2I0YA

Cfms tyrosine kinase (fgf kid) in complex with an arylamide inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
316
structure length
289
Chain Sequence
VRWKIIESYESYTFIEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKRQLSSRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cFMS Tyrosine Kinase
publication title Crystal structure of the tyrosine kinase domain of colony-stimulating factor-1 receptor (cFMS) in complex with two inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 289
sequence length 316
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2i0yA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2i0yA01
2PVNA 4MXXA 4RLLA 5A4EA 1WBTA 5A4QA 3CD3A 3R7VA 2YWVA 5E4HA 4EORA 3CKXA 4BIBA 3TDVA 5HI2A 3M2WA 3A61A 2YAKA 1YXVA 3ORMA 4E4XA 1H4LA 5HE2A 4PP9A 3R02A 4C7TA 3QALE 5HE0A 3P7CA 2PE1A 4E6CA 5L8KA 2JAMA 3BYVA 3QXOA 3SOCA 3VBYA 3ZDIA 3SRVB 5K9IA 1U59A 3VUDA 3R63A 4UMRA 4KIKA 4TNDA 4FEVA 1W7HA 3BEAA 4O96A 4BL1A 1NXKA 4F0IA 3U6IA 4G9RA 3UP2A 3EIDA 3DQXA 4YSMA 3VS1A 3E63A 3WYXA 3JVSA 2QNJA 2HZ4A 3VVHA 3ZHPC 2IVSA 4E3CA 4F0FA 3TN8A 4KIPA 5KMLA 3R83A 3PTGA 3GENA 4U6RA 2YAAA 3ELJA 3VQHA 2FB8A 3QRJA 4NL0A 4E4NA 1S9IA 2R9SA 1W8CA 4EK4A 1FGKA 3M42A 3H0ZA 3AD5A 3PA4A 4IB0A 4RJ7A 5L2TA 3Q32A 4OTPA 1A48A 3D5WA 3P7BA 3D5XA 5IZFA 3LOKA 2HELA 1W82A 1J7IA 3KGAA 4L68A 3OTUA 1DS5A 3O2MA 3BEGA 3ORTA 3FMEA 4AGCA 3BRBA 5AR3A 3PXRA 3DNDA 3I4BA 3QUEA 4GG5A 3OG7A 4KSPA 4U81A 3LXKA 5AV2A 3ATTA 3KFAA 5AX3A 5A9UA 3Q2JA 1MRYA 2ZDTA 5LARA 4FIEA 3A99A 3HMNA 4LYNA 3FMLA 4B8LA 4HVGA 5K5XA 4O7SA 4Y8DA 2OXYA 5EHLA 5L8JA 3UO4A 4DBNA 3MY0A 3R8VA 3ET7A 1F0QA 4WNKA 2QODA 2PZPA 4TN6A 3ZO2A 1H07A 3Q9ZA 1IRKA 4IFGA 2W1FA 3MGYA 4DF3A 3QCQA 4RJ3A 5EM7A 4CT2A 4EUUA 3VULA 1YDTE 5IA0A 2P33A 3GU8A 3HRBA 1BI7A 1H28A 5K4IA 4GUEA 5HVYA 3ZEPA 4XNEA 3DXQA 3I5ZA 5HBJA 5HTBA 4OAVB 4EEVA 5HICA 2Z7QA 3C0GA 3UYTA 4TL0A 3E8EA 1OKVA 3W2RA 4YO6A 3PLAE 3BGQA 3BLRA 4NIFA 3UIXA 3GNIB 3PRIA 3ZUVA 3I1AA 3HMOA 3Q2MA 3CEKA 1UU3A 3DGKA 1Q97A 2O64A 4I4EA 3NUSA 4GJ2A 4LI5A 3PJ8A 4ANLA 4TPTA 3FZRA 3CTQA 2V22A 3TKIA 3IG7A 4MXAA 5BQ0A 4TRLA 4RX8A 4YZMA 2VTNA 3NYVA 3BI6A 2JAVA 3R7GA 2BILB 4EQCA 3QTRA 1F5QA 2WTDA 5ANKA 5FG8A 5LWNA 4FTRA 4L7SA 5AUWA 5H8BA 4ENXA 2GFSA 4E73A 1XH4A 2LGCA 4QMNA 4YR8A 1CM8A 2VTSA 5CQUA 2X81A 5DEYA 4JX3A 4M15A 4I6HA 3SRVA 2OZOA 3F6XA 4IB1A 3OS3A 4IAZA 5AM6A 4D4VA 4CLIA 1CTPE 3G6HA 1IR3A 4BCQA 2QHMA 4RWIA 4G34A 5CXZA 5AMNA 4R78A 5KUPA 1H26A 3C9WA 4QTAA 4U79A 4ZTHA 5EQPA 2XKDA 3ACKA 1Q3WA 1J3HA 3LCOA 4ITIA 3W2SA 5JKGA 2ETRA 3EYGA 4ENYA 5K4JA 3NYXA 4O38A 5HE3A 3FI8A 2HZ0A 4R5YA 2VO3A 2XYUA 3IO7A 2E9UA 3R7YA 4C37A 5IUGA 4D58A 5FD2A 2Y0AA 4O7TA 2X2LA 1U54A 1PYEA 5IH5A 4AQCA 3OY1A 3IS5A 4FTCA 3RAKA 3AQVA 4L3LA 3B8QA 4RVLA 3WOWA 2ZB1A 3UPXA 4AOJA 4CQGA 2X2MA 5JFVA 2JEDA 3REPA 4I94A 3L8SA 4IANA 5FXSA 3IDCA 3LCTA 2PUUA 4E4LA 4AUAA 3HECA 4FV3A 4NH1A 1H1QA 5CSPA 4ZAUA 3EL7A 3R8UA 2PK9A 2CKEA 5E8UA 5F20A 4WSYA 4FF8A 4IAAA 4UWYA 5KHWA 2DYLA 3C51A 1Y91A 3TCPA 1YOJA 4XP2A 3IK3A 5DPVA 3PSDA 3QLFA 3U8WA 2ITZA 3QQLA 3F3WA 2W4OA 2GFCA 2YCFA 1Q8YA 2PYWA 3NUUA 3R1NA 3ZDUA 2QOLA 1H1SA 3THBA 4F7NA 5HORA 2FSLX 2YN8A 3MYGA 5IQHA 5A3XA 3W2QA 5AV3A 4EJ7A 2W17A 5CSHA 3UDBA 1H01A 4TWNA 5DG5A 3TG1A 5EM5A 1WZYA 5EQYA 4GMYA 3NUAA 3VBWA 1SMHA 1YXSA 2BHEA 3BGZA 4PX6A 4F7SA 1Q61A 3LJ2A 4FTMA 4FGBA 5CU0A 2BRGA 5TOZA 2PULA 3MPTA 4G6LA 1G5SA 5ANJA 5BVFA 4RT7A 3ZM4A 3W32A 4I6FA 2YIWA 5DHJA 1Q8UA 4W4VA 3VO3A 4EL9A 4DINA 3ZO1A 3OY3A 3QQJA 4G3FA 4JAJA 5F9EA 4L53A 5ITAA 4XV3A 4W8EA 4DGLC 3IDPA 4HJOA 3GCSA 3NR9A 3CSVA 5M08A 2VTHA 4RRVA 2AYPA 4AN3A 5HIBA 1UU8A 3T3UA 3HP5A 3EN5A 3V3VA 5IDPA 2A27A 2IW6A 4ZSEA 4AN2A 3EWHA 2CLXA 2Y6MA 3DB6A 4IVDA 1GNGA 2VO6A 1P4FA 1TQMA 2B52A 1P2AA 4IXPA 3NX8A 4JL9A 3QTXA 4RWJA 3UQGA 2BDWA 5KCVA 4KA3A 3FI2A 4APPA 2EVAA 4FSNA 2WMXA 1H25A 3V8SA 4EI4A 2P2IA 5CWZA 3GQIA 2WTVA 3HV5A 2F4JA 5B0XA 1KE7A 5I3OA 3NAYA 3OWKA 3SAYA 2JKMA 2WO6A 3PJ3A 4RIYB 3HEGA 2UW6A 3LLTA 3UC3A 4D5KA 5EW8A 4GT3A 1W83A 2ZM3A 3EJ1A 1Q4LA 3CY3A 3EQRA 4JVGA 4NCTA 1YRPA 4GFGA 4P2KA 5EM6A 2FVDA 3O8UA 4CCUA 3ZO3A 5GINE 4XJ0A 5HEZA 5FTGA 4BR3A 4GT5A 3VF9A 4IIRA 4E8AA 2F9GA 3AC5A 3DB8A 4Y83A 1LPUA 2GHMA 4L52A 4U7ZA 3R7IA 4RJ5A 3K5VA 3BU3A 4O2ZA 4I5CA 3DJ5A 3CPBA 1OECA 2PZYA 3I0QA 4K18A 2JDOA 4FV1A 3ZXZA 4EK3A 4BDEA 5KZIA 3FC1X 2QR7A 2ZJWA 1J1CA 3ORPA 4GL9A 3RPVA 5JT2A 1XBCA 3ITZA 5CF5A 3C4XA 4TYHB 4BZNA 2XKCA 4R3CA 4ZTNA 5JRQA 2JFMA 3LFNA 4FTNA 4DEAA 4Y72A 5GZ9A 4MQ1A 3L9MA 2OICA 5IMXA 3HMPA 2C3KA 1PYXA 4HOKA 3BBTB 4XBRA 3TTJA 1LUFA 1H8FA 1Y6AA 5IEYA 5JFSA 3RKBA 3EQBA 2HZNA 2R3FA 4GYGA 4NK9A 4QMSA 2WMUA 5CY3A 1PXNA 2A19B 3TJDA 5BMSA 4BTKA 3NVKI 4TYEA 1WBWA 1XH8A 3B8RA 3C7QA 4ZTRA 3R7OA 2GQRA 4FV6A 2CCIA 3M1SA 4C59A 4N57A 4NWMA 4AFEA 2NRYA 3ULIA 3TDWA 5DFPA 3TI1A 1Q8ZA 4LMNA 5CASA 2KTYA 3AC1A 1DI8A 2F7EE 3ZU7A 1IA8A 3SG9A 1P5EA 4I6BA 4FIIA 4YLJA 4HGTA 5AADA 3D5VA 4JDIA 1PXJA 1XBAA 1M2RA 4BDGA 4QYFA 2C6IA 4U80A 3VBXA 1BUHA 2RIOA 2ZB0A 3RHXA 4HVHA 5L2IA 4EZ7A 3UOLA 2ONLC 2QKRA 3EOCA 4IVAA 3ZFMA 3MVJA 5L6WL 4QMPA 2I0VA 3PDTA 1SVEA 2ERZE 2REIA 3DLZA 4J95A 1WCCA 4XH6A 3DDPA 2FGIA 4LL0A 3Q3BA 5HESA 5JGDA 4YNOA 3LKMA 5BMMA 4PL4A 3FMDA 4HGSA 2QONA 3O50A 3ZLXA 2Q83A 5JH6A 4E7WA 1KE5A 4BTMA 1Z57A 2LAVA 4G9CA 3CCNA 4UYNA 2XKFA 3CP9A 1OBGA 2OF2A 5LMKA 2WQOA 3MPAA 5GZ8A 2PMIA 4A9SA 3NAXA 4QT1A 2EXMA 2C6TA 3QTSA 4J99A 4A4OA 2YDJA 2RKUA 4UZDA 4FEWA 3WE4A 4IX6A 3NUPA 1WBVA 3WIKA 5HD4A 3R28A 4TW9A 4FT9A 5HVJA 2XUUA 3GEQA 3LMIA 4MXYA 4LRKA 3OCBA 5EM8A 1E9HA 3RALA 3ZOSA 3UGCA 1PXOA 1LP4A 3DK7A 3F5UA 3G90X 2R7BA 4KWPA 4M0ZA 4MNFA 4RIYA 2XEZA 4JIAA 4ACMA 4QYGA 4E1ZA 3WF5A 5L8LA 4IQ6A 1FBNA 4JT3A 5EG3A 5GIOE 2W9FB 5EKOA 2J50A 3TTIA 4RIWB 4GV1A 3QKMA 2R3MA 3CS9A 2WEIA 2OG8A 3VS0A 4DHFA 5A14A 4IWDA 1OB3A 3DKCA 5CSXA 3COKA 3Q04A 4RVKA 3E93A 4FKIA 5B2MA 2BTSA 3QHRA 4CMUA 4USDA 5KMOA 4UMUA 2YERA 2W96B 3G33A 5M56A 4OTDA 2IW8A 4W8DA 4DN5A 5JZJA 4FX3A 1EH4A 2Z8CA 3QTIA 4FKTA 1FQ1B 5E7RA 3MI9A 3LVPA 5AFVA 5CANA 4IAYA 4CEGA 5GZAA 4FVRA 3F82A 3COMA 1ZWSA 4M84A 4ZP5A 5DN3A 3VS4A 4XG9A 5AR7A 3ID6C 2YM3A 2PY3A 3DKGA 4IACA 4PP7A 4FIFA 4UMQA 2WTJA 1ZMUA 4FV9A 2PVMA 3A8WA 4QTEA 5M53A 2ITVA 4U43A 2OW3A 3EN7A 3FKNA 4RPVA 3Q6WA 3SD0A 3D4QA 3MH1A 5A4CA 3DAKA 5E8XA 4A06A 3NNVA 3ALNA 5HGIA 2BCJA 2C5XA 3E8CA 3E88A 4MHAA 2J6MA 3H10A 1KV2A 3UIMA 3LQ8A 4D0XA 3IPHA 4FG9A 4WA9A 3RAIA 3OOGA 4GK4A 4C02A 5HQ0A 4AZEA 3LFQA 3OCSA 3ORLA 4EBVA 2YCRA 4V0GB 5DEWA 3VW8A 1OM1A 3HZTA 3KMWA 4ORKA 5E8ZA 4B9DA 1OL5A 3PXZA 3KXXA 3LAUA 4HPTE 4DFZE 1APME 4ZTMA 1R3CA 4JBQA 2PWLA 2EXCX 3IQ7A 2XMYA 3MPMA 4JBPA 4FNZA 5HKMA 3AG9A 1OGUA 2HENA 4MH7A 1J91A 4EHEA 4YHTA 1WVYA 4E4MA 3HAMA 1YOLA 3FMKA 5AAFA 2ITYA 3H9OA 3OUNB 4AP7A 2PPQA 4FV5A 5HO7A 2ZMCA 1PMEA 1SNUA 3F3VA 3VS7A 2XCHA 3HL7A 3FLNC 2PUPA 2XJ0A 4IZ5A 4JG7A 3VUHA 2ITPA 2FSMX 3R21A 3HNGA 3LFBA 2BR1A 4BCMA 4R8QA 3RPYA 2A0CX 2GNJA 2I40A 2H34A 2UZUE 2XNBA 4A4XA 4J71A 3C4FA 1R0EA 3GGFA 3LXLA 1FVTA 4FKLA 4O2PA 4AA4A 5KO1A 2BIYA 3Q60A 4BDIA 3HLLA 3UOHA 4FG8A 3BHYA 4CZTA 3OWJA 5L6OA 4S2ZA 4QP3A 2XEYA 2FYSA 4PDOA 3WZDA 4DGGA 3LLAA 4DT8A 1BMKA 1LR4A 3PZHA 2GTMA 3KCKA 4O1PA 3ZLYA 3R9HA 3UO5A 3LFCA 1ZRZA 2YHVA 3F7WA 2XM8A 4PWNA 5H8GA 3F66A 1Q41A 4OGRA 4OBQA 4UY9A 4FKRA 5E8TA 4I23A 4FTTA 3HV7A 5EYMA 3OCTA 3KY2A 4PPCA 4FKQA 4LOOA 2VWWA 2WKMA 2BKZA 3R7EA 4G3GA 3R7UA 4AT5A 2OJJA 4LGHA 4QMZA 3TIZA 4G5JA 4JG8A 3VUGA 3W2PA 3DK3A 3R00A 4FEUA 3VIDA 4A9TA 3KN5A 3DTCA 2XRUA 3QF9A 4GEOA 4IMYA 4JQ8A 4RC3A 3CKWA 4DFBA 2FA2A 4HNIA 4AWIA 3SDJA 4EOLA 2BMCA 4KRDA 4GIIA 4TYJA 5A6OA 4D5HA 5KBRA 3JR1A 3IW7A 3H9RA 3EL8A 4AA0A 2UW3A 1OIYA 3SG8A 4UBAA 2QU6A 3UIBA 1DAWA 4IDTA 4EH7A 4F63A 4LV5A 3D7TA 4H3PA 2C0TA 4YGAA 5DNRA 5DH3A 3RNYA 1Q5KA 2I0HA 5M07A 3KULA 4QO9A 2NPQA 1YXTA 2OJ9A 4I20A 2GNGA 4C4IA 4CG9A 3D2KA 3W2OA 1OMWA 4EH4A 5LOHA 3ZMMA 3G51A 3MFSA 5F94A 4J1RA 3QC9A 3RJCA 4WG3A 3FQEA 5FP5A 2DWBA 2HWOA 2QOKA 4EWHA 4F9CA 4P90A 3H9FA 2R5TA 3FBVA 3UO6A 1GAGA 5JGAA 1FINA 1FVVA 4GIHA 1T45A 2W5HA 3P79A 4OTFA 2J5EA 4V0GA 5HCXA 3DJ6A 4BCPA 2EB3A 4WUNA 3KXZA 3GI3A 3QQUA 3AMBA 5AP5A 4NTTA 2W4JA 3A7HA 3DU8A 4D2WA 4NKSA 3V5JA 3DS6A 1BI8A 4LG4A 2WD1A 4E5AX 2XB7A 3FSFA 4JAIA 1B6CB 4O7LA 4ANMA 3BCEA 4O22A 5LCJA 3WARA 4QP6A 3DV3A 4ZLOA 3UODA 4C35A 4XG2A 4XG8A 3KA0A 3PY0A 2R4BA 1A06A 3RWPA 3V5PA 5J5TA 2O65A 2Z2WA 1WAKA 4GS6A 3R1YA 4UZHA 3S95A 3MFUA 4AA5A 1ERKA 2O3PA 3MVHA 5IUIA 4EOMA 2E9OA 4B7TA 2C5NA 4BCJA 3EQIA 5JGBA 2C6EA 3BX5A 4F1OA 4E26A 3R0TA 2WMBA 3RI1A 3PPJA 3PY3A 4ZZMA 2E9NA 3MH3A 4NYEA 4OTHA 5I9XA 4NSTA 3V04A 1ZLTA 4NZWB 5AIRA 4CFXA 2CN5A 1Z5MA 1SYKA 4W4YA 2QOFA 3D9VA 4CXAA 4F1TA 4TTHB 2C68A 2VWBA 1PXMA 2JKKA 3HP2A 4FT5A 4KNBA 3F5PA 4LOPA 2PMNX 2WU7A 3QU0A 5F4NA 4DH5A 4ZTLA 3JS2A 5EW3A 2BZHB 5L2SA 3PY1A 4PMPA 3MTFA 1S9JA 4YBKA 5IU2A 3ZFXA 2F2UA 3O96A 4O83A 4CLJA 1SM2A 3I7BA 3LFDA 4NIFB 2XBJA 5E91A 3VW6A 3O51A 3P4KA 4M97A 3DNEA 4GU9A 3KEXA 4I0RA 4U45A 5I9UA 2OXXA 5IA2A 5A6NA 4MCVA 2ETKA 3MWUA 4UMPA 1VYWA 1ZOGA 4M8TA 3TEIA 3OCGA 5EYDA 3ZTXA 3OW3A 1UWHA 5J7HA 1RDQE 2QD9A 3NW5A 4ZEGA 2WTCA 4IW0A 2WMTA 1M52A 3I60A 4L42A 1OZ1A 4FOBA 4CMOA 4GRBA 3QX4A 4R3RA 5EI2A 2NO3A 4BB4A 2UZWE 2EUFB 2VWXA 2PMOX 4X2KA 5FRIA 3VS3A 4FSRA 4GW8A 4U40A 4CKIA 2ZV7A 4PV0A 4QTCA 2QCSA 4BWPA 3UZRA 1PHKA 3ACJA 3U51A 3CE3A 3DZQA 4BDBA 3DJ7A 3C0HA 4CRSA 4Q9ZA 2O63A 3OXIA 1E1XA 3Q52A 4LL5A 4Z55A 5FXRA 1Y6BA 1U5QA 4MNEA 4XV2A 4MXOA 1DI9A 3D94A 4L9IA 4FK3A 4YJNA 5EH0A 5AUXA 1IAJA 5HNIX 4DCEA 4U97A 2IO6A 3LCDA 4MQ2A 4X7QA 3RM6A 3CBLA 4I93A 4II5A 3NS9A 4LGGA 4M66A 3WF7A 4D2RA 4TYIA 4IZYA 3I6WA 2V55A 2Y8OA 4U3YA 3QZGA 3QRIA 1PXPA 3W55A 3T3VA 1H0WA 2WFYA 3B2TA 4BHNA 2BRMA 4FSZA 4JRNA 4W4WA 1JBPE 3P1AA 2VGOA 1A9UA 3NIZA 2IZSA 2CGUA 1E1VA 2ZV8A 2JBPA 3SXRA 4A4LA 4BBFA 1U54B 4IWPA 1H1PA 5IA3A 1ZOEA 2CGWA 4OW8A 4YSJA 5K3YA 3OT8A 3AGLA 3VUTA 2OJFE 1IEPA 3MIYA 2P2HA 4RJ4A 2WXVA 1AGWA 2QQ7A 2CJMA 3GBZA 3LFSA 3P7AA 3PXQA 4M67A 3OF0A 3WF6A 1NT2A 3U87A 3ORZA 1M17A 3COIA 3DK6A 4J7BA 5AEPA 1REKA 4OTWA 4RFMA 4L3JA 3ZSGA 5FQDC 4H3QA 4FSQA 1TKIA 5AUVA 5HBEA 5DMZA 2VO7A 3IGGA 3SLSA 3KC3A 4G1WA 2UZOA 1YOMA 3E7VA 1YI3A 3G0FA 1OIUA 3MS9A 5KMJA 5EDPA 1DAYA 5IKWA 4KSQA 3ZEWA 1QPDA 3FI4A 5IA5A 5GHVA 2ZDUA 4AGWA 1YVJA 1XH5A 2F7ZE 4AOTA 3PXKA 5C8NA 4WNMA 5EDRA 4ZTQA 1WMKA 3Q5ZA 4KBAA 4R7IA 4ANOA 3FYKX 4YJOA 4HVDA 3TUBA 5T3QA 3TJCA 4GSBA 4BN1A 3OHTA 4X3FB 2WMSA 4G6NA 4M0YA 3SX9A 3H30A 1RW8A 5KMIA 3W16A 4WG5A 3ZC6A 3G6GA 5CU6A 5KKRB 3KXNA 3QA8A 1PKDA 1VJYA 3QD0A 3VF8A 4K0YA 4EH8A 4C58A 2ITNA 3QX2A 4V01A 4E5BA 2QURA 1JVPP 4YZNA 4F65A 3KXHA 4B0GA 3VWAA 5EYKA 3D14A 3WZKA 3EQFA 3MN3A 5AUUA 5IEVA 2QR8A 4K33A 3Q4ZA 3RPOA 3K54A 4WRGA 1OIQA 3UNJA 2WTIA 4QMXA 5G6VA 3F88A 1W84A 4C4JA 3C5IA 4CZUA 3Q6UA 3KMMA 5JMSA 5CVGA 5HG7A 4U3ZA 2X39A 3R2BA 4NEUA 3GQLA 2VV9A 4PTGA 4FIJA 5D12A 4QPAA 2PE2A 5FM2A 2HAKA 2B0QA 2UW0A 3ZZEA 1HOWA 5E9EA 3ZZWA 1XQZA 3BGPA 3PWYA 1R1WA 3R9DA 2UW4A 4BY9E 4K1BA 3QCYA 4MF1A 5AR5A 4BWKA 4FTAA 5DT3A 2W05A 4IAKA 5LCKA 5AM7A 3FPMA 2R3LA 5LVMA 3HV4A 4L43A 1GJOA 3BHUA 3WF9A 3IW6A 4OUCA 4QTBA 4C33A 4C62A 3AMAA 4C4FA 1OUKA 5HCZA 4F08A 3PXYA 4LGDA 4N4SA 3W10A 4O84A 4R7BA 4RZVA 2VWVA 2WQBA 4XOZA 2XNMA 4IM3A 3PUPA 5BPYA 3ZONA 2WOTA 1OPLA 4FV2A 4QQJA 3OMVA 5FBOA 1YWRA 1TQPA 3GFEA 2O8YA 4FA2A 2X1NA 3UYSA 4IM2A 4DTKA 2XCKA 2OWBA 1JPAA 4ITHA 4JQEA 2R3JA 5IQIA 3P9JA 5IQBA 4DEDA 3SC1A 3LIJA 2QO9A 2GNHA 4FT0A 5FBNC 4AFJA 4D1XA 4U8ZA 4EHVA 5HTCA 3OROA 4EYMA 5J79A 3L8XA 3EQGA 3FE3A 3JY0A 3LFEA 4MBIA 3RCJA 5J95A 4AZVA 5CEOA 5AR8A 1G8AA 4S31A 4EZ5A 2R3QA 3UVQA 4ALVA 4DEEA 3I7CA 4O7WA 3TL8A 1ZYSA 4PTCA 2VNYA 5F1ZA 2I7QA 1PJKA 4JBVA 4JG6A 2QOIA 1Y8GA 1V0PA 2JDSA 2WMRA 4IAIA 1YXUA 3FL4A 4NM7A 4G17A 4XG7A 5TF9A 2IJMA 5HU9A 2C0OA 4JLCA 2W7XA 4RQVA 4Z16A 2BVAA 4C36A 1JSVA 3L1SA 4FL1A 4A9UA 4PPBA 2VTAA 2Y4IB 3OXTA 3D83A 3GXLA 2PTKA 4IE9A 1WBNA 2Q0NA 3QQGA 4O0UA 4ZSLA 3GU7A 4X3FA 5BVWA 1V1KA 5AIKA 4HZRA 3BHTA 3QFVA 5DT0A 2YDKA 3FHRA 1GZNA 3PRFA 5H3QA 3RM7A 3KVWA 3W33A 4Z3VA 5J9ZA 5ANGA 4F4PA 4WG4A 5HO6A 3KL8A 4AW1A 2WPAA 3FMJA 4ZJJA 3ZH8A 4O0SA 4UN0C 2O0UA 3UQFA 5FWKK 3T9TA 4MXZA 4ANQA 5HLNA 1SNXA 3QZIA 4FEQA 2GQSA 2HXQA 2C5VA 3GUBA 2PVJA 3RZFA 2BDJA 3KU2A 4DC2A 5IPJA 2VN9A 4YC8A 1H00A 2QO2A 5E90A 2VRXA 3DBDA 3OFMA 4F99A 3R73A 3KF7A 2J51A 4DG0E 3K3JA 3CPCA 5CT0A 4K2RA 4EOOA 2PVFA 4I41A 5AP3A 2Y6OA 4ASEA 5CAPA 3V8TA 1B39A 1WBPA 4H1JA 4QTDA 4CTCA 2GHLA 2NRUA 2BUJA 3BE9A 3NGAA 4BCIA 4H05A 3TZMA 4AZWA 4B99A 3VBVA 1K9AA 3QD3A 4KUJA 4ACCA 4FT3A 2ZOQA 3CTJA 5M4CA 2W5AA 3KK9A 3TZ8A 4GH2A 2V62A 3N4TA 1MUOA 4EK5A 3IW4A 4Q5EA 2QOOA 3QYZA 4GJ3A 4KS8A 5J5SA 3HRFA 4O7NA 4IB3A 4W4XA 3IW5A 2F57A 5TT7A 3U4UA 3SKCA 4OAUC 4O0WA 2VGPA 4FV4A 5CEQA 3V5LA 3S3IA 3G0EA 4PL5A 3EZVA 5A4TA 2HY81 4BIEA 1JKLA 3QTQA 3F2RA 3R01A 4DEHA 4FZFB 4MVFA 3MVLA 2W9ZB 3OT3A 5D7VA 5J9YA 2VTLA 4XOYA 3JUHA 4GT4A 3UG1A 4BCGA 2G01A 4GCJA 4MXCA 4PF4A 3I79A 4TWOA 2JBOA 5TO8A 2P0CA 3BIZA 4NKAA 5HLWA 4BBEA 4FYOA 2A2AA 2FUMA 4JBOA 4IM0A 3QD4A 1JSTA 1VZOA 2UZVA 3UMWA 3UNKA 2PVKA 4OBPA 5CVHA 4BF2A 3HAVA 5LXMA 1H0VA 4I3ZA 2JDTA 2OZAA 3QGWA 2PVHA 2WMWA 3AT3A 3BQCA 3EKKA 1K2PA 2ITOA 4ZSJA 4D2TA 1PW2A 4LUEA 4H1MA 5DT4A 5IQFA 5FXQA 3R9NA 3NW6A 3L9LA 5AX9A 2B7AA 5EOLA 4XRJA 4ANBA 5K0KA 3SOAA 3U9NA 4TWPA 2X0GA 4IFCA 4P5QA 4BCHA 4BTJA 1ZYJA 5E92A 3ENHA 4DH1A 4GK2A 3DLSA 5H9BA 4Y5HA 3VHEA 1ZZ2A 2W1HA 5AP7A 4YTCA 3QL8A 2BAJA 1UVRA 5GNKA 2C4GA 2W1GA 3UC4A 3WI6A 2I0EA 3GU6A 4H3BA 3K3IA 4CKRA 3LM0A 4EYJA 2YDIA 4BGGA 2G1TA 2OI4X 3MA6A 4B4LA 4BDJA 4ITJA 3KKVA 5EK7A 3RTPA 4F9BA 4ZS4A 4N0SA 4QP9A 5HX8A 3ZO4A 3DT1A 4FR4A 5JSMA 4M68A 2HK5A 3E62A 4C38A 5AAGA 2JITA 4FTJA 3W1FA 4CKJA 3TNHA 1UWJA 1WFCA 3IDBA 3QUPA 1NY3A 3PP1A 2VAGA 1H1WA 3V01A 2J5FA 2VTOA 3MY5A 3R22A 5LMBA 4DA5A 2VTPA 4FSYA 2WB8A 1M7NA 2BROA 1XJDA 3R1QA 3FKLA 2WZJA 5CS6A 5M4FA 5ANOA 4ARKA 1RQQA 4FNYA 4QMUA 4WIHA 5LVLA 5E1EA 3OBJA 4KB8A 4AW2A 2FSTX 3AGMA 1PRYA 2AUHA 3QXPA 4RG0A 2YLEA 2DUVA 4DGOA 3GU5A 4HW7A 4XG3A 4ANNA 4YP8A 5FDPA 2CDZA 4TYGA 3ALOA 3OBGA 3ORNA 4BBMA 5BX0A 5CEMA 2A1AB 1YXXA 3EN4A 4KD1A 3NUXA 5BVEA 1PXLA 2R3NA 3B2WA 3HV3A 2NP8A 2V7OA 3LZBA 1ZY5A 4WSQA 4BDCA 3OD6X 3LQ3A 4PTEA 4IX5A 4EKKA 2HXLA 2UUEA 3OTVA 4X2GA 2QVSE 3FUPA 3PG3A 4IDVA 5C01A 3MW1A 3ZSHA 1X8BA 5CEKA 4RVMA 2UW8A 1R39A 2IVVA 4CFMA 4C61A 4M7IA 3ZFYA 4F1MA 4PUZA 3DKFA 4J8NA 4GFMA 2WNTA 1KE6A 3FLSA 2QLQA 5JRSA 3TZ7A 3E64A 4E93A 1UKHA 3CJFA 2G2HA 3P08A 3SXSA 4L45A 3EFKA 4IX3A 4RC2A 4S34A 2HZIA 4XCUA 5AAEA 4JX7A 4AW0A 3LQ5A 4XBUA 4FKUA 3GVUA 3HV6A 1H24A 1Q3DA 4AACA 3D15A 4FICA 3GC0A 4XS2A 3BV2A 2HOGA 3PJCA 5E1SA 3GU4A 3MV5A 4K6ZA 3RPRA 4U9AA 1PY5A 3QRUA 3PPKA 1AD5A 5EQEA 4C57A 3C0IA 2Q0BA 4QQTA 4GKHA 3AD4A 4FIHA 1MQ4A 4DTBA 5K0XA 3QLGA 4EWQA 2XJ1A 4A9YA 2X4FA 3FMMA 4O27B 4PRJA 2WMVA 4XLVA 3NDMA 2BIKB 2J0LA 4YHFA 4I22A 4TXCA 3P5KA 1ZY4A 1R78A 2YABA 2JIUA 2VTIA 2YA9A 3QKLA 4PQNA 1OVEA 3GC9A 4WNPA 3TV7A 5GJFA 1YW2A 5B7VA 1OL6A 5LVPA 5EDQA 2XH5A 4MD7E 1DM2A 3G2FA 5M51A 3O7LD 3O8PA 4O0RA 4JDKA 4RX5A 4FC0A 5CQWA 3D7TB 5CU3A 3DAJA 2R64A 1ZMWA 2RFDA 4W9WA 4X2FA 4ACHA 3LXNA 5M06A 3KULB 4FODA 4FSTA 4U5JA 5CAVA 5M4UA 4FE2A 5C27A 2RFEA 3EN9A 3I81A 3GCVA 4FI1A 5DR6A 1UNLA 3AXWA 1JAMA 2RFSA 2PHKA 3NYNA 4J97A 4YZDA 4NCTC 3T9IA 2RSVA 2HY0A 3UBDA 1BKXA 4WD5A 1U4DA 4CT1A 1M2PA 3PP0A 5E8VA 4CFUA 4QPSA 5I9VA 4FSUA 3FQSA 4J52A 4MF0A 4YJPA 1B38A 5DOSA 4BDHA 2BKKA 4DLIA 3R8MA 3UE4A 3ZUUA 2J9MA 2YFXA 3QQHA 5FEEA 3RK7A 4KKHA 1PXIA 2E9VA 4IZAA 4ZZOA 3WYYA 5C26A 5IMEA 5LJJA 3FLYA 3NUNA 4J53A 3HMIA 1CMKE 3E5AA 5DR2A 2XZSA 5C03A 4D9UA 4O21A 5DLSA 1MRUA 5CF4A 4I5PA 3UMXA 2R0IA 4JDJA 4L8MA 4U44A 3FHIA 3EHAA 2W0JA 4J8MA 4X0MA 3VAPA 4E6AA 2J0KA 4F7LA 3IGOA 3S00A 3QQKA 4GK3A 5HBHA 2B55A 4M14A 3DPKA 4S30A 4EC8A 2HW7A 5L3AA 4RX9A 4CGAA 4FSWA 2C5YA 4Q5HA 3ENMA 2ZV9A 3FLWA 4LUDA 2YIXA 3CQWA 3OZ6A 4TNBA 2Y4IC 5CNOA 3RZBA 4AN9A 1GY3A 4IVCA 4B8MA 3C4ZA 4G3CA 3RCDA 4BKYA 5FTOA 3MB6A 5CI6A 3C50A 5AUYA 2PSQA 3DFAA 3FY2A 4JI9A 1IAHA 4EK6A 1P4OA 4FUYA 5IQEA 4KBCA 3CY2A 2C6LA 3JXWA 1XWSA 1PKGA 3ULZA 4DFYA 3EYHA 4BKJA 4IWOA 3E8DA 3MVMA 3UOKA 3IKAA 3KQ7A 4FEXA 4QMYA 3VS5A 5D11A 4YTFA 2RL5A 4JIKA 2GS7A 2Z02A 4MX9A 5AA8A 5JN2A 5HZNA 4NT4A 5DYJA 1URCA 5ANEA 5IA4A 2YITA 4AG8A 4CFWA 4DTAA 4WO5A 3GC7A 2OXDA 4G5PA 3FYJX 5M57A 3O71A 3R1SA 3T8OA 4D4YA 5KMNA 3UVRA 2BZJA 3ZYAA 4HYIA 1LEWA 3GCQA 3R8LA 2W99B 5A4LA 3FPQA 3HA8A 5EHYA 4OTGA 1AQ1A 3NPCA 3QC4A 2GSFA 4QMMA 4ZJIA 1KOBA 4YO4A 4BKZA 3FMHA 3DXNA 4AX8A 5LMKC 4BC6A 4CFNA 3U54A 1KE8A 1WVWA 3HDMA 3C13A 4AAAA 5HHWA 3GP0A 2JKQA 2CN8A 4N6YA 5CEIA 4IBMA 4C0TA 2QOHA 4XX9A 4BI0A 1FMOE 1Q24A 3QCSA 2PU8A 4ZZNA 3UPZA 1YHVA 3TUCA 2PZ5A 3MTLA 3G15A 3KXMA 4KKEA 2VWIA 5J7BA 2B9FA 3R9OA 3UVPA 2VU3A 4FMQA 4RA4A 4DFNA 3RAHA 2J0JA 4YPDA 3EQHA 2RFNA 1SZMA 2UW9A 4H58A 4MNEB 4YC6A 2YCQA 2O5KA 3ANRA 3FC2A 2OH4A 3MIAA 4I5HA 2GMXA 4X6RA 3ZXTA 5JK3A 1G3NA 2GNIA 4O7RA 2ZMDA 5CTPA 4NM0A 5IDNA 3OC1A 4YJVA 3RP9A 5CXHA 3AC2A 1YHWA 3WZUA 4CQEA 4GYIA 1IG1A 1U5RA 4GVAA 5CALA 2BAKA 1HCKA 3P23A 5CU4A 4IB5A 3PVGA 5BVDA 4L7FA 5KE0A 5BYYA 2OKRA 2G2IA 3BYUA 3FJQE 3VBQA 5ICPA 5AV0A 2WGJA 4C4HA 3V6SA 2V7AA 4BCFA 3C4EA 3OW4A 1M14A 5ETAA 4YJUA 3L8VA 3FXXA 4HYUA 2JD5A 3S1HA 3QYWA 5HG5A 4O6EA 2GQGA 1XKKA 2R3OA 3BE2A 4R1YA 5H8EA 3QWJA 3KREA 4G31A 4ZSAA 4DT9A 2GNLA 3CQEA 3R2YA 3EFLA 3TNPC 2IZRA 4JR3A 2BZIB 4DFUA 3BPRA 3TZ9A 3KN6A 3CQUA 3AT4A 4GUBA 1ZXEA 5LMAA 3FZTA 3ZLSA 3NCZA 4I0TA 2I0YA 4PNIA 2HW6A 4S32A 3Q5IA 3MY1A 4FZAB 4L3PA 3FKOA 4MKCA 1M2QA 2XK3A 3Q4UA 4EH3A 4UB7A 4S33A 4MAOA 3SHEA 3CR0A 2F2CB 3PA5A 4IH8A 3RWQA 1YDSE 5CZHA 3U4WA 3VS2A 1GIHA 3F7ZA 1OL7A 2UZNA 4F0GA 5HOAA 4HVIA 4NM5A 3ORIA 3QKKA 4ZJVA 4O0XA 4H39A 3KRJA 4EH6A 4Z7GA 1KSWA 2XNOA 2ITUA 2C47A 2YISA 3NZ0A 2VX1A 1WBSA 2B1PA 3UG2A 3OEZA 3ZRKA 5DBXA 5IISA 4HVSA 2UW7A 5CU2A 4QP8A 5FLFA 2GDOA 4EHGA 2VTJA 1KV1A 1JKSA 2YZAA 4XHKB 4OR5A 3AOXA 3KK8A 5HD7A 5I9ZA 3PG1A 4FVPA 5AV4A 2XYNA 5ETIA 4AGDA 3KB7A 3FZOA 3E87A 3NWWA 4YZCA 3V51A 4Y73A 4C2VA 3EN6A 3UP7A 3FWQA 1ATPE 4RIXA 2YM4A 5BNJA 1RJBA 1O6LA 1M7QA 4EOJA 1GIIA 4OLIA 2Z60A 5I0BA 4BICA 1VYZA 3WZEA 2CNVA 4BCNA 3AC4A 2XIYA 5HE1A 4XUFA 3A7IA 2NNWB 3DDQA 5JEBA 2X6DA 5EOBA 3NRMA 5J1WA 1KE9A 1OUYA 4YJSA 4IC8A 4PNKA 3SGCA 2ITXA 2C3LA 2R0UA 5GJGA 1UA2A 1URWA 4IJ9A 3KRWA 3QWKA 5FEQA 3FEGA 2SRCA 4PDYA 3HUCA 3PA3A 2XBAA 3DQWA 2BRNA 5KZ0A 3PJ1A 2WHBA 4QOXA 3UIUA 4BTFA 4O0VA 4R6VA 4AE9A 2C1AA 3Q9XA 2JLDA 5AJQA 4CV9A 4O7VA 4BVUA 2R2PA 3FQHA 4Y46A 4Z9LA 3SXFA 5I9YA 4D2PA 3QBNA 2WQNA 3DCVA 3PWDA 5D10A 4MBLA 3ZUTA 4M69A 1FPUA 4WUAA 4A9RA 3AD6A 1MRVA 1ZZLA 4LM5A 2YJRA 4FK6A 3HDNA 2XK9A 4I24A 4YLKA 5LVOA 3JY9A 1ZARA 1O9UA 3II5A 3PLSA 4G2FA 3PYYA 1G8SA 2I1MA 1P14A 4Y85A 1JOWB 1QPJA 5EI8A 4ASZA 4ALUA 5BUIA 3BLHA 3ODZX 3LE6A 4MEDA 4ZIMA 2J90A 3C5UA 3HA6A 3LXPA 5IH6A 3W8LA 2CMWA 1U46A 2WQMA 2YWPA 3OUKA 3OEFX 2EXEA 4RBLA 3TT0A 3RINA 4YUQA 1IA9A 2X8EA 3MH2A 1XBBA 3SW4A 5H2UA 5FTQA 4EQUA 4YTHA 2IWIA 2YM5A 5J87A 5ACBC 3O7LB 3COHA 2R3RA 3WIGA 4WBBB 1FOTA 2BRHA 5E8WA 4ACGA 4C4EA 2QC6A 2P4IA 1WBOA 3TKUA 3LCSA 5FEDA 2XK6A 3RK9A 3TIYA 2PZIA 3FI3A 4XP0A 4WRSA 3FZSA 5HIDA 3DKOA 3L9PA 3RBWA 2WEVA 1BYGA 2BAQA 3UJGA 4A7CA 5M4IA 3QRKA 4QNYA 3PIYA 4ZMFA 4FOCA 5GJDA 4AZSA 4ZK5A 3GOKA 2Z7LA 3VC4A 4ONAA 3ZRMA 1UNHA 3LFFA 5JQ8A 5EFQA 4BDFA 4F7JA 3BWJA 3BYSA 4J98A 3JVRA 4LMUA 5AR4A 5JZNA 2PUNA 4I6QA 3E3PA 4KBKA 4MWHA 3PPZA 4P4CA 3LJ1A 4P5ZA 1XH7A 4ASDA 3A60A 2XP2A 3CXWA 3QQFA 4LQMA 2VO0A 3BLQA 1SVHA 3G9LX 1XR1A 3H4JA 4HYSA 2WU6A 1XH6A 4KAOA 5J1VA 4FZ6A 4M3QA 2XIZA 4TKSA 5G1XA 5CAOA 5HIEA 5B2KA 2C6MA 3Q96A 2QHNA 5M44A 5D41A 3FLZA 3DFCB 3TM0A 4JNWA 3BHHA 3PVWA 4AU8A 4C2WA 4F6WA 3ZM9A 5E8SA 4UXQA 2XNNA 4AF3A 3BYMA 4GG7A 4U41A 5CF8A 3NEWA 5I5ZA 1YKRA 4AOIA 2PVYA 3EFWA 2X2KA 4FKSA 4OT6A 2HYYA 3CGOA 4MWIA 2UZTA 4F9WA 5LWMA 3EH9A 4FNXA 4RMZA 1JLUE 1IASA 4XMOA 3I5NA 3QAME 5J8IA 2BDFA 3VS6A 2WMQA 4IVBA 3K2LA 3VUIA 5DR9A 5HTIA 5CSVA 3ZC5A 1OL1A 4FG7A 3H3CA 4LRJA 3CC6A 4C34A 4O81A 4FBXA 4IC7A 3G9NA 4U42A 3VJNA 4FIGA 4ASXA 5IUHA 4IEBA 5DI1A 1UU9A 2CCHA 1FVRA 3HRCA 4C4GA 5CAUA 4XP3A 1L8TA 3LCKA 2PVLA 2CNUA 2VWZA 3F9NA 2XM9A 3N51A 4AT3A 4FGRA 2CHLA 3K5UA 1Q62A 2W1CA 3VN9A 4PDSA 3BZ3A 3PVUA 3CLYA 1UKIA 3NYOA 4IHPA 2YZLA 2W1ZA 3ZCLA 1GIJA 4EC9A 1WVXA 4YZBA 4UEUA 2YIRA 2WTKB 1V0OA 2HWPA 3ZBFA 4AS0A 2J0IA 2W5BA 4CTBA 4EUTA 1HCLA 4I21A 3HYHA 2KULA 1UV5A 5EHOA 4DEBA 3A4OX 2UZBA 2DQ7X 2X9FA 1QMZA 2X7FA 3AMYA 4L00A 4HGEA 2C6DA 1Q8WA 2OH0E 5FP6A 4FZ7A 5L2WA 2OZAB 1YQJA 4O0TA 4RLKA 3OWPA 4F70A 2ZAZA 3IOPA 3N9XA 2B53A 3LJ0A 2XK8A 3L9NA 4FKWA 3GB2A 5GIPE 1MP8A 3ANQA 4AZFA 4NW6A 3UNZA 4ZY6A 5A46A 3EQPA 2UW5A 2Y7JA 2XIXA 5LVNA 3DBCA 3OP5A 4CZYB 2CLQA 2W1EA 3N4VA 4CSVA 2GPHA 4AZTA 4EHZA 3JPVA 4FSMA 4ID7A 5EYCA 3QZHA 4ZMEA 2J0MB 1OITA 5DA3A 3D2IA 4UXLA 3A7FA 4O1OA 2C0IA 4RGJA 4DYMA 3LMGA 3LPBA 4XEYA 3V5QA 4C8BA 4FKGA 3S0OA 4R77A 4GVJA 4IZ7A 1JNKA 1ZOHA 2ONLA 4N70A 2B9HA 2JDVA 4PY1A 4OT5A 3L8PA 4BDAA 3QD2B 4QP7A 4YU2A 4O6LA 2PL0A 2B4SB 3BYOA 5EW9A 2OIBA 2V0DA 3FLQA 3VNTA 4BGHA 4QP2A 3OXZA 3QRTA 3QTUA 5CYIA 4EH2A 2YEXA 3NUYA 3UOJA 2R3IA 1CSNA 2OGVA 4GU6A 1REJA 3M11A 4BWXA 2QI8A 5CEPA 4K9YA 2JDRA 2FO0A 2IG7A 4YJRA 1STCE 3IONA 4DH7A 4DLJA 4CRLA 4X21A 2G2FA 5ETFA 1QPCA 3I0OA 5BUJA 1PMUA 2F49A 3UTOA 3TNQB 2OJGA 4FTQA 3E92A 4NJ3A 4RC4A 1CKIA 4DEIA 1ZAOA 4H36A 4Y5QA 3KMUA 2JFLA 4OBOA 2HCKA 2GNFA 2VD5A 2X7OA 2X9EA 5L2QA 4C3FA 4D55A 4KINA 4NFNA 3OOMA 3VUKA 3GCPA 3IW8A 5AP6A 2DS1A 4RSSA 4OTRA 3UZPA 4EBWA 4FYNA 4RZWA 2XK7A 2PE0A 1H08A 1W0XC 4RA5A 3V5WA 1JWHA 3ZRLA 2OF4A 5KMMA 4HYHA 3KVXA 4Z7HA 5JQ5A 1XH9A 5KMKA 5IA1A 4NU1A 1GZ8A 2IVTA 4RJ8A 5BVNA 4RX7A 1GZKA 5FDXA 2ESMA 3WILA 5AA9A 4XRLA 2RF9A 3ODYX 4YPSA 5KX8A 5DIAA 4ZSGA 3SA0A 3R8PA 1ZMVA 3I6UA 2X6EA 4HZSA 4TT7A 5AP1A 4X2NA 3RNIA 3CTHA 2EWAA 3U55A 4YHJA 4O91A 1NW1A 2XK4A 2OLCA 3NNUA 2QO7A 2BRBA 4X3JA 2UZDA 3ATSA 2JIIA 2RG6A 2BZKB 1OPKA 1QPEA 2G15A 2OFVA 4LOQA 4QMOA 1UNGA 2ITQA 3A62A 2X8DA 3VUMA 4I92A 4DITA 4ZOGA 4QPMA 2XIRA 4Y95A 5KBQA 5JFXA 2W1IA 3A4PA 3RPSA 4O7YA 4TY1A 3NW7A 5CNNA 3PSCA 1CKPA 5C9CA 1ZYDA 1Q8TA 3EQDA 2GCDA 3Q9YA 5L4QA 2IVUA 4RWLA 5HO8A 5KHXA 2ACXA 3TWJA 3ERKA 4X6QC 3UZTA 4EJNA 3MSSA 2W06A 2EB2A 3F3UA 4WHZA 2VTTA 2PZRA 3F3ZA 3FAAA 3NNWA 3ROYA 4BYIA 2C1BA 4C3PA 4DEGA 2BALA 4BZOA 2V5QA 5AUZA 3LHJA 3ETAA 1J1BA 4UALA 5CX9A 5T68A 3H0YA 4L44A 3IOKA 5DGZA 5AR2A 5TKDA 2GTNA 1VEBA 4O7ZA 3CIKA 4I1ZA 3F5GA 3LFAA 4EOSA 5C4LA 4BI1A 3FMNA 1T46A 3VRYA 1YHSA 5CVFA 5JFWA 4BRXA 2GS2A 5CF6A 3PVBA 5K5NA 1NA7A 2OU7A 4L01A 4N6ZA 3F5XA 4V05A 2ITTA 2OSCA 1NVQA 4OTQA 3OVVA 3U6JA 5HLPA 4FT7A 3GC8A 3PXFA 4K8AA 1JQHA 2X4ZA 4QYEA 5DVRA 5T6KA 3R71A 3NSZA 4E5WA 2RGPA 1Z9XA 2VX3A 3NMUF 3WZJA 5D9HA 2HIWA 1KOAA 3BU6A 5IF1A 4APCA 2WIPA 4ERWA 2X7GA 5BYZA 2VWUA 3POZA 4HNFA 2CKOA 4NW5A 4MD9E 4YNEA 1YDRE 3BWFA 4K11A 5IQDA 2PVRA 1GOLA 3O0GA 1Y8YA 2C6KA 3MH0A 4YURA 5IG1A 3O23A 5IH4A 4EK8A 3KF4A 2Y4PA 3AT2A 2UVXA 4EONA 4ZLZA 4BCKA 5CSWA 5C8MA 1BX6A 1JKKA 1ZYLA 2BTRA 5L6PA 3DBQA 4WT6A 3VJOA 3Q9WA 1RE8A 5BVOA 2JC6A 2OK1A 2QOCA 4KABA 4EOIA 1XHAA 4MTAA 2WTWA 5I3RA 4PMTA 4DH3A 3IECA 3NLBA 4FTLA 4NJDA 4X3FC 2YIYA 4XYFA 2CGXA 4TZRA 3E8NA 4DH8A 5KKRC 3ZS5A 4PDPA 3MFTA 4RIOA 4ZY5A 4BCOA 5EKNA 4I0SA 2ZVAA 4RWKA 2OBJA 4CFVA 5IQCA 3HUBA 4BDDA 2QG5A 3LMHA 2H96A 1FMKA 2C69A 2WAJA 4R5SA 1V0BA 4LRMA 4F6SA 1PMNA 2QKWB 3PIXA 4RQKA 5EI6A 4EOPA 2ETMA 1L3RE 4RFZA 4I5MA 3AC8A 4DGNA 4JRVA 1PF8A 4O86A 1YWVA 2W1DA 2YIQA 2XKEA 4JQ7A 5AV1A 3FSKA 2VWYA 4QP1A 4EOQA 2UZLA 3BELA 3KRRA 2XNPA 2AC5A 4DFXE 4O82A 3TACA 2WMAA 4EZ3A 3MA3A 3CD8A 4HCTA 3A8XA 3RK5A 3FZ1A 5M55A 1OPJA 4YC3A 4D28A 3NVMB 2JGZA 3P86A 3VBTA 3ZBXA 4G3DA 3RHKA 2YJSA 5IQGA 4BGQA 3GOPA 5TE0A 5HU3A 4KRCA 4QMQA 4NTSA 4QP4A 2QU5A 4ZTSA 1W98A 4U0IA 3DY7A 2ZM4A 4FTUA 3DOGA 4CYJA 2C3IB 1MQBA 2XNGA 3BKBA 3MB7A 4CFFA 4XV9A 5AUTA 4YLLA 1JSUA 1BL6A 1J7UA 4FTKA 4QQ5A 4HCUA 4TYHA 4J96A 4QRCA 3RVGA 2QOQA 3R30A 4JJRA 2WTKC 3W2CA 2QG7A 2FH9A 2VTRA 4G6OA 1H1RA 4GKIA 4JR7A 1BLXA 2BHHA 3EMGA 3QTZA 4Q9SA 2XS0A 4KIOA 1I44A 2BFYA 3F3TA 3MJ2A 4M13A 4ZXTA 4FTIA 3NCGA 5BYLA 5A54A 2GS6A 4DCAA 4F9YA 2G9XA 3FL5A 3DZOA 5AP0A 2QOBA 4D0WA 3SVVA 1H27A 5D7AA 1Q99A 3V5TA 4ALWA 3DXPA 4CYIA 3E7OA 3V6RA 4IJPA 1OKWA 2QLUA 4O0YA 4YZ9A 2Y9QA 2P3GX 3NNXA 4OTIA 2YM6A 3FY0A 4NM3A 4RFYA 4AGUA 2ZV2A 3O8TA 4CMTA 4D4SA 1OKZA 2PMLX 4USEA 3O17A 3DBEA 2CPKE 2CGVA 3P0MA 3QHWA 3Q53A 4M12A 4LFIA 4BI2A 5AP4A 5B2LA 1LEZA 3HGKA 1XO2B 4MK0A 2I6LA 4ZS0A 2OIDA 3RGFA 4ERKA 4P7EA 1R0PA 5HG9A 3MBLA 4CG8A 4KIQA 4JS8A 4E6QA 4QMVA 5HCYA 3SQQA 1K3AA 2B54A 3HVCA 3MESA 2UZEA 4QD6A 1KWPA 3PJ2A 3POOA 4ACDA 2J4ZA 5HG8A 3A2CA 4QMWA 2IW9A 3A7JA 4DGMA 4DG3E 2VTMA 1PMVA 1YI6A 3R6XA 4FL3A 5E8YA 3R04A 2C6OA 3U6HA 4L46A 4UWBA 4HCVA 1TVOA 3HX4A 5D1JA 2WELA 1YWNA 4BYJA 2UVYA 4FNWA 5HNBA 4G16A 4XG4A 5FGKA 4ANSA 3JYAA 3PFQA 4CNHA 2YM7A 2R3GA 4NFMA 3TNWA 3VHKA 3BQRA 3QZFA 4PMSA 4BIDA 5FUTA 4QYYA 2XJ2A 1SVGA 4JXFA 2H8HA 2C3JA 3F2NA 4USFA 4CVAA 3F61A 5J9LA 2WQEA 3BV3A 2ERKA 3P78A 3QTWA 2JIVA 2EU9A 4XLIA 4L67A 5DRBA 1OKYA 4IAFA 1CKJA 2H9VA 5CT7A 5ANIA 5DWRA 1O6KA 2R3PA 4R7HA 2FSOX 1OL2A 2X8IA 4RIXB 3KRXA 5C8KA 3F2AA 1BL7A 4PL3A 4RIWA 5TR6A 3C4CA 5BVKA 3Q4CA 4XG6A 4C3RA 4DFLA 5DE2A 4DBXA 3PZEA 3U9CA 2BFXA 2UV2A 1QCFA 1NVSA 3KRLA 4FZDB 3DTWA 4WBOA 3TXOA 5HVKA 5ETCA 3DBFA 2XIKA 2XNEA 4PPAA 4R3PA 4E6DA 4G3EA 3A7GA 3ORXA 2W4KA 3FXWA 4I4FA 1FGIA 3PIZA 4DAWA 2C5OA 4RVTA 3KCFA 4MD8E 3BBWA 4QYHA 4QMTA 3FZPA 3VRZA 4AXAA 3W18A 5AWMA 3C4WA 4EH5A 3ZSIA 4IX4A 4D2SA 5ANDA 2IN6A 4A07A 1PXKA 4F9AA 1ZYCA 4QNAA 2RG5A 2OJIA 4M69B 5M09A 3GCUA 1O6YA 4UV0A 3RAWA 3ZLWA 3S2PA 4UYAA 4FV8A 5AP2A 2J7TA 2WOUA 2R3HA 2XVDA 1OIRA 3FDNA 2R3KA 1KUTA 5F95A 2VX0A 3PE1A 4L6QA 5C4KA 2PUIA 4YBJA 3EFJA 3BU5A 3FV8A 2OIQA 3MDYA 4Q2AA 3QUDA 4KIKB 4DG2E 4BDKA 4FKJA 4HPUE 3ROCA 3R8ZA 4CCBA 2F7XE 4F6UA 2R7IA 3HKOA 4EQMA 1JKTA 5HX6A 4DE4A 4FUXA 4BHZA 2E2BA 3VQUA 1VR2A 2O2UA 2IZUA 4PMMA 2ITWA 5BUEA 4HGLA 3LM5A 2YM8A 5CLPA 1NVRA 3WF8A 5LQFA 1OI9A 3KXGA 4KS7A 2YLFA 2YACA 2XF0A 4MYGA 2ZYBA 4YJTA 3WBLA 4E20A 2XRWA 3FXZA 3SW7A 1GZOA 5IQAA 4JOAA 4FV0A 2JKOA 2AC3A 5CAQA 3HMMA 1J7LA 5CENA 4UMTA 4CD0A 4X2JA 3GT8A 2CSNA 3G5DA 4FL2A 3ORKA 3F69A 2C30A 4WNOA 5CZIA 3SV0A 3D0EA 4FTOA 3TV6A 3D7ZA 3N4UA 5DRDA 1F3MC 3GFWA 4FKVA 4IWQA 1ND4A 4AW5A 3PE2A 4FVQA 3TKHA 5FM3A 3W8QA 2VZ6A 2IZTA 3UQCA 3EKNA 2E9PA 1OBDA 3EQCA 4YJQA 2OFUA 4QQCA 3QCXA 2GHGA 4B6LA 4D1SA 2XA4A 1I09A 3E3BX 3QGYA 4FV7A 3V8WA 4BZDA 5KNJA 2OO8X 3DAEA 2J2IB 4QMLA 4W9XA 4WOVA 3PSBA 4FKOA 3TNIA 2IPXA 2A4LA 2VTQA 4IADA 4MBJA 3WE8A 4GFOA 4CV8A 4UX9A 2CKQA 3QA0A 5I9WA 3DA6A 3MFRA 1UU7A 2WIHA 4TWCA 4D1ZA 4F64A 5IEXA 4JDHA 4NUSA 2BPMA 4D2VA 3LW0A 2B9JA 3CGFA 2UVZA 3CJGA 4RJ6A 5HNGA 3MJ1A 4D4RA 4EH9A 1YI4A 5I4NA 5CI7A 2VNWA 4V04A 2CKPA 2B9IA 4EOKA 2VUWA 3AC3A 3OWLA 5ACKA 3C1XA 3R9RA 4AT4A 3Q4TA 4KKGA 3D5UA 3EB0A 1CDKA 4AE6A 4EKLA 4F09A 4LV8A 4YMJA 4R1VA 2Z7SA 4YTIA 4XV1A 4D9TA 4ZLYA 4K77A 3TV4A 2P55A 4FKPA 1QL6A 3EZRA 1Y57A 3TUDA 4ZY4A 2H6DA 2ZM1A 4WKQA 5C1QB 3RMFA 2GU8A 2YCSA 3BHVA 3NIEA 4UWCA 4BFMA 3S4QA 2Z7RA 1TQIA 2CNQA
chains in the Genus database with same CATH superfamily
2PVNA 4MXXA 4RLLA 5A4EA 2AEGA 1WBTA 5A4QA 3CD3A 3R7VA 2YWVA 5E4HA 4EORA 3CKXA 4BIBA 3TDVA 5HI2A 3M2WA 3A61A 2YAKA 1YXVA 3ORMA 4E4XA 1H4LA 5HE2A 4PP9A 3R02A 4C7TA 3QALE 5HE0A 3P7CA 2PE1A 4E6CA 5L8KA 2JAMA 3BYVA 3QXOA 3SOCA 3VBYA 3ZDIA 3SRVB 5K9IA 1U59A 3VUDA 3R63A 4UMRA 4KIKA 4TNDA 4FEVA 1W7HA 3BEAA 4O96A 4BL1A 1NXKA 4F0IA 3U6IA 4G9RA 3UP2A 3EIDA 3DQXA 4YSMA 3VS1A 3E63A 3WYXA 3JVSA 2QNJA 2HZ4A 3VVHA 3ZHPC 2IVSA 4E3CA 3BLAA 4F0FA 3TN8A 4KIPA 5KMLA 3R83A 3PTGA 3GENA 4U6RA 2YAAA 3ELJA 3VQHA 2FB8A 3QRJA 4NL0A 4E4NA 1S9IA 2R9SA 1W8CA 4EK4A 1FGKA 3M42A 3H0ZA 3AD5A 3PA4A 4IB0A 4RJ7A 5L2TA 3Q32A 4OTPA 1A48A 3D5WA 3P7BA 3D5XA 5IZFA 3LOKA 2HELA 1W82A 1J7IA 3KGAA 4L68A 3OTUA 1DS5A 3O2MA 3BEGA 3ORTA 3FMEA 4AGCA 3BRBA 5AR3A 3PXRA 3DNDA 3I4BA 3QUEA 4GG5A 3OG7A 4KSPA 4U81A 3LXKA 5AV2A 3ATTA 3KFAA 5AX3A 5A9UA 3Q2JA 1MRYA 2ZDTA 5LARA 3AKJA 4FIEA 3A99A 3HMNA 4LYNA 3FMLA 4B8LA 4HVGA 5K5XA 4O7SA 4Y8DA 2OXYA 5EHLA 5L8JA 3UO4A 4DBNA 3MY0A 3R8VA 3ET7A 1F0QA 4WNKA 2QODA 2PZPA 4TN6A 3ZO2A 1H07A 3Q9ZA 1IRKA 4IFGA 2W1FA 3MGYA 4DF3A 3QCQA 4RJ3A 5EM7A 4CT2A 4EUUA 3VULA 1YDTE 5IA0A 2P33A 3GU8A 3HRBA 1BI7A 1H28A 4DHZA 5K4IA 4GUEA 5HVYA 3ZEPA 4XNEA 3DXQA 3I5ZA 5HBJA 5HTBA 4OAVB 4EEVA 5HICA 2Z7QA 3C0GA 3UYTA 4TL0A 3E8EA 1OKVA 3W2RA 4YO6A 3PLAE 3BGQA 3BLRA 4NIFA 3UIXA 3GNIB 3PRIA 3ZUVA 3I1AA 3HMOA 3Q2MA 3CEKA 1UU3A 3DGKA 5BV3A 1Q97A 2O64A 4I4EA 3NUSA 4GJ2A 4LI5A 3PJ8A 4ANLA 4TPTA 3FZRA 3CTQA 2V22A 3TKIA 3IG7A 2XAOA 4MXAA 5BQ0A 4TRLA 4RX8A 4YZMA 2VTNA 3NYVA 3BI6A 2JAVA 3R7GA 2BILB 4EQCA 3QTRA 1F5QA 2WTDA 5ANKA 5FG8A 5LWNA 4FTRA 4L7SA 5AUWA 5H8BA 4ENXA 2GFSA 4E73A 1XH4A 2LGCA 4QMNA 4YR8A 1CM8A 2VTSA 5CQUA 2X81A 5DEYA 4JX3A 4M15A 4I6HA 3SRVA 2OZOA 3F6XA 4IB1A 3OS3A 4IAZA 5AM6A 4D4VA 4CLIA 1CTPE 3G6HA 1IR3A 4BCQA 2QHMA 4RWIA 4G34A 5CXZA 5AMNA 4R78A 5KUPA 1H26A 3C9WA 4QTAA 4U79A 4ZTHA 1ST0A 5EQPA 2XKDA 3ACKA 1Q3WA 1J3HA 3LCOA 4ITIA 3W2SA 5JKGA 2ETRA 3EYGA 4ENYA 5K4JA 3NYXA 4O38A 5HE3A 3FI8A 2HZ0A 4R5YA 2VO3A 2XYUA 3IO7A 2E9UA 3R7YA 4C37A 5IUGA 4D58A 5FD2A 2Y0AA 4O7TA 2X2LA 1U54A 1PYEA 5IH5A 4AQCA 3OY1A 3IS5A 4FTCA 3RAKA 3AQVA 4L3LA 3B8QA 4RVLA 3WOWA 2ZB1A 3UPXA 4AOJA 4CQGA 2X2MA 5JFVA 2JEDA 3REPA 4I94A 3L8SA 4IANA 5FXSA 3IDCA 3LCTA 2PUUA 4E4LA 4AUAA 3HECA 4FV3A 4NH1A 1H1QA 5CSPA 4ZAUA 3EL7A 3R8UA 2PK9A 2CKEA 5E8UA 5F20A 4WSYA 4FF8A 4IAAA 4UWYA 5KHWA 2DYLA 3C51A 1Y91A 3TCPA 1YOJA 4XP2A 3IK3A 5DPVA 3PSDA 3QLFA 3U8WA 2ITZA 3QQLA 3F3WA 2W4OA 2GFCA 2YCFA 1Q8YA 2PYWA 3NUUA 3R1NA 3ZDUA 2QOLA 1H1SA 3THBA 4F7NA 5HORA 2FSLX 2YN8A 3MYGA 5IQHA 5A3XA 3W2QA 5AV3A 4EJ7A 2W17A 5CSHA 3UDBA 1H01A 4TWNA 5DG5A 3TG1A 5EM5A 1WZYA 5EQYA 4GMYA 3NUAA 3VBWA 1SMHA 1YXSA 4DHIB 2BHEA 3BGZA 4PX6A 4F7SA 1Q61A 3LJ2A 4FTMA 4FGBA 4FJVA 5CU0A 2BRGA 5TOZA 2PULA 3MPTA 4G6LA 1G5SA 5ANJA 5BVFA 4RT7A 3ZM4A 3W32A 4I6FA 4O4DA 2YIWA 5DHJA 1Q8UA 4W4VA 3VO3A 4EL9A 4DINA 3ZO1A 3OY3A 3QQJA 4G3FA 4JAJA 5F9EA 4L53A 5ITAA 4XV3A 4W8EA 4DGLC 3IDPA 4HJOA 3GCSA 3NR9A 3CSVA 5M08A 2VTHA 4RRVA 2AYPA 4AN3A 5HIBA 1UU8A 3T3UA 3HP5A 3EN5A 3V3VA 5IDPA 2A27A 2IW6A 4ZSEA 4AN2A 3EWHA 2CLXA 2Y6MA 3DB6A 4IVDA 1GNGA 2VO6A 1P4FA 1TQMA 2B52A 1P2AA 4IXPA 3NX8A 4JL9A 3QTXA 4RWJA 3UQGA 2BDWA 5KCVA 4KA3A 3FI2A 4APPA 2EVAA 4FSNA 2WMXA 1H25A 3V8SA 4EI4A 2P2IA 5CWZA 3GQIA 2WTVA 3HV5A 2F4JA 5B0XA 1KE7A 5I3OA 3NAYA 3OWKA 3SAYA 2JKMA 2WO6A 3PJ3A 4RIYB 3HEGA 2UW6A 3LLTA 3UC3A 4D5KA 5EW8A 4GT3A 1W83A 2ZM3A 3EJ1A 1Q4LA 3CY3A 3EQRA 4JVGA 4NCTA 1YRPA 4GFGA 4P2KA 5EM6A 2FVDA 3O8UA 4CCUA 3ZO3A 5GINE 4XJ0A 5HEZA 5FTGA 4BR3A 4GT5A 3VF9A 4IIRA 4E8AA 2F9GA 3AC5A 3DB8A 4Y83A 1LPUA 2GHMA 4L52A 4U7ZA 3R7IA 4RJ5A 3K5VA 3BU3A 4O2ZA 4I5CA 3DJ5A 3CPBA 1OECA 2PZYA 3I0QA 4K18A 2JDOA 4FV1A 3ZXZA 4EK3A 4BDEA 5KZIA 3FC1X 2QR7A 2ZJWA 1J1CA 3ORPA 4GL9A 3RPVA 5JT2A 1XBCA 3ITZA 5CF5A 3C4XA 4TYHB 4BZNA 2XKCA 4R3CA 4ZTNA 5JRQA 2JFMA 3LFNA 4FTNA 4DEAA 4Y72A 5GZ9A 4MQ1A 3L9MA 2OICA 5IMXA 3HMPA 2C3KA 1PYXA 4HOKA 3BBTB 4XBRA 3TTJA 1LUFA 1H8FA 1Y6AA 5IEYA 5JFSA 3RKBA 3EQBA 2HZNA 2R3FA 4GYGA 4NK9A 4QMSA 2WMUA 5CY3A 1PXNA 2A19B 3TJDA 5BMSA 4BTKA 3NVKI 4TYEA 1WBWA 1XH8A 3B8RA 3C7QA 4ZTRA 3R7OA 2GQRA 4FV6A 2CCIA 3M1SA 4C59A 4N57A 4NWMA 4AFEA 2NRYA 3ULIA 3TDWA 5DFPA 3TI1A 1Q8ZA 4LMNA 5CASA 2KTYA 3AC1A 1DI8A 2F7EE 3ZU7A 1IA8A 3SG9A 1P5EA 4I6BA 4FIIA 4YLJA 1W2CA 4HGTA 5AADA 3D5VA 4JDIA 1PXJA 1XBAA 1M2RA 4BDGA 4QYFA 2C6IA 4U80A 3VBXA 1BUHA 2RIOA 2ZB0A 3RHXA 4HVHA 5L2IA 4EZ7A 3UOLA 2ONLC 2QKRA 3EOCA 4IVAA 3ZFMA 3MVJA 5L6WL 4QMPA 2I0VA 3PDTA 1SVEA 2ERZE 2REIA 3DLZA 4J95A 1WCCA 4XH6A 3DDPA 2FGIA 4LL0A 3Q3BA 5HESA 5JGDA 4YNOA 3LKMA 5BMMA 4PL4A 3FMDA 4HGSA 2QONA 3O50A 3ZLXA 2Q83A 3PUFC 5JH6A 4E7WA 1KE5A 4BTMA 1Z57A 2LAVA 4G9CA 3CCNA 4UYNA 2XKFA 3CP9A 1OBGA 2OF2A 5LMKA 3ML1A 2WQOA 3MPAA 5GZ8A 2PMIA 4A9SA 3NAXA 4QT1A 2EXMA 2C6TA 3QTSA 4J99A 4A4OA 2YDJA 2RKUA 4UZDA 4FEWA 3WE4A 4IX6A 3W0MA 3NUPA 1WBVA 3WIKA 5HD4A 3R28A 4TW9A 4FT9A 5HVJA 2XUUA 3GEQA 3LMIA 4MXYA 4LRKA 3OCBA 5EM8A 1E9HA 3RALA 3ZOSA 4AXFA 3UGCA 1PXOA 1LP4A 3DK7A 3F5UA 3G90X 2R7BA 4KWPA 4M0ZA 4MNFA 4RIYA 2XEZA 4JIAA 4ACMA 4QYGA 4E1ZA 3WF5A 5L8LA 4IQ6A 1FBNA 4JT3A 5EG3A 5GIOE 2W9FB 5EKOA 2J50A 3TTIA 4RIWB 4GV1A 3QKMA 2R3MA 3CS9A 2WEIA 2OG8A 3VS0A 4DHFA 5A14A 4IWDA 1OB3A 3DKCA 5CSXA 3COKA 3Q04A 4RVKA 3E93A 4FKIA 5B2MA 2BTSA 3QHRA 4CMUA 4USDA 5KMOA 4UMUA 2YERA 2W96B 3G33A 4QEBA 5M56A 4OTDA 2IW8A 4W8DA 4DN5A 5JZJA 4FX3A 1EH4A 2Z8CA 3QTIA 4FKTA 1FQ1B 5E7RA 3MI9A 3LVPA 5AFVA 5CANA 4IAYA 4CEGA 5GZAA 4FVRA 1XMLA 3F82A 3COMA 1ZWSA 4M84A 4ZP5A 5DN3A 3VS4A 4XG9A 5AR7A 3ID6C 2YM3A 2PY3A 3DKGA 4IACA 4PP7A 4FIFA 4UMQA 2WTJA 1ZMUA 4FV9A 2PVMA 3A8WA 4QTEA 5M53A 2ITVA 4U43A 2OW3A 3EN7A 3FKNA 4RPVA 3Q6WA 3SD0A 3D4QA 3MH1A 5A4CA 3DAKA 5E8XA 4A06A 3NNVA 3ALNA 5HGIA 2BCJA 2C5XA 3E8CA 3E88A 4MHAA 2J6MA 3H10A 1KV2A 3UIMA 3LQ8A 4D0XA 3IPHA 4FG9A 4WA9A 3RAIA 3OOGA 4GK4A 4C02A 5HQ0A 4AZEA 3LFQA 3OCSA 3ORLA 4EBVA 2YCRA 4V0GB 5DEWA 3VW8A 1OM1A 3HZTA 3KMWA 4ORKA 5E8ZA 4B9DA 1OL5A 3PXZA 3KXXA 3LAUA 4HPTE 4DFZE 1APME 4ZTMA 1R3CA 4JBQA 2PWLA 2EXCX 3IQ7A 2XMYA 3MPMA 4JBPA 4FNZA 5HKMA 3AG9A 1OGUA 2HENA 4MH7A 1J91A 4EHEA 4YHTA 1WVYA 4E4MA 3HAMA 1YOLA 3FMKA 5AAFA 2ITYA 3H9OA 3OUNB 4AP7A 2PPQA 4FV5A 5HO7A 2ZMCA 1PMEA 1SNUA 3F3VA 3VS7A 2XCHA 3HL7A 3FLNC 2PUPA 2XJ0A 4IZ5A 4JG7A 3VUHA 2ITPA 2FSMX 3R21A 3HNGA 3LFBA 2BR1A 4BCMA 4R8QA 3RPYA 2A0CX 2GNJA 2I40A 2H34A 2UZUE 2XNBA 4A4XA 4J71A 3C4FA 1R0EA 3GGFA 3LXLA 3KIOC 1FVTA 4FKLA 4O2PA 4AA4A 5KO1A 2BIYA 3Q60A 4BDIA 3HLLA 3UOHA 4FG8A 3BHYA 4CZTA 3OWJA 5L6OA 4S2ZA 4QP3A 2XEYA 2FYSA 4PDOA 3WZDA 4DGGA 3LLAA 4DT8A 1BMKA 1LR4A 3PZHA 2GTMA 3KCKA 4O1PA 3ZLYA 3R9HA 3UO5A 3LFCA 1ZRZA 2YHVA 3F7WA 2XM8A 4PWNA 5H8GA 3F66A 1Q41A 4OGRA 4OBQA 4UY9A 4FKRA 5E8TA 4I23A 4FTTA 3HV7A 5EYMA 3OCTA 4LV7A 3KY2A 4PPCA 4FKQA 4LOOA 2VWWA 2WKMA 2BKZA 3R7EA 4G3GA 3R7UA 4AT5A 2OJJA 4LGHA 4QMZA 3TIZA 4G5JA 4JG8A 3VUGA 3W2PA 3DK3A 3R00A 4FEUA 3VIDA 4A9TA 3KN5A 3DTCA 2XRUA 3QF9A 4GEOA 4IMYA 4JQ8A 4RC3A 3CKWA 4DFBA 2FA2A 4HNIA 4AWIA 3SDJA 4EOLA 2BMCA 4KRDA 4GIIA 4TYJA 5A6OA 4D5HA 5KBRA 3JR1A 3IW7A 3H9RA 3EL8A 4AA0A 2UW3A 1OIYA 3SG8A 4UBAA 2QU6A 3UIBA 1DAWA 4IDTA 4EH7A 4F63A 4LV5A 3D7TA 4H3PA 2C0TA 4YGAA 5DNRA 5DH3A 3RNYA 1Q5KA 2I0HA 5M07A 3KULA 4QO9A 2NPQA 1YXTA 2OJ9A 4I20A 2GNGA 4C4IA 4CG9A 3D2KA 3NFFB 3W2OA 1OMWA 4EH4A 5LOHA 3ZMMA 3G51A 3MFSA 5F94A 4J1RA 4AAYA 3QC9A 3RJCA 4WG3A 3FQEA 5FP5A 2DWBA 2HWOA 2QOKA 4EWHA 4F9CA 4P90A 3H9FA 2R5TA 3FBVA 3UO6A 1GAGA 5JGAA 1FINA 1FVVA 4GIHA 1T45A 2W5HA 3P79A 4OTFA 2J5EA 4V0GA 5HCXA 3W0QA 3DJ6A 4BCPA 2EB3A 4WUNA 3KXZA 3GI3A 3QQUA 3AMBA 5AP5A 4NTTA 2W4JA 3A7HA 3DU8A 4D2WA 4NKSA 3V5JA 3DS6A 1BI8A 4LG4A 2WD1A 4E5AX 2XB7A 3FSFA 4JAIA 1B6CB 4O7LA 4ANMA 3BCEA 4O22A 5LCJA 3WARA 4QP6A 3DV3A 4ZLOA 3UODA 4C35A 4XG2A 4XG8A 3KA0A 3PY0A 2R4BA 1A06A 3RWPA 3V5PA 5J5TA 2O65A 2Z2WA 1WAKA 4GS6A 3R1YA 4UZHA 3S95A 3MFUA 4AA5A 1ERKA 2O3PA 3MVHA 5IUIA 2IEWA 2E9OA 4B7TA 2C5NA 4BCJA 4EOMA 3EQIA 5JGBA 2C6EA 3BX5A 4F1OA 4E26A 3R0TA 2WMBA 3RI1A 3PPJA 3PY3A 4ZZMA 2E9NA 3MH3A 4NYEA 4OTHA 5I9XA 4NSTA 3V04A 1ZLTA 4NZWB 5AIRA 4CFXA 2CN5A 1Z5MA 1SYKA 4W4YA 2QOFA 3D9VA 4CXAA 4F1TA 4TTHB 2C68A 2VWBA 1PXMA 2JKKA 3HP2A 1XMMA 4FT5A 4KNBA 3F5PA 4LOPA 2PMNX 2WU7A 3QU0A 5F4NA 4DH5A 4ZTLA 3JS2A 5EW3A 2BZHB 5L2SA 3PY1A 4PMPA 3MTFA 1S9JA 4YBKA 5IU2A 3ZFXA 2F2UA 3O96A 4O83A 4CLJA 1G8KA 1SM2A 3I7BA 3LFDA 4NIFB 2XBJA 5E91A 3VW6A 3O51A 3P4KA 4M97A 3DNEA 4GU9A 3KEXA 4I0RA 4U45A 5I9UA 2OXXA 5IA2A 5A6NA 4MCVA 2ETKA 3MWUA 4UMPA 1VYWA 1ZOGA 4M8TA 3TEIA 3OCGA 5EYDA 3ZTXA 3OW3A 1UWHA 5J7HA 1RDQE 2QD9A 3NW5A 4ZEGA 2WTCA 4IW0A 2WMTA 1M52A 3I60A 4L42A 1OZ1A 4FOBA 4CMOA 4GRBA 3QX4A 4R3RA 5EI2A 2NO3A 4BB4A 2UZWE 2EUFB 2VWXA 2PMOX 4X2KA 5FRIA 3VS3A 4FSRA 4GW8A 4U40A 4CKIA 2ZV7A 4PV0A 4QTCA 2QCSA 4BWPA 3UZRA 1PHKA 3ACJA 3U51A 3CE3A 3DZQA 4BDBA 3DJ7A 3C0HA 4CRSA 4Q9ZA 2O63A 3OXIA 1E1XA 3Q52A 4LL5A 4Z55A 5FXRA 1Y6BA 1U5QA 4MNEA 4XV2A 4MXOA 1DI9A 3D94A 4L9IA 4FK3A 4YJNA 4LDTA 5EH0A 5AUXA 1IAJA 5HNIX 4DCEA 4U97A 2IO6A 3LCDA 4MQ2A 4X7QA 3RM6A 3CBLA 4I93A 4II5A 3NS9A 4LGGA 4M66A 3WF7A 4D2RA 4TYIA 4IZYA 3I6WA 2V55A 2Y8OA 4U3YA 3QZGA 3QRIA 1PXPA 3W55A 3T3VA 1H0WA 2WFYA 3B2TA 4BHNA 2BRMA 4FSZA 4JRNA 4W4WA 1JBPE 3P1AA 2VGOA 1A9UA 3NIZA 2IZSA 2CGUA 1E1VA 2ZV8A 2JBPA 3SXRA 4A4LA 4BBFA 1U54B 4IWPA 1H1PA 5IA3A 1ZOEA 2CGWA 4OW8A 4YSJA 5K3YA 3OT8A 3AGLA 3VUTA 2OJFE 1IEPA 3MIYA 2P2HA 4RJ4A 2WXVA 1AGWA 2QQ7A 2CJMA 3GBZA 3LFSA 3P7AA 3PXQA 4M67A 4QDVA 3OF0A 3WF6A 1NT2A 3U87A 3ORZA 1M17A 3COIA 3DK6A 4J7BA 5AEPA 1REKA 4OTWA 4RFMA 4L3JA 3ZSGA 5FQDC 4H3QA 4FSQA 1TKIA 5AUVA 5HBEA 5DMZA 2VO7A 3IGGA 3SLSA 3KC3A 4G1WA 2UZOA 1YOMA 3E7VA 1YI3A 3G0FA 1OIUA 3MS9A 5KMJA 5EDPA 1DAYA 5IKWA 4KSQA 3ZEWA 3AKKA 1QPDA 3FI4A 5IA5A 5GHVA 2ZDUA 4I6LA 4AGWA 1YVJA 3O5AA 1XH5A 2F7ZE 4AOTA 3W0SA 3PXKA 5C8NA 4WNMA 5EDRA 4ZTQA 1WMKA 3Q5ZA 4KBAA 4R7IA 4ANOA 3FYKX 4YJOA 4HVDA 3TUBA 5T3QA 3TJCA 4GSBA 4BN1A 3OHTA 4X3FB 2WMSA 4G6NA 4M0YA 3SX9A 3H30A 1RW8A 5KMIA 3W16A 4WG5A 3ZC6A 3G6GA 5CU6A 5KKRB 3KXNA 3QA8A 1PKDA 1VJYA 3QD0A 3VF8A 4K0YA 4EH8A 4C58A 2ITNA 3QX2A 4V01A 4E5BA 2QURA 1JVPP 4YZNA 4F65A 3KXHA 4B0GA 3VWAA 5EYKA 3D14A 3WZKA 3EQFA 3MN3A 5AUUA 5IEVA 2QR8A 4K33A 3Q4ZA 3RPOA 3K54A 4WRGA 1OIQA 3UNJA 2WTIA 4QMXA 5G6VA 4BY9E 3F88A 1W84A 4C4JA 3C5IA 4CZUA 3Q6UA 3KMMA 5JMSA 5CVGA 5HG7A 4U3ZA 2X39A 3R2BA 4NEUA 3GQLA 2VV9A 4PTGA 4FIJA 5D12A 4QPAA 2PE2A 5FM2A 2HAKA 2B0QA 2UW0A 3ZZEA 1HOWA 5E9EA 3ZZWA 1XQZA 3BGPA 3PWYA 1R1WA 4O4EA 2UW4A 3R9DA 4K1BA 3QCYA 4MF1A 5AR5A 4BWKA 4FTAA 5DT3A 2W05A 4IAKA 5LCKA 5AM7A 3FPMA 2R3LA 5LVMA 3HV4A 4L43A 1GJOA 3BHUA 3WF9A 3IW6A 4OUCA 4QTBA 4C33A 4C62A 3AMAA 4C4FA 1OUKA 5HCZA 4F08A 3PXYA 4LGDA 4N4SA 3W10A 4O84A 4R7BA 4RZVA 2VWVA 2WQBA 4XOZA 2XNMA 4IM3A 3PUPA 5BPYA 3ZONA 2WOTA 1OPLA 4FV2A 4QQJA 3OMVA 5FBOA 1YWRA 1TQPA 3GFEA 2O8YA 4FA2A 2X1NA 3UYSA 4IM2A 4DTKA 2XCKA 2OWBA 1JPAA 4ITHA 4JQEA 2R3JA 5IQIA 3P9JA 5IQBA 4DEDA 3SC1A 3LIJA 2QO9A 2GNHA 4FT0A 5FBNC 4AFJA 4D1XA 4U8ZA 4EHVA 1W2FA 3OROA 4EYMA 5HTCA 5J79A 3L8XA 3EQGA 3FE3A 3JY0A 3LFEA 4MBIA 3RCJA 5J95A 4AZVA 5CEOA 5AR8A 1G8AA 4S31A 4EZ5A 2R3QA 3UVQA 4ALVA 4DEEA 3I7CA 4O7WA 3TL8A 1ZYSA 4PTCA 2VNYA 5F1ZA 2I7QA 1PJKA 4JBVA 4JG6A 2QOIA 1Y8GA 1V0PA 2JDSA 2WMRA 4IAIA 1YXUA 3FL4A 4NM7A 4G17A 4XG7A 5TF9A 2IJMA 5HU9A 2C0OA 4JLCA 2W7XA 4RQVA 4Z16A 2BVAA 4C36A 1JSVA 1VLRA 3L1SA 4FL1A 4A9UA 4PPBA 2VTAA 2Y4IB 3OXTA 3D83A 3GXLA 2PTKA 4IE9A 1WBNA 2Q0NA 3QQGA 4O0UA 4ZSLA 3GU7A 4X3FA 5BVWA 1V1KA 5AIKA 4HZRA 3BHTA 3QFVA 5DT0A 2YDKA 3FHRA 1GZNA 3PRFA 5H3QA 3RM7A 3KVWA 3W33A 4Z3VA 5J9ZA 5ANGA 4F4PA 4WG4A 5HO6A 3KL8A 4AW1A 2WPAA 3FMJA 4ZJJA 3ZH8A 4O0SA 4UN0C 2O0UA 3UQFA 5FWKK 3T9TA 4MXZA 4ANQA 5HLNA 4MUQA 1SNXA 3QZIA 4FEQA 2GQSA 2HXQA 2C5VA 3GUBA 2PVJA 3RZFA 2BDJA 3KU2A 4DC2A 5IPJA 2VN9A 4YC8A 1H00A 2QO2A 5E90A 2VRXA 3DBDA 3OFMA 4F99A 3R73A 3KF7A 2J51A 4DG0E 3K3JA 3CPCA 5CT0A 4K2RA 4EOOA 2PVFA 4I41A 5AP3A 2Y6OA 4ASEA 5CAPA 3V8TA 1B39A 1WBPA 4H1JA 4QTDA 4CTCA 2GHLA 2NRUA 2BUJA 3BE9A 3NGAA 4BCIA 4H05A 3TZMA 4AZWA 4B99A 3VBVA 1K9AA 3QD3A 4KUJA 4ACCA 3W0PA 4FT3A 2ZOQA 3CTJA 5M4CA 2W5AA 3KK9A 3TZ8A 4GH2A 2V62A 3N4TA 1MUOA 4EK5A 3IW4A 4Q5EA 2QOOA 3QYZA 4GJ3A 4KS8A 5J5SA 3HRFA 4O7NA 4IB3A 4W4XA 3IW5A 2F57A 5TT7A 3U4UA 3SKCA 4OAUC 4O0WA 2VGPA 4FV4A 5CEQA 3V5LA 3S3IA 3G0EA 4PL5A 3EZVA 5A4TA 2HY81 4BIEA 1JKLA 3QTQA 3F2RA 3R01A 4DEHA 4FZFB 4MVFA 3MVLA 2W9ZB 3OT3A 5D7VA 5J9YA 2VTLA 4XOYA 3JUHA 4GT4A 3UG1A 4BCGA 2G01A 4GCJA 4MXCA 4PF4A 3I79A 4TWOA 2JBOA 5TO8A 2P0CA 3BIZA 4NKAA 5HLWA 4BBEA 4FYOA 2A2AA 2FUMA 4JBOA 4IM0A 3QD4A 1JSTA 1VZOA 2UZVA 3UMWA 3UNKA 2PVKA 4OBPA 5CVHA 4BF2A 3HAVA 5LXMA 1H0VA 4I3ZA 2JDTA 2OZAA 3QGWA 2PVHA 2WMWA 3AT3A 3BQCA 3EKKA 1K2PA 2ITOA 4ZSJA 4D2TA 1PW2A 4LUEA 4H1MA 5DT4A 5IQFA 5FXQA 3R9NA 3NW6A 3L9LA 5AX9A 2B7AA 5EOLA 4XRJA 4ANBA 5K0KA 3SOAA 3U9NA 4TWPA 2X0GA 4IFCA 4P5QA 4BCHA 4BTJA 1ZYJA 5E92A 3ENHA 4DH1A 4GK2A 3DLSA 5H9BA 4Y5HA 3VHEA 1ZZ2A 2W1HA 5AP7A 4YTCA 3QL8A 2BAJA 1UVRA 5GNKA 2C4GA 2W1GA 3UC4A 3WI6A 2I0EA 3GU6A 4H3BA 3K3IA 4CKRA 3LM0A 4EYJA 2YDIA 4BGGA 2G1TA 2OI4X 3MA6A 4B4LA 4BDJA 4ITJA 3KKVA 5EK7A 3RTPA 4F9BA 4ZS4A 4N0SA 4QP9A 5HX8A 3ZO4A 3DT1A 4FR4A 5JSMA 4M68A 2HK5A 3E62A 4BJJA 4C38A 5AAGA 4DDIA 2JITA 4FTJA 3W1FA 4CKJA 3TNHA 1UWJA 1WFCA 3IDBA 3QUPA 1NY3A 3PP1A 2VAGA 1H1WA 3V01A 2J5FA 2VTOA 3MY5A 3R22A 5LMBA 4DA5A 2VTPA 4FSYA 2WB8A 1M7NA 2BROA 1XJDA 3R1QA 3FKLA 2WZJA 5CS6A 5M4FA 5ANOA 4ARKA 1RQQA 4FNYA 4QMUA 4WIHA 5LVLA 5E1EA 3OBJA 4KB8A 4AW2A 2FSTX 3AGMA 1PRYA 2AUHA 3QXPA 4RG0A 2YLEA 2DUVA 4DGOA 3GU5A 4HW7A 4XG3A 4ANNA 4YP8A 5FDPA 2CDZA 4TYGA 3ALOA 3OBGA 3ORNA 4BBMA 5BX0A 5CEMA 2A1AB 1YXXA 3EN4A 4KD1A 3NUXA 5BVEA 1PXLA 2R3NA 3B2WA 3HV3A 2NP8A 2V7OA 3LZBA 1ZY5A 4WSQA 4BDCA 3OD6X 3LQ3A 4PTEA 4IX5A 4EKKA 2HXLA 2UUEA 3OTVA