2I0TD

Crystal structure of phenylacetaldehyde derived r-carbinolamine adduct of aromatic amine dehydrogenase
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
Knots found
sequence length
121
structure length
120
Chain Sequence
HISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 35
structure length 120
sequence length 121
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2i0tD00
2OIZD 2IUVD 2AGXD 2J56L 1MG2B 3RN1C 2BBKL 4K3IC 2OK6D 2OJYD 1MAEL 2HKMD 4L1QC 2IUPD 2GC7B 2I0TD 4L3GC 2H3XB 2AGZD 2Q7QD 3L4MC 2AH1D 2AGWD 4FAVC 3ORVC 2AGYD 2HXCD 4L3HC 2OK4D 2GC4B 3RMZC 3PXTC 4FB1C 2IAAB 3SXTC 3SVWC 1MAFL 2I0SD 3RLMC 3L4OC 4FA5C 4FA4C 2J57K 2IURD 2MADL 3C75L 3SWSC 3SJLC 2HJ4D 2AGLD 4Y5RC 2H47B 1MG3B 2IUQD 4FA9C 1MDAL 2HKRD 2MTAL 2J55L 4FA1C 2HJBD 2AH0D 4O1QC 3RN0C 3SLEC 3PXWC 4FANC 3PXSC 2I0RD
chains in the Genus database with same CATH superfamily
2OIZD 2IUVD 2AGXD 2J56L 1MG2B 3RN1C 2BBKL 4K3IC 2OK6D 2OJYD 1MAEL 2HKMD 4L1QC 2IUPD 2GC7B 2I0TD 4L3GC 2H3XB 2AGZD 2Q7QD 3L4MC 2AH1D 2AGWD 4FAVC 3ORVC 2AGYD 2HXCD 4L3HC 2OK4D 2GC4B 3RMZC 3PXTC 4FB1C 2IAAB 3SXTC 3SVWC 1MAFL 2I0SD 3RLMC 3L4OC 4FA5C 4FA4C 2J57K 2IURD 2MADL 3C75L 3SWSC 3SJLC 2HJ4D 2AGLD 4Y5RC 2H47B 1MG3B 2IUQD 4FA9C 1MDAL 2HKRD 2MTAL 2J55L 4FA1C 2HJBD 2AH0D 4O1QC 3RN0C 3SLEC 3PXWC 4FANC 3PXSC 2I0RD
chains in the Genus database with same CATH topology
2OIZD 2IUVD 2AGXD 2J56L 1MG2B 3RN1C 2BBKL 4K3IC 2OK6D 2OJYD 1MAEL 2HKMD 4L1QC 2IUPD 2GC7B 2I0TD 4L3GC 2H3XB 2AGZD 2Q7QD 3L4MC 2AH1D 2AGWD 4FAVC 3ORVC 2AGYD 2HXCD 4L3HC 2OK4D 2GC4B 3RMZC 3PXTC 4FB1C 2IAAB 3SXTC 3SVWC 1MAFL 2I0SD 3RLMC 3L4OC 4FA5C 4FA4C 2J57K 2IURD 2MADL 3C75L 3SWSC 3SJLC 2HJ4D 2AGLD 4Y5RC 2H47B 1MG3B 2IUQD 4FA9C 1MDAL 2HKRD 2MTAL 2J55L 4FA1C 2HJBD 2AH0D 4O1QC 3RN0C 3SLEC 3PXWC 4FANC 3PXSC 2I0RD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OIZ D;  2IUV D;  2AGX D;  2J56 L;  1MG2 B;  3RN1 C;  2BBK L;  4K3I C;  2OK6 D;  2OJY D;  1MAE L;  2HKM D;  4L1Q C;  2IUP D;  2GC7 B;  2I0T D;  4L3G C;  2H3X B;  2AGZ D;  2Q7Q D;  3L4M C;  2AH1 D;  2AGW D;  4FAV C;  3ORV C;  2AGY D;  2HXC D;  4L3H C;  2OK4 D;  2GC4 B;  3RMZ C;  3PXT C;  4FB1 C;  2IAA B;  3SXT C;  3SVW C;  1MAF L;  2I0S D;  3RLM C;  3L4O C;  4FA5 C;  4FA4 C;  2J57 K;  2IUR D;  2MAD L;  3C75 L;  3SWS C;  3SJL C;  2HJ4 D;  2AGL D;  4Y5R C;  2H47 B;  1MG3 B;  2IUQ D;  4FA9 C;  1MDA L;  2HKR D;  2MTA L;  2J55 L;  4FA1 C;  2HJB D;  2AH0 D;  4O1Q C;  3RN0 C;  3SLE C;  3PXW C;  4FAN C;  3PXS C;  2I0R D; 
#chains in the Genus database with same CATH topology
 2OIZ D;  2IUV D;  2AGX D;  2J56 L;  1MG2 B;  3RN1 C;  2BBK L;  4K3I C;  2OK6 D;  2OJY D;  1MAE L;  2HKM D;  4L1Q C;  2IUP D;  2GC7 B;  2I0T D;  4L3G C;  2H3X B;  2AGZ D;  2Q7Q D;  3L4M C;  2AH1 D;  2AGW D;  4FAV C;  3ORV C;  2AGY D;  2HXC D;  4L3H C;  2OK4 D;  2GC4 B;  3RMZ C;  3PXT C;  4FB1 C;  2IAA B;  3SXT C;  3SVW C;  1MAF L;  2I0S D;  3RLM C;  3L4O C;  4FA5 C;  4FA4 C;  2J57 K;  2IUR D;  2MAD L;  3C75 L;  3SWS C;  3SJL C;  2HJ4 D;  2AGL D;  4Y5R C;  2H47 B;  1MG3 B;  2IUQ D;  4FA9 C;  1MDA L;  2HKR D;  2MTA L;  2J55 L;  4FA1 C;  2HJB D;  2AH0 D;  4O1Q C;  3RN0 C;  3SLE C;  3PXW C;  4FAN C;  3PXS C;  2I0R D; 
#chains in the Genus database with same CATH homology
 2OIZ D;  2IUV D;  2AGX D;  2J56 L;  1MG2 B;  3RN1 C;  2BBK L;  4K3I C;  2OK6 D;  2OJY D;  1MAE L;  2HKM D;  4L1Q C;  2IUP D;  2GC7 B;  2I0T D;  4L3G C;  2H3X B;  2AGZ D;  2Q7Q D;  3L4M C;  2AH1 D;  2AGW D;  4FAV C;  3ORV C;  2AGY D;  2HXC D;  4L3H C;  2OK4 D;  2GC4 B;  3RMZ C;  3PXT C;  4FB1 C;  2IAA B;  3SXT C;  3SVW C;  1MAF L;  2I0S D;  3RLM C;  3L4O C;  4FA5 C;  4FA4 C;  2J57 K;  2IUR D;  2MAD L;  3C75 L;  3SWS C;  3SJL C;  2HJ4 D;  2AGL D;  4Y5R C;  2H47 B;  1MG3 B;  2IUQ D;  4FA9 C;  1MDA L;  2HKR D;  2MTA L;  2J55 L;  4FA1 C;  2HJB D;  2AH0 D;  4O1Q C;  3RN0 C;  3SLE C;  3PXW C;  4FAN C;  3PXS C;  2I0R D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...