  4ESX A;  3IL1 B;  4HCY A;  2VHA A;  1PB8 A;  4JXI A;  1B3L A;  1P99 A;  3OMB A;  4GD5 A;  5JEI A;  3FV2 A;  3TTN A;  5CMB A;  1FQD A;  4GXA A;  4G8N A;  4FAT A;  4ELR A;  2PT2 A;  5F7V A;  2Z8F A;  2NXO A;  3FGS A;  3TEL A;  3N94 A;  1EZP A;  4ONY A;  2Z22 A;  3PUY E;  2A5T B;  2KLF A;  3PMW A;  2R9J A;  3LSX A;  1H3D A;  3PPR A;  4YMA A;  4Z7E A;  3UIF A;  4X48 A;  4GWO A;  4DXB A;  5IAI A;  3FAS A;  2NVU B;  5DVJ A;  1LFG A;  4QRZ A;  1XC1 A;  5H8F A;  4KYS A;  4DXU A;  1B52 A;  1A54 A;  4U22 A;  3SDF A;  4BDQ A;  3O97 A;  4K3F A;  2H98 A;  1T0K A;  3FUZ A;  3K6W A;  2XX9 A;  4MBP A;  1XVY A;  1OVT A;  1SYH A;  4X1B A;  3MAM A;  3VXB A;  1OQG A;  4OMB A;  3FVK A;  1B0L A;  3FXR A;  1US5 A;  4IGR A;  3L6H A;  2UVI A;  3LSL A;  3TZA A;  4YAH X;  3T93 B;  3HCQ A;  4R73 A;  1O63 A;  5TPA B;  1SW2 A;  1D9Y A;  3IX1 A;  3T9V A;  3DM0 A;  4IB2 A;  3G3G A;  3K6V A;  4OEU A;  4F19 A;  3M8U A;  1UIV A;  3KJT A;  5I59 B;  3TQL A;  1US4 A;  1XHY A;  4NF6 B;  1AOV A;  1ATG A;  5TU0 A;  4G8H A;  1FTK A;  1ZIU A;  3GBB A;  2X26 A;  5AA1 A;  2O7U A;  3TTK A;  3ONM A;  3RT8 A;  1N0T A;  5B70 A;  1UQW A;  2YJP A;  4NF8 B;  3ZS6 A;  1PB7 A;  3HPI A;  1S50 A;  3PU5 A;  1AH5 A;  3MVX A;  3O2A A;  3SKP A;  5I84 A;  4P0I A;  4UAC A;  1D9V A;  2D21 A;  1QVS A;  2REJ A;  4ZDM A;  3KN8 A;  3TUS A;  2XXV A;  1R9L A;  1LLS A;  1GVC A;  5KCJ B;  3BKI B;  1FQC A;  3A3U A;  5BUU A;  5CBR A;  3SEU A;  4F3G A;  2GHB A;  5I2N A;  3EN3 A;  1B5I A;  5ITO A;  2Q89 A;  4F1Y A;  2F36 A;  1H76 A;  1Y9U A;  4ELP A;  3G7W A;  4PFU A;  5M2V A;  1P1Q A;  2DXR A;  1VR5 A;  1YPN A;  4Q5T A;  1FCK A;  3TYH A;  2Q2A A;  3TCG A;  4WXJ A;  4KD5 A;  1A7L A;  2D3I A;  2DE3 A;  1XT8 A;  1DOT A;  4EF2 A;  5I58 A;  2F35 A;  3E13 X;  1D3K A;  3IK6 B;  3ZKK A;  4O3B A;  2DOJ A;  5CRY A;  4IO4 A;  1MG1 A;  1DSN A;  4U2R A;  1H43 A;  2O69 A;  3SEW A;  1LBC A;  1MQD A;  3DP8 A;  1Y1M A;  3WAF A;  5L9O A;  4QFL A;  3B7D A;  4IO7 A;  3IOV A;  2ZNT A;  1II5 A;  3BFT A;  2XXI A;  3OO8 A;  3MZ1 A;  3CI8 A;  3V83 A;  2XXR A;  2ZYO A;  1R1N A;  1MQJ A;  2HAU A;  2G29 A;  4RK2 A;  1FW0 A;  2OK2 A;  2BJJ X;  3KG2 A;  3CG3 A;  5AA3 A;  4MLQ A;  4F22 A;  4RXL A;  3EF7 A;  1I6A A;  3FJ7 A;  2DWA A;  4C1T A;  1Y3N A;  2DWJ A;  2V3Q A;  3C9H A;  4H6D A;  1ZU0 A;  3IOU A;  5CC2 A;  1QJM A;  3RTW B;  2A5S A;  3KGC A;  3OEM A;  4RJZ A;  1MPB A;  4WEP A;  4X1D A;  2P2A A;  1FTO A;  4OER A;  3UN6 A;  4ISU A;  4FED A;  3H7M A;  3PV0 E;  1MXU A;  1S7Y A;  3FXQ A;  4Q0C A;  3TOD A;  1SBP A;  4JWO A;  1SW5 A;  1M5B A;  5CBS A;  1ZJL A;  4NF4 A;  3SES A;  1DPP A;  2GRV A;  3KSX A;  3H03 A;  5J1D A;  4RY1 A;  2CMO A;  1SD3 A;  2QMX A;  3C32 A;  3H6V A;  1MQH A;  1F9B A;  2F34 A;  3S9L C;  3E9X A;  4I9D A;  1B7U A;  2XX7 A;  3IOR A;  4NWC A;  3Q26 A;  4H67 A;  4OFJ A;  3W9W A;  3O28 A;  1MM7 A;  2G93 A;  3CR9 A;  2V93 A;  4KR5 A;  2PMS A;  1B6H A;  4IO3 A;  4R6Y A;  5I57 B;  5ISU A;  4LZ5 A;  2DVZ A;  3HST A;  3FAT A;  2B65 A;  2F8D A;  4G2Z A;  4KYD A;  4JSO A;  4LZ7 A;  4ND9 A;  3N6T A;  3IB2 A;  4U23 A;  2WKY A;  3L6G A;  3O66 A;  3U72 A;  4N6P A;  4GQO A;  3OOA A;  5L9M A;  3QUJ A;  1AL3 A;  1SYI A;  3EHU A;  1NKX A;  1O64 A;  4EUO A;  1QKA A;  5ICQ A;  2XXP A;  3IJO B;  3MUQ A;  1FQB A;  4F2O A;  3MVY A;  1LFI A;  4PET A;  3FVN A;  5EHS A;  2H4I A;  2QJE A;  2XX8 A;  2ZNU A;  4DLD A;  1NH8 A;  4POW A;  2RC7 A;  5AE4 A;  2RC9 A;  2AIX A;  2UYF A;  2V3T A;  2YPN A;  4MH5 A;  4U1Z A;  4HCW A;  2H99 A;  4WED A;  1JW4 A;  3OD7 A;  5JTY A;  1B32 A;  1URS A;  4KFQ A;  4Q30 B;  1TWY A;  3G3F A;  2XXW A;  4QFK A;  5ELV A;  1GTK A;  3FV1 A;  3HO7 A;  5I56 B;  4U21 A;  4EXK A;  1NH7 A;  5I2K B;  5FHN A;  2ANJ A;  2I4B A;  1R9Q A;  3DLN A;  2Y7I A;  3RN8 A;  1LBB A;  1AMF A;  3E3K A;  3P7I A;  1HSE A;  1VFE A;  1PB9 A;  4YKK A;  3KEI A;  2QPQ A;  3G3J A;  1YTV A;  4ZEB A;  5L8D A;  2H9B A;  4EF1 A;  1JVX A;  4PFW A;  1ZTY A;  3KN7 A;  3QAX A;  1B4H A;  4OZ9 A;  4ZE8 A;  2XXY A;  4QFO A;  3C4M A;  5AA2 A;  1PBP A;  1QUJ A;  4PE5 B;  5KDT A;  3W15 C;  3K6X A;  1WVJ A;  4IO2 A;  2VD3 A;  1B1H A;  1DTG A;  5L9S A;  1B2H A;  4R9G A;  5JK4 A;  4ZZA A;  2NOO A;  2THI A;  3SEY A;  4UA8 A;  2QS4 A;  1IEJ A;  1P1N A;  2I3V A;  3PPN A;  3C33 A;  3U94 A;  2HAV A;  4QSD A;  3IB1 A;  3FJM A;  3SEX A;  4ECF A;  3I5O A;  1RKM A;  3ZSF A;  4EDP A;  3HV1 A;  3S4U A;  2X7Q A;  2RIN A;  3EPE A;  1FQF A;  2VGQ A;  2O1M A;  4FIM A;  3VLV A;  5HBC A;  4THI A;  2DVC A;  2F78 A;  3S9N C;  3D4G A;  3LBS A;  2I0B A;  4OTE A;  4OEV A;  3EHS A;  2UYE A;  4OWD A;  4YB5 A;  3CFX A;  4FE8 A;  2P1S A;  3K02 A;  4OYV A;  3I6V A;  4FEC A;  1B46 A;  2ONK E;  1I6Q A;  1XS5 A;  1VSO A;  2AL4 A;  3TQW A;  3T9X B;  3E4R A;  3OSR A;  3TCF A;  4QHQ A;  3SER A;  1LAX A;  3PUV E;  1DPE A;  1J1N A;  1MY1 A;  4FAJ A;  4XIG Q;  4PFT A;  4YIC A;  3VVD A;  1IZ1 A;  3ODB A;  3OO7 A;  1JW5 A;  4DE8 A;  1NFT A;  1Q1K A;  3LSW A;  3G3K A;  2QS1 A;  1B3E A;  1MXW A;  4KYE A;  3W9V A;  1O7T A;  2UVJ A;  3OO6 A;  1NNK A;  3IR1 A;  2NUV A;  3OXN A;  4JBZ A;  4KI0 E;  4O3A A;  1QUK A;  2LAO A;  5K2Y A;  3MW0 A;  4RK9 A;  3PPQ A;  3IAZ A;  3CFL A;  3LR1 A;  2F5X A;  1Z7N E;  4H1X A;  4JDF A;  3U8Q A;  5DEX A;  2F6G A;  1L5T A;  1MH4 A;  3K1N A;  3RQT A;  1R6Z A;  4H5F A;  4DCY A;  1LST A;  4AQ4 A;  1A40 A;  2HZL A;  3LSF B;  4P0G A;  3KFM A;  3M3K A;  1B7H A;  5H8N A;  1QW0 A;  4YU0 A;  3TKD A;  1Y4T A;  1B5J A;  4IGT A;  1Y20 A;  1P1O A;  3CVG A;  2V84 A;  1Y3Q A;  2Q2C A;  5ITP A;  4YKI A;  2RKM A;  4G68 A;  3VLW A;  3AXF A;  3OO9 A;  3PUX E;  5H8F B;  2IEE A;  3DP6 A;  1TT1 A;  1TXF A;  3PMX A;  1IXI A;  4DIG A;  4GVO A;  3THI A;  1MPC A;  3FXU A;  1NL5 A;  1MPD A;  3BFU A;  2HCA A;  4L17 A;  4DXC A;  5K2X A;  4ZZE A;  3RTF B;  1NNT A;  4G77 A;  4AB5 A;  1QKB A;  4YMB A;  3PPO A;  4KCD A;  1MXV A;  1EU8 A;  1KWH A;  3K01 A;  3CFZ A;  2OZZ A;  2PYY A;  2XD3 A;  4JWY A;  4KCC A;  1FQA A;  5EYF A;  3CG1 A;  3T66 A;  4OEN A;  3U93 A;  5EHM A;  1B9J A;  4ZS9 A;  3GXA A;  4WKM A;  5FTI A;  1IIW A;  3FJG A;  3CRB A;  3D4C A;  3V89 B;  2OCU A;  4H5G A;  1MXX A;  3KJ7 A;  3DP4 A;  3QUF A;  4IO5 A;  4ZEI A;  4JB7 A;  1LAF E;  2DP8 A;  2XD2 A;  5LOM A;  4OFO A;  1OVB A;  1BIY A;  3KBR A;  3K1P A;  3C31 A;  1S9T A;  1HSL A;  1YAE A;  1UTH A;  5H8N B;  1BP5 A;  5AA4 A;  2ESN A;  4H8J A;  3VLU A;  4GL0 A;  3VE1 B;  3IB0 A;  1ZMG A;  1USY E;  3OEK A;  3Q25 A;  2RCA A;  3KZG A;  1IXH A;  5I2N B;  1JET A;  4G68 B;  3TPA A;  3U92 A;  4PQJ A;  3OSQ A;  3PUZ E;  4NTL A;  3R26 A;  2O7I A;  3PMV A;  5H8Q A;  1FTM A;  1M5D A;  1MDP 1;  4H0W A;  2I48 A;  3LC8 A;  2QS2 A;  4LQ2 A;  4R75 A;  1H45 A;  3H3G A;  3S9M C;  2PX1 A;  5I58 B;  2RC8 A;  1P1U A;  3TDJ A;  5H8H A;  3JYR A;  2DSF A;  3O29 A;  4ZEC A;  1MXY A;  2OJT A;  5CM6 A;  1MY3 A;  2YLN A;  3QXM A;  2OLB A;  4P11 A;  4QF9 A;  1LGB C;  2F7B A;  4F18 A;  5IKB A;  3HHG A;  3QK6 A;  1I6B A;  4DCX A;  3PUW E;  4LZ8 A;  1MDQ A;  4X9T A;  3IOW A;  1MRP A;  2Q9T A;  2DQV A;  5DYH A;  3JV9 A;  3PD9 A;  1UTB A;  4GF8 A;  3H06 B;  2XXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...