2I0MA

Crystal structure of the phosphate transport system regulatory protein phou from streptococcus pneumoniae
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
212
structure length
207
Chain Sequence
QFDLELHELEQSFLGLGQLVLETASKALLALASKDKEMAELIINKDHAINQGQSAIELTCARLLALPQVSDLRFVISIMSSCSDLERMGDHMAGIAKAVLQLKENQLAEEQLHQMGKLSLSMLADLLVAFPLHQASKAISIAQKDEQIDQYYYALSKEIIGLMKDQESIPNGTQYLYIIGHLERFADYIANICERLVYLETGELVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the phosphate transport system regulatory protein PhoU from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
molecule keywords Phosphate transport system protein phoU
total genus 88
structure length 207
sequence length 212
ec nomenclature
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2i0mA01
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2i0mA02
1SUMB 2OLTA 4Q25A 2I0MA 1T8BA 2BKNA 2IIUA 2BKPA 1T72A 1VCTA 3L39A 2BKOA 1XWMA
chains in the Genus database with same CATH superfamily
5FY1A 3RC3A 3U3IA 1R8IA 4QX7B 4A98A 2K9AA 4YSYA 2KWIB 2RP4A 1QLBA 2W61A 3NRXA 3DP7A 3AE4A 3LFMA 4I43B 1U4QA 4E7ZA 3ABVA 2E2AA 2N2NA 3AE5A 1HCIA 3AAAB 4HFDA 4IHJE 4ISSA 4QH4A 4TWDA 5EK4A 3TLWA 4OK0A 3R6NA 5HEUA 1ZP0A 2LEHA 3K3NA 3MACA 2DI4A 3N2KE 3I0QA 1KEYA 4MLKA 2CWOA 4IDZA 3UU3A 2CPTA 3C4ZA 2N9DA 2L3LA 2V8SV 1HTJF 1B7TA 3CQGB 3UUXB 4WBNE 5FY0A 3LG7A 3SRZA 4GKJT 5J2TE 5F8PA 2XM1A 2LM2A 3N2GE 4HE8A 4O2AE 2CHOA 3TLTA 3ZC0A 3AECA 4PFOA 1HNZT 2LHNA 3E08A 4PFPA 5TAOA 3EDUA 2Z6EA 4IDNA 5IYZE 4DBQA 3WAJA 5AQSB 5JH7E 4UF0A 4P09A 4O4LE 4IDQA 4ZI2D 2LKGA 2YDRA 4I50E 4DR2T 2CRBA 3PUZF 5FXXA 3Q5WA 3PUGA 5LNKA 2X51A 3RRCA 5JTGA 2FJAA 4JI7T 2HN2A 1ZKEA 1WFDA 4I0UA 3AEEA 1XNQT 4JBWF 3FZFB 4C91A 5LA6E 2IDOB 2NP9A 2Q9QC 3BQIA 3CKDA 4BJNA 3PUSA 4I55E 4PK5A 2LLYA 3IHRA 1OEDC 2WDQA 4TX5A 3FZLB 3WI3A 3AEBA 3JAEA 2YDQA 5AQGB 4X5TA 4X64T 1US7B 2VL8A 3C4XA 5AQPB 4EB6E 2Y8DA 2Q9QD 2QVAA 3A7MA 4AKLA 4EXTA 4LFAT 1YW0A 4H63H 2IHR1 2BKNA 4DV3T 4CZZB 5LOVE 4HWIB 2X9XA 3BK9A 4EGWA 1KK7A 3HKEE 3N5LA 2W66A 5IUXA 4YT0A 3FB2A 1OEDA 5AQOB 4YTPA 4IDPA 5LGNB 2V5DA 4QXBB 2DL1A 3AEDA 3P8CD 3X1DA 2V7KA 4CQIA 4ZOLE 3AE1A 3ZYKA 2CXFA 2XUEA 3N9MA 4YJ2E 2X9WA 3KDSE 2JQHA 4JUYA 5ABGA 3Q5EA 4DV0T 4H9PC 4GYSA 2LKHA 3K3OA 2VL0A 4TWFA 3LSVA 2JQ9A 5HAXA 3ZLIA 3I1AA 3TLSA 1M7KA 2XQ9A 3F31A 3O1IA 5HXRA 5AQTB 3OVUA 3CX6B 4UVCB 1L0VA 3RIUA 2V26A 4ASKA 2XQ6A 4B3TT 2WDRA 3C4WA 4LF7T 4IE6A 2ZM2A 4LF8T 2LJLA 2X9HA 2VKDA 3OBVE 2VQET 3M65A 3BQLA 3E22E 3N2OA 3ZCJA 1NWMX 4TNWA 3P50A 4DV6T 2UUCT 1S35A 3NKZA 4ILBA 1XZYA 3PU3A 2V7MA 1YQ4A 3AA0B 1D1AA 4U7YA 5DJQC 2I6HA 3E0ZA 5JREA 4K0KT 2YDSA 3RLFF 2YOEA 2MBGA 4UR9A 5ABFB 2V6YB 3K1SA 4Z90A 2WWVA 5F3JA 2CM0A 1IZNB 2LOSA 2D9DA 3ZMUB 1G8XA 2N1GA 2CE7A 5L47A 1AJ3A 2YK0A 3CQCB 2BS2A 2ACZA 3P4WA 2WBLA 5HEOA 3C50A 4NUVA 4HWCA 2W0GA 1N33T 1BR1A 3J9X1 1DU2A 3MK7C 3RIFA 1UCUA 3LK3B 2LRKA 2A9UA 2DWKA 2FUPA 3P4QA 4OX9T 3HKBE 5AQKB 4HKAA 4CN1A 2RA1A 5EK2A 3MA9A 4X65T 2LSGA 5FL1A 5L3EB 2A72A 4IL9A 1GQEA 3EAMA 2BVLA 2FBWA 4HEAA 4A56A 2J4GA 2EHOA 2X68A 1SHZC 3SFEA 5C3JA 4JI4T 3EUHA 2C5JA 1LVFA 3ONJA 2XQYA 1Y64B 3L39A 4YLHA 3AE2A 3ZJ1A 4ERRA 2UXDT 2ZM8A 3AE3A 3NWIA 3MJXA 4HTEA 4DR5T 5L4HA 3HI2A 4AXPA 3PV0F 4L5GA 5AQMB 4BJMA 3ZN1B 5HXHA 4UV8B 5KXJA 3VU7H 3ANWA 2J62A 3QC9A 3UULA 2F4VT 1YQ3A 2LHRA 4UEMA 4ZHQE 1XDPA 4X62T 5HEHA 3AA6B 2WZHA 2EHOB 2HN1A 2LOPA 2PG8A 2MOZA 2MYSA 2X0HA 3WAKA 3ZMTB 4YHJA 1FJGT 2MTQA 3CMLA 1D0YA 2VVNA 3DTOA 2D2SA 3RQWA 4HGAA 5AQFB 1WCRA 3NRYA 4DBRA 3EI0A 2LSJA 3PUQA 4IIJE 2LT3A 3AVRA 3Q2MA 4HWDA 3SS1A 5JDHA 3RC8A 2CLYB 3FZHB 2HPJA 2P9BA 3L3PA 4NPPA 4QXCB 5AQLB 2WU5A 5L3FB 4IE7A 3LK2B 1ZV4X 3PUYF 3LDQB 3RQUA 3ZKRA 4M1PA 5AQIB 2WCAA 3ZN0B 2FJEA 2XAFB 3CWZB 5ABEA 2K5BB 2UXBT 5AQQB 4QX8B 5HYAA 1BR0A 4DV1T 5JRCA 2YU1A 2Y48B 4JYAT 4IGUA 3B57A 3TKLB 5A1LA 1IBMT 2UUBT 3AXJB 5AQVB 2VKJA 3NZPA 3TLUA 1CHUA 2V1DB 2XSBA 3B13A 1HX1B 4P1NA 5F5WA 4YFSA 5J2UE 2LRLA 2X67A 5LBMA 1ZHCA 5IWAT 4A97A 2V7JA 4O8SA 3RHWA 4Z91A 5L2LA 3N9NA 1IJ5A 2DLRA 2R6GF 4JI8T 4DVDA 1V9DA 2YKSA 4I4TE 4EZHA 5LYJE 1OWAA 2BG9A 4ZZBA 4JI0T 4DR4T 4NUUA 2VKOA 1N34T 2WMOA 2EHOC 3PUXF 1UX5A 4ADZA 5AQRB 4U7IA 2Q9QA 3Q5XA 2PTFA 2WSSV 4L0RA 2NW9A 4DR1T 3R84B 4AQFA 2XY8B 3KVAA 1J5WA 1SUMB 1SE7A 2C5KT 2K24A 3OKQA 4IREA 4V1Av 2CXDA 1QSDA 4BAYB 1FEWA 2WS3A 3MZKB 5LHGB 1OXZA 4XAXB 2AE9A 4LMLA 3PUWF 3C64A 4ZI3D 5IHYA 4AKRB 4JEUB 2CEAA 1KFYA 3PE0A 2YN6A 4Z8XA 3A8YC 3OPCA 5JR9A 4N78D 2WAUA 4OYKA 4OFZA 4H9NC 4QH1A 2VASA 4KP3C 2NTYA 4TV8E 3RKOA 4HFCA 4JI5T 4OYJA 2M6BA 2WP9A 2E5LT 2VKHA 2XQAA 2XQ7A 2WU2A 3UFGA 5JRCB 2C0SA 2D5UA 3KV4A 4LMKA 3SFDA 4G2AA 2XAGB 4LF9T 3UQ4A 3UFEA 4HWFA 3VKGA 2OLTA 4IE4A 2MPKA 4X1IE 3V5UA 3ZYMA 4UVBB 4ZZCA 4JI3T 4NXNT 4ANJA 2X0LB 3HA4A 4GK5E 1T7SA 3PDYA 3OYZA 4X20E 2D0TA 3KBTA 4H63V 3RPUA 5JDNA 3T1HT 1LRZA 2UXCT 4E7SA 4HWHA 3CQXC 1EZ3A 5LB7B 2VQFT 1NENA 2ZLYA 3Q5DA 1UK5A 3L09A 4HFIA 5JQGE 2CBJA 3UUMA 4TZ4C 2Q9QB 4B6XA 2KZ7B 4UV9B 4BA9A 4U2ZA 2LE8A 2G0UA 5AFUL 2QYWA 4UIGA 4DV4T 1N36T 5AQHB 2M67A 5LBQB 2E9XD 4JI6T 4UVAB 1YD8G 2CXLA 2BVMA 2DWGA 1HX8A 4DMVA 1LKXA 5LHHB 4U74A 4MFRA 4MALA 3ETUA 5FKYA 5ABHA 4ZI7E 3D0TA 1HNWT 2C5IT 5CJ5A 1UURA 4IDOA 1WYBA 4KI0F 2WDVA 2NW8A 4F8HA 1QUUA 4U3CA 2LSKA 5FXVA 1D1BA 3PUAA 3CX8B 4EOZB 5JDLA 2UXXB 5JR9C 1UX4A 2ODVA 3BQKA 4TN7B 3ZJ2A 2B76A 1MMGA 2LSYA 2I59A 1HF8A 2QRXA 4O4HE 4P0BA 2X0YA 4O4IE 3DJBA 3ANWB 4PK4A 2NWBA 3ZMSB 3CPZA 4QWNB 2HPLA 4U33A 2E9XA 4EEBA 4XZCA 2CMRA 2ZM0A 3PURA 4AIUA 1YXRA 4CXXA 1NEKA 1X79A 3LK42 5M4YA 1W0AA 3JC6C 3EDVA 4QHOA 3RGLA 4X66T 1YKEB 2BBJA 4PAGA 2H89A 3AEFA 3RH3A 3FZMB 5H6QB 2W00A 3RYFE 1T98A 2CWYA 4G63A 4U31A 2JPFA 3HKCE 2XJ7A 3FBLA 3IF8B 5KMGP 4ZXLA 4HN9A 3GA8A 3I9WA 5AQUB 2ODUA 1ZEEA 3O9XA 2PFVA 3AA1B 2MAWA 4YSXA 1SA0E 1JNZA 5HWXA 4DUYT 1FMWA 2B1EA 2ES0A 1WLXA 4WW0A 3AE8A 2KNDA 1MMNA 3MXZA 4IL4A 1N32T 3HL6A 3O1HA 4DV2T 2H7VC 4JLEA 3NZQA 4A5XA 5LHIB 4YTMA 4DIDB 5GONE 1E2AA 5ETWA 1VCSA 2WB5A 3LBXA 4IT4A 5KDMC 5H6RB 1Z8UA 3PJAJ 2XQ4A 5HCMA 3G06A 4EAHA 2D0UA 2BG9C 4DV5T 5JDQA 4PJJA 1XNRT 3ONXA 3RYIE 3ETVA 3ZYLA 3J7Yq 3ZMVB 5L3DB 3F2EA 2A2FX 1J5ET 3OJAA 4L9IA 2YEVC 1UUSA 4DO0A 3HR0A 5FMNA 5FVLA 1D0ZA 2H88A 2PJQA 4AQFC 5CA0E 3N9LA 4PK6A 3UUNA 1XMQT 2IMLA 2FJBA 2BS3A 4NIQA 4H9QC 3ZMZB 2Y6XA 2UU9T 3VRAA 3CX7B 3JADA 2YINA 3RYHE 3UT5E 3I0OA 2E9XC 3FBZA 1ZOYA 3K3QC 1M62A 3VR8A 3ZCIA 1MNEA 4P0AA 3TLVA 4JV5T 4GYRA 3RYCE 4GK0E 3UUBA 5L3BB 3P4RA 5CGMA 3KVBA 3C51A 4TNVA 1IJ6A 3IA3A 3CK6A 3OYXA 5KX5E 1KNZA 4GKKT 2IIUA 2BG9E 2W62A 3H37A 3L8RA 4COFA 5JVDE 5FVKA 3RKGA 5ADXL 4TUYE 3T1YT 2BKOA 5JR9B 4KHPT 4JI2T 4LMJA 3UU6A 3ZT5A 2J1DG 3N9QA 1NAFA 5AQNB 3JAFA 4LF5T 2HHHT 4AQGA 3RX6A 2FJDA 3O4XE 2QGSA 4C90A 5C8YE 4WZXA 1MIVA 2BG9B 1XMOT 4YTNA 3LBXB 4NXMT 3UU4A 2OA5A 2XTLA 4TWHA 1MIYA 4YHHT 3UU8A 5LMNT 3M3ZB 3QUJA 3FZKB 2BS4A 1D1CA 2XQ5A 5CFBA 4UF0B 3H3MA 4ILCA 3PTRB 4HFVA 5LP6E 4DV7T 2VWAA 3QK6A 5HEGA 3RF1A 4JEHB 4CXWA 4AI6A 2A3DA 5DQVA 1IBKT 3FXDB 2JMKA 4HFHA 1MMDA 2W2UA 2KMFA 3KV6A 3AVSA 4CI3B 1HS7A 3JCFA 3U78A 2PBIA 2X9YA 5HXEA 4AKIA 1CUNA 3JC6D 1I6ZA 3SWHA 2KT9A 4LF6T 5JDGA 1KNRA 4XBFB 1HFAA 2V6XA 5HXCA 4ZI3C 3AAEB 3GWHA 4KMCA 5LCYA 3UTKA 4OHFA 2XQ8A 2CLYC 3PJAA 2DNXA 2ZMAA 3SOLA 3N9OA 2KSRA 2ACXA 5EK3A 3KBUA 1W9RA 2DCFA 2IUBA 2XZEA 4ILAA 4KUMB 2VURA 5J1GA 3RRWA 5LXTE 5HEJA 2E5VA 4FJOA 4H9OC 2QA7A 2XSAA 3LJCA 4ILUA 3AEGA 4K0UA 1T8BA 2VB6A 3KFWX 4DR3T 2JQKA 4AKHA 3O1JA 4ZEYA 3N9PA 4DUZT 3IEEA 3ZEFB 1I94T 3KV9A 3ONLC 3C98B 3QOFA 2BZBA 5FY7A 1JNRA 1XDOA 2H7OA 2HH7A 3K8PC 4CI2B 4PNIA 2XQ3A 4ZS3A 4H9SE 2I0MA 4O2BE 4EYYR 4LFCT 4YJ3E 3T8OA 4YXDA 3VRBA 4YY3T 2LSIA 2XM2A 4J2CA 1HR0T 3B5MA 5FXZA 1HNXT 2KWHA 2CBIA 3QB5K 3VR9A 3Q9DA 5L3CB 3A5XA 3PUVF 2E9XB 3AE7A 3AE6A 4U72A 1E1HB 4WNKA 4WYVA 5HXSA 1Z0PA 3AA7B 3RIUC 2JIWA 2ZM6T 1WR0A 3I9YA 3UQ7A 2V7LA 4H9RC 4DMWA 2BDEA 1BR2A 1W09A 2W63A 4GOUA 4HFEA 4PJMA 1BR4A 5FYMA 4YSZA 2AXDS 2DHRA 1OEDB 2H3RA 4IE5A 2UUAT 4O4JE 4Q25A 3ZSTA 2KINB 4EYUA 2WQYA 4CN6A 3QB5A 4AQYT 1D0XA 2V6YA 3CIRA 5LG4A 2IC9A 5DQWA 1WYCA 4KHZF 5E0OA 3NBXX 2NR4A 2JMHA 3GN5A 4AISA 2BBHA 2L8KA 2UXNB 4CI1B 4UXNB 2W67A 5HWYA 1U5PA 3S4UA 1UGOA 4MBQA 4UELA 4QXHB 4EEDA 2V7IA 1IAPA 2XHEB 3AAIA 2WY2A 4X1YE 4CXYA 4B3ST 1HG2A 4EZ4A 5LMUT 4EV6A 1FMVA 3UU5A 4MHCA 3RI5A 2XPKA 2YU2A 2NTXA 2V5CA 4PW8A 5BR8T 1J1JA 3P4SA 2WWUA 5J0ZA 1MIWA 3CVRA 4QKNA 1LVKA 3ZT7A 4EIWA 1IBLT 5EZYE 5FNVE 4DR6T 4FI5A 3KINB 3ZC1A 3ZPOA 3NVOA 4DR7T 1VCTA 2JJ9A 4PJNA 4ZS2A 5FP3A 5ABFA 2XAJB 5HCJA 3EABA 3EHZA 3P7IA 3GMIA 1OEDE 4IE0A 5CA1E 3OTOT 4LF4T 4AKGA 2JRKA 2W4XA 4WBOA 1MNDA 2BKPA 2X66A 4CN4A 2WM9A 3AXJA 1WRDA 4B3RT 2WMNA 3AE9A 1O3XA 1KNPA 5BMVE 3IBPA 3ZT6A 2WZIA 2GK9A 2EHOD 2NW7A 1Y01A 2SPCA 2CHNA 2E8IA 4HFBA 2K3WA 5L3GB 2IAKA 1YKHB 1S94A 2L9QA 5JDMA 3MKDA 3V5SA 2JQQA 5LJNA 1VOMA 5C2TA 1KF6A 5FXWA 3PU8A 2XASB 2M6IA 4KBMB 2KXPB 3EVYA 3FXEB 5LGTB 4B3MT 2KLQA 4TV9E 4KX6A 3GN5B 4ISTA 1WR6A 1HG5A 1H7CA 1W0BA 2LM9A 1E7PA 2VVSA 3H3AA 1FIOA 1XWMA 3KV5A 1MMAA 2IW5B 3ESLA 2J47A 4DNDA 5LJMA 5LG3A 2CCQA 5CB4E 4LFBT 2XAQB 4ZI2C 3HKDE 1G73A 3FHNA 3P4PA 2CA5A 3F57A 5AQJB 1T72A 2K48A 4U2YA 5FL0A 5JDFA 4JI1T 3AB3B 4GIWA 2VK9A 5L4EA 3QNUA 1X9BA 5DABA 5LGUB 3VKHA 3ZSSA 2XAHB 2NOXA 4QH5A 2OV9A 2IC6A 2RPAA 3W15B 4F6RC 3VHLA 3RIAA 4PJLA 1VRBA 4X1KE 3AEAA
chains in the Genus database with same CATH topology
1SUMB 2OLTA 4Q25A 2I0MA 1T8BA 2BKNA 2IIUA 2BKPA 1T72A 1VCTA 3L39A 2BKOA 1XWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SUM B;  2OLT A;  4Q25 A;  2I0M A;  1T8B A;  2BKN A;  2IIU A;  2BKP A;  1T72 A;  1VCT A;  3L39 A;  2BKO A;  1XWM A; 
#chains in the Genus database with same CATH topology
 5FY1 A;  3RC3 A;  3U3I A;  1R8I A;  4QX7 B;  4A98 A;  2K9A A;  4YSY A;  2KWI B;  2RP4 A;  1QLB A;  2W61 A;  3NRX A;  3DP7 A;  3AE4 A;  3LFM A;  4I43 B;  1U4Q A;  4E7Z A;  3ABV A;  2E2A A;  2N2N A;  3AE5 A;  1HCI A;  3AAA B;  4HFD A;  4IHJ E;  4ISS A;  4QH4 A;  4TWD A;  5EK4 A;  3TLW A;  4OK0 A;  3R6N A;  5HEU A;  1ZP0 A;  2LEH A;  3K3N A;  3MAC A;  2DI4 A;  3N2K E;  3I0Q A;  1KEY A;  4MLK A;  2CWO A;  4IDZ A;  3UU3 A;  2CPT A;  3C4Z A;  2N9D A;  2L3L A;  2V8S V;  1HTJ F;  1B7T A;  3CQG B;  3UUX B;  4WBN E;  5FY0 A;  3LG7 A;  3SRZ A;  4GKJ T;  5J2T E;  5F8P A;  2XM1 A;  2LM2 A;  3N2G E;  4HE8 A;  4O2A E;  2CHO A;  3TLT A;  3ZC0 A;  3AEC A;  4PFO A;  1HNZ T;  2LHN A;  3E08 A;  4PFP A;  5TAO A;  3EDU A;  2Z6E A;  4IDN A;  5IYZ E;  4DBQ A;  3WAJ A;  5AQS B;  5JH7 E;  4UF0 A;  4P09 A;  4O4L E;  4IDQ A;  4ZI2 D;  2LKG A;  2YDR A;  4I50 E;  4DR2 T;  2CRB A;  3PUZ F;  5FXX A;  3Q5W A;  3PUG A;  5LNK A;  2X51 A;  3RRC A;  5JTG A;  2FJA A;  4JI7 T;  2HN2 A;  1ZKE A;  1WFD A;  4I0U A;  3AEE A;  1XNQ T;  4JBW F;  3FZF B;  4C91 A;  5LA6 E;  2IDO B;  2NP9 A;  2Q9Q C;  3BQI A;  3CKD A;  4BJN A;  3PUS A;  4I55 E;  4PK5 A;  2LLY A;  3IHR A;  1OED C;  2WDQ A;  4TX5 A;  3FZL B;  3WI3 A;  3AEB A;  3JAE A;  2YDQ A;  5AQG B;  4X5T A;  4X64 T;  1US7 B;  2VL8 A;  3C4X A;  5AQP B;  4EB6 E;  2Y8D A;  2Q9Q D;  2QVA A;  3A7M A;  4AKL A;  4EXT A;  4LFA T;  1YW0 A;  4H63 H;  2IHR 1;  2BKN A;  4DV3 T;  4CZZ B;  5LOV E;  4HWI B;  2X9X A;  3BK9 A;  4EGW A;  1KK7 A;  3HKE E;  3N5L A;  2W66 A;  5IUX A;  4YT0 A;  3FB2 A;  1OED A;  5AQO B;  4YTP A;  4IDP A;  5LGN B;  2V5D A;  4QXB B;  2DL1 A;  3AED A;  3P8C D;  3X1D A;  2V7K A;  4CQI A;  4ZOL E;  3AE1 A;  3ZYK A;  2CXF A;  2XUE A;  3N9M A;  4YJ2 E;  2X9W A;  3KDS E;  2JQH A;  4JUY A;  5ABG A;  3Q5E A;  4DV0 T;  4H9P C;  4GYS A;  2LKH A;  3K3O A;  2VL0 A;  4TWF A;  3LSV A;  2JQ9 A;  5HAX A;  3ZLI A;  3I1A A;  3TLS A;  1M7K A;  2XQ9 A;  3F31 A;  3O1I A;  5HXR A;  5AQT B;  3OVU A;  3CX6 B;  4UVC B;  1L0V A;  3RIU A;  2V26 A;  4ASK A;  2XQ6 A;  4B3T T;  2WDR A;  3C4W A;  4LF7 T;  4IE6 A;  2ZM2 A;  4LF8 T;  2LJL A;  2X9H A;  2VKD A;  3OBV E;  2VQE T;  3M65 A;  3BQL A;  3E22 E;  3N2O A;  3ZCJ A;  1NWM X;  4TNW A;  3P50 A;  4DV6 T;  2UUC T;  1S35 A;  3NKZ A;  4ILB A;  1XZY A;  3PU3 A;  2V7M A;  1YQ4 A;  3AA0 B;  1D1A A;  4U7Y A;  5DJQ C;  2I6H A;  3E0Z A;  5JRE A;  4K0K T;  2YDS A;  3RLF F;  2YOE A;  2MBG A;  4UR9 A;  5ABF B;  2V6Y B;  3K1S A;  4Z90 A;  2WWV A;  5F3J A;  2CM0 A;  1IZN B;  2LOS A;  2D9D A;  3ZMU B;  1G8X A;  2N1G A;  2CE7 A;  5L47 A;  1AJ3 A;  2YK0 A;  3CQC B;  2BS2 A;  2ACZ A;  3P4W A;  2WBL A;  5HEO A;  3C50 A;  4NUV A;  4HWC A;  2W0G A;  1N33 T;  1BR1 A;  3J9X 1;  1DU2 A;  3MK7 C;  3RIF A;  1UCU A;  3LK3 B;  2LRK A;  2A9U A;  2DWK A;  2FUP A;  3P4Q A;  4OX9 T;  3HKB E;  5AQK B;  4HKA A;  4CN1 A;  2RA1 A;  5EK2 A;  3MA9 A;  4X65 T;  2LSG A;  5FL1 A;  5L3E B;  2A72 A;  4IL9 A;  1GQE A;  3EAM A;  2BVL A;  2FBW A;  4HEA A;  4A56 A;  2J4G A;  2EHO A;  2X68 A;  1SHZ C;  3SFE A;  5C3J A;  4JI4 T;  3EUH A;  2C5J A;  1LVF A;  3ONJ A;  2XQY A;  1Y64 B;  3L39 A;  4YLH A;  3AE2 A;  3ZJ1 A;  4ERR A;  2UXD T;  2ZM8 A;  3AE3 A;  3NWI A;  3MJX A;  4HTE A;  4DR5 T;  5L4H A;  3HI2 A;  4AXP A;  3PV0 F;  4L5G A;  5AQM B;  4BJM A;  3ZN1 B;  5HXH A;  4UV8 B;  5KXJ A;  3VU7 H;  3ANW A;  2J62 A;  3QC9 A;  3UUL A;  2F4V T;  1YQ3 A;  2LHR A;  4UEM A;  4ZHQ E;  1XDP A;  4X62 T;  5HEH A;  3AA6 B;  2WZH A;  2EHO B;  2HN1 A;  2LOP A;  2PG8 A;  2MOZ A;  2MYS A;  2X0H A;  3WAK A;  3ZMT B;  4YHJ A;  1FJG T;  2MTQ A;  3CML A;  1D0Y A;  2VVN A;  3DTO A;  2D2S A;  3RQW A;  4HGA A;  5AQF B;  1WCR A;  3NRY A;  4DBR A;  3EI0 A;  2LSJ A;  3PUQ A;  4IIJ E;  2LT3 A;  3AVR A;  3Q2M A;  4HWD A;  3SS1 A;  5JDH A;  3RC8 A;  2CLY B;  3FZH B;  2HPJ A;  2P9B A;  3L3P A;  4NPP A;  4QXC B;  5AQL B;  2WU5 A;  5L3F B;  4IE7 A;  3LK2 B;  1ZV4 X;  3PUY F;  3LDQ B;  3RQU A;  3ZKR A;  4M1P A;  5AQI B;  2WCA A;  3ZN0 B;  2FJE A;  2XAF B;  3CWZ B;  5ABE A;  2K5B B;  2UXB T;  5AQQ B;  4QX8 B;  5HYA A;  1BR0 A;  4DV1 T;  5JRC A;  2YU1 A;  2Y48 B;  4JYA T;  4IGU A;  3B57 A;  3TKL B;  5A1L A;  1IBM T;  2UUB T;  3AXJ B;  5AQV B;  2VKJ A;  3NZP A;  3TLU A;  1CHU A;  2V1D B;  2XSB A;  3B13 A;  1HX1 B;  4P1N A;  5F5W A;  4YFS A;  5J2U E;  2LRL A;  2X67 A;  5LBM A;  1ZHC A;  5IWA T;  4A97 A;  2V7J A;  4O8S A;  3RHW A;  4Z91 A;  5L2L A;  3N9N A;  1IJ5 A;  2DLR A;  2R6G F;  4JI8 T;  4DVD A;  1V9D A;  2YKS A;  4I4T E;  4EZH A;  5LYJ E;  1OWA A;  2BG9 A;  4ZZB A;  4JI0 T;  4DR4 T;  4NUU A;  2VKO A;  1N34 T;  2WMO A;  2EHO C;  3PUX F;  1UX5 A;  4ADZ A;  5AQR B;  4U7I A;  2Q9Q A;  3Q5X A;  2PTF A;  2WSS V;  4L0R A;  2NW9 A;  4DR1 T;  3R84 B;  4AQF A;  2XY8 B;  3KVA A;  1J5W A;  1SUM B;  1SE7 A;  2C5K T;  2K24 A;  3OKQ A;  4IRE A;  4V1A v;  2CXD A;  1QSD A;  4BAY B;  1FEW A;  2WS3 A;  3MZK B;  5LHG B;  1OXZ A;  4XAX B;  2AE9 A;  4LML A;  3PUW F;  3C64 A;  4ZI3 D;  5IHY A;  4AKR B;  4JEU B;  2CEA A;  1KFY A;  3PE0 A;  2YN6 A;  4Z8X A;  3A8Y C;  3OPC A;  5JR9 A;  4N78 D;  2WAU A;  4OYK A;  4OFZ A;  4H9N C;  4QH1 A;  2VAS A;  4KP3 C;  2NTY A;  4TV8 E;  3RKO A;  4HFC A;  4JI5 T;  4OYJ A;  2M6B A;  2WP9 A;  2E5L T;  2VKH A;  2XQA A;  2XQ7 A;  2WU2 A;  3UFG A;  5JRC B;  2C0S A;  2D5U A;  3KV4 A;  4LMK A;  3SFD A;  4G2A A;  2XAG B;  4LF9 T;  3UQ4 A;  3UFE A;  4HWF A;  3VKG A;  2OLT A;  4IE4 A;  2MPK A;  4X1I E;  3V5U A;  3ZYM A;  4UVB B;  4ZZC A;  4JI3 T;  4NXN T;  4ANJ A;  2X0L B;  3HA4 A;  4GK5 E;  1T7S A;  3PDY A;  3OYZ A;  4X20 E;  2D0T A;  3KBT A;  4H63 V;  3RPU A;  5JDN A;  3T1H T;  1LRZ A;  2UXC T;  4E7S A;  4HWH A;  3CQX C;  1EZ3 A;  5LB7 B;  2VQF T;  1NEN A;  2ZLY A;  3Q5D A;  1UK5 A;  3L09 A;  4HFI A;  5JQG E;  2CBJ A;  3UUM A;  4TZ4 C;  2Q9Q B;  4B6X A;  2KZ7 B;  4UV9 B;  4BA9 A;  4U2Z A;  2LE8 A;  2G0U A;  5AFU L;  2QYW A;  4UIG A;  4DV4 T;  1N36 T;  5AQH B;  2M67 A;  5LBQ B;  2E9X D;  4JI6 T;  4UVA B;  1YD8 G;  2CXL A;  2BVM A;  2DWG A;  1HX8 A;  4DMV A;  1LKX A;  5LHH B;  4U74 A;  4MFR A;  4MAL A;  3ETU A;  5FKY A;  5ABH A;  4ZI7 E;  3D0T A;  1HNW T;  2C5I T;  5CJ5 A;  1UUR A;  4IDO A;  1WYB A;  4KI0 F;  2WDV A;  2NW8 A;  4F8H A;  1QUU A;  4U3C A;  2LSK A;  5FXV A;  1D1B A;  3PUA A;  3CX8 B;  4EOZ B;  5JDL A;  2UXX B;  5JR9 C;  1UX4 A;  2ODV A;  3BQK A;  4TN7 B;  3ZJ2 A;  2B76 A;  1MMG A;  2LSY A;  2I59 A;  1HF8 A;  2QRX A;  4O4H E;  4P0B A;  2X0Y A;  4O4I E;  3DJB A;  3ANW B;  4PK4 A;  2NWB A;  3ZMS B;  3CPZ A;  4QWN B;  2HPL A;  4U33 A;  2E9X A;  4EEB A;  4XZC A;  2CMR A;  2ZM0 A;  3PUR A;  4AIU A;  1YXR A;  4CXX A;  1NEK A;  1X79 A;  3LK4 2;  5M4Y A;  1W0A A;  3JC6 C;  3EDV A;  4QHO A;  3RGL A;  4X66 T;  1YKE B;  2BBJ A;  4PAG A;  2H89 A;  3AEF A;  3RH3 A;  3FZM B;  5H6Q B;  2W00 A;  3RYF E;  1T98 A;  2CWY A;  4G63 A;  4U31 A;  2JPF A;  3HKC E;  2XJ7 A;  3FBL A;  3IF8 B;  5KMG P;  4ZXL A;  4HN9 A;  3GA8 A;  3I9W A;  5AQU B;  2ODU A;  1ZEE A;  3O9X A;  2PFV A;  3AA1 B;  2MAW A;  4YSX A;  1SA0 E;  1JNZ A;  5HWX A;  4DUY T;  1FMW A;  2B1E A;  2ES0 A;  1WLX A;  4WW0 A;  3AE8 A;  2KND A;  1MMN A;  3MXZ A;  4IL4 A;  1N32 T;  3HL6 A;  3O1H A;  4DV2 T;  2H7V C;  4JLE A;  3NZQ A;  4A5X A;  5LHI B;  4YTM A;  4DID B;  5GON E;  1E2A A;  5ETW A;  1VCS A;  2WB5 A;  3LBX A;  4IT4 A;  5KDM C;  5H6R B;  1Z8U A;  3PJA J;  2XQ4 A;  5HCM A;  3G06 A;  4EAH A;  2D0U A;  2BG9 C;  4DV5 T;  5JDQ A;  4PJJ A;  1XNR T;  3ONX A;  3RYI E;  3ETV A;  3ZYL A;  3J7Y q;  3ZMV B;  5L3D B;  3F2E A;  2A2F X;  1J5E T;  3OJA A;  4L9I A;  2YEV C;  1UUS A;  4DO0 A;  3HR0 A;  5FMN A;  5FVL A;  1D0Z A;  2H88 A;  2PJQ A;  4AQF C;  5CA0 E;  3N9L A;  4PK6 A;  3UUN A;  1XMQ T;  2IML A;  2FJB A;  2BS3 A;  4NIQ A;  4H9Q C;  3ZMZ B;  2Y6X A;  2UU9 T;  3VRA A;  3CX7 B;  3JAD A;  2YIN A;  3RYH E;  3UT5 E;  3I0O A;  2E9X C;  3FBZ A;  1ZOY A;  3K3Q C;  1M62 A;  3VR8 A;  3ZCI A;  1MNE A;  4P0A A;  3TLV A;  4JV5 T;  4GYR A;  3RYC E;  4GK0 E;  3UUB A;  5L3B B;  3P4R A;  5CGM A;  3KVB A;  3C51 A;  4TNV A;  1IJ6 A;  3IA3 A;  3CK6 A;  3OYX A;  5KX5 E;  1KNZ A;  4GKK T;  2IIU A;  2BG9 E;  2W62 A;  3H37 A;  3L8R A;  4COF A;  5JVD E;  5FVK A;  3RKG A;  5ADX L;  4TUY E;  3T1Y T;  2BKO A;  5JR9 B;  4KHP T;  4JI2 T;  4LMJ A;  3UU6 A;  3ZT5 A;  2J1D G;  3N9Q A;  1NAF A;  5AQN B;  3JAF A;  4LF5 T;  2HHH T;  4AQG A;  3RX6 A;  2FJD A;  3O4X E;  2QGS A;  4C90 A;  5C8Y E;  4WZX A;  1MIV A;  2BG9 B;  1XMO T;  4YTN A;  3LBX B;  4NXM T;  3UU4 A;  2OA5 A;  2XTL A;  4TWH A;  1MIY A;  4YHH T;  3UU8 A;  5LMN T;  3M3Z B;  3QUJ A;  3FZK B;  2BS4 A;  1D1C A;  2XQ5 A;  5CFB A;  4UF0 B;  3H3M A;  4ILC A;  3PTR B;  4HFV A;  5LP6 E;  4DV7 T;  2VWA A;  3QK6 A;  5HEG A;  3RF1 A;  4JEH B;  4CXW A;  4AI6 A;  2A3D A;  5DQV A;  1IBK T;  3FXD B;  2JMK A;  4HFH A;  1MMD A;  2W2U A;  2KMF A;  3KV6 A;  3AVS A;  4CI3 B;  1HS7 A;  3JCF A;  3U78 A;  2PBI A;  2X9Y A;  5HXE A;  4AKI A;  1CUN A;  3JC6 D;  1I6Z A;  3SWH A;  2KT9 A;  4LF6 T;  5JDG A;  1KNR A;  4XBF B;  1HFA A;  2V6X A;  5HXC A;  4ZI3 C;  3AAE B;  3GWH A;  4KMC A;  5LCY A;  3UTK A;  4OHF A;  2XQ8 A;  2CLY C;  3PJA A;  2DNX A;  2ZMA A;  3SOL A;  3N9O A;  2KSR A;  2ACX A;  5EK3 A;  3KBU A;  1W9R A;  2DCF A;  2IUB A;  2XZE A;  4ILA A;  4KUM B;  2VUR A;  5J1G A;  3RRW A;  5LXT E;  5HEJ A;  2E5V A;  4FJO A;  4H9O C;  2QA7 A;  2XSA A;  3LJC A;  4ILU A;  3AEG A;  4K0U A;  1T8B A;  2VB6 A;  3KFW X;  4DR3 T;  2JQK A;  4AKH A;  3O1J A;  4ZEY A;  3N9P A;  4DUZ T;  3IEE A;  3ZEF B;  1I94 T;  3KV9 A;  3ONL C;  3C98 B;  3QOF A;  2BZB A;  5FY7 A;  1JNR A;  1XDO A;  2H7O A;  2HH7 A;  3K8P C;  4CI2 B;  4PNI A;  2XQ3 A;  4ZS3 A;  4H9S E;  2I0M A;  4O2B E;  4EYY R;  4LFC T;  4YJ3 E;  3T8O A;  4YXD A;  3VRB A;  4YY3 T;  2LSI A;  2XM2 A;  4J2C A;  1HR0 T;  3B5M A;  5FXZ A;  1HNX T;  2KWH A;  2CBI A;  3QB5 K;  3VR9 A;  3Q9D A;  5L3C B;  3A5X A;  3PUV F;  2E9X B;  3AE7 A;  3AE6 A;  4U72 A;  1E1H B;  4WNK A;  4WYV A;  5HXS A;  1Z0P A;  3AA7 B;  3RIU C;  2JIW A;  2ZM6 T;  1WR0 A;  3I9Y A;  3UQ7 A;  2V7L A;  4H9R C;  4DMW A;  2BDE A;  1BR2 A;  1W09 A;  2W63 A;  4GOU A;  4HFE A;  4PJM A;  1BR4 A;  5FYM A;  4YSZ A;  2AXD S;  2DHR A;  1OED B;  2H3R A;  4IE5 A;  2UUA T;  4O4J E;  4Q25 A;  3ZST A;  2KIN B;  4EYU A;  2WQY A;  4CN6 A;  3QB5 A;  4AQY T;  1D0X A;  2V6Y A;  3CIR A;  5LG4 A;  2IC9 A;  5DQW A;  1WYC A;  4KHZ F;  5E0O A;  3NBX X;  2NR4 A;  2JMH A;  3GN5 A;  4AIS A;  2BBH A;  2L8K A;  2UXN B;  4CI1 B;  4UXN B;  2W67 A;  5HWY A;  1U5P A;  3S4U A;  1UGO A;  4MBQ A;  4UEL A;  4QXH B;  4EED A;  2V7I A;  1IAP A;  2XHE B;  3AAI A;  2WY2 A;  4X1Y E;  4CXY A;  4B3S T;  1HG2 A;  4EZ4 A;  5LMU T;  4EV6 A;  1FMV A;  3UU5 A;  4MHC A;  3RI5 A;  2XPK A;  2YU2 A;  2NTX A;  2V5C A;  4PW8 A;  5BR8 T;  1J1J A;  3P4S A;  2WWU A;  5J0Z A;  1MIW A;  3CVR A;  4QKN A;  1LVK A;  3ZT7 A;  4EIW A;  1IBL T;  5EZY E;  5FNV E;  4DR6 T;  4FI5 A;  3KIN B;  3ZC1 A;  3ZPO A;  3NVO A;  4DR7 T;  1VCT A;  2JJ9 A;  4PJN A;  4ZS2 A;  5FP3 A;  5ABF A;  2XAJ B;  5HCJ A;  3EAB A;  3EHZ A;  3P7I A;  3GMI A;  1OED E;  4IE0 A;  5CA1 E;  3OTO T;  4LF4 T;  4AKG A;  2JRK A;  2W4X A;  4WBO A;  1MND A;  2BKP A;  2X66 A;  4CN4 A;  2WM9 A;  3AXJ A;  1WRD A;  4B3R T;  2WMN A;  3AE9 A;  1O3X A;  1KNP A;  5BMV E;  3IBP A;  3ZT6 A;  2WZI A;  2GK9 A;  2EHO D;  2NW7 A;  1Y01 A;  2SPC A;  2CHN A;  2E8I A;  4HFB A;  2K3W A;  5L3G B;  2IAK A;  1YKH B;  1S94 A;  2L9Q A;  5JDM A;  3MKD A;  3V5S A;  2JQQ A;  5LJN A;  1VOM A;  5C2T A;  1KF6 A;  5FXW A;  3PU8 A;  2XAS B;  2M6I A;  4KBM B;  2KXP B;  3EVY A;  3FXE B;  5LGT B;  4B3M T;  2KLQ A;  4TV9 E;  4KX6 A;  3GN5 B;  4IST A;  1WR6 A;  1HG5 A;  1H7C A;  1W0B A;  2LM9 A;  1E7P A;  2VVS A;  3H3A A;  1FIO A;  1XWM A;  3KV5 A;  1MMA A;  2IW5 B;  3ESL A;  2J47 A;  4DND A;  5LJM A;  5LG3 A;  2CCQ A;  5CB4 E;  4LFB T;  2XAQ B;  4ZI2 C;  3HKD E;  1G73 A;  3FHN A;  3P4P A;  2CA5 A;  3F57 A;  5AQJ B;  1T72 A;  2K48 A;  4U2Y A;  5FL0 A;  5JDF A;  4JI1 T;  3AB3 B;  4GIW A;  2VK9 A;  5L4E A;  3QNU A;  1X9B A;  5DAB A;  5LGU B;  3VKH A;  3ZSS A;  2XAH B;  2NOX A;  4QH5 A;  2OV9 A;  2IC6 A;  2RPA A;  3W15 B;  4F6R C;  3VHL A;  3RIA A;  4PJL A;  1VRB A;  4X1K E;  3AEA A; 
#chains in the Genus database with same CATH homology
 1SUM B;  2OLT A;  4Q25 A;  2I0M A;  1T8B A;  2BKN A;  2IIU A;  2BKP A;  1T72 A;  1VCT A;  3L39 A;  2BKO A;  1XWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...