2I0MA

Crystal structure of the phosphate transport system regulatory protein phou from streptococcus pneumoniae
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
212
structure length
207
Chain Sequence
b'QFDLELHELEQSFLGLGQLVLETASKALLALASKDKEMAELIINKDHAINQGQSAIELTCARLLALPQVSDLRFVISIMSSCSDLERMGDHMAGIAKAVLQLKENQLAEEQLHQMGKLSLSMLADLLVAFPLHQASKAISIAQKDEQIDQYYYALSKEIIGLMKDQESIPNGTQYLYIIGHLERFADYIANICERLVYLETGELVDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate transport system protein phoU
publication title Crystal structure of the phosphate transport system regulatory protein PhoU from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 88
structure length 207
sequence length 212
ec nomenclature
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2i0mA01
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2i0mA02
1XWMA 3L39A 2BKPA 2BKOA 1T72A 1T8BA 2OLTA 2IIUA 4Q25A 1SUMB 2I0MA 1VCTA 2BKNA
chains in the Genus database with same CATH superfamily
3AAEB 4TZ4C 3ZN0B 2N1GA 2W61A 3C64A 1VOMA 5FL0A 1X9BA 3AECA 4NPPA 2XTLA 2BDEA 2HH7A 5FY0A 2WP9A 4IDNA 4JBWF 4UVBB 3NZPA 1OEDA 5FVKA 2E9XB 4YHHT 2VQFT 5LYJE 3ZPOA 3RYIE 2L3LA 2MAWA 3AA6B 3KDSE 1MNDA 2JQQA 3CMLA 5HEUA 5AQVB 3O1HA 2DWKA 3TKLB 3FXEB 4LMJA 1MMAA 4DV0T 2XQ4A 2CPTA 2YKSA 1NEKA 1W0BA 1OEDE 4OHFA 4TX5A 1E2AA 1U5PA 5LNKA 2YU1A 4X1KE 2LLYA 3ZMVB 2AE9A 2YINA 4HKAA 2QYWA 2UUBT 4UV9B 3I0OA 3ZMTB 3IHRA 2Y6XA 3P4QA 3BQKA 3R84B 5LOVE 5KX5E 3AAIA 2W4XA 4AXPA 3B5MA 2KINB 2NW7A 3H3MA 1KF6A 2CXFA 4O4LE 3RQWA 1WYBA 2V7LA 4PJJA 3PUXF 5AQIB 2V5CA 1ZOYA 3T1HT 2LKHA 4YJ3E 3C4ZA 2V26A 1OEDB 1KNZA 4G63A 5JDGA 3CIRA 3N9OA 3N2KE 1XNRT 2XUEA 1KEYA 4KI0F 2LSGA 2Q9QD 3ZSSA 3C98B 1V9DA 1HX1B 4K0UA 4IE4A 3S4UA 4UF0A 3GMIA 4ILBA 2PG8A 2H7OA 3VHLA 4ISSA 2PJQA 4ANJA 4EYUA 4CXWA 4ZOLE 1OEDC 4EOZB 3Q9DA 4AKIA 3RYFE 4H9RC 1D0YA 3ONJA 5L4EA 2C0SA 2CLYB 2IIUA 1WYCA 3AE6A 4JI1T 4DMWA 3JADA 3AVSA 4GOUA 4XZCA 2W67A 1Z0PA 3SFDA 2BBHA 1Y64B 5FXXA 2E5VA 3QK6A 4YTMA 4CQIA 4Z91A 5FY7A 3ESLA 5HXRA 4N78D 1VRBA 5LHIB 2CBJA 3M65A 3RQUA 4YSZA 4ZI3D 5IYZE 3AEGA 3UFGA 5AQGB 2LSYA 2YEVC 4DV7T 4AKRB 3ZMUB 4UVCB 5LB7B 2LEHA 4EAHA 3UTKA 4ZI2C 4QWNB 3PUAA 1MIVA 5AQRB 2DHRA 5JQGE 3H37A 4L5GA 2F4VT 1N33T 3B13A 3PURA 3ZMZB 5JR9A 4QX7B 4UF0B 4BAYB 4X66T 1L0VA 3QNUA 4H9OC 4UEMA 1NENA 5C3JA 2N9DA 2CM0A 4DV4T 3LDQB 4P0BA 4EYYR 1HS7A 4DBRA 4PFOA 3F2EA 3AE5A 3RH3A 4ILCA 2K3WA 3RRCA 4DIDB 5IHYA 3ZMSB 4DNDA 4I50E 2VL0A 4U2YA 1SUMB 3UUXB 4AQYT 2BG9B 4O2AE 3PU8A 4EXTA 3RX6A 4YLHA 2WDRA 3KVAA 5FNVE 1WR6A 2JMKA 2RPAA 4JEUB 2LOSA 3KBUA 4GKJT 3OBVE 2W00A 2XQAA 4C91A 4QXBB 2FJAA 3UQ7A 3UU8A 5LG4A 4J2CA 4AKLA 1T72A 5EK2A 2MPKA 5BR8T 3RRWA 2XQYA 4PNIA 3OYZA 2KWHA 1ZHCA 2OLTA 3UU5A 4O4IE 3TLTA 2IDOB 4X62T 3KV6A 3A7MA 5CFBA 2BBJA 5JR9B 5FXVA 4YJ2E 3SS1A 4H63H 2D0TA 4CZZB 4JLEA 3K1SA 2XHEB 2JJ9A 2CCQA 3AEFA 4DUYT 1E7PA 2VKJA 4HWHA 1LVFA 4LF4T 2NW9A 5CB4E 2WAUA 5AFUL 3ZC0A 4BA9A 4OYKA 4MFRA 4IT4A 3LJCA 2GK9A 4Q25A 5JR9C 3KBTA 4IE5A 4B3ST 4DR4T 1D1BA 3FZLB 4JV5T 1YQ3A 5L3DB 3FXDB 1BR0A 4GYSA 2NR4A 2X51A 1NWMX 3IF8B 1HG5A 3E22E 2JIWA 4DR7T 3FHNA 1M62A 2C5IT 3UULA 2M67A 4IREA 3ZJ2A 2WB5A 3EHZA 1N32T 3NRXA 2UXNB 1AJ3A 1HG2A 5HWXA 3WI3A 4EV6A 5LBQB 2JQ9A 1HFAA 1IBLT 5KMGP 4JI7T 3UU6A 3A5XA 4TV9E 2KWIB 3VKGA 2K5BB 3I1AA 4U74A 3N5LA 1ZKEA 2EHOD 2YOEA 3ZT7A 2E9XA 2X9XA 3C51A 2FBWA 1I94T 2BS3A 2Q9QA 4HN9A 4HWCA 2H88A 2E8IA 4KX6A 4OX9T 4YHJA 3EAMA 2V7KA 3VKHA 4NUUA 3CKDA 2XSBA 3FZFB 3UU4A 4ZZCA 2YK0A 1YKHB 4TNVA 2A9UA 3VRBA 2W66A 5H6RB 1WFDA 4JUYA 4JI8T 5HWYA 3JC6D 5J0ZA 3KV5A 2CRBA 2D2SA 4X64T 3ZCIA 2DNXA 4QX8B 1US7B 1ZP0A 2VVNA 3CQXC 2A3DA 2IC9A 1MMGA 4F6RC 3GWHA 3MACA 5L2LA 5IUXA 5ADXL 3ANWA 3RIFA 3UU3A 5JRCA 3ETUA 1IAPA 2PBIA 3JAFA 4ADZA 1D0ZA 4DR3T 2YDSA 3BQLA 2UU9T 2WZHA 4GK5E 3NWIA 4GKKT 1OWAA 4O2BE 5LP6E 5AQLB 2XQ3A 2LM2A 1FIOA 5IWAT 2BKOA 4U7YA 5LMNT 2Q9QB 2DCFA 5L3EB 1IZNB 4H63V 3AE8A 4HFDA 5L47A 5AQPB 2A72A 3HL6A 5DQVA 2NWBA 3SWHA 2VKOA 2QRXA 4X1YE 4A98A 4NUVA 4LFCT 1B7TA 4PAGA 5E0OA 1SHZC 1NAFA 2CWOA 3LK2B 5AQQB 4ZEYA 2E9XC 2CA5A 5JDMA 2VKDA 1IBKT 3ONXA 2KT9A 2Q9QC 3RKOA 5KXJA 3ZT6A 4TWDA 3EDVA 4JI0T 3H3AA 5JTGA 2WBLA 1J5WA 4U3CA 3E08A 4B3TT 2WDVA 3ANWB 2XPKA 2B1EA 3HKDE 2NW8A 5JRCB 3L09A 2BVLA 4UR9A 3KVBA 4LF8T 2VL8A 4L0RA 1HNXT 3AA1B 4O4JE 4LF5T 4I0UA 2B76A 5JREA 1SE7A 2ZLYA 4U7IA 1WR0A 4EZHA 4PK6A 5LJNA 3EI0A 2E5LT 3PJAJ 2VASA 4LFBT 5L3FB 2VKHA 3QOFA 3N9NA 4MHCA 2WY2A 2X0HA 3NKZA 1VCTA 4YT0A 2WM9A 2CXLA 4WYVA 3ZYLA 2CEAA 5JDLA 2VK9A 3L3PA 3FB2A 3JAEA 3NRYA 2JQKA 5AQJB 5AQMB 2MBGA 5BMVE 3CPZA 3RHWA 5JDNA 4GIWA 5A1LA 4PJMA 3C4WA 4U72A 4K0KT 3BQIA 3ZLIA 2C5KT 3F57A 3CQGB 2ZM2A 1G8XA 3VR8A 5FVLA 4KHZF 3HR0A 2YN6A 3DTOA 2W62A 2X67A 5FKYA 4PJNA 1S35A 3AE9A 3LG7A 5LXTE 2WU2A 3N9LA 2BG9A 3F31A 5J1GA 1N34T 1D1AA 3RLFF 2LE8A 4DV1T 1LVKA 2QVAA 2X9HA 5HEOA 2CLYC 4QH1A 1XMQT 5ABGA 2X66A 4H9PC 4AQGA 4KUMB 3ONLC 4JYAT 3C4XA 4TWFA 3KV9A 4HEAA 3CVRA 2X0YA 3J7Yq 2ES0A 3O4XE 1HR0T 3AA0B 4UXNB 3LBXB 4A5XA 2LOPA 5FYMA 3OKQA 4AIUA 4ZI7E 4M1PA 2BG9E 5EK3A 1W9RA 2EHOA 2XAHB 4QH5A 2JMHA 3X1DA 2CHOA 2V7JA 3ZT5A 5DABA 3PUYF 1X79A 2RA1A 3SFEA 2VB6A 1SA0E 4IGUA 4IDOA 4L9IA 3V5SA 3TLUA 4CI1B 3NVOA 3RGLA 4WBNE 3AEDA 3O1JA 2FUPA 1LKXA 4KBMB 3QB5K 4NXNT 1UK5A 2CBIA 1FMWA 4TUYE 1W0AA 4HFVA 4DR6T 4CXYA 1CHUA 3AE7A 4FI5A 5HXHA 1Z8UA 5JDFA 4ZI2D 5ABEA 4DR5T 4WW0A 4G2AA 1N36T 2J62A 1UX5A 3HA4A 3TLWA 3N9MA 5HXCA 3WAJA 3W15B 4ZS3A 3AB3B 3CK6A 2H89A 2XQ5A 5EZYE 4TN7B 4HFCA 3DJBA 4X5TA 1YW0A 2CXDA 3I0QA 1T98A 3K8PC 2BG9C 3OYXA 4HTEA 2DWGA 4ILAA 2K24A 2JQHA 3EABA 1JNZA 3FBLA 5J2UE 2HPJA 2IHR1 2EHOB 4DV2T 5HEGA 5FL1A 4AI6A 2LSKA 1T8BA 2OV9A 4WBOA 4GK0E 5FMNA 3O9XA 2W0GA 5GONE 1D0XA 3OPCA 3VR9A 5ETWA 4PW8A 2K9AA 2V6YB 2BZBA 2NTYA 2XAJB 2XQ8A 2LJLA 4MBQA 3P7IA 4GYRA 3HKEE 5AQTB 2EHOC 2KSRA 1BR4A 5AQSB 3Q2MA 2FJDA 4AISA 2DI4A 2LHRA 1FEWA 5DQWA 4ZHQE 3AAAB 2H3RA 5CA1E 4IE0A 4FJOA 3QC9A 3UUNA 2IMLA 5L3CB 2A2FX 2NP9A 5LHHB 2UUAT 1HF8A 3P8CD 2M6BA 4IHJE 3ZCJA 5L4HA 3JC6C 2WWUA 2KNDA 4A56A 5CJ5A 3TLVA 4LF6T 2D5UA 1YQ4A 4ZS2A 4KP3C 2ZMAA 3N9PA 3AVRA 2KXPB 1MMNA 2JPFA 3KV4A 2ODUA 4P0AA 3SOLA 4I4TE 2YDRA 4EEBA 2WQYA 3AXJB 4ILUA 3TLSA 1YD8G 1HTJF 1IJ6A 2XY8B 4PK4A 5FY1A 4PK5A 3L8RA 3EUHA 1WCRA 5LGUB 2NTXA 4O8SA 2BVMA 2LRKA 5HXSA 1UGOA 2WSSV 3G06A 2UXXB 3AA7B 3RIAA 5AQKB 2PTFA 4EIWA 2UXBT 3ZSTA 2LKGA 3M3ZB 2D9DA 5HCMA 3K3QC 2VURA 3ZJ1A 4I55E 2IUBA 4JI4T 2LT3A 3P4WA 4DVDA 3RF1A 2HHHT 2VVSA 3L39A 1XDPA 3ZYMA 2L8KA 3PUWF 4IE6A 2P9BA 2DLRA 5C2TA 5F8PA 1EZ3A 3E0ZA 3HKBE 4DUZT 4IL9A 4MLKA 5L3GB 2C5JA 4DMVA 5LCYA 5M4YA 3BK9A 5TAOA 3AE3A 3P4RA 3MZKB 3CQCB 2H7VC 1UX4A 2OA5A 2I6HA 2NOXA 1J1JA 4JI6T 4IL4A 2IAKA 4DBQA 5CGMA 1IJ5A 2CWYA 1J5ET 2MYSA 2LSJA 3AE4A 5LGNB 3O1IA 5JH7E 5DJQC 5ABHA 3RYHE 1QSDA 2V5DA 3MJXA 3ETVA 3N2OA 3D0TA 3RC3A 4YSXA 4UVAB 3K3NA 2JRKA 3U78A 3T8OA 4IDQA 5FP3A 4ASKA 5LBMA 2ZM0A 2HN1A 2YDQA 1MIWA 3AEEA 3VU7H 1UCUA 1E1HB 4JI2T 3Q5DA 3RYCE 5LJMA 1WRDA 2Z6EA 1KFYA 4CN1A 4LMKA 2XM1A 3AEBA 2XQ6A 4U33A 2V1DB 5AQOB 3HI2A 1HNWT 2WMOA 3RKGA 4H9QC 2ACXA 1BR1A 2BS2A 4COFA 2BKPA 4B3RT 4AKHA 3OJAA 3T1YT 3N9QA 3IBPA 3AEAA 2XJ7A 3AE1A 4YTPA 5HEJA 2LM9A 4ISTA 4Z8XA 5FXZA 1CUNA 4H9SE 4CN4A 3CWZB 3C50A 2J4GA 2QGSA 2V6XA 1XMOT 4OFZA 4NXMT 5L3BB 2SPCA 2Y48B 1LRZA 2IW5B 2WU5A 3IA3A 2XAGB 1YXRA 3ZKRA 2XZEA 2J47A 4EB6E 4EGWA 2MTQA 2E2AA 3LBXA 5KDMC 4ZI3C 1R8IA 2BS4A 5ABFA 3GN5A 4DV6T 2E9XD 3FZHB 4HFBA 4QXCB 2ACZA 4DO0A 1O3XA 3UUMA 3PUSA 4YY3T 3OVUA 1KK7A 3CX6B 1XZYA 1UUSA 2LRLA 1MNEA 4HGAA 2XAFB 2VQET 4KMCA 4Z90A 5HYAA 3I9YA 4PJLA 3CX7B 4OK0A 4HE8A 2V7MA 1QUUA 1MIYA 3RPUA 4JI3T 4KHPT 4QKNA 3PJAA 2V7IA 5JDQA 5HXEA 3PTRB 2UXCT 4XBFB 3SRZA 4P09A 3MXZA 4B3MT 5J2TE 1MMDA 4AQFA 4DV3T 2Y8DA 3RIUA 5AQHB 1HCIA 5F3JA 1UURA 4PFPA 3FZMB 3PE0A 2WS3A 5LMUT 3ABVA 2DL1A 3B57A 3UUBA 3JCFA 3MK7C 3AE2A 2CHNA 3HKCE 1VCSA 4YXDA 3GA8A 2XASB 1GQEA 5ABFB 3GN5B 3OTOT 1HX8A 2LSIA 2X9WA 2I59A 4A97A 3P4PA 3UFEA 2W63A 4X20E 4DR1T 2XM2A 2V6YA 2KMFA 4CN6A 4CI3B 1XWMA 1I6ZA 2HPLA 3NZQA 2CE7A 1KNPA 2AXDS 4HWIB 1DU2A 1XDOA 1OXZA 4F8HA 1YKEB 1FMVA 3P50A 1KNRA 4V1Av 4OYJA 3RC8A 4MALA 3CX8B 4IDPA 3MA9A 1M7KA 3LK42 2MOZA 5EK4A 4HFIA 2R6GF 3A8YC 4U2ZA 2LHNA 2WCAA 3I9WA 3FBZA 1HNZT 4YFSA 2K48A 3PV0F 5AQUB 2XQ9A 5AQFB 1IBMT 4JEHB 2X68A 4YSYA 1FJGT 3PUZF 5LA6E 4UELA 2BKNA 3PUGA 3KFWX 3MKDA 2KLQA 2KZ7B 3R6NA 4BJNA 2I0MA 3NBXX 4TNWA 3ZN1B 4IIJE 4AQFC 2XQ7A 3RIUC 3AXJA 1WLXA 2N2NA 4X65T 4HFEA 5HCJA 2G0UA 2WMNA 4XAXB 5FXWA 4EEDA 5F5WA 4E7SA 5C8YE 3QB5A 4LF7T 2L9QA 4EZ4A 2D0UA 4ZZBA 4LF9T 3V5UA 1BR2A 5HEHA 4DR2T 2WWVA 1JNRA 3PU3A 4I43B 4CI2B 3Q5WA 4O4HE 3UT5E 3LSVA 3DP7A 5LG3A 3N2GE 2ODVA 5LGTB 2ZM6T 3IEEA 3PDYA 4U31A 5CA0E 1W09A 4E7ZA 1D1CA 5LHGB 1U4QA 1ZV4X 2WZIA 4QXHB 2ZM8A 5JDHA 4CXXA 4TWHA 3U3IA 3VRAA 3EVYA 3LK3B 3UQ4A 2IC6A 4P1NA 5H6QB 1G73A 1ZEEA 2X9YA 2PFVA 3FZKB 3WAKA 2UXDT 2CMRA 2FJBA 4ERRA 4IE7A 3Q5XA 4WNKA 5AQNB 1Y01A 2X0LB 1T7SA 2WDQA 3PUVF 4IDZA 2YU2A 4QHOA 1H7CA 4AKGA 4ZXLA 4LFAT 2RP4A 4C90A 2VWAA 3LFMA 4TV8E 2FJEA 4JI5T 3ZC1A 4WZXA 2W2UA 3Q5EA 4H9NC 2XAQB 3PUQA 5JVDE 1S94A 3J9X1 5HAXA 4NIQA 2XSAA 3RI5A 4HWFA 3P4SA 3ZYKA 4UIGA 1QLBA 2HN2A 4HWDA 4QH4A 4B6XA 2J1DG 3QUJA 4LMLA 3ZEFB 4X1IE 4HFHA 2QA7A 2V8SV 3K3OA 4UV8B 4BJMA 2M6IA 3KINB 2UUCT 4DV5T 1XNQT 3EDUA 4YTNA
chains in the Genus database with same CATH topology
1XWMA 3L39A 2BKPA 2BKOA 1T72A 1T8BA 2OLTA 2IIUA 4Q25A 1SUMB 2I0MA 1VCTA 2BKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWM A;  3L39 A;  2BKP A;  2BKO A;  1T72 A;  1T8B A;  2OLT A;  2IIU A;  4Q25 A;  1SUM B;  2I0M A;  1VCT A;  2BKN A; 
#chains in the Genus database with same CATH topology
 3AAE B;  4TZ4 C;  3ZN0 B;  2N1G A;  2W61 A;  3C64 A;  1VOM A;  5FL0 A;  1X9B A;  3AEC A;  4NPP A;  2XTL A;  2BDE A;  2HH7 A;  5FY0 A;  2WP9 A;  4IDN A;  4JBW F;  4UVB B;  3NZP A;  1OED A;  5FVK A;  2E9X B;  4YHH T;  2VQF T;  5LYJ E;  3ZPO A;  3RYI E;  2L3L A;  2MAW A;  3AA6 B;  3KDS E;  1MND A;  2JQQ A;  3CML A;  5HEU A;  5AQV B;  3O1H A;  2DWK A;  3TKL B;  3FXE B;  4LMJ A;  1MMA A;  4DV0 T;  2XQ4 A;  2CPT A;  2YKS A;  1NEK A;  1W0B A;  1OED E;  4OHF A;  4TX5 A;  1E2A A;  1U5P A;  5LNK A;  2YU1 A;  4X1K E;  2LLY A;  3ZMV B;  2AE9 A;  2YIN A;  4HKA A;  2QYW A;  2UUB T;  4UV9 B;  3I0O A;  3ZMT B;  3IHR A;  2Y6X A;  3P4Q A;  3BQK A;  3R84 B;  5LOV E;  5KX5 E;  3AAI A;  2W4X A;  4AXP A;  3B5M A;  2KIN B;  2NW7 A;  3H3M A;  1KF6 A;  2CXF A;  4O4L E;  3RQW A;  1WYB A;  2V7L A;  4PJJ A;  3PUX F;  5AQI B;  2V5C A;  1ZOY A;  3T1H T;  2LKH A;  4YJ3 E;  3C4Z A;  2V26 A;  1OED B;  1KNZ A;  4G63 A;  5JDG A;  3CIR A;  3N9O A;  3N2K E;  1XNR T;  2XUE A;  1KEY A;  4KI0 F;  2LSG A;  2Q9Q D;  3ZSS A;  3C98 B;  1V9D A;  1HX1 B;  4K0U A;  4IE4 A;  3S4U A;  4UF0 A;  3GMI A;  4ILB A;  2PG8 A;  2H7O A;  3VHL A;  4ISS A;  2PJQ A;  4ANJ A;  4EYU A;  4CXW A;  4ZOL E;  1OED C;  4EOZ B;  3Q9D A;  4AKI A;  3RYF E;  4H9R C;  1D0Y A;  3ONJ A;  5L4E A;  2C0S A;  2CLY B;  2IIU A;  1WYC A;  3AE6 A;  4JI1 T;  4DMW A;  3JAD A;  3AVS A;  4GOU A;  4XZC A;  2W67 A;  1Z0P A;  3SFD A;  2BBH A;  1Y64 B;  5FXX A;  2E5V A;  3QK6 A;  4YTM A;  4CQI A;  4Z91 A;  5FY7 A;  3ESL A;  5HXR A;  4N78 D;  1VRB A;  5LHI B;  2CBJ A;  3M65 A;  3RQU A;  4YSZ A;  4ZI3 D;  5IYZ E;  3AEG A;  3UFG A;  5AQG B;  2LSY A;  2YEV C;  4DV7 T;  4AKR B;  3ZMU B;  4UVC B;  5LB7 B;  2LEH A;  4EAH A;  3UTK A;  4ZI2 C;  4QWN B;  3PUA A;  1MIV A;  5AQR B;  2DHR A;  5JQG E;  3H37 A;  4L5G A;  2F4V T;  1N33 T;  3B13 A;  3PUR A;  3ZMZ B;  5JR9 A;  4QX7 B;  4UF0 B;  4BAY B;  4X66 T;  1L0V A;  3QNU A;  4H9O C;  4UEM A;  1NEN A;  5C3J A;  2N9D A;  2CM0 A;  4DV4 T;  3LDQ B;  4P0B A;  4EYY R;  1HS7 A;  4DBR A;  4PFO A;  3F2E A;  3AE5 A;  3RH3 A;  4ILC A;  2K3W A;  3RRC A;  4DID B;  5IHY A;  3ZMS B;  4DND A;  4I50 E;  2VL0 A;  4U2Y A;  1SUM B;  3UUX B;  4AQY T;  2BG9 B;  4O2A E;  3PU8 A;  4EXT A;  3RX6 A;  4YLH A;  2WDR A;  3KVA A;  5FNV E;  1WR6 A;  2JMK A;  2RPA A;  4JEU B;  2LOS A;  3KBU A;  4GKJ T;  3OBV E;  2W00 A;  2XQA A;  4C91 A;  4QXB B;  2FJA A;  3UQ7 A;  3UU8 A;  5LG4 A;  4J2C A;  4AKL A;  1T72 A;  5EK2 A;  2MPK A;  5BR8 T;  3RRW A;  2XQY A;  4PNI A;  3OYZ A;  2KWH A;  1ZHC A;  2OLT A;  3UU5 A;  4O4I E;  3TLT A;  2IDO B;  4X62 T;  3KV6 A;  3A7M A;  5CFB A;  2BBJ A;  5JR9 B;  5FXV A;  4YJ2 E;  3SS1 A;  4H63 H;  2D0T A;  4CZZ B;  4JLE A;  3K1S A;  2XHE B;  2JJ9 A;  2CCQ A;  3AEF A;  4DUY T;  1E7P A;  2VKJ A;  4HWH A;  1LVF A;  4LF4 T;  2NW9 A;  5CB4 E;  2WAU A;  5AFU L;  3ZC0 A;  4BA9 A;  4OYK A;  4MFR A;  4IT4 A;  3LJC A;  2GK9 A;  4Q25 A;  5JR9 C;  3KBT A;  4IE5 A;  4B3S T;  4DR4 T;  1D1B A;  3FZL B;  4JV5 T;  1YQ3 A;  5L3D B;  3FXD B;  1BR0 A;  4GYS A;  2NR4 A;  2X51 A;  1NWM X;  3IF8 B;  1HG5 A;  3E22 E;  2JIW A;  4DR7 T;  3FHN A;  1M62 A;  2C5I T;  3UUL A;  2M67 A;  4IRE A;  3ZJ2 A;  2WB5 A;  3EHZ A;  1N32 T;  3NRX A;  2UXN B;  1AJ3 A;  1HG2 A;  5HWX A;  3WI3 A;  4EV6 A;  5LBQ B;  2JQ9 A;  1HFA A;  1IBL T;  5KMG P;  4JI7 T;  3UU6 A;  3A5X A;  4TV9 E;  2KWI B;  3VKG A;  2K5B B;  3I1A A;  4U74 A;  3N5L A;  1ZKE A;  2EHO D;  2YOE A;  3ZT7 A;  2E9X A;  2X9X A;  3C51 A;  2FBW A;  1I94 T;  2BS3 A;  2Q9Q A;  4HN9 A;  4HWC A;  2H88 A;  2E8I A;  4KX6 A;  4OX9 T;  4YHJ A;  3EAM A;  2V7K A;  3VKH A;  4NUU A;  3CKD A;  2XSB A;  3FZF B;  3UU4 A;  4ZZC A;  2YK0 A;  1YKH B;  4TNV A;  2A9U A;  3VRB A;  2W66 A;  5H6R B;  1WFD A;  4JUY A;  4JI8 T;  5HWY A;  3JC6 D;  5J0Z A;  3KV5 A;  2CRB A;  2D2S A;  4X64 T;  3ZCI A;  2DNX A;  4QX8 B;  1US7 B;  1ZP0 A;  2VVN A;  3CQX C;  2A3D A;  2IC9 A;  1MMG A;  4F6R C;  3GWH A;  3MAC A;  5L2L A;  5IUX A;  5ADX L;  3ANW A;  3RIF A;  3UU3 A;  5JRC A;  3ETU A;  1IAP A;  2PBI A;  3JAF A;  4ADZ A;  1D0Z A;  4DR3 T;  2YDS A;  3BQL A;  2UU9 T;  2WZH A;  4GK5 E;  3NWI A;  4GKK T;  1OWA A;  4O2B E;  5LP6 E;  5AQL B;  2XQ3 A;  2LM2 A;  1FIO A;  5IWA T;  2BKO A;  4U7Y A;  5LMN T;  2Q9Q B;  2DCF A;  5L3E B;  1IZN B;  4H63 V;  3AE8 A;  4HFD A;  5L47 A;  5AQP B;  2A72 A;  3HL6 A;  5DQV A;  2NWB A;  3SWH A;  2VKO A;  2QRX A;  4X1Y E;  4A98 A;  4NUV A;  4LFC T;  1B7T A;  4PAG A;  5E0O A;  1SHZ C;  1NAF A;  2CWO A;  3LK2 B;  5AQQ B;  4ZEY A;  2E9X C;  2CA5 A;  5JDM A;  2VKD A;  1IBK T;  3ONX A;  2KT9 A;  2Q9Q C;  3RKO A;  5KXJ A;  3ZT6 A;  4TWD A;  3EDV A;  4JI0 T;  3H3A A;  5JTG A;  2WBL A;  1J5W A;  4U3C A;  3E08 A;  4B3T T;  2WDV A;  3ANW B;  2XPK A;  2B1E A;  3HKD E;  2NW8 A;  5JRC B;  3L09 A;  2BVL A;  4UR9 A;  3KVB A;  4LF8 T;  2VL8 A;  4L0R A;  1HNX T;  3AA1 B;  4O4J E;  4LF5 T;  4I0U A;  2B76 A;  5JRE A;  1SE7 A;  2ZLY A;  4U7I A;  1WR0 A;  4EZH A;  4PK6 A;  5LJN A;  3EI0 A;  2E5L T;  3PJA J;  2VAS A;  4LFB T;  5L3F B;  2VKH A;  3QOF A;  3N9N A;  4MHC A;  2WY2 A;  2X0H A;  3NKZ A;  1VCT A;  4YT0 A;  2WM9 A;  2CXL A;  4WYV A;  3ZYL A;  2CEA A;  5JDL A;  2VK9 A;  3L3P A;  3FB2 A;  3JAE A;  3NRY A;  2JQK A;  5AQJ B;  5AQM B;  2MBG A;  5BMV E;  3CPZ A;  3RHW A;  5JDN A;  4GIW A;  5A1L A;  4PJM A;  3C4W A;  4U72 A;  4K0K T;  3BQI A;  3ZLI A;  2C5K T;  3F57 A;  3CQG B;  2ZM2 A;  1G8X A;  3VR8 A;  5FVL A;  4KHZ F;  3HR0 A;  2YN6 A;  3DTO A;  2W62 A;  2X67 A;  5FKY A;  4PJN A;  1S35 A;  3AE9 A;  3LG7 A;  5LXT E;  2WU2 A;  3N9L A;  2BG9 A;  3F31 A;  5J1G A;  1N34 T;  1D1A A;  3RLF F;  2LE8 A;  4DV1 T;  1LVK A;  2QVA A;  2X9H A;  5HEO A;  2CLY C;  4QH1 A;  1XMQ T;  5ABG A;  2X66 A;  4H9P C;  4AQG A;  4KUM B;  3ONL C;  4JYA T;  3C4X A;  4TWF A;  3KV9 A;  4HEA A;  3CVR A;  2X0Y A;  3J7Y q;  2ES0 A;  3O4X E;  1HR0 T;  3AA0 B;  4UXN B;  3LBX B;  4A5X A;  2LOP A;  5FYM A;  3OKQ A;  4AIU A;  4ZI7 E;  4M1P A;  2BG9 E;  5EK3 A;  1W9R A;  2EHO A;  2XAH B;  4QH5 A;  2JMH A;  3X1D A;  2CHO A;  2V7J A;  3ZT5 A;  5DAB A;  3PUY F;  1X79 A;  2RA1 A;  3SFE A;  2VB6 A;  1SA0 E;  4IGU A;  4IDO A;  4L9I A;  3V5S A;  3TLU A;  4CI1 B;  3NVO A;  3RGL A;  4WBN E;  3AED A;  3O1J A;  2FUP A;  1LKX A;  4KBM B;  3QB5 K;  4NXN T;  1UK5 A;  2CBI A;  1FMW A;  4TUY E;  1W0A A;  4HFV A;  4DR6 T;  4CXY A;  1CHU A;  3AE7 A;  4FI5 A;  5HXH A;  1Z8U A;  5JDF A;  4ZI2 D;  5ABE A;  4DR5 T;  4WW0 A;  4G2A A;  1N36 T;  2J62 A;  1UX5 A;  3HA4 A;  3TLW A;  3N9M A;  5HXC A;  3WAJ A;  3W15 B;  4ZS3 A;  3AB3 B;  3CK6 A;  2H89 A;  2XQ5 A;  5EZY E;  4TN7 B;  4HFC A;  3DJB A;  4X5T A;  1YW0 A;  2CXD A;  3I0Q A;  1T98 A;  3K8P C;  2BG9 C;  3OYX A;  4HTE A;  2DWG A;  4ILA A;  2K24 A;  2JQH A;  3EAB A;  1JNZ A;  3FBL A;  5J2U E;  2HPJ A;  2IHR 1;  2EHO B;  4DV2 T;  5HEG A;  5FL1 A;  4AI6 A;  2LSK A;  1T8B A;  2OV9 A;  4WBO A;  4GK0 E;  5FMN A;  3O9X A;  2W0G A;  5GON E;  1D0X A;  3OPC A;  3VR9 A;  5ETW A;  4PW8 A;  2K9A A;  2V6Y B;  2BZB A;  2NTY A;  2XAJ B;  2XQ8 A;  2LJL A;  4MBQ A;  3P7I A;  4GYR A;  3HKE E;  5AQT B;  2EHO C;  2KSR A;  1BR4 A;  5AQS B;  3Q2M A;  2FJD A;  4AIS A;  2DI4 A;  2LHR A;  1FEW A;  5DQW A;  4ZHQ E;  3AAA B;  2H3R A;  5CA1 E;  4IE0 A;  4FJO A;  3QC9 A;  3UUN A;  2IML A;  5L3C B;  2A2F X;  2NP9 A;  5LHH B;  2UUA T;  1HF8 A;  3P8C D;  2M6B A;  4IHJ E;  3ZCJ A;  5L4H A;  3JC6 C;  2WWU A;  2KND A;  4A56 A;  5CJ5 A;  3TLV A;  4LF6 T;  2D5U A;  1YQ4 A;  4ZS2 A;  4KP3 C;  2ZMA A;  3N9P A;  3AVR A;  2KXP B;  1MMN A;  2JPF A;  3KV4 A;  2ODU A;  4P0A A;  3SOL A;  4I4T E;  2YDR A;  4EEB A;  2WQY A;  3AXJ B;  4ILU A;  3TLS A;  1YD8 G;  1HTJ F;  1IJ6 A;  2XY8 B;  4PK4 A;  5FY1 A;  4PK5 A;  3L8R A;  3EUH A;  1WCR A;  5LGU B;  2NTX A;  4O8S A;  2BVM A;  2LRK A;  5HXS A;  1UGO A;  2WSS V;  3G06 A;  2UXX B;  3AA7 B;  3RIA A;  5AQK B;  2PTF A;  4EIW A;  2UXB T;  3ZST A;  2LKG A;  3M3Z B;  2D9D A;  5HCM A;  3K3Q C;  2VUR A;  3ZJ1 A;  4I55 E;  2IUB A;  4JI4 T;  2LT3 A;  3P4W A;  4DVD A;  3RF1 A;  2HHH T;  2VVS A;  3L39 A;  1XDP A;  3ZYM A;  2L8K A;  3PUW F;  4IE6 A;  2P9B A;  2DLR A;  5C2T A;  5F8P A;  1EZ3 A;  3E0Z A;  3HKB E;  4DUZ T;  4IL9 A;  4MLK A;  5L3G B;  2C5J A;  4DMV A;  5LCY A;  5M4Y A;  3BK9 A;  5TAO A;  3AE3 A;  3P4R A;  3MZK B;  3CQC B;  2H7V C;  1UX4 A;  2OA5 A;  2I6H A;  2NOX A;  1J1J A;  4JI6 T;  4IL4 A;  2IAK A;  4DBQ A;  5CGM A;  1IJ5 A;  2CWY A;  1J5E T;  2MYS A;  2LSJ A;  3AE4 A;  5LGN B;  3O1I A;  5JH7 E;  5DJQ C;  5ABH A;  3RYH E;  1QSD A;  2V5D A;  3MJX A;  3ETV A;  3N2O A;  3D0T A;  3RC3 A;  4YSX A;  4UVA B;  3K3N A;  2JRK A;  3U78 A;  3T8O A;  4IDQ A;  5FP3 A;  4ASK A;  5LBM A;  2ZM0 A;  2HN1 A;  2YDQ A;  1MIW A;  3AEE A;  3VU7 H;  1UCU A;  1E1H B;  4JI2 T;  3Q5D A;  3RYC E;  5LJM A;  1WRD A;  2Z6E A;  1KFY A;  4CN1 A;  4LMK A;  2XM1 A;  3AEB A;  2XQ6 A;  4U33 A;  2V1D B;  5AQO B;  3HI2 A;  1HNW T;  2WMO A;  3RKG A;  4H9Q C;  2ACX A;  1BR1 A;  2BS2 A;  4COF A;  2BKP A;  4B3R T;  4AKH A;  3OJA A;  3T1Y T;  3N9Q A;  3IBP A;  3AEA A;  2XJ7 A;  3AE1 A;  4YTP A;  5HEJ A;  2LM9 A;  4IST A;  4Z8X A;  5FXZ A;  1CUN A;  4H9S E;  4CN4 A;  3CWZ B;  3C50 A;  2J4G A;  2QGS A;  2V6X A;  1XMO T;  4OFZ A;  4NXM T;  5L3B B;  2SPC A;  2Y48 B;  1LRZ A;  2IW5 B;  2WU5 A;  3IA3 A;  2XAG B;  1YXR A;  3ZKR A;  2XZE A;  2J47 A;  4EB6 E;  4EGW A;  2MTQ A;  2E2A A;  3LBX A;  5KDM C;  4ZI3 C;  1R8I A;  2BS4 A;  5ABF A;  3GN5 A;  4DV6 T;  2E9X D;  3FZH B;  4HFB A;  4QXC B;  2ACZ A;  4DO0 A;  1O3X A;  3UUM A;  3PUS A;  4YY3 T;  3OVU A;  1KK7 A;  3CX6 B;  1XZY A;  1UUS A;  2LRL A;  1MNE A;  4HGA A;  2XAF B;  2VQE T;  4KMC A;  4Z90 A;  5HYA A;  3I9Y A;  4PJL A;  3CX7 B;  4OK0 A;  4HE8 A;  2V7M A;  1QUU A;  1MIY A;  3RPU A;  4JI3 T;  4KHP T;  4QKN A;  3PJA A;  2V7I A;  5JDQ A;  5HXE A;  3PTR B;  2UXC T;  4XBF B;  3SRZ A;  4P09 A;  3MXZ A;  4B3M T;  5J2T E;  1MMD A;  4AQF A;  4DV3 T;  2Y8D A;  3RIU A;  5AQH B;  1HCI A;  5F3J A;  1UUR A;  4PFP A;  3FZM B;  3PE0 A;  2WS3 A;  5LMU T;  3ABV A;  2DL1 A;  3B57 A;  3UUB A;  3JCF A;  3MK7 C;  3AE2 A;  2CHN A;  3HKC E;  1VCS A;  4YXD A;  3GA8 A;  2XAS B;  1GQE A;  5ABF B;  3GN5 B;  3OTO T;  1HX8 A;  2LSI A;  2X9W A;  2I59 A;  4A97 A;  3P4P A;  3UFE A;  2W63 A;  4X20 E;  4DR1 T;  2XM2 A;  2V6Y A;  2KMF A;  4CN6 A;  4CI3 B;  1XWM A;  1I6Z A;  2HPL A;  3NZQ A;  2CE7 A;  1KNP A;  2AXD S;  4HWI B;  1DU2 A;  1XDO A;  1OXZ A;  4F8H A;  1YKE B;  1FMV A;  3P50 A;  1KNR A;  4V1A v;  4OYJ A;  3RC8 A;  4MAL A;  3CX8 B;  4IDP A;  3MA9 A;  1M7K A;  3LK4 2;  2MOZ A;  5EK4 A;  4HFI A;  2R6G F;  3A8Y C;  4U2Z A;  2LHN A;  2WCA A;  3I9W A;  3FBZ A;  1HNZ T;  4YFS A;  2K48 A;  3PV0 F;  5AQU B;  2XQ9 A;  5AQF B;  1IBM T;  4JEH B;  2X68 A;  4YSY A;  1FJG T;  3PUZ F;  5LA6 E;  4UEL A;  2BKN A;  3PUG A;  3KFW X;  3MKD A;  2KLQ A;  2KZ7 B;  3R6N A;  4BJN A;  2I0M A;  3NBX X;  4TNW A;  3ZN1 B;  4IIJ E;  4AQF C;  2XQ7 A;  3RIU C;  3AXJ A;  1WLX A;  2N2N A;  4X65 T;  4HFE A;  5HCJ A;  2G0U A;  2WMN A;  4XAX B;  5FXW A;  4EED A;  5F5W A;  4E7S A;  5C8Y E;  3QB5 A;  4LF7 T;  2L9Q A;  4EZ4 A;  2D0U A;  4ZZB A;  4LF9 T;  3V5U A;  1BR2 A;  5HEH A;  4DR2 T;  2WWV A;  1JNR A;  3PU3 A;  4I43 B;  4CI2 B;  3Q5W A;  4O4H E;  3UT5 E;  3LSV A;  3DP7 A;  5LG3 A;  3N2G E;  2ODV A;  5LGT B;  2ZM6 T;  3IEE A;  3PDY A;  4U31 A;  5CA0 E;  1W09 A;  4E7Z A;  1D1C A;  5LHG B;  1U4Q A;  1ZV4 X;  2WZI A;  4QXH B;  2ZM8 A;  5JDH A;  4CXX A;  4TWH A;  3U3I A;  3VRA A;  3EVY A;  3LK3 B;  3UQ4 A;  2IC6 A;  4P1N A;  5H6Q B;  1G73 A;  1ZEE A;  2X9Y A;  2PFV A;  3FZK B;  3WAK A;  2UXD T;  2CMR A;  2FJB A;  4ERR A;  4IE7 A;  3Q5X A;  4WNK A;  5AQN B;  1Y01 A;  2X0L B;  1T7S A;  2WDQ A;  3PUV F;  4IDZ A;  2YU2 A;  4QHO A;  1H7C A;  4AKG A;  4ZXL A;  4LFA T;  2RP4 A;  4C90 A;  2VWA A;  3LFM A;  4TV8 E;  2FJE A;  4JI5 T;  3ZC1 A;  4WZX A;  2W2U A;  3Q5E A;  4H9N C;  2XAQ B;  3PUQ A;  5JVD E;  1S94 A;  3J9X 1;  5HAX A;  4NIQ A;  2XSA A;  3RI5 A;  4HWF A;  3P4S A;  3ZYK A;  4UIG A;  1QLB A;  2HN2 A;  4HWD A;  4QH4 A;  4B6X A;  2J1D G;  3QUJ A;  4LML A;  3ZEF B;  4X1I E;  4HFH A;  2QA7 A;  2V8S V;  3K3O A;  4UV8 B;  4BJM A;  2M6I A;  3KIN B;  2UUC T;  4DV5 T;  1XNQ T;  3EDU A;  4YTN A; 
#chains in the Genus database with same CATH homology
 1XWM A;  3L39 A;  2BKP A;  2BKO A;  1T72 A;  1T8B A;  2OLT A;  2IIU A;  4Q25 A;  1SUM B;  2I0M A;  1VCT A;  2BKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...