2I0MA

Crystal structure of the phosphate transport system regulatory protein phou from streptococcus pneumoniae
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
212
structure length
207
Chain Sequence
QFDLELHELEQSFLGLGQLVLETASKALLALASKDKEMAELIINKDHAINQGQSAIELTCARLLALPQVSDLRFVISIMSSCSDLERMGDHMAGIAKAVLQLKENQLAEEQLHQMGKLSLSMLADLLVAFPLHQASKAISIAQKDEQIDQYYYALSKEIIGLMKDQESIPNGTQYLYIIGHLERFADYIANICERLVYLETGELVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate transport system protein phoU
publication title Crystal structure of the phosphate transport system regulatory protein PhoU from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 88
structure length 207
sequence length 212
ec nomenclature
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2i0mA01
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2i0mA02
2OLTA 1VCTA 1XWMA 2BKNA 1SUMB 2I0MA 2IIUA 3L39A 4Q25A 1T72A 2BKPA 1T8BA 2BKOA
chains in the Genus database with same CATH superfamily
2EHOB 4I55E 2Q9QA 1HTJF 4I50E 4YSZA 2XAJB 2H7VC 5ABEA 2X51A 2ZM2A 4LF9T 4KUMB 2ZM6T 3RGLA 1IAPA 2CEAA 3AEFA 4IE4A 4KP3C 3FZMB 3VKGA 1WLXA 2CXDA 1HF8A 1U4QA 4X1YE 2IAKA 3RQUA 4LF4T 1X9BA 3F57A 3LSVA 4KX6A 2XAFB 2D2SA 3RKOA 4IE6A 3OYXA 4O8SA 3BK9A 3BQKA 3F2EA 5AQRB 2XM2A 1HX8A 4U72A 3C4ZA 1UX5A 4CI1B 3Q5XA 3P4SA 4QHOA 5AQOB 5LMUT 3TLUA 4DR3T 1ZHCA 5LXTE 4GOUA 5FXVA 3N9NA 2MYSA 1D1CA 2PTFA 2IW5B 2E9XB 4ZS2A 2ZMAA 3ZT7A 1OEDE 1QLBA 4DV5T 1E1HB 2C5JA 1XMOT 3TLSA 2HPJA 2V1DB 1OEDA 3ZYMA 4JBWF 5HEGA 1W9RA 4WBOA 4JI6T 3AB3B 3JAEA 3TKLB 1FMWA 3CX6B 5HEJA 4QX8B 2QA7A 4IREA 1ZOYA 3RQWA 2K3WA 4HGAA 4X5TA 4N78D 3AE5A 5HEUA 3ZPOA 3RI5A 1OWAA 2I0MA 3MKDA 4LF5T 3RC8A 3PU8A 3N9PA 4PNIA 3PDYA 3KBTA 4U33A 1MNDA 2LM9A 4JUYA 4QH4A 2MAWA 2XASB 2NWBA 2HHHT 4UF0A 3JC6D 1T7SA 2X0YA 4IDQA 2V7LA 3FZLB 2LHRA 2X9XA 2NW7A 3PUQA 4IDPA 3NKZA 4YTNA 5J0ZA 3P4RA 2Q9QD 3ZC1A 3RX6A 3P4QA 3PU3A 3RIFA 4YY3T 4Q25A 4YSYA 3TLVA 4QXHB 2KXPB 2Y6XA 3ZCIA 4HFEA 2JRKA 4A56A 1BR4A 4MALA 1YW0A 1MMGA 4LFAT 5LJNA 4GYSA 2KZ7B 3DTOA 2WU2A 4DMVA 3AAEB 2XQYA 3LK3B 3JC6C 4FI5A 2CLYC 3UUXB 3RYFE 3S4UA 4OYJA 3X1DA 2J1DG 2N2NA 3ESLA 1IBMT 2Q9QC 2DL1A 1KFYA 5L2LA 3H3MA 3C4WA 2YDSA 4DR2T 2XSAA 5L3EB 1YXRA 1D1BA 2WDVA 5LHGB 4ERRA 5DQWA 3FBLA 1S35A 4YTMA 4C90A 5JDGA 2YEVC 3FXDB 4TZ4C 3ZMZB 3AE6A 3FZHB 4H63V 2V6YB 3KV5A 2WDQA 1ZEEA 1XMQT 4ZZCA 1U5PA 4YSXA 5CB4E 2D0UA 5LMNT 2XAQB 2M6BA 4U3CA 3R6NA 2WZHA 4M1PA 1G8XA 5L3CB 1HS7A 3EDUA 5JTGA 2JQKA 3N9QA 2WB5A 4U2YA 2VKOA 4JEUB 2CE7A 4XBFB 3M65A 3RPUA 2VQET 2A2FX 2J47A 4JI4T 2BG9E 2HPLA 4X65T 3CPZA 1H7CA 4DV0T 4UR9A 5CA1E 2K5BB 1OEDC 3QB5A 5JRCB 4G2AA 4HWCA 4JI1T 5JR9B 1E2AA 4ZXLA 2CRBA 3KVAA 3QNUA 4ILBA 2KNDA 2B1EA 2VKHA 3PV0F 2H3RA 2M6IA 1LRZA 4EOZB 4IDZA 5FL0A 2NW8A 2BDEA 3Q9DA 3UU5A 4DV1T 2NTYA 3K3OA 4O4JE 2NTXA 1HX1B 4AI6A 3RYCE 5IWAT 3ZLIA 1AJ3A 4BA9A 2J4GA 2WCAA 2VL8A 3ZYLA 3PUSA 3NZQA 1D1AA 4ASKA 1VRBA 4PK4A 2I6HA 2XM1A 3W15B 2W0GA 4X62T 2IDOB 2J62A 5HAXA 2BZBA 5EK3A 2WWVA 4HWIB 3P7IA 1WRDA 3GA8A 3H37A 3CX8B 1ZV4X 4TNVA 4UVBB 4WNKA 4NXMT 5AQVB 4L0RA 5BR8T 1LVKA 2LLYA 1L0VA 4IHJE 3PUVF 3CQGB 1Z8UA 4X64T 4TNWA 3I9WA 3ONLC 4C91A 5TAOA 4PW8A 1FMVA 4ILUA 4QX7B 2W62A 2IC6A 3QK6A 2A72A 5DABA 2CWYA 5LBMA 3T1HT 2XQ8A 2ZM8A 3ZSTA 3MA9A 3C4XA 2BVLA 4J2CA 1MMNA 4LMKA 2WMNA 2BBJA 3M3ZB 4ZI3D 2A3DA 3AXJB 4KHZF 2M67A 2SPCA 4DMWA 3AVSA 4EGWA 5JDFA 3GWHA 5LP6E 2LJLA 4X20E 3EDVA 2LKHA 3LG7A 4TUYE 4NUUA 2JQ9A 3FB2A 5DJQC 4TWHA 3RHWA 4F8HA 4X1IE 3UT5E 2VKJA 5LGUB 1QSDA 4XAXB 3OTOT 1YQ3A 2BG9C 3SWHA 3CKDA 3AEBA 4JI8T 3D0TA 2UXBT 2V5DA 3I1AA 3O1JA 5HXSA 2LRLA 4ZI3C 3AE9A 2XQ4A 5LG3A 4X1KE 1OXZA 2VB6A 3G06A 4EYYR 3EABA 3GN5A 3EVYA 5LB7B 4GKKT 2W61A 3P50A 4H9NC 5A1LA 2DWKA 2XQAA 4DV3T 4PJJA 1I6ZA 3C50A 4ADZA 3UUBA 3AEDA 3B5MA 2JQHA 4DV7T 3HKDE 3AE3A 1W09A 2RA1A 1WR6A 4AIUA 2CMRA 3RRWA 4PFPA 2K48A 2KT9A 5HYAA 3AE7A 2W63A 4OX9T 2XTLA 3ETVA 4ILCA 4DR6T 5L4HA 2JMHA 2IC9A 1CHUA 5CA0E 3UUNA 5AQJB 4EEBA 2CXLA 2X66A 4Z90A 5AQTB 5LCYA 2JQQA 3JAFA 4YHHT 4Z8XA 2JPFA 3LBXB 4AXPA 2V7KA 4U2ZA 2XZEA 3ANWA 2XUEA 2LT3A 1XZYA 1S94A 2V7IA 5ABFB 2KWIB 5LBQB 5LNKA 5FVKA 2KSRA 3UU8A 2BVMA 4X66T 5HXEA 2WQYA 1IJ6A 3NZPA 4CXXA 3O1HA 4YJ3E 3HKEE 1D0XA 1UGOA 5FMNA 3UQ7A 4HEAA 4GKJT 4LFCT 1WYBA 1WCRA 3N9OA 1T98A 4PK5A 2FJDA 4CQIA 4MLKA 2VVNA 2C0SA 2K24A 4YFSA 4YTPA 2V7JA 2IIUA 3HKCE 3RIUA 1DU2A 3ONXA 4DUZT 2YOEA 4B6XA 3PUAA 4DBRA 2BG9B 5EK4A 2LOSA 3CK6A 3KDSE 4U31A 4DV4T 1N36T 2YDQA 4COFA 4ZHQE 4PAGA 2D9DA 4ZEYA 1YD8G 3L09A 3MACA 3JCFA 3HR0A 2FBWA 1IZNB 2ODUA 3MZKB 4KBMB 1YKHB 5AQPB 4ANJA 2X67A 1WFDA 3V5UA 4EZHA 5HXRA 4IE0A 4V1Av 5F3JA 2LSGA 4AQGA 3L3PA 3N2KE 2W67A 1T72A 5IYZE 4TV8E 3VR9A 4DO0A 3OJAA 5LYJE 3LDQB 1UX4A 1ZP0A 2EHOA 2YINA 4ISSA 5F5WA 3PUXF 4B3ST 3ZKRA 5HCJA 2DCFA 5C3JA 2XQ7A 1YKEB 3VRAA 4EV6A 3FZFB 1WYCA 4O4IE 3C98B 3QB5K 2KWHA 3LFMA 3R84B 2H7OA 2CM0A 1R8IA 4YXDA 3AE4A 2JJ9A 3RIAA 3ZN0B 2ZM0A 3HKBE 4EIWA 3PUYF 3MXZA 4AKLA 1EZ3A 2E9XA 3AAIA 4CI2B 4MHCA 5AQSB 2P9BA 5FVLA 1BR2A 3J9X1 2X9HA 4HFHA 3OYZA 4LF6T 3VKHA 2LE8A 2LHNA 4DVDA 3N2GE 3AEEA 5ABGA 2KMFA 2IMLA 2KINB 4NXNT 5CJ5A 1O3XA 2DHRA 4H63H 3AA7B 5LHIB 1NENA 2X9WA 2XAGB 4IDOA 3UQ4A 4CXYA 4ZI2D 4DV6T 1T8BA 1WR0A 4ILAA 4UIGA 4CN4A 2BKNA 2IHR1 1N32T 2QYWA 4CN1A 4HFVA 3FXEB 5LOVE 2WY2A 1BR1A 4JEHB 2WS3A 5CFBA 1KNRA 5HXCA 5J2TE 4P1NA 2X9YA 4JLEA 3Q5EA 4YT0A 3N9MA 4BAYB 1JNZA 2H89A 3I9YA 2ACZA 1HG5A 3UU3A 4TX5A 3RIUC 2CXFA 5JVDE 3B57A 2X0LB 1VCTA 1E7PA 3ZMSB 5L3FB 4PJNA 2XQ9A 4IGUA 2EHOD 3PJAJ 4ZI2C 2UUAT 2BS3A 2YDRA 2VKDA 5LGTB 1IJ5A 4PJLA 3ONJA 4UVAB 5JDMA 4ZOLE 3E08A 5KMGP 5IHYA 1GQEA 5JDHA 5FP3A 3CMLA 1VCSA 2DNXA 4JV5T 2BKOA 3OVUA 4PJMA 3T8OA 3ETUA 2LSJA 4QKNA 5JDQA 3T1YT 2WSSV 2WU5A 2YN6A 2FJBA 3LK2B 2CLYB 4CN6A 2Z6EA 2V5CA 2EHOC 2Q9QB 3WAKA 3O4XE 3UULA 2E5VA 3KINB 3AA0B 3Q5DA 4DNDA 4AQFA 4QXCB 4ZS3A 3UFEA 3AAAB 3A8YC 3VHLA 5EZYE 4U7YA 5L3BB 4TWFA 4IIJE 4P0AA 2NP9A 2UUCT 1BR0A 4WBNE 1N34T 2V6YA 3A7MA 2XQ5A 5J2UE 2OLTA 4DR5T 2A9UA 4HTEA 2CA5A 2PBIA 4XZCA 1KK7A 3ZMUB 2BKPA 2LKGA 3EUHA 4L5GA 3PURA 3VU7H 4P09A 2XSBA 1HNWT 3MK7C 4EYUA 2D0TA 4ISTA 3PUGA 1OEDB 4OYKA 2C5KT 3NVOA 4DBQA 4GIWA 5JRCA 2MPKA 5LG4A 3U3IA 3ZN1B 4A98A 2LSKA 5JR9A 3N9LA 3SOLA 5AQUB 3BQLA 2UUBT 5HXHA 5JH7E 1HR0T 3P8CD 2I59A 1B7TA 3K8PC 4YJ2E 3A5XA 3QOFA 1J1JA 3DJBA 2E8IA 4KHPT 2UXXB 4O2BE 3RLFF 3I0QA 3CX7B 3I0OA 2XQ6A 2E2AA 2ZLYA 3EAMA 1Y01A 2XQ3A 4UF0B 3ZMVB 2Y8DA 4GK0E 4HFDA 4UV8B 3RYIE 4L9IA 3K3NA 2DWGA 4O2AE 5HCMA 4KI0F 2XJ7A 2G0UA 2N1GA 4CI3B 5J1GA 4AKRB 3C64A 3OPCA 2PG8A 2NOXA 5FXXA 2VASA 2R6GF 4QWNB 2CWOA 1UCUA 1G73A 1FJGT 5BMVE 2VVSA 5AQLB 2DI4A 4OHFA 4OK0A 3ZJ1A 4QH1A 2GK9A 1US7B 4DR7T 4OFZA 5AQFB 3PE0A 4TWDA 4P0BA 5HWXA 5LA6E 1D0ZA 2AE9A 3TLTA 4I4TE 3KVBA 2QVAA 4BJNA 3U78A 1UUSA 2V26A 1LKXA 2CBJA 5F8PA 2W4XA 4EAHA 3SS1A 4HFBA 4AQFC 4MBQA 2LM2A 1XDPA 4HKAA 5L3DB 1VOMA 3UFGA 2RPAA 1UURA 3CIRA 3PUWF 3V5SA 4LMJA 5AQMB 4NUVA 4LF7T 5KX5E 3VRBA 3HA4A 3PJAA 1LVFA 4I43B 3AXJA 4GYRA 4H9OC 3LK42 3E0ZA 3ZT5A 1NWMX 4YHJA 3ABVA 2CCQA 4NIQA 2YU1A 1QUUA 3IF8B 3UU4A 4JI2T 4AKHA 3RRCA 5HWYA 2YKSA 1MNEA 3OBVE 4QXBB 4EB6E 3IA3A 3CQXC 3AEAA 1I94T 3KV6A 2IUBA 2HN1A 2UXDT 3NRXA 3O1IA 3SRZA 5JR9C 4B3TT 2V7MA 3CQCB 2AXDS 4G63A 1HG2A 2H88A 4DR1T 3DP7A 5JREA 2WMOA 4QH5A 4AKIA 4EXTA 3O9XA 2VK9A 5FY7A 5GONE 4K0KT 5L3GB 2VURA 1UK5A 3HI2A 4DV2T 3J7Yq 2V8SV 4IL9A 5L47A 4IE7A 2VQFT 1V9DA 4H9SE 4WYVA 3E22E 5FNVE 4HWFA 5FKYA 2LSYA 2UXCT 2WWUA 4U7IA 3ZMTB 4BJMA 4UEMA 5CGMA 5FY1A 4IL4A 2HH7A 3RYHE 3LBXA 3EI0A 2WBLA 4H9QC 1J5ET 1XNRT 4JI5T 3AEGA 5LHHB 3MJXA 3UU6A 1HNXT 5JDLA 4PFOA 5ABFA 2V6XA 5AQIB 2XPKA 2XAHB 2W2UA 1M7KA 2N9DA 1IBKT 3SFDA 4KMCA 4DUYT 2XY8B 4B3MT 3RKGA 1MIYA 1SUMB 3FZKB 2XHEB 4TV9E 5HEHA 1YQ4A 1Z0PA 3RC3A 4AISA 4YLHA 5EK2A 2WDRA 3RH3A 3ZYKA 1MMDA 3IHRA 4JI7T 4WW0A 3P4PA 4DR4T 2X0HA 4WZXA 4GK5E 3Q5WA 4IE5A 3VR8A 4H9RC 4U74A 5JQGE 3FBZA 2MTQA 2WP9A 3P4WA 2FUPA 2LEHA 2DLRA 2MOZA 4LFBT 2BG9A 4E7ZA 2MBGA 2PFVA 3KV9A 3ZSSA 2KLQA 2JIWA 5AQQB 2F4VT 3ZEFB 1M62A 1MMAA 3SFEA 3TLWA 4AKGA 3BQIA 1FEWA 3LJCA 2W00A 1ZKEA 4H9PC 4TN7B 5AFUL 4UV9B 1KEYA 1HNZT 3FHNA 3ZCJA 4AQYT 2WAUA 4HN9A 4E7SA 1MIWA 4LMLA 2PJQA 2L8KA 2B76A 3GN5B 3Q2MA 2YK0A 5AQGB 5DQVA 4IT4A 5LGNB 4A5XA 3IEEA 2LSIA 2BS2A 2E5LT 4DIDB 1HCIA 2OV9A 2FJEA 3OKQA 2YU2A 2WM9A 3ZT6A 3CWZB 3JADA 1SA0E 5FXWA 1N33T 3CVRA 2Y48B 4HWDA 4UELA 4CZZB 1NEKA 3UTKA 2C5IT 4LF8T 4HFCA 4HE8A 2OA5A 3ZJ2A 4ZZBA 3KFWX 3ZC0A 2E9XD 3F31A 2RP4A 3EHZA 1D0YA 2VWAA 2NR4A 2ACXA 5FYMA 1XWMA 2X68A 1NAFA 3H3AA 3NWIA 3KV4A 1KF6A 3B13A 3L8RA 4UVCB 4EEDA 5AQNB 4JI3T 2ODVA 3NBXX 2JMKA 5E0OA 3L39A 4O4HE 3RF1A 4UXNB 4MFRA 5JDNA 3ANWB 3WAJA 2CHNA 5HEOA 5C2TA 2VL0A 3AVRA 2D5UA 3AECA 2CBIA 5H6RB 2NW9A 2E9XC 5ADXL 5AQKB 4PK6A 3PTRB 4K0UA 2UXNB 2HN2A 4Z91A 5KDMC 2CHOA 2CPTA 5ETWA 4JYAT 3AA6B 4NPPA 5IUXA 2UU9T 3QUJA 5AQHB 1X79A 2LOPA 5M4YA 5FL1A 3K1SA 4A97A 3QC9A 3AA1B 1JNRA 3GMIA 3PUZF 1Y64B 5FXZA 3IBPA 3KBUA 3NRYA 5L4EA 1SE7A 4O4LE 4B3RT 3K3QC 2W66A 4FJOA 3UUMA 3AE8A 4F6RC 5LJMA 1W0BA 2BBHA 2ES0A 4CXWA 5FY0A 2BS4A 1XNQT 5KXJA 1XDOA 5H6QB 1KNZA 5C8YE 4IDNA 1W0AA 1MIVA 4HWHA 1CUNA 3AE1A 2L3LA 2WZIA 3N2OA 2K9AA 3HL6A 1KNPA 2L9QA 3WI3A 3N5LA 4HFIA 3AE2A 1FIOA 1SHZC 2LRKA 2QRXA 1IBLT 3C51A 2FJAA 1J5WA 2QGSA 4I0UA 4ZI7E 4EZ4A 4JI0T 5ABHA 1HFAA
chains in the Genus database with same CATH topology
2OLTA 1VCTA 1XWMA 2BKNA 1SUMB 2I0MA 2IIUA 3L39A 4Q25A 1T72A 2BKPA 1T8BA 2BKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OLT A;  1VCT A;  1XWM A;  2BKN A;  1SUM B;  2I0M A;  2IIU A;  3L39 A;  4Q25 A;  1T72 A;  2BKP A;  1T8B A;  2BKO A; 
#chains in the Genus database with same CATH topology
 2EHO B;  4I55 E;  2Q9Q A;  1HTJ F;  4I50 E;  4YSZ A;  2XAJ B;  2H7V C;  5ABE A;  2X51 A;  2ZM2 A;  4LF9 T;  4KUM B;  2ZM6 T;  3RGL A;  1IAP A;  2CEA A;  3AEF A;  4IE4 A;  4KP3 C;  3FZM B;  3VKG A;  1WLX A;  2CXD A;  1HF8 A;  1U4Q A;  4X1Y E;  2IAK A;  3RQU A;  4LF4 T;  1X9B A;  3F57 A;  3LSV A;  4KX6 A;  2XAF B;  2D2S A;  3RKO A;  4IE6 A;  3OYX A;  4O8S A;  3BK9 A;  3BQK A;  3F2E A;  5AQR B;  2XM2 A;  1HX8 A;  4U72 A;  3C4Z A;  1UX5 A;  4CI1 B;  3Q5X A;  3P4S A;  4QHO A;  5AQO B;  5LMU T;  3TLU A;  4DR3 T;  1ZHC A;  5LXT E;  4GOU A;  5FXV A;  3N9N A;  2MYS A;  1D1C A;  2PTF A;  2IW5 B;  2E9X B;  4ZS2 A;  2ZMA A;  3ZT7 A;  1OED E;  1QLB A;  4DV5 T;  1E1H B;  2C5J A;  1XMO T;  3TLS A;  2HPJ A;  2V1D B;  1OED A;  3ZYM A;  4JBW F;  5HEG A;  1W9R A;  4WBO A;  4JI6 T;  3AB3 B;  3JAE A;  3TKL B;  1FMW A;  3CX6 B;  5HEJ A;  4QX8 B;  2QA7 A;  4IRE A;  1ZOY A;  3RQW A;  2K3W A;  4HGA A;  4X5T A;  4N78 D;  3AE5 A;  5HEU A;  3ZPO A;  3RI5 A;  1OWA A;  2I0M A;  3MKD A;  4LF5 T;  3RC8 A;  3PU8 A;  3N9P A;  4PNI A;  3PDY A;  3KBT A;  4U33 A;  1MND A;  2LM9 A;  4JUY A;  4QH4 A;  2MAW A;  2XAS B;  2NWB A;  2HHH T;  4UF0 A;  3JC6 D;  1T7S A;  2X0Y A;  4IDQ A;  2V7L A;  3FZL B;  2LHR A;  2X9X A;  2NW7 A;  3PUQ A;  4IDP A;  3NKZ A;  4YTN A;  5J0Z A;  3P4R A;  2Q9Q D;  3ZC1 A;  3RX6 A;  3P4Q A;  3PU3 A;  3RIF A;  4YY3 T;  4Q25 A;  4YSY A;  3TLV A;  4QXH B;  2KXP B;  2Y6X A;  3ZCI A;  4HFE A;  2JRK A;  4A56 A;  1BR4 A;  4MAL A;  1YW0 A;  1MMG A;  4LFA T;  5LJN A;  4GYS A;  2KZ7 B;  3DTO A;  2WU2 A;  4DMV A;  3AAE B;  2XQY A;  3LK3 B;  3JC6 C;  4FI5 A;  2CLY C;  3UUX B;  3RYF E;  3S4U A;  4OYJ A;  3X1D A;  2J1D G;  2N2N A;  3ESL A;  1IBM T;  2Q9Q C;  2DL1 A;  1KFY A;  5L2L A;  3H3M A;  3C4W A;  2YDS A;  4DR2 T;  2XSA A;  5L3E B;  1YXR A;  1D1B A;  2WDV A;  5LHG B;  4ERR A;  5DQW A;  3FBL A;  1S35 A;  4YTM A;  4C90 A;  5JDG A;  2YEV C;  3FXD B;  4TZ4 C;  3ZMZ B;  3AE6 A;  3FZH B;  4H63 V;  2V6Y B;  3KV5 A;  2WDQ A;  1ZEE A;  1XMQ T;  4ZZC A;  1U5P A;  4YSX A;  5CB4 E;  2D0U A;  5LMN T;  2XAQ B;  2M6B A;  4U3C A;  3R6N A;  2WZH A;  4M1P A;  1G8X A;  5L3C B;  1HS7 A;  3EDU A;  5JTG A;  2JQK A;  3N9Q A;  2WB5 A;  4U2Y A;  2VKO A;  4JEU B;  2CE7 A;  4XBF B;  3M65 A;  3RPU A;  2VQE T;  2A2F X;  2J47 A;  4JI4 T;  2BG9 E;  2HPL A;  4X65 T;  3CPZ A;  1H7C A;  4DV0 T;  4UR9 A;  5CA1 E;  2K5B B;  1OED C;  3QB5 A;  5JRC B;  4G2A A;  4HWC A;  4JI1 T;  5JR9 B;  1E2A A;  4ZXL A;  2CRB A;  3KVA A;  3QNU A;  4ILB A;  2KND A;  2B1E A;  2VKH A;  3PV0 F;  2H3R A;  2M6I A;  1LRZ A;  4EOZ B;  4IDZ A;  5FL0 A;  2NW8 A;  2BDE A;  3Q9D A;  3UU5 A;  4DV1 T;  2NTY A;  3K3O A;  4O4J E;  2NTX A;  1HX1 B;  4AI6 A;  3RYC E;  5IWA T;  3ZLI A;  1AJ3 A;  4BA9 A;  2J4G A;  2WCA A;  2VL8 A;  3ZYL A;  3PUS A;  3NZQ A;  1D1A A;  4ASK A;  1VRB A;  4PK4 A;  2I6H A;  2XM1 A;  3W15 B;  2W0G A;  4X62 T;  2IDO B;  2J62 A;  5HAX A;  2BZB A;  5EK3 A;  2WWV A;  4HWI B;  3P7I A;  1WRD A;  3GA8 A;  3H37 A;  3CX8 B;  1ZV4 X;  4TNV A;  4UVB B;  4WNK A;  4NXM T;  5AQV B;  4L0R A;  5BR8 T;  1LVK A;  2LLY A;  1L0V A;  4IHJ E;  3PUV F;  3CQG B;  1Z8U A;  4X64 T;  4TNW A;  3I9W A;  3ONL C;  4C91 A;  5TAO A;  4PW8 A;  1FMV A;  4ILU A;  4QX7 B;  2W62 A;  2IC6 A;  3QK6 A;  2A72 A;  5DAB A;  2CWY A;  5LBM A;  3T1H T;  2XQ8 A;  2ZM8 A;  3ZST A;  3MA9 A;  3C4X A;  2BVL A;  4J2C A;  1MMN A;  4LMK A;  2WMN A;  2BBJ A;  3M3Z B;  4ZI3 D;  2A3D A;  3AXJ B;  4KHZ F;  2M67 A;  2SPC A;  4DMW A;  3AVS A;  4EGW A;  5JDF A;  3GWH A;  5LP6 E;  2LJL A;  4X20 E;  3EDV A;  2LKH A;  3LG7 A;  4TUY E;  4NUU A;  2JQ9 A;  3FB2 A;  5DJQ C;  4TWH A;  3RHW A;  4F8H A;  4X1I E;  3UT5 E;  2VKJ A;  5LGU B;  1QSD A;  4XAX B;  3OTO T;  1YQ3 A;  2BG9 C;  3SWH A;  3CKD A;  3AEB A;  4JI8 T;  3D0T A;  2UXB T;  2V5D A;  3I1A A;  3O1J A;  5HXS A;  2LRL A;  4ZI3 C;  3AE9 A;  2XQ4 A;  5LG3 A;  4X1K E;  1OXZ A;  2VB6 A;  3G06 A;  4EYY R;  3EAB A;  3GN5 A;  3EVY A;  5LB7 B;  4GKK T;  2W61 A;  3P50 A;  4H9N C;  5A1L A;  2DWK A;  2XQA A;  4DV3 T;  4PJJ A;  1I6Z A;  3C50 A;  4ADZ A;  3UUB A;  3AED A;  3B5M A;  2JQH A;  4DV7 T;  3HKD E;  3AE3 A;  1W09 A;  2RA1 A;  1WR6 A;  4AIU A;  2CMR A;  3RRW A;  4PFP A;  2K48 A;  2KT9 A;  5HYA A;  3AE7 A;  2W63 A;  4OX9 T;  2XTL A;  3ETV A;  4ILC A;  4DR6 T;  5L4H A;  2JMH A;  2IC9 A;  1CHU A;  5CA0 E;  3UUN A;  5AQJ B;  4EEB A;  2CXL A;  2X66 A;  4Z90 A;  5AQT B;  5LCY A;  2JQQ A;  3JAF A;  4YHH T;  4Z8X A;  2JPF A;  3LBX B;  4AXP A;  2V7K A;  4U2Z A;  2XZE A;  3ANW A;  2XUE A;  2LT3 A;  1XZY A;  1S94 A;  2V7I A;  5ABF B;  2KWI B;  5LBQ B;  5LNK A;  5FVK A;  2KSR A;  3UU8 A;  2BVM A;  4X66 T;  5HXE A;  2WQY A;  1IJ6 A;  3NZP A;  4CXX A;  3O1H A;  4YJ3 E;  3HKE E;  1D0X A;  1UGO A;  5FMN A;  3UQ7 A;  4HEA A;  4GKJ T;  4LFC T;  1WYB A;  1WCR A;  3N9O A;  1T98 A;  4PK5 A;  2FJD A;  4CQI A;  4MLK A;  2VVN A;  2C0S A;  2K24 A;  4YFS A;  4YTP A;  2V7J A;  2IIU A;  3HKC E;  3RIU A;  1DU2 A;  3ONX A;  4DUZ T;  2YOE A;  4B6X A;  3PUA A;  4DBR A;  2BG9 B;  5EK4 A;  2LOS A;  3CK6 A;  3KDS E;  4U31 A;  4DV4 T;  1N36 T;  2YDQ A;  4COF A;  4ZHQ E;  4PAG A;  2D9D A;  4ZEY A;  1YD8 G;  3L09 A;  3MAC A;  3JCF A;  3HR0 A;  2FBW A;  1IZN B;  2ODU A;  3MZK B;  4KBM B;  1YKH B;  5AQP B;  4ANJ A;  2X67 A;  1WFD A;  3V5U A;  4EZH A;  5HXR A;  4IE0 A;  4V1A v;  5F3J A;  2LSG A;  4AQG A;  3L3P A;  3N2K E;  2W67 A;  1T72 A;  5IYZ E;  4TV8 E;  3VR9 A;  4DO0 A;  3OJA A;  5LYJ E;  3LDQ B;  1UX4 A;  1ZP0 A;  2EHO A;  2YIN A;  4ISS A;  5F5W A;  3PUX F;  4B3S T;  3ZKR A;  5HCJ A;  2DCF A;  5C3J A;  2XQ7 A;  1YKE B;  3VRA A;  4EV6 A;  3FZF B;  1WYC A;  4O4I E;  3C98 B;  3QB5 K;  2KWH A;  3LFM A;  3R84 B;  2H7O A;  2CM0 A;  1R8I A;  4YXD A;  3AE4 A;  2JJ9 A;  3RIA A;  3ZN0 B;  2ZM0 A;  3HKB E;  4EIW A;  3PUY F;  3MXZ A;  4AKL A;  1EZ3 A;  2E9X A;  3AAI A;  4CI2 B;  4MHC A;  5AQS B;  2P9B A;  5FVL A;  1BR2 A;  3J9X 1;  2X9H A;  4HFH A;  3OYZ A;  4LF6 T;  3VKH A;  2LE8 A;  2LHN A;  4DVD A;  3N2G E;  3AEE A;  5ABG A;  2KMF A;  2IML A;  2KIN B;  4NXN T;  5CJ5 A;  1O3X A;  2DHR A;  4H63 H;  3AA7 B;  5LHI B;  1NEN A;  2X9W A;  2XAG B;  4IDO A;  3UQ4 A;  4CXY A;  4ZI2 D;  4DV6 T;  1T8B A;  1WR0 A;  4ILA A;  4UIG A;  4CN4 A;  2BKN A;  2IHR 1;  1N32 T;  2QYW A;  4CN1 A;  4HFV A;  3FXE B;  5LOV E;  2WY2 A;  1BR1 A;  4JEH B;  2WS3 A;  5CFB A;  1KNR A;  5HXC A;  5J2T E;  4P1N A;  2X9Y A;  4JLE A;  3Q5E A;  4YT0 A;  3N9M A;  4BAY B;  1JNZ A;  2H89 A;  3I9Y A;  2ACZ A;  1HG5 A;  3UU3 A;  4TX5 A;  3RIU C;  2CXF A;  5JVD E;  3B57 A;  2X0L B;  1VCT A;  1E7P A;  3ZMS B;  5L3F B;  4PJN A;  2XQ9 A;  4IGU A;  2EHO D;  3PJA J;  4ZI2 C;  2UUA T;  2BS3 A;  2YDR A;  2VKD A;  5LGT B;  1IJ5 A;  4PJL A;  3ONJ A;  4UVA B;  5JDM A;  4ZOL E;  3E08 A;  5KMG P;  5IHY A;  1GQE A;  5JDH A;  5FP3 A;  3CML A;  1VCS A;  2DNX A;  4JV5 T;  2BKO A;  3OVU A;  4PJM A;  3T8O A;  3ETU A;  2LSJ A;  4QKN A;  5JDQ A;  3T1Y T;  2WSS V;  2WU5 A;  2YN6 A;  2FJB A;  3LK2 B;  2CLY B;  4CN6 A;  2Z6E A;  2V5C A;  2EHO C;  2Q9Q B;  3WAK A;  3O4X E;  3UUL A;  2E5V A;  3KIN B;  3AA0 B;  3Q5D A;  4DND A;  4AQF A;  4QXC B;  4ZS3 A;  3UFE A;  3AAA B;  3A8Y C;  3VHL A;  5EZY E;  4U7Y A;  5L3B B;  4TWF A;  4IIJ E;  4P0A A;  2NP9 A;  2UUC T;  1BR0 A;  4WBN E;  1N34 T;  2V6Y A;  3A7M A;  2XQ5 A;  5J2U E;  2OLT A;  4DR5 T;  2A9U A;  4HTE A;  2CA5 A;  2PBI A;  4XZC A;  1KK7 A;  3ZMU B;  2BKP A;  2LKG A;  3EUH A;  4L5G A;  3PUR A;  3VU7 H;  4P09 A;  2XSB A;  1HNW T;  3MK7 C;  4EYU A;  2D0T A;  4IST A;  3PUG A;  1OED B;  4OYK A;  2C5K T;  3NVO A;  4DBQ A;  4GIW A;  5JRC A;  2MPK A;  5LG4 A;  3U3I A;  3ZN1 B;  4A98 A;  2LSK A;  5JR9 A;  3N9L A;  3SOL A;  5AQU B;  3BQL A;  2UUB T;  5HXH A;  5JH7 E;  1HR0 T;  3P8C D;  2I59 A;  1B7T A;  3K8P C;  4YJ2 E;  3A5X A;  3QOF A;  1J1J A;  3DJB A;  2E8I A;  4KHP T;  2UXX B;  4O2B E;  3RLF F;  3I0Q A;  3CX7 B;  3I0O A;  2XQ6 A;  2E2A A;  2ZLY A;  3EAM A;  1Y01 A;  2XQ3 A;  4UF0 B;  3ZMV B;  2Y8D A;  4GK0 E;  4HFD A;  4UV8 B;  3RYI E;  4L9I A;  3K3N A;  2DWG A;  4O2A E;  5HCM A;  4KI0 F;  2XJ7 A;  2G0U A;  2N1G A;  4CI3 B;  5J1G A;  4AKR B;  3C64 A;  3OPC A;  2PG8 A;  2NOX A;  5FXX A;  2VAS A;  2R6G F;  4QWN B;  2CWO A;  1UCU A;  1G73 A;  1FJG T;  5BMV E;  2VVS A;  5AQL B;  2DI4 A;  4OHF A;  4OK0 A;  3ZJ1 A;  4QH1 A;  2GK9 A;  1US7 B;  4DR7 T;  4OFZ A;  5AQF B;  3PE0 A;  4TWD A;  4P0B A;  5HWX A;  5LA6 E;  1D0Z A;  2AE9 A;  3TLT A;  4I4T E;  3KVB A;  2QVA A;  4BJN A;  3U78 A;  1UUS A;  2V26 A;  1LKX A;  2CBJ A;  5F8P A;  2W4X A;  4EAH A;  3SS1 A;  4HFB A;  4AQF C;  4MBQ A;  2LM2 A;  1XDP A;  4HKA A;  5L3D B;  1VOM A;  3UFG A;  2RPA A;  1UUR A;  3CIR A;  3PUW F;  3V5S A;  4LMJ A;  5AQM B;  4NUV A;  4LF7 T;  5KX5 E;  3VRB A;  3HA4 A;  3PJA A;  1LVF A;  4I43 B;  3AXJ A;  4GYR A;  4H9O C;  3LK4 2;  3E0Z A;  3ZT5 A;  1NWM X;  4YHJ A;  3ABV A;  2CCQ A;  4NIQ A;  2YU1 A;  1QUU A;  3IF8 B;  3UU4 A;  4JI2 T;  4AKH A;  3RRC A;  5HWY A;  2YKS A;  1MNE A;  3OBV E;  4QXB B;  4EB6 E;  3IA3 A;  3CQX C;  3AEA A;  1I94 T;  3KV6 A;  2IUB A;  2HN1 A;  2UXD T;  3NRX A;  3O1I A;  3SRZ A;  5JR9 C;  4B3T T;  2V7M A;  3CQC B;  2AXD S;  4G63 A;  1HG2 A;  2H88 A;  4DR1 T;  3DP7 A;  5JRE A;  2WMO A;  4QH5 A;  4AKI A;  4EXT A;  3O9X A;  2VK9 A;  5FY7 A;  5GON E;  4K0K T;  5L3G B;  2VUR A;  1UK5 A;  3HI2 A;  4DV2 T;  3J7Y q;  2V8S V;  4IL9 A;  5L47 A;  4IE7 A;  2VQF T;  1V9D A;  4H9S E;  4WYV A;  3E22 E;  5FNV E;  4HWF A;  5FKY A;  2LSY A;  2UXC T;  2WWU A;  4U7I A;  3ZMT B;  4BJM A;  4UEM A;  5CGM A;  5FY1 A;  4IL4 A;  2HH7 A;  3RYH E;  3LBX A;  3EI0 A;  2WBL A;  4H9Q C;  1J5E T;  1XNR T;  4JI5 T;  3AEG A;  5LHH B;  3MJX A;  3UU6 A;  1HNX T;  5JDL A;  4PFO A;  5ABF A;  2V6X A;  5AQI B;  2XPK A;  2XAH B;  2W2U A;  1M7K A;  2N9D A;  1IBK T;  3SFD A;  4KMC A;  4DUY T;  2XY8 B;  4B3M T;  3RKG A;  1MIY A;  1SUM B;  3FZK B;  2XHE B;  4TV9 E;  5HEH A;  1YQ4 A;  1Z0P A;  3RC3 A;  4AIS A;  4YLH A;  5EK2 A;  2WDR A;  3RH3 A;  3ZYK A;  1MMD A;  3IHR A;  4JI7 T;  4WW0 A;  3P4P A;  4DR4 T;  2X0H A;  4WZX A;  4GK5 E;  3Q5W A;  4IE5 A;  3VR8 A;  4H9R C;  4U74 A;  5JQG E;  3FBZ A;  2MTQ A;  2WP9 A;  3P4W A;  2FUP A;  2LEH A;  2DLR A;  2MOZ A;  4LFB T;  2BG9 A;  4E7Z A;  2MBG A;  2PFV A;  3KV9 A;  3ZSS A;  2KLQ A;  2JIW A;  5AQQ B;  2F4V T;  3ZEF B;  1M62 A;  1MMA A;  3SFE A;  3TLW A;  4AKG A;  3BQI A;  1FEW A;  3LJC A;  2W00 A;  1ZKE A;  4H9P C;  4TN7 B;  5AFU L;  4UV9 B;  1KEY A;  1HNZ T;  3FHN A;  3ZCJ A;  4AQY T;  2WAU A;  4HN9 A;  4E7S A;  1MIW A;  4LML A;  2PJQ A;  2L8K A;  2B76 A;  3GN5 B;  3Q2M A;  2YK0 A;  5AQG B;  5DQV A;  4IT4 A;  5LGN B;  4A5X A;  3IEE A;  2LSI A;  2BS2 A;  2E5L T;  4DID B;  1HCI A;  2OV9 A;  2FJE A;  3OKQ A;  2YU2 A;  2WM9 A;  3ZT6 A;  3CWZ B;  3JAD A;  1SA0 E;  5FXW A;  1N33 T;  3CVR A;  2Y48 B;  4HWD A;  4UEL A;  4CZZ B;  1NEK A;  3UTK A;  2C5I T;  4LF8 T;  4HFC A;  4HE8 A;  2OA5 A;  3ZJ2 A;  4ZZB A;  3KFW X;  3ZC0 A;  2E9X D;  3F31 A;  2RP4 A;  3EHZ A;  1D0Y A;  2VWA A;  2NR4 A;  2ACX A;  5FYM A;  1XWM A;  2X68 A;  1NAF A;  3H3A A;  3NWI A;  3KV4 A;  1KF6 A;  3B13 A;  3L8R A;  4UVC B;  4EED A;  5AQN B;  4JI3 T;  2ODV A;  3NBX X;  2JMK A;  5E0O A;  3L39 A;  4O4H E;  3RF1 A;  4UXN B;  4MFR A;  5JDN A;  3ANW B;  3WAJ A;  2CHN A;  5HEO A;  5C2T A;  2VL0 A;  3AVR A;  2D5U A;  3AEC A;  2CBI A;  5H6R B;  2NW9 A;  2E9X C;  5ADX L;  5AQK B;  4PK6 A;  3PTR B;  4K0U A;  2UXN B;  2HN2 A;  4Z91 A;  5KDM C;  2CHO A;  2CPT A;  5ETW A;  4JYA T;  3AA6 B;  4NPP A;  5IUX A;  2UU9 T;  3QUJ A;  5AQH B;  1X79 A;  2LOP A;  5M4Y A;  5FL1 A;  3K1S A;  4A97 A;  3QC9 A;  3AA1 B;  1JNR A;  3GMI A;  3PUZ F;  1Y64 B;  5FXZ A;  3IBP A;  3KBU A;  3NRY A;  5L4E A;  1SE7 A;  4O4L E;  4B3R T;  3K3Q C;  2W66 A;  4FJO A;  3UUM A;  3AE8 A;  4F6R C;  5LJM A;  1W0B A;  2BBH A;  2ES0 A;  4CXW A;  5FY0 A;  2BS4 A;  1XNQ T;  5KXJ A;  1XDO A;  5H6Q B;  1KNZ A;  5C8Y E;  4IDN A;  1W0A A;  1MIV A;  4HWH A;  1CUN A;  3AE1 A;  2L3L A;  2WZI A;  3N2O A;  2K9A A;  3HL6 A;  1KNP A;  2L9Q A;  3WI3 A;  3N5L A;  4HFI A;  3AE2 A;  1FIO A;  1SHZ C;  2LRK A;  2QRX A;  1IBL T;  3C51 A;  2FJA A;  1J5W A;  2QGS A;  4I0U A;  4ZI7 E;  4EZ4 A;  4JI0 T;  5ABH A;  1HFA A; 
#chains in the Genus database with same CATH homology
 2OLT A;  1VCT A;  1XWM A;  2BKN A;  1SUM B;  2I0M A;  2IIU A;  3L39 A;  4Q25 A;  1T72 A;  2BKP A;  1T8B A;  2BKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...