2I0TD

Crystal structure of phenylacetaldehyde derived r-carbinolamine adduct of aromatic amine dehydrogenase
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
Knots found
sequence length
121
structure length
120
Chain Sequence
b'HISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 35
structure length 120
sequence length 121
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2i0tD00
1MAFL 2AGLD 2IUQD 2BBKL 1MG2B 2IURD 4FB1C 2I0TD 2IAAB 4FA1C 4FAVC 2Q7QD 2HJBD 4O1QC 2OJYD 3SLEC 3PXWC 3SWSC 3RN0C 4L1QC 3ORVC 4L3GC 2I0RD 4Y5RC 3RN1C 2IUVD 3PXSC 4K3IC 4FA9C 3RLMC 4FANC 2GC4B 3L4OC 2HKRD 2AGWD 1MG3B 2J55L 1MDAL 2I0SD 3PXTC 2OIZD 2AGYD 2OK6D 2AH0D 2HJ4D 3C75L 3SJLC 2H47B 1MAEL 3RMZC 2AGXD 2H3XB 2OK4D 2GC7B 4FA4C 3SVWC 2HKMD 3SXTC 2MADL 2J57K 2MTAL 2AGZD 4FA5C 2HXCD 2J56L 2IUPD 3L4MC 2AH1D 4L3HC
chains in the Genus database with same CATH superfamily
1MAFL 2AGLD 2IUQD 2BBKL 1MG2B 2IURD 4FB1C 2I0TD 2IAAB 4FA1C 4FAVC 2Q7QD 2HJBD 4O1QC 2OJYD 3SLEC 3PXWC 3SWSC 3RN0C 4L1QC 3ORVC 4L3GC 2I0RD 4Y5RC 3RN1C 2IUVD 3PXSC 4K3IC 4FA9C 3RLMC 4FANC 2GC4B 3L4OC 2HKRD 2AGWD 1MG3B 2J55L 1MDAL 2I0SD 3PXTC 2OIZD 2AGYD 2OK6D 2AH0D 2HJ4D 3C75L 3SJLC 2H47B 1MAEL 3RMZC 2AGXD 2H3XB 2OK4D 2GC7B 4FA4C 3SVWC 2HKMD 3SXTC 2MADL 2J57K 2MTAL 2AGZD 4FA5C 2HXCD 2J56L 2IUPD 3L4MC 2AH1D 4L3HC
chains in the Genus database with same CATH topology
1MAFL 2AGLD 2IUQD 2BBKL 1MG2B 2IURD 4FB1C 2I0TD 2IAAB 4FA1C 4FAVC 2Q7QD 2HJBD 4O1QC 2OJYD 3SLEC 3PXWC 3SWSC 3RN0C 4L1QC 3ORVC 4L3GC 2I0RD 4Y5RC 3RN1C 2IUVD 3PXSC 4K3IC 4FA9C 3RLMC 4FANC 2GC4B 3L4OC 2HKRD 2AGWD 1MG3B 2J55L 1MDAL 2I0SD 3PXTC 2OIZD 2AGYD 2OK6D 2AH0D 2HJ4D 3C75L 3SJLC 2H47B 1MAEL 3RMZC 2AGXD 2H3XB 2OK4D 2GC7B 4FA4C 3SVWC 2HKMD 3SXTC 2MADL 2J57K 2MTAL 2AGZD 4FA5C 2HXCD 2J56L 2IUPD 3L4MC 2AH1D 4L3HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAF L;  2AGL D;  2IUQ D;  2BBK L;  1MG2 B;  2IUR D;  4FB1 C;  2I0T D;  2IAA B;  4FA1 C;  4FAV C;  2Q7Q D;  2HJB D;  4O1Q C;  2OJY D;  3SLE C;  3PXW C;  3SWS C;  3RN0 C;  4L1Q C;  3ORV C;  4L3G C;  2I0R D;  4Y5R C;  3RN1 C;  2IUV D;  3PXS C;  4K3I C;  4FA9 C;  3RLM C;  4FAN C;  2GC4 B;  3L4O C;  2HKR D;  2AGW D;  1MG3 B;  2J55 L;  1MDA L;  2I0S D;  3PXT C;  2OIZ D;  2AGY D;  2OK6 D;  2AH0 D;  2HJ4 D;  3C75 L;  3SJL C;  2H47 B;  1MAE L;  3RMZ C;  2AGX D;  2H3X B;  2OK4 D;  2GC7 B;  4FA4 C;  3SVW C;  2HKM D;  3SXT C;  2MAD L;  2J57 K;  2MTA L;  2AGZ D;  4FA5 C;  2HXC D;  2J56 L;  2IUP D;  3L4M C;  2AH1 D;  4L3H C; 
#chains in the Genus database with same CATH topology
 1MAF L;  2AGL D;  2IUQ D;  2BBK L;  1MG2 B;  2IUR D;  4FB1 C;  2I0T D;  2IAA B;  4FA1 C;  4FAV C;  2Q7Q D;  2HJB D;  4O1Q C;  2OJY D;  3SLE C;  3PXW C;  3SWS C;  3RN0 C;  4L1Q C;  3ORV C;  4L3G C;  2I0R D;  4Y5R C;  3RN1 C;  2IUV D;  3PXS C;  4K3I C;  4FA9 C;  3RLM C;  4FAN C;  2GC4 B;  3L4O C;  2HKR D;  2AGW D;  1MG3 B;  2J55 L;  1MDA L;  2I0S D;  3PXT C;  2OIZ D;  2AGY D;  2OK6 D;  2AH0 D;  2HJ4 D;  3C75 L;  3SJL C;  2H47 B;  1MAE L;  3RMZ C;  2AGX D;  2H3X B;  2OK4 D;  2GC7 B;  4FA4 C;  3SVW C;  2HKM D;  3SXT C;  2MAD L;  2J57 K;  2MTA L;  2AGZ D;  4FA5 C;  2HXC D;  2J56 L;  2IUP D;  3L4M C;  2AH1 D;  4L3H C; 
#chains in the Genus database with same CATH homology
 1MAF L;  2AGL D;  2IUQ D;  2BBK L;  1MG2 B;  2IUR D;  4FB1 C;  2I0T D;  2IAA B;  4FA1 C;  4FAV C;  2Q7Q D;  2HJB D;  4O1Q C;  2OJY D;  3SLE C;  3PXW C;  3SWS C;  3RN0 C;  4L1Q C;  3ORV C;  4L3G C;  2I0R D;  4Y5R C;  3RN1 C;  2IUV D;  3PXS C;  4K3I C;  4FA9 C;  3RLM C;  4FAN C;  2GC4 B;  3L4O C;  2HKR D;  2AGW D;  1MG3 B;  2J55 L;  1MDA L;  2I0S D;  3PXT C;  2OIZ D;  2AGY D;  2OK6 D;  2AH0 D;  2HJ4 D;  3C75 L;  3SJL C;  2H47 B;  1MAE L;  3RMZ C;  2AGX D;  2H3X B;  2OK4 D;  2GC7 B;  4FA4 C;  3SVW C;  2HKM D;  3SXT C;  2MAD L;  2J57 K;  2MTA L;  2AGZ D;  4FA5 C;  2HXC D;  2J56 L;  2IUP D;  3L4M C;  2AH1 D;  4L3H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...