2I0YA

Cfms tyrosine kinase (fgf kid) in complex with an arylamide inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
316
structure length
289
Chain Sequence
b'VRWKIIESYESYTFIEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKRQLSSRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQAQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cFMS Tyrosine Kinase
publication title Crystal structure of the tyrosine kinase domain of colony-stimulating factor-1 receptor (cFMS) in complex with two inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 289
sequence length 316
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2i0yA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2i0yA01
5EM8A 5EOBA 3VS6A 1UVRA 2PSQA 1U5RA 3ETAA 2O64A 4CCUA 4WO5A 3ZO4A 4BDGA 2WMTA 3BYMA 4EOLA 1XJDA 5H9BA 2IO6A 3BYOA 1Q41A 1U59A 3F2AA 3VBYA 4CV9A 3C5IA 3R7YA 3C1XA 4EKKA 3I60A 4TNDA 3JVRA 3CPCA 2Y6OA 5FWKK 4EUUA 1Q97A 5B2LA 3GCVA 4CG8A 4QYYA 3O8PA 4QYHA 1M2RA 5J9YA 5DBXA 1ZYLA 3BV3A 3AC1A 3HRFA 5C8MA 4OTFA 3VBVA 3QD3A 4AFEA 4R7BA 1W8CA 5CAQA 5LCJA 3MW1A 4UWBA 2XK8A 5F1ZA 2GFSA 3BGZA 4IVDA 3PWYA 2OJFE 3FUPA 4R5SA 4WNOA 3LQ3A 2DWBA 2XJ0A 1YWNA 3ORIA 4R3RA 2YIYA 3TTIA 3NYXA 3GBZA 2B9HA 4FKUA 3G6HA 4FTKA 4G6OA 1WZYA 3I7CA 4HYIA 3B2TA 4IBMA 2UW0A 2R3IA 2R7IA 1PMVA 2ETMA 1GNGA 1LUFA 3PA5A 3GC0A 4D4VA 1PXPA 4NCTC 4QQJA 5HORA 2PK9A 2BVAA 1REJA 3CCNA 3NR9A 1REKA 1E1XA 3ZSHA 4O91A 4D5KA 5LMBA 1DI8A 2W1DA 4OT5A 3LCOA 3VUIA 2VWIA 5J9LA 5EQYA 3H9RA 4FICA 3G33A 4DFYA 3NZ0A 1ZXEA 2HIWA 2R3FA 3UYSA 2O8YA 4D2TA 4MX9A 3TZ8A 2IG7A 5JMSA 2W0JA 2XMYA 4DFNA 3QZIA 2C3JA 1JWHA 4P7EA 2OJIA 5E4HA 4BI0A 4YR8A 4ZAUA 3QXOA 4UMUA 2W96B 4DFBA 4BKYA 5HIDA 4NWMA 5DA3A 3BQRA 2X39A 1PRYA 3D7TA 4O7RA 4JQ8A 2UZEA 3I81A 4K18A 1Q8ZA 4I94A 4U44A 4DTAA 3D2KA 4FSUA 2B9IA 2QOQA 2Y9QA 2YIXA 4CKIA 2W1EA 2XEZA 2JBPA 1OL7A 3GC9A 2PUNA 5CF5A 1M14A 2XKCA 4DT9A 1OIQA 4OTGA 4ZMEA 4XUFA 1HCKA 2JDRA 1W84A 3QQHA 3QTIA 3EQDA 4X6QC 4BTKA 5I9XA 1WAKA 2BROA 2OF2A 2HZ0A 4I0TA 4TWOA 2BCJA 3O23A 3OUKA 3QFVA 3R8ZA 1CTPE 3G51A 1ZOGA 5IQDA 4JBVA 2WU6A 2BZHB 2HXQA 3PE1A 4BF2A 5KMMA 4ACGA 4U81A 1OPLA 2O0UA 1F5QA 3FMMA 4W4VA 4BZDA 5JKGA 5JRQA 2YIRA 4FKVA 4I5PA 4CLIA 4QP7A 5HG9A 1JSUA 5JZNA 4G3GA 5BYZA 3ZEWA 2WB8A 3SXFA 2WEIA 2C5NA 1UKHA 1Q4LA 4ZTQA 2ZB0A 3TZ9A 4D9TA 2C5OA 2IVTA 3VS4A 1X8BA 3GNIB 5KBQA 3QCSA 5M44A 3BPRA 4YGAA 5DR2A 4UMPA 3ELJA 4ANLA 2CCIA 3CP9A 2I0EA 3MTFA 3RWPA 2JFMA 4L3JA 3QGWA 3BGPA 5HICA 4N4SA 1RJBA 3R00A 4G31A 4MNEA 5JEBA 3UO5A 2OFVA 5AUVA 3TNPC 4NUSA 4RQVA 1UV5A 2WO6A 3KREA 4BI1A 2UZWE 5HE3A 4O81A 3DFAA 3AC3A 4M14A 1G8AA 4XG3A 3FMEA 3HMNA 4RJ6A 3R8MA 4E3CA 4QTEA 3NCGA 3QRKA 4ACHA 4KSPA 5BVDA 2VTPA 1XH6A 3QA0A 5CVHA 4RFMA 5H8BA 4FTTA 3KB7A 4YLLA 5HIBA 3AXWA 2O63A 2YM3A 4QP3A 4IVCA 4PPAA 4BICA 3QTXA 2QODA 4M69A 4ITIA 4Y83A 1YHSA 2E9UA 4IWPA 1ZYSA 3DBQA 1UWJA 4F64A 3FZSA 2W7XA 4PWNA 2XUUA 4C4EA 4RWJA 2R3LA 3LXLA 4D4YA 3A2CA 3OXZA 3PVBA 4JOAA 1E1VA 3P7BA 4W9XA 5EK7A 1BKXA 3ZUVA 1Y8YA 4TWNA 3B8RA 5JGBA 4WA9A 5FBNC 4USFA 3BX5A 3ZM9A 4CT2A 3P23A 5IA3A 4ANNA 3HRBA 1ZYDA 3V6SA 4BB4A 5IISA 5HO8A 3UE4A 3DNDA 2YCRA 4LM5A 4U43A 4NEUA 2JDSA 2G2HA 1OKYA 1OKVA 5L2IA 1WBVA 1CSNA 4QQCA 3I7BA 2QNJA 4IZ7A 3RAKA 1WVXA 2R3HA 5IH6A 1BI8A 4AE6A 5HIEA 4KKGA 3EQIA 3REPA 2OKRA 3KRWA 3BU6A 4WT6A 3VUMA 5DHJA 2YM5A 3OZ6A 4QTAA 4MH7A 4YO6A 3VUGA 4HW7A 3LKMA 2DYLA 3F2NA 4D2SA 4ANBA 4WG4A 3FI2A 1YHVA 2JGZA 5M09A 3KF4A 4CLJA 2YM8A 4JG7A 4GK2A 4J8NA 4OAVB 3DXQA 4JDKA 5A4CA 2RFEA 3EL8A 3NAXA 3MH0A 3KMMA 4O7YA 3DBFA 2CLQA 3BELA 4GRBA 3L9MA 4KKEA 1H8FA 3FC2A 2BFXA 3UO4A 4K33A 4JG8A 3W33A 4AGCA 4FV8A 4IVBA 3JUHA 4LOOA 2VWUA 4WUAA 4A9SA 3R2BA 4CTCA 4E4MA 4D5HA 5D12A 4DG3E 4HVIA 4L6QA 2DUVA 3HDMA 4PPBA 3VUHA 1ZWSA 5HBJA 3CTHA 2JLDA 4V0GA 4RX8A 1MQBA 2XK4A 4BDCA 4YZNA 4FEWA 3FI8A 3NUUA 4GYIA 5M4CA 4BN1A 1QPEA 5FG8A 4C3RA 3TDWA 3GU7A 3TKUA 3U54A 2J6MA 4CFXA 5IMXA 5CI7A 4YJRA 2BRHA 4BCHA 3MVHA 1U4DA 1S9IA 2BALA 3F3VA 4HCTA 4O7NA 5T68A 3BHYA 3R9NA 1IR3A 2UV2A 3KXXA 2VRXA 1U46A 2QOKA 4EQUA 5CVFA 5JN2A 2BTSA 2OIQA 3GCQA 5L6WL 4BCFA 5CU3A 2OH4A 3NW7A 5M4IA 4WSQA 3AQVA 3BWJA 5D9HA 3UBDA 1XHAA 4QTDA 2WMRA 4CZUA 4F9AA 1URCA 3QYZA 3RHKA 3NW5A 1AQ1A 4UALA 4ZP5A 1FMOE 2UW8A 4RIWB 3NEWA 5CAVA 4GK4A 2FVDA 3FKOA 2FO0A 4ITHA 5E1EA 4F63A 3L9PA 1FQ1B 4NK9A 1FOTA 3MPAA 4G3DA 3UVRA 2PZ5A 1R1WA 2UVZA 2QOCA 3CS9A 2XIXA 1MUOA 3DNEA 3EQHA 4R7HA 4K11A 5HO6A 3A8WA 3A4PA 2VX0A 3TUCA 3DTCA 4GKHA 2BPMA 1WCCA 3DQXA 3R22A 4C3PA 4AOJA 4O7WA 4I5CA 4GJ2A 3GXLA 3VW6A 4YURA 3OT8A 5E1SA 3M2WA 4IM2A 2O65A 3TG1A 4CGAA 5EI6A 4FA2A 4FSQA 3PWDA 4QMVA 3NW6A 3BWFA 2HK5A 3D4QA 3F5UA 3OWLA 2PE2A 3I4BA 1GIHA 3PLSA 4AA5A 5JT2A 4GW8A 3JVSA 2CGUA 1RE8A 3OP5A 1ZRZA 4K1BA 4L8MA 4Y5HA 5HEZA 2YEXA 3RZFA 4I22A 1OIUA 2HAKA 2I7QA 4QMMA 1YOMA 4FIGA 4HPTE 3WZEA 3R83A 2IWIA 4X2FA 4FIFA 2QOLA 4QD6A 4RGJA 5EH0A 2PVHA 4TYIA 2WAJA 3SQQA 4FSWA 5EOLA 4BKZA 4M15A 4XJ0A 2R3RA 3A62A 3PSBA 5CX9A 3OOGA 4APPA 4BWPA 4U41A 3D9VA 3IDPA 4WIHA 2XCKA 4FSRA 3LFCA 4FKWA 3ANQA 2ITPA 2R4BA 2GTNA 3HV4A 1J1BA 4FODA 3MB6A 2RF9A 5HNIX 3R9RA 5HO7A 2QVSE 4XOYA 3D0EA 4MAOA 1Y6AA 3ULZA 4FV4A 2J2IB 5CNOA 4EH6A 3HECA 2CKPA 4XLVA 4HCUA 4CYJA 4DCEA 4RJ3A 2WPAA 3P78A 5IEVA 3RPYA 3VS5A 3QQGA 3T9IA 3DOGA 2OF4A 5KMNA 3IKAA 3AGMA 3FC1X 3H4JA 4TTHB 1Q8YA 4DINA 2C3IB 3PZEA 4BDDA 3HGKA 4XG7A 3RAHA 5L3AA 1YW2A 4X7QA 4ZTHA 5IPJA 3NUXA 5M4FA 4O0UA 3RCJA 2WXVA 3R21A 3WZKA 2ZMDA 3G0EA 3QCQA 3TIZA 2VWXA 3DBCA 2CNUA 5AUWA 1MQ4A 3ATSA 4ERKA 4O84A 2R7BA 5HTIA 5E8ZA 2Z60A 4IQ6A 5DT4A 1KOBA 3KK9A 4C37A 1OBDA 4USEA 3T9TA 4G6LA 4A9UA 4I0SA 3V5PA 4GFGA 3PXYA 3K5UA 4YTIA 5DOSA 5E8SA 3R7EA 4KKHA 3QCXA 4DEIA 4U97A 3HX4A 4N70A 1V0OA 5EHYA 3TKIA 5EM5A 1PKGA 3DB6A 2VWZA 4NIFB 3GCPA 2QC6A 5A46A 3E88A 3QZGA 3PVWA 3QD4A 3ACKA 4J8MA 4XV3A 2BHHA 2GU8A 4GFMA 3QWJA 1RDQE 2VO3A 3ORTA 2HZNA 4BHNA 4CXAA 2RIOA 1XH9A 3BU5A 3OWPA 4FTJA 2V62A 4AZFA 3LFNA 3UZTA 3R30A 5M08A 4F6SA 2XIZA 4FSZA 3F6XA 2PUUA 4ZLYA 5KMJA 4R1YA 2ITQA 2ZM4A 3LJ0A 4KIKA 2WQMA 3FZTA 3O2MA 4YP8A 4CMUA 4FKRA 3U8WA 2W4KA 2ZV8A 2R0IA 3VS0A 3TJCA 3ID6C 3MFTA 2BAKA 4FVQA 4PL4A 1CKPA 3V5LA 2YJSA 2GSFA 4I5HA 3W1FA 4F99A 1JBPE 2QD9A 2YZAA 3VQUA 4H39A 1YI3A 5HD7A 2GPHA 4Z16A 1TQIA 1YXVA 3A61A 2F57A 4YNEA 3W2QA 4DFZE 3FY2A 2XNNA 4ZTMA 5F9EA 4ZTSA 4O7TA 2C5XA 3DU8A 3GU4A 2B7AA 3MI9A 4I6QA 4IAFA 4IE9A 5E92A 5LARA 3AC5A 3RNIA 1JKTA 4EL9A 3SW7A 5IA0A 2R3GA 4PV0A 3MYGA 5FQDC 2CGVA 4X2KA 2YDIA 4Z9LA 5E7RA 2PYWA 3PSCA 5FXQA 3NDMA 3ZTXA 5F95A 2G9XA 4Y95A 3OBJA 4U79A 3RWQA 3ERKA 3ZEPA 3Q4ZA 4LG4A 3WYXA 3OCGA 1IEPA 4YJQA 3WI6A 3NUSA 3OY1A 2VO7A 5J79A 2X2MA 4Q5HA 2C6LA 3HAVA 3WILA 3E7OA 5BVNA 3TXOA 1U54B 2HZIA 2C0OA 3FKLA 3FSKA 4G17A 3IW4A 3R7VA 4YJNA 4NM3A 3F5PA 3TNWA 3UG1A 1AD5A 2VTHA 4FYNA 3TKHA 5E8UA 2UUEA 4WOVA 1KE5A 3R8LA 1GOLA 5EDQA 3VF8A 5BPYA 5I3RA 4FV7A 3PZHA 2A1AB 5CEPA 4FT7A 3SG8A 4JLCA 4V01A 4KBCA 1XO2B 4FKSA 5KHXA 2P2HA 3EFLA 5CF8A 5HLWA 3BE9A 4A4OA 3MFRA 4Q9SA 2X6EA 2HWPA 2FGIA 2IW9A 1M2QA 2DS1A 2HY0A 4QMOA 3OOMA 2O3PA 1H1WA 3ORLA 1YXXA 4O0YA 5FP5A 4BC6A 2W1HA 5C8NA 2GNHA 3VBQA 1DAWA 2I1MA 4KINA 5AP6A 5ETAA 2VTIA 1I09A 4FUXA 2W5HA 4RIYA 4RVMA 2V7AA 2WMVA 3PYYA 3FHIA 4MVFA 2J0JA 3Q4TA 2XK3A 3O0GA 3Q6UA 2BRGA 1HCLA 1Q8UA 3QTSA 5BUIA 4GS6A 2C6DA 3OG7A 3RZBA 4LOQA 4EK4A 2C68A 5IDNA 5BUEA 4U8ZA 3TCPA 2Y8OA 3PA4A 5KKRC 2W99B 4C4GA 1J7LA 1EH4A 2HOGA 5HCXA 5AUZA 3OEFX 5HESA 5K4IA 3II5A 5H8EA 5LWNA 1Q3DA 3HA6A 4O0TA 3V5WA 1UU3A 2VAGA 4Y8DA 4CSVA 5GZAA 5FUTA 5LMAA 3A60A 3M11A 2QO2A 3IS5A 5AR2A 1OPJA 4YTCA 4JL9A 3QALE 5IKWA 2OZOA 4LRKA 2J51A 5GJDA 1VEBA 2XKEA 3S00A 4IAKA 2R3QA 2X81A 4PL5A 5I4NA 2UZLA 4OR5A 3KKVA 4LGHA 2WTIA 3FYKX 4I6BA 2PZYA 4MD8E 4O0WA 2PVNA 3GC8A 2WMQA 4KWPA 3P5KA 3R0TA 4YJPA 3GOPA 2YACA 5CF6A 2XA4A 4FX3A 1H4LA 4AXAA 1NA7A 2ITYA 4YNOA 5IU2A 2Z7LA 3KC3A 3HNGA 2C69A 3SRVB 1JOWB 3EQCA 3BRBA 4QT1A 4KA3A 2RFSA 5M55A 5EM7A 2YDJA 5CT0A 1O6YA 2ITTA 4P2KA 4RC3A 4WKQA 3UMWA 3EN9A 4AFJA 5KKRB 2PVKA 4B99A 5HBEA 3WZJA 3ZS5A 2JKMA 4G34A 4RWKA 3U4UA 3KULB 3UTOA 4XG6A 3CY2A 3FKNA 4AQCA 4ZS4A 2YIQA 2OXDA 3H30A 4IMYA 3SX9A 1JKLA 4AOIA 4BCGA 5AUTA 3C0GA 3PTGA 2O5KA 5CSXA 2VTJA 4EC8A 5KCVA 2XP2A 3TNQB 1Z57A 1PYEA 2JD5A 4L9IA 3L9NA 3PPKA 4M0ZA 3SD0A 1YDTE 2WTKB 4FTUA 1Y8GA 5CSVA 4E6QA 5F4NA 1IAHA 1YXTA 4CMOA 3FLWA 4DEDA 5EQPA 2R64A 2YLEA 4IAYA 5AR3A 3SXRA 1H08A 3BU3A 3F3WA 3IOPA 4HGEA 4RFZA 4D1ZA 3ZUTA 3TN8A 2OGVA 5IA4A 4IH8A 2EU9A 5G1XA 1OM1A 3DK3A 1TQMA 2BAJA 3AC4A 4G1WA 4RG0A 4ZK5A 4IHPA 4AUAA 5FM2A 2NRYA 4ZEGA 4UN0C 3CKXA 4GVJA 3ZH8A 3QQKA 4ZMFA 3BEGA 4JX7A 4USDA 2OIBA 3EJ1A 5HU9A 2UZDA 3QWKA 5IZFA 1ZYJA 3FL5A 3ZLXA 4D4RA 3PY1A 1FGKA 3IGOA 2IW6A 3EB0A 2QQ7A 5AV3A 4YJSA 3NUNA 5FRIA 4AW5A 4BCKA 2VTMA 3E8DA 5CEKA 4IAAA 1R0EA 3DTWA 4M67A 2Y4PA 5C9CA 1TVOA 3MB7A 5C8KA 5JFSA 3KF7A 4CT1A 1JPAA 3K3JA 2IVUA 4OW8A 4TN6A 4CFMA 1OECA 2W5AA 2EWAA 3VIDA 2JAMA 2UZUE 3FQSA 4DGLC 1ZY4A 1H1SA 2P2IA 1PW2A 1XQZA 2O2UA 2WFYA 1PXMA 3D5WA 4GKIA 2XYUA 3IQ7A 5GJGA 2UZBA 2X7FA 4GJ3A 4MXAA 4O22A 3NNVA 3QRTA 4GL9A 3COHA 1XWSA 3OW4A 2IZTA 4KIOA 4LQMA 4JIAA 4GH2A 4NKAA 2WTWA 1ZOEA 4L3LA 3UOLA 1FBNA 4OGRA 1SVGA 4LOPA 5AP2A 5K9IA 4I93A 1P2AA 4TWCA 4RVLA 2G2FA 3R1QA 4L42A 3O96A 3HV3A 4TZRA 2VD5A 3L8PA 3ZXZA 4FEUA 3UNKA 5BMSA 4H05A 4PMSA 3QQLA 2BDWA 2Y0AA 4AX8A 4C7TA 4YZDA 3ZZWA 1YDRE 3LJ1A 3O71A 4FKTA 4FL2A 4YMJA 4HPUE 4ZLOA 2ONLC 4KD1A 3C4CA 2BKKA 3KVXA 4NYEA 3KXMA 1UU7A 4NTSA 4DTKA 4RJ4A 5E8VA 4JQ7A 4IVAA 1H0VA 5KE0A 5LMKA 1TKIA 5EQEA 1UWHA 3RK9A 4BR3A 3CLYA 3QA8A 4H3QA 3MJ1A 3PSDA 4K9YA 4YZBA 5EKNA 4BIBA 4O96A 1PXLA 4C2WA 4JIKA 5K0KA 1WBSA 1SYKA 2XNGA 4TYGA 5CU0A 5DMZA 4IX4A 5DPVA 2XF0A 4FOBA 4C38A 3CC6A 3E3BX 4GIIA 5CEIA 2XVDA 1G5SA 3QAME 3LOKA 3QXPA 2YM7A 4BDFA 5D11A 3HMPA 5CWZA 1ZARA 4FR4A 2GFCA 3V04A 4AAAA 3ENHA 5CLPA 1NVRA 1WFCA 4C61A 2RFNA 3GU6A 4GT5A 4XG8A 4CV8A 3NYOA 4AGUA 3QCYA 2B1PA 4CQEA 2CNQA 3KGAA 4U7ZA 4UMRA 3DLSA 2FSLX 3OD6X 3UIUA 2H34A 5AV1A 5HVKA 2OU7A 3R8UA 2QR8A 3BBTB 4LI5A 4BDHA 3GOKA 3NYVA 5BUJA 3EWHA 2C3KA 2PVYA 3CE3A 5C27A 2WD1A 3U4WA 3VWAA 3BYSA 2J5EA 4EORA 2QHMA 4CG9A 4MXOA 5GZ9A 3VS1A 3UJGA 3JXWA 4DCAA 4ZTNA 3AMAA 3CQUA 2QOBA 4G3CA 1IASA 4G16A 4JRVA 3OMVA 2QG7A 3F3TA 2QURA 2X4FA 3IW8A 3MFSA 3ZHPC 3ZRMA 4XV9A 1YKRA 4WD5A 4OAUC 4D55A 4FSTA 5A4TA 3PVGA 4FSMA 4LMUA 4RC2A 4YLJA 3OCBA 4CD0A 3DKGA 3QL8A 4FZAB 4KIQA 4TY1A 2YFXA 4FV3A 4GEOA 4PL3A 2HWOA 4Z7HA 5A14A 4NM7A 1ZLTA 5A4QA 4BGGA 3FAAA 1STCE 2ZV9A 2QG5A 3IECA 3OHTA 4FKQA 5FEEA 4EONA 3CTQA 1YI4A 3LLTA 3LXPA 3PXQA 4FGBA 4MD7E 4EWHA 5CEOA 3UGCA 2OJGA 1PXNA 5FEDA 3JS2A 3C0IA 4GIHA 5FTGA 4N6YA 4NH1A 4DE4A 1Y91A 4EH2A 5I3OA 3BYUA 1UKIA 4M68A 4W8EA 4G6NA 2ITXA 2UZTA 4AW2A 1W7HA 1CMKE 4Q9ZA 3QHWA 3ZDIA 2RL5A 1NXKA 2W06A 4QQ5A 4IWOA 3V8SA 4E6AA 4CNHA 5IDPA 4FVRA 4AG8A 3LFSA 3Q9XA 4DAWA 2OZAA 5IQBA 2GS6A 5M07A 1QPCA 2X1NA 3DDQA 3E7VA 4JXFA 5DFPA 5AM6A 1GY3A 4RMZA 3VRYA 2BR1A 5IQIA 2EXCX 3EMGA 4FSNA 2ZV2A 5E8YA 2F7XE 3IDBA 3WIGA 3QUEA 4F7JA 2GHLA 5E91A 1FVRA 5IQEA 1URWA 4MEDA 2AC3A 3SKCA 3V51A 5L8KA 5M57A 2GS7A 3MH1A 5GZ8A 3CTJA 4FK6A 4Z7GA 1JLUE 3DLZA 3ODZX 2UZOA 4DH5A 3HV6A 4FV1A 3POOA 3UP2A 4BWXA 4C35A 4ANSA 4BBEA 1PJKA 4DGOA 1QMZA 5J1VA 2OI4X 1QCFA 5JRSA 2W1FA 3TV6A 4ZS0A 3ZSIA 3E8EA 4PDYA 4MTAA 3KXNA 4HNIA 3ZLSA 4A9YA 1JSVA 3R63A 4QP6A 4C62A 1IA8A 1UNHA 4QMPA 3L8XA 4QQTA 3KMWA 2JEDA 4F7LA 4DFUA 2J7TA 2WQEA 2EXEA 4QMQA 1XH5A 3DKCA 5AP5A 4ASDA 4UZDA 4EH5A 5BNJA 3UIXA 4Y46A 3VVHA 4ANOA 4FTLA 4C4IA 3HUCA 3LFEA 4TXCA 4MNFA 2KTYA 3FBVA 2BDJA 3NS9A 3LAUA 4X3JA 1GIIA 3EYHA 5LOHA 1O9UA 4E7WA 3ET7A 4NM5A 2W05A 2EUFB 2UW6A 3FMHA 3C4WA 1GZKA 2OH0E 4F0GA 3UIBA 4DH7A 3GU8A 4I41A 4I6FA 3FLNC 4UY9A 1H0WA 1GAGA 4ASZA 5IF1A 2VWWA 3SG9A 4IFCA 1Q24A 3H10A 3M1SA 3QQFA 4M0YA 3C50A 3PPZA 3EHAA 4DTBA 4MKCA 3MWUA 2R0UA 2IJMA 3QQUA 2W4JA 2Q83A 3Q4CA 2DQ7X 2VTNA 4O2PA 4W8DA 4PMPA 2X0GA 5DH3A 3G6GA 1Q8TA 1YQJA 3FY0A 2B9FA 2JITA 2VTLA 3MY1A 4XP2A 5ANOA 3EN7A 3BI6A 5KMOA 4HGLA 3EN5A 3HV5A 3F69A 4GU6A 3C5UA 3U51A 3W2CA 5A6NA 4ALWA 4BCMA 4FKOA 4CVAA 3TV4A 4QPMA 3TJDA 3V6RA 3LQ8A 2W5BA 1FMKA 2UW9A 1OL5A 3T3VA 3BE2A 3C4XA 3KQ7A 3NNWA 4QOXA 5AA8A 5CQWA 1GZOA 2WTDA 3UP7A 4WBOA 3KU2A 4U9AA 5HG7A 2OIDA 2WQBA 3GFWA 2ERZE 2F49A 2Y4IC 1G8SA 1XH8A 5FXRA 4RX9A 3RMFA 4DH8A 2I0HA 2Z2WA 2IZSA 3F3ZA 4DGNA 4FUYA 3Q4UA 4IXPA 1OIYA 4X2GA 3K3IA 3BHUA 3OXIA 5JFXA 4FYOA 3W2SA 4JAIA 3GQLA 4KIPA 2ESMA 3QRUA 4J1RA 4BCOA 4BTJA 2HZ4A 1SVHA 2C30A 3DAJA 3DZQA 4MHAA 2CLXA 2X4ZA 3HRCA 1KV2A 4N0SA 3HDNA 3QKMA 5HOAA 4ZJVA 2JIUA 2RFDA 2W1CA 2W9ZB 1VYZA 4Y72A 2AC5A 4W9WA 3AOXA 3RPRA 5J9ZA 1OI9A 2H8HA 4L68A 3FJQE 3R2YA 3R6XA 5DT3A 5HLNA 3E93A 4D9UA 3DY7A 4TT7A 1YXSA 3HEGA 2QI8A 4IWDA 4RLLA 3ANRA 3PRIA 4AT3A 3LXNA 4EH4A 3F82A 4QYGA 3EKKA 4FTIA 4MF0A 4FSYA 4D2WA 3QTZA 2R9SA 1XBBA 3UPZA 1H24A 3EKNA 4AP7A 3WF7A 5IUHA 4L44A 4O82A 4YZCA 2R3NA 3N4UA 2G15A 3OF0A 3W10A 2A19B 3E3PA 3VS7A 5CU4A 2WIPA 1V0PA 1GIJA 5I0BA 4FI1A 4YLKA 2CN5A 2KULA 2JDTA 2YIWA 3HP5A 2Y4IB 4DF3A 4H1MA 3ORMA 2YZLA 4N57A 4DBXA 4F0IA 4JDJA 3CR0A 2PZRA 4RA4A 4OBPA 5GINE 5H3QA 2QHNA 4JI9A 3FEGA 3PDTA 5DR9A 1XBCA 4XG9A 4DGMA 3G90X 1E9HA 4HYHA 3NYNA 2JKKA 5CENA 2ITVA 2QLUA 4RIXB 4ZY6A 5KZ0A 4AZVA 1J91A 3ATTA 4NW6A 4KS7A 4NJDA 3IGGA 5ANJA 4ACDA 3LMGA 5K4JA 2R3JA 3LM0A 1PMUA 2V5QA 1R3CA 3FXXA 4TNBA 3ORXA 3ORNA 2W1GA 5JSMA 4KNBA 5HGIA 4Z55A 4EOSA 1KOAA 4PRJA 4J99A 1W83A 3I0OA 2GHGA 3AG9A 3GQIA 4S32A 5J5SA 4I23A 2ZV7A 3C4FA 5AV2A 4L00A 5BX0A 3PXFA 2IVVA 3EN6A 2YDKA 5HG5A 5I9WA 4YTFA 3EZRA 4ORKA 4QP1A 3AC8A 3FI4A 3MY5A 4EUTA 1R78A 1IA9A 2B54A 3LLAA 3QD0A 3OCTA 4M97A 4II5A 3LXKA 5IH4A 3NSZA 1Q99A 5D1JA 3H0YA 4XG2A 3F5GA 4O0XA 5CSPA 3UO6A 1SZMA 4S34A 1M7QA 5HBHA 3RM6A 4BGHA 3GVUA 1K3AA 4DLIA 3QTWA 4ENXA 3ZDUA 1O6LA 2QKWB 3ZLYA 1V0BA 4FIJA 4HVHA 2CDZA 2FSMX 4M13A 3U9CA 3ZONA 1YXUA 4CTBA 5L4QA 5CEQA 1MP8A 2XM8A 3E8CA 5C26A 3O17A 1H1QA 4EH9A 2PMIA 2W17A 4I4FA 2IN6A 4OTPA 4P5QA 4C57A 5CTPA 4R1VA 1W0XC 4O7LA 2VTRA 4IZYA 1OL1A 3AD4A 4NCTA 3FYJX 3VW8A 5CALA 2PUPA 5EW9A 3RINA 5ICPA 3F9NA 4LUEA 4NU1A 4OBQA 4QTBA 1LEZA 3NMUF 3PG3A 3VS3A 4BDJA 5EHOA 1J7IA 2E9NA 4F6WA 2BDFA 3AT2A 4FTAA 2HELA 4LL5A 4ZTRA 4PQNA 4FNYA 3D14A 4C8BA 3JY0A 1MRYA 4P4CA 5EI8A 4A07A 1OB3A 4ACCA 2PVRA 4FC0A 3R1NA 5HHWA 3VHKA 5DEYA 5DT0A 4F9WA 3LFFA 1HOWA 4RVTA 4CYIA 1H26A 5DNRA 5H8GA 3P0MA 5DGZA 4ENYA 3MTLA 4LL0A 2BAQA 4PP9A 3EFWA 2WEVA 3OWKA 4QMNA 3HLLA 3OCSA 4WBBB 3E64A 4XP0A 3RBWA 3TNIA 4F0FA 3DJ6A 4TYEA 3CQEA 2X8DA 4A9TA 5HU3A 2HW7A 1L3RE 4CCBA 5FBOA 4PUZA 4S31A 2QU6A 1M2PA 3ZBFA 3ALNA 5B2MA 3VUTA 4C4HA 1ZMUA 2ITNA 4QO9A 4RBLA 2ETRA 3QHRA 2ZM1A 4KAOA 3UIMA 1OGUA 5LVNA 3AMBA 3C9WA 4EYJA 4BTFA 2XS0A 3W2RA 4AWIA 2PMLX 3LHJA 2C5VA 4IDTA 4QPAA 4DGGA 2WTJA 4J71A 4BI2A 4D28A 4EC9A 4B4LA 4WRSA 2A4LA 4K8AA 5AP1A 3BYVA 4U45A 2WMXA 3BQCA 5IH5A 3F2RA 4X0MA 4RC4A 2CMWA 4TYHB 4KABA 4L67A 3UOKA 4EH3A 3KL8A 3PIZA 4MXZA 4MF1A 3LVPA 4YJOA 3ZM4A 2XZSA 1KWPA 1KE7A 5J1WA 1CKJA 5AP4A 4PTCA 4XEYA 5AJQA 3CIKA 4HJOA 4QMZA 4OT6A 4PP7A 4LV8A 5IUIA 4D2VA 3UNJA 5ANDA 1FPUA 3D5XA 4J96A 3MVLA 3RVGA 4E5AX 1NY3A 2JAVA 2V55A 4YHFA 3AC2A 3G2FA 3K2LA 3KN6A 3U6JA 1G3NA 3DAKA 4NFNA 1Y57A 5LCKA 5HTCA 3C7QA 3EOCA 3D7ZA 5GIOE 1JNKA 5J95A 2OJ9A 3GEQA 3AD6A 5E8TA 4OTWA 4RZVA 4AN3A 1GJOA 3KRRA 4DG2E 5J5TA 1PXKA 3EQPA 3AT4A 4MQ2A 4NT4A 3DZOA 4WNKA 3A7GA 4EK3A 2UW5A 4O38A 3SOAA 5D41A 4F09A 4I3ZA 4MBLA 3ZBXA 4CFVA 3GP0A 3PRFA 4L46A 4PDPA 3CD8A 1VJYA 2BMCA 1UNGA 5EKOA 2XRUA 3OT3A 4JR3A 3Q60A 3ZO3A 4XRLA 3FPQA 3A7HA 2VU3A 2WOTA 4M84A 1BYGA 5IA2A 4BDAA 4QP4A 3VN9A 3ROYA 1JKKA 4JRNA 3C13A 4W4YA 4EJ7A 4I20A 3ORPA 3SXSA 1KE8A 3Q3BA 5CNNA 1H28A 2PVFA 3MV5A 3R7OA 4D1SA 4D2PA 4EHGA 4QMLA 5J8IA 3E63A 4FIIA 3PLAE 4AS0A 3LPBA 4FTOA 3LFAA 4RSSA 1PMEA 1FVVA 3ZSGA 3O8TA 2C0TA 2F2CB 5CY3A 3DBDA 3ZZEA 4IW0A 2YJRA 5T6KA 1J7UA 3FMLA 5JQ5A 3OY3A 3NVMB 5CXZA 1F3MC 3OROA 5ETIA 3MY0A 5FXSA 2GNFA 1OITA 3KFAA 3AMYA 3EYGA 3R28A 1F0QA 4UMQA 2XCHA 2PMOX 4OTQA 4C36A 4GFOA 3S3IA 4M66A 2PVMA 5AP7A 4XNEA 3HP2A 4BCIA 4DEGA 4CFNA 1YI6A 4QP9A 5J7BA 3R8VA 1WVYA 2ERKA 2GQRA 2CGXA 3P08A 4FNXA 4RX7A 4A9RA 5AAEA 5AEPA 4WUNA 2VGOA 4RIWA 3KRLA 2C6IA 3QUDA 4RJ5A 4TRLA 2WMBA 2XRWA 3PUPA 3EQGA 2ZB1A 3LIJA 2FB8A 3GCUA 2CKEA 3BHVA 3D7TB 5AUUA 4IC7A 5KNJA 4GK3A 3C0HA 4J7BA 4EOQA 3TT0A 5K5NA 3UZRA 1J3HA 3FMKA 4YHTA 2XKFA 5TKDA 3N9XA 4DEEA 3HV7A 3WYYA 3IW6A 4EH8A 1OKWA 3DKFA 4E4LA 3UMXA 5CAPA 4QYEA 3VQHA 3HZTA 2IZRA 5JGDA 3UOHA 2JDVA 2I0VA 4J98A 4FKLA 4IZAA 4QYFA 5I9YA 3KXGA 3DS6A 2V22A 2E9PA 3GFEA 4DG0E 2YM4A 4PY1A 4OTIA 4APCA 3IK3A 5IQCA 2IW8A 2OICA 1NW1A 2VWVA 2YA9A 2E9OA 5AIRA 3OTUA 1ZYCA 2C5YA 4QMYA 2UZVA 4TPTA 4QNAA 3RCDA 2ZYBA 4IB3A 2XNPA 4AOTA 4FTRA 4ZSJA 3PJ8A 4O0VA 4I21A 5EDRA 3LCTA 3KRXA 4XP3A 3N4TA 5B2KA 4I92A 5H2UA 4UZHA 2ZOQA 3ROCA 3KK8A 4PMTA 3T3UA 3O7LB 3VRZA 1A06A 4YC8A 4MNEB 1YOLA 3HVCA 5DI1A 5LVPA 2VTAA 2RG6A 4AN9A 5JZJA 3K5VA 5I5ZA 3IW5A 4BIEA 4M7IA 3BHHA 3TACA 4FKIA 3D15A 4YSMA 1NVQA 5EDPA 4H3PA 3CGFA 2JKQA 5JH6A 3MSSA 1VZOA 3TTJA 4ZOGA 4WNPA 3WARA 2QOIA 2XNMA 3OW3A 4GSBA 2HENA 1FGIA 4ZTLA 2Z7QA 4XOZA 2CJMA 4C02A 2Z8CA 4FTQA 4IZ5A 4FK3A 5DWRA 5AR7A 3VHEA 4DT8A 5IQGA 4UB7A 1GZ8A 3Q5IA 3SC1A 3WF9A 5HD4A 4FKJA 1XR1A 2ITUA 2BKZA 4M69B 1Z5MA 3TWJA 5IA1A 5M4UA 2A27A 4L52A 4O21A 3WZDA 2F9GA 3FHRA 2XK6A 1BI7A 4IACA 2QR7A 4YTHA 5E8XA 5AAFA 3LCSA 5G6VA 3G0FA 5CEMA 3KCFA 2RKUA 4XRJA 2YWPA 3A7IA 2W4OA 4E1ZA 1LR4A 4EYMA 3OBGA 4FTCA 2UVXA 3R7GA 3QBNA 3NNXA 5HI2A 4G5PA 4FOCA 5T3QA 3H9OA 3H3CA 5EW8A 3RTPA 2PZPA 3V5JA 2IPXA 2UZNA 4DYMA 3NUPA 5IEXA 2CNVA 2VWYA 4YZMA 3FDNA 4IB0A 4WG5A 3OVVA 4AT5A 2HCKA 5L2QA 3QRIA 4FV0A 4L53A 3W8LA 4EEVA 3LCKA 3RKBA 1NT2A 3HAMA 2V7OA 4O7SA 1OL2A 3EN4A 3MN3A 1APME 1DM2A 3EZVA 3FMDA 4NIFA 3A4OX 1BUHA 3COKA 4ZJIA 5HQ0A 5D10A 4CRSA 4KBKA 5CQUA 4AACA 4W4XA 1MRUA 5AP0A 4GT3A 3SHEA 1U5QA 3TIYA 4ZJJA 4MXXA 4U6RA 3MIAA 4OTHA 4PTGA 5CSWA 3SV0A 4KRCA 4QTCA 4TYJA 2XH5A 3HMMA 3QLFA 4IB1A 2OSCA 4XG4A 3V01A 4ZSGA 1CKIA 3TDVA 4I5MA 2C6EA 3UOJA 5I9VA 4G2FA 2UW3A 3IW7A 4IC8A 1M7NA 4ID7A 2FSTX 2LAVA 3I6WA 4Q5EA 3F7ZA 2WMAA 2JC6A 3PXRA 1CDKA 4QMWA 5J87A 4ACMA 4ANQA 3O50A 1ZZ2A 3FV8A 3QTUA 5IUGA 4QMTA 4OBOA 4U3YA 5ITAA 4RX5A 5J7HA 1H27A 3QKKA 3UZPA 4EZ7A 4LGGA 2YAKA 3Q9YA 4TW9A 3PJ2A 2GMXA 1WBTA 4V04A 5AM7A 1XKKA 5DVRA 3WF6A 3CEKA 2XNEA 4F9YA 4V0GB 3FMJA 4IM3A 4DEBA 3NPCA 2CKQA 2B53A 4IFGA 3ZFXA 2SRCA 2XKDA 2FSOX 3L9LA 4WSYA 2ZAZA 3F88A 4NFMA 4DC2A 3IO7A 2B52A 2CSNA 4RRVA 2QU5A 3BIZA 4L7FA 4RWLA 4ZY5A 2B0QA 1U54A 5IQAA 1OZ1A 4FT9A 4FV2A 2VWBA 4K77A 5A4EA 4BDIA 1ZY5A 2VNYA 3TNHA 4FKGA 3FZRA 3PXZA 5HNGA 2J5FA 1M52A 1P14A 4K0YA 2JKOA 2NNWB 3MIYA 5FM3A 4YUQA 4XBUA 3GC7A 2C3LA 2J9MA 4ZZMA 1OIRA 2A0CX 2W9FB 3HL7A 3A7FA 4PPCA 3V5QA 2ITOA 4DN5A 2WZJA 4FG9A 3I1AA 3OXTA 1ZAOA 2YN8A 2BUJA 4H36A 3MJ2A 3NIZA 3HUBA 3QGYA 5LQFA 5HVJA 3RGFA 5C4LA 2F4JA 2JFLA 4LUDA 1Q62A 2FA2A 4F4PA 5CASA 4E8AA 1PF8A 3I5ZA 3MESA 3QTRA 3TUBA 3BBWA 4HVDA 5AUYA 3G9LX 4U0IA 5D7VA 1LEWA 5TOZA 4G9RA 4P90A 5AUXA 3ITZA 5TO8A 2F7EE 4MWHA 3W16A 5HNBA 4YC6A 3G9NA 5E90A 3WIKA 2XNBA 1YDSE 1ZZLA 2W1ZA 2Q0BA 4HYSA 4RZWA 4R6VA 3DJ5A 4X3FA 4LGDA 5DLSA 5EYMA 3ZC6A 5KBRA 4ZSLA 4MBIA 3EQFA 3GI3A 4PNKA 3ENMA 1Q3WA 2PE1A 2PL0A 3CJFA 1R39A 4QP2A 5DRBA 3ZCLA 4AZTA 4EK5A 4H58A 5JGAA 3IPHA 3DK7A 4FZFB 4Q2AA 4PF4A 3D5UA 1IAJA 3P86A 2XIYA 1KE9A 3LMIA 1T45A 4FNWA 4JX3A 5AIKA 4FT5A 1YWRA 4FZ7A 4QP8A 5EM6A 5B0XA 4OTRA 2G01A 4X6RA 3S2PA 4FGRA 5CZIA 4AGWA 4ZXTA 2YISA 3UC3A 4IAZA 4O7VA 4EBVA 4CKJA 2PPQA 3ZRLA 5CS6A 5JFVA 4C58A 4BRXA 5KZIA 4ERWA 5L6PA 4YJVA 5AMNA 3TI1A 2WIHA 3DPKA 3RAIA 5FTOA 4F1TA 4YSJA 5BVOA 2VUWA 4FV5A 2Z7SA 4JT3A 3ALOA 5EFQA 5AWMA 2PU8A 3DAEA 2A2AA 3PP1A 3SRVA 1UNLA 4FV9A 3W55A 1KSWA 2E9VA 5HCZA 3SA0A 4LYNA 5HZNA 3FPMA 4E4NA 3JPVA 3PVUA 2PZIA 3KULA 4UWYA 5EG3A 3TEIA 4NTTA 5HX8A 2QOHA 5C1QB 5ANEA 2REIA 4XCUA 4G3FA 3UNZA 1SM2A 2YCFA 2GNJA 4EZ5A 3LE6A 3QQJA 1JVPP 4KBAA 3ACJA 3WF8A 4C3FA 3MPMA 4EQCA 2X2KA 5M51A 2WMSA 3GGFA 3QKLA 3Q2MA 4ZLZA 5JFWA 3JY9A 3KY2A 4R77A 3MA6A 4JR7A 3R01A 2WMWA 2X9EA 4GYGA 4H3BA 2QKRA 3EL7A 3L8SA 4GUBA 1BLXA 2XBJA 3POZA 3VBXA 4D58A 2CKOA 4BL1A 4IWQA 4N6ZA 5FD2A 4FMQA 2C6OA 2X6DA 3DDPA 4E6CA 1ND4A 5TE0A 4EH7A 3F3UA 5AFVA 3W18A 2AUHA 5CXHA 3TZ7A 2ITZA 3I0QA 2WGJA 4C4JA 4EI4A 2H96A 2XBAA 4Y85A 3AT3A 3E62A 3FQEA 4ASEA 2IVSA 3NX8A 3QUPA 4UEUA 3NUAA 3DFCB 5BYLA 3R8PA 3U55A 3DXPA 4JJRA 1ATPE 3PXKA 2ZDTA 4KIKB 4EKLA 2YWVA 5EI2A 4OUCA 3KN5A 5BVKA 3GENA 4O27B 2F2UA 3CKWA 4EHZA 5A54A 3K54A 4O0SA 4CEGA 3LFQA 5CF4A 5LVLA 4J97A 4OLIA 3VBWA 5FDPA 4S2ZA 5E8WA 1PMNA 4R8QA 5FTQA 2XM9A 4PDOA 3QZFA 4Y5QA 4IX3A 4BFMA 5BYYA 4O7ZA 2R2PA 3VAPA 4B8MA 4FIEA 4U42A 4D0XA 4ALVA 2ZDUA 4NL0A 4HVSA 1I44A 2HXLA 3BZ3A 2VTOA 4AW1A 3R1YA 3LJ2A 3VNTA 5AA9A 3ZUUA 3V8TA 2WQNA 4BDBA 5FP6A 4YHJA 3T8OA 4F7NA 4AGDA 4UXQA 2OXXA 4C34A 4FTMA 3DK6A 4MQ1A 1ZMWA 4XS2A 5DE2A 3ZOSA 4BCNA 4I0RA 4UBAA 4Y73A 3SOCA 3RPSA 3BLRA 3R04A 3UVPA 4CMTA 5DIAA 3FL4A 4PX6A 4TWPA 5HVYA 2UW7A 4JAJA 3EQRA 4U5JA 2B55A 1H07A 2X8IA 2XYNA 3ORZA 4PMMA 2C6KA 1Q5KA 5L2TA 3U87A 5A3XA 1PY5A 4XV2A 3DCVA 3P9JA 2WKMA 3PJ1A 4HCVA 4L43A 4FVPA 4ZSEA 3KCKA 1ZMVA 3L8VA 5CANA 3NGAA 5LJJA 4KSQA 1PYXA 5LVMA 2HYYA 2J4ZA 2P4IA 3LFBA 4U40A 4XMOA 1OKZA 1W98A 2VN9A 4CZYB 4X2NA 2ZMCA 3DJ7A 4JBOA 3W8QA 3NVKI 4FG8A 4RWIA 3RJCA 3B8QA 4EK8A 5C03A 4MXYA 4KB8A 4B8LA 5KO1A 3IG7A 2BIKB 1A9UA 3MS9A 2CGWA 3S4QA 4EHEA 5L8JA 3ZC5A 5AX3A 4ZZNA 4RIYB 3TM0A 2QOOA 3Q5ZA 3QTQA 2PY3A 3FQHA 3KRJA 3LQ5A 5ACBC 4HVGA 5L2SA 3COMA 3UODA 3OEZA 3NCZA 1FINA 2AYPA 2J0KA 3CPBA 3ORKA 2G2IA 5ETCA 4J95A 3E92A 1A48A 2Y6MA 4RPVA 2QO7A 3OFMA 5CU2A 3QC9A 2NP8A 3MGYA 3ODYX 3QU0A 3KA0A 4JVGA 3VO3A 4F7SA 5BQ0A 3GB2A 1J1CA 3I79A 2QOFA 5KMKA 1BX6A 3DB8A 4IX5A 3VF9A 4K6ZA 3E87A 3RK7A 2VO0A 2ZVAA 4F70A 5IMEA 2X8EA 2ONLA 2FUMA 1XBAA 2RSVA 1JSTA 1DAYA 3ZYAA 4TL0A 2YLFA 3G15A 2X9FA 3OC1A 3P79A 2HW6A 3CY3A 3Q9WA 4A4LA 4L7SA 1H1PA 4BCPA 3FZPA 4E20A 3SAYA 2GQGA 3R7IA 4PDSA 2C6MA 4KS8A 4O86A 4ZSAA 3F66A 5CSHA 4BGQA 3RPOA 4P5ZA 4IM0A 1KV1A 3I6UA 3R9DA 4BDKA 4YBKA 4IANA 3LZBA 5HLPA 5CZHA 1QPJA 5TF9A 3CGOA 1NVSA 4CKRA 1OPKA 2R5TA 4LFIA 2WHBA 4LV5A 1ZOHA 2QO9A 4O2ZA 2QONA 2BRBA 2VGPA 2UW4A 3Q96A 1RQQA 2BRMA 4KRDA 4AE9A 2NO3A 4ASXA 5CU6A 4AA0A 4YBJA 2PVLA 2P55A 4XYFA 5FDXA 4E5WA 2Y7JA 4EOIA 3ZO1A 2C1BA 5K5XA 3R02A 3IDCA 5LWMA 4R78A 4ZIMA 3MBLA 4JBPA 2WELA 3ZRKA 2WMUA 4C33A 3JR1A 3NRMA 4A4XA 3Q32A 4JS8A 3BLQA 4DEHA 3DT1A 5IQFA 3RP9A 3VJOA 4F6UA 4QMSA 4QNYA 2Z02A 1CM8A 3BV2A 4CQGA 3VULA 4FEQA 2PWLA 1PKDA 1JAMA 3CQWA 4L3PA 4U3ZA 4BKJA 1PXJA 4R3CA 5A6OA 1WVWA 3U6HA 2NPQA 3OWJA 2F7ZE 4DHFA 3QX2A 3P7CA 4BY9E 4GVAA 3MH2A 3U9NA 1P4OA 2ACXA 4C59A 4JG6A 5LVOA 2PTKA 4IX6A 3WE8A 3PY0A 4HYUA 5A9UA 3C4ZA 5ANGA 5L2WA 5C01A 4OTDA 2BFYA 3AGLA 3TUDA 2OK1A 2ZM3A 4BBFA 2XNOA 3EQBA 5AX9A 1P4FA 1R0PA 3NWWA 3R9HA 3ULIA 2GHMA 4YJTA 4L45A 5IA5A 2XB7A 3ZU7A 4O1PA 5AADA 2CPKE 4X2JA 2V0DA 2B4SB 3AD5A 4JDHA 4GCJA 3KXZA 4FEVA 5ANIA 3ZXTA 2P33A 3MH3A 3R9OA 1AGWA 4O0RA 4LRJA 4U80A 4C4FA 2BHEA 2PE0A 3KVWA 4DBNA 3FMNA 2B9JA 4G3EA 3LFDA 3R73A 4FL1A 1K2PA 4ZZOA 2OBJA 3SVVA 1BL7A 5C4KA 5LMKC 4UMTA 4YJUA 1VR2A 3DQWA 2VV9A 4W4WA 3THBA 4FL3A 2QCSA 5BVWA 2P0CA 2W1IA 3CBLA 5L8LA 3CD3A 3D83A 3NAYA 5I9UA 2VNWA 4CFFA 3CXWA 4G9CA 4R3PA 4RJ7A 4FIHA 1H1RA 4NKSA 3COIA 1B39A 3BGQA 3MVJA 4AN2A 1QL6A 3FLQA 4BTMA 3GUBA 5BVEA 2JDOA 4IJPA 4M12A 5JK3A 3PE2A 2H6DA 3P1AA 3FLSA 5IG1A 4FE2A 5AR5A 3QX4A 1OVEA 1S9JA 4WNMA 3DXNA 2ETKA 3E8NA 4QRCA 3F5XA 4RQKA 5HKMA 4IAIA 3S95A 1BMKA 1OMWA 2I6LA 1Z9XA 5KHWA 2C0IA 3A99A 2EB3A 4AU8A 2BRNA 2FYSA 3SDJA 3D2IA 1SMHA 2X2LA 2X7GA 2OFUA 3PIXA 5HCYA 4ZY4A 2YERA 5KUPA 2I40A 2GCDA 2YCQA 3UPXA 5EYDA 5DG5A 1PHKA 4FT0A 3GU5A 4RVKA 3Q52A 1IG1A 1GZNA 4JQEA 3KEXA 3UC4A 1W82A 4H1JA 4BZOA 3BEAA 3P7AA 1IRKA 2E2BA 2XJ1A 3LCDA 4GUEA 3JYAA 4GT4A 5KX8A 4FZ6A 5CAUA 5TR6A 4KUJA 4WRGA 2EXMA 4MWIA 5GIPE 4WHZA 3PPJA 3A7JA 3QLGA 3W2OA 3R7UA 4CFUA 3RNYA 3O8UA 4L01A 4ALUA 2RG5A 4YPDA 4PNIA 4RA5A 4BHZA 2VTSA 3UG2A 3LM5A 1QPDA 5CAOA 4GU9A 4NSTA 3QZHA 2OJJA 2GNIA 4X3FC 1K9AA 4DLJA 4BYIA 3QYWA 4XV1A 5FGKA 3SW4A 2C4GA 3R71A 1VYWA 2J0MB 4RT7A 1FVTA 5IEYA 2PUIA 5I9ZA 1H00A 2R3OA 2YAAA 3NLBA 3QC4A 4E26A 3PJCA 3PY3A 4HZSA 1WMKA 1DI9A 5BMMA 4YC3A 4IB5A 3UYTA 3H9FA 3D94A 5K3YA 3DV3A 3H0ZA 4E93A 3U6IA 3L1SA 4Z3VA 5F20A 4EWQA 1Q8WA 3NIEA 3UVQA 3DA6A 4BZNA 1OL6A 1MRVA 3KXHA 4HZRA 4JNWA 4K2RA 1Y6BA 4MD9E 5HE1A 3FXZA 1UU8A 5AAGA 3EFJA 5HE0A 4E6DA 3G5DA 5A4LA 2CCHA 4LMNA 2C1AA 4TKSA 3FSFA 3Q04A 3O7LD 4HOKA 3FXWA 4DH1A 3FWQA 4QPSA 3HA8A 1YHWA 1JQHA 4F65A 4F9BA 4UV0A 5AV4A 5ACKA 3CSVA 2WTCA 4D2RA 4EOMA 3PJ3A 5E9EA 2OW3A 1KUTA 4A06A 1H25A 2QLQA 2GNLA 3MDYA 4ONAA 4EOKA 4BBMA 3W2PA 4BCQA 2UVYA 2BZKB 3VJNA 4UWCA 5K0XA 3D5VA 4EOPA 4FZDB 4X21A 5HX6A 4XLIA 2JIVA 5EHLA 2XEYA 1H01A 1SNXA 2P3GX 2PVJA 3C4EA 5KMLA 1YRPA 4F9CA 4HGSA 2YABA 4GMYA 4FNZA 3PIYA 4MCVA 2R3MA 4X3FB 1OUYA 4FG7A 4IDVA 3WZUA 3V3VA 4EJNA 5M06A 4M3QA 3S1HA 4DA5A 1WBWA 2BZJA 4YPSA 3QRJA 3Q9ZA 4FKPA 2HY81 2EVAA 4F08A 4M8TA 1YWVA 2ITWA 3HMIA 2C47A 3HKOA 3ZFYA 4EQMA 2J90A 4FT3A 1XH4A 3Q6WA 4RIXA 1L8TA 1M17A 4I4EA 3N51A 4XBRA 4O6LA 2BTRA 4FF8A 3UDBA 4ARKA 1LP4A 2I0YA 3PA3A 4J53A 3SLSA 4EBWA 1UU9A 4EOOA 5HTBA 4O83A 1WBNA 2WTKC 5HE2A 5AP3A 3HYHA 4BCJA 4BYJA 4YU2A 4BWKA 2H9VA 4RLKA 2XK9A 2VX1A 4EOJA 1WBOA 4V05A 4D1XA 3UQCA 5AV0A 1ERKA 2OZAB 3WBLA 2PMNX 4EHVA 5HG8A 3F61A 5EYCA 2WOUA 1DS5A 4HGTA 1B38A 2Q0NA 2YCSA 2LGCA 4MBJA 4RFYA 2GDOA 1B6CB 3WE4A 2OLCA 3FZ1A 2VO6A 4FTNA 4IIRA 4G5JA 4AZEA 3FE3A 3Q53A 5CT7A 4EZ3A 4R7IA 4B0GA 1SVEA 1TQPA 5M53A 2CHLA 2EB2A 1V1KA 4BVUA 5EW3A 4HNFA 2FH9A 2XIRA 4A7CA 2WQOA 4NZWB 4CFWA 4D4SA 4MYGA 2VX3A 4UYAA 4NJ3A 4AT4A 2BILB 2C6TA 2YM6A 3FI3A 4C2VA 4DFXE 3HMOA 4UX9A 4JDIA 4FBXA 4QMUA 3NNUA 4AZSA 3TZMA 5LXMA 3QD2B 2OWBA 3GT8A 5F94A 1LPUA 4B6LA 4IJ9A 3O51A 4CZTA 4S33A 5TT7A 2R3PA 4XHKB 2PHKA 1KE6A 5L6OA 2GS2A 4RIOA 3NUYA 3Q2JA 5IQHA 3WF5A 4AW0A 4YO4A 4YZ9A 3RM7A 4AA4A 3DKOA 3P4KA 3EFKA 3RI1A 3RHXA 3ZFMA 1RW8A 2J50A 3FZOA 3IONA 2CN8A 3FLZA 3A8XA 4XH6A 3TV7A 2YHVA 3UQGA 3ZLWA 4FEXA 2OXYA 2GNGA 2WNTA 5DR6A 2BIYA 4NM0A 4WG3A 5ANKA 3BKBA 4EK6A 3E5AA 4B7TA 3PP0A 2XIKA 2WU7A 2VTQA 4R5YA 3RK5A 4I1ZA 4J52A 1SNUA 3MFUA 5KMIA 3B2WA 1O6KA 2VTTA 2NRUA 4PTEA 2XJ2A 4F1OA 3LW0A 4I6HA 3PFQA 2YITA 3QF9A 2J0IA 4UXLA 5CYIA 3FLYA 4I24A 5GHVA 2G1TA 2GTMA 3C51A 4ITJA 3KMUA 3VS2A 3PG1A 1WBPA 3W32A 3DGKA 5DRDA 2X7OA 3SGCA 5CI6A 1OUKA 3RAWA 3V8WA 1OBGA 3ZO2A 1YVJA 3ZMMA 5GJFA 3VUDA 1PXIA 5AR4A 4LRMA 4FV6A 5ETFA 1BL6A 3F7WA 2WTVA 3MVMA 4B9DA 2JBOA 5EYKA 5M56A 3N4VA 4F1MA 4C0TA 3DBEA 3I5NA 2GQSA 3IOKA 5D7AA 3EH9A 2BZIB 3S0OA 1PXOA 4AZWA 2Z7RA 4BDEA 4E73A 4NW5A 3TL8A 4E4XA 4CRLA 5GNKA 3BCEA 4E5BA 1JKSA 2IZUA 3OS3A 1YOJA 2OO8X 3OUNB 4TYHA 5DN3A 3VBTA 4DH3A 3CJGA 2RGPA 3BHTA 4BIDA 2XK7A 2OG8A 2R3KA 1T46A 3BLHA 5BVFA 3UQFA 3V5TA 3VUKA 3M42A 4IADA 4MK0A 5DEWA 3MA3A 5JQ8A 2JIIA 5CVGA 5AR8A 1XH7A 1UA2A 3GCSA 4GV1A 4JBQA 4DEAA 4RJ8A 1Q61A 4GG7A 4MXCA 3MPTA 5DYJA 2PULA 4IEBA 4ANMA 3RPVA 1P5EA 4GG5A 3EIDA 3R1SA 3LMHA 2ZJWA 5FLFA 4O6EA 3RALA 3VC4A 4AF3A 5B7VA 4DFLA 2J0LA 4QMXA 4S30A 5FEQA 3WOWA 4DITA 2VZ6A 4XX9A 4UYNA 4O1OA 4D0WA 3OTVA
chains in the Genus database with same CATH superfamily
5EM8A 5EOBA 3VS6A 1UVRA 2PSQA 1U5RA 3ETAA 2O64A 4CCUA 4WO5A 3ZO4A 4BDGA 2WMTA 3BYMA 4EOLA 1XJDA 5H9BA 2IO6A 3BYOA 1Q41A 1U59A 3F2AA 3VBYA 4CV9A 3C5IA 3R7YA 3C1XA 4EKKA 3I60A 4TNDA 3JVRA 3CPCA 2Y6OA 5FWKK 4EUUA 1Q97A 5B2LA 3GCVA 4CG8A 4QYYA 3O8PA 4QYHA 1M2RA 5J9YA 5DBXA 1ZYLA 3BV3A 3AC1A 3HRFA 5C8MA 4OTFA 3VBVA 3QD3A 4AFEA 4R7BA 1W8CA 5CAQA 5LCJA 3MW1A 4UWBA 2XK8A 5F1ZA 2GFSA 3BGZA 4IVDA 3PWYA 2OJFE 3FUPA 4R5SA 4WNOA 3LQ3A 2DWBA 2XJ0A 1YWNA 3ORIA 4R3RA 2YIYA 3TTIA 3NYXA 3GBZA 2B9HA 4FKUA 3G6HA 4FTKA 4G6OA 1WZYA 3I7CA 4HYIA 3B2TA 4IBMA 2UW0A 2R3IA 2R7IA 1PMVA 2ETMA 1GNGA 1LUFA 3PA5A 3GC0A 4D4VA 1PXPA 4NCTC 4QQJA 5HORA 2PK9A 3NFGB 2BVAA 1REJA 3CCNA 3NR9A 1REKA 1E1XA 3ZSHA 4O91A 4D5KA 5LMBA 1DI8A 2W1DA 4OT5A 3LCOA 3VUIA 2VWIA 5J9LA 5EQYA 3H9RA 4FICA 3G33A 4DFYA 3NZ0A 1ZXEA 2HIWA 2R3FA 3UYSA 2O8YA 4D2TA 4MX9A 3TZ8A 2IG7A 5JMSA 2W0JA 2XMYA 4DFNA 3QZIA 2C3JA 1JWHA 4P7EA 2OJIA 5E4HA 4BI0A 4YR8A 3UDZA 4ZAUA 3QXOA 4UMUA 2W96B 4DFBA 4BKYA 5HIDA 4NWMA 5DA3A 3BQRA 2X39A 1PRYA 3D7TA 4O7RA 4JQ8A 2UZEA 3I81A 4K18A 1Q8ZA 4I94A 4U44A 4DTAA 3D2KA 4FSUA 2B9IA 2QOQA 2Y9QA 2YIXA 4CKIA 2W1EA 2XEZA 2JBPA 1OL7A 3GC9A 2PUNA 5CF5A 1M14A 2XKCA 4DT9A 1OIQA 4OTGA 4ZMEA 4XUFA 1HCKA 2JDRA 1W84A 3QQHA 3QTIA 3EQDA 4X6QC 4BTKA 5I9XA 1WAKA 2BROA 2OF2A 2HZ0A 4I0TA 4TWOA 2BCJA 3O23A 3OUKA 3QFVA 3R8ZA 1CTPE 3G51A 1ZOGA 5IQDA 4JBVA 2WU6A 2BZHB 2HXQA 3PE1A 4BF2A 5KMMA 4ACGA 4U81A 1OPLA 4BJJA 2O0UA 1F5QA 3FMMA 4W4VA 4BZDA 5JKGA 5JRQA 2YIRA 4FKVA 4I5PA 4CLIA 4QP7A 5HG9A 3P5JC 3TYKA 1JSUA 5JZNA 4G3GA 5BYZA 3ZEWA 2WB8A 3SXFA 2WEIA 2C5NA 3O5AA 1UKHA 1Q4LA 4ZTQA 2ZB0A 3TZ9A 4D9TA 2C5OA 2IVTA 3VS4A 1X8BA 3GNIB 5KBQA 3QCSA 5M44A 3BPRA 4YGAA 5DR2A 4UMPA 3ELJA 4ANLA 2CCIA 3CP9A 2I0EA 3MTFA 3RWPA 2JFMA 4L3JA 3QGWA 3BGPA 5HICA 4N4SA 1RJBA 3R00A 4G31A 4MNEA 5JEBA 3UO5A 2OFVA 5AUVA 3TNPC 4NUSA 4RQVA 1UV5A 2WO6A 3KREA 4BI1A 3NFFB 2UZWE 5HE3A 4O81A 3DFAA 3AC3A 4M14A 1G8AA 4XG3A 3FMEA 3HMNA 4RJ6A 3R8MA 4E3CA 4QTEA 3NCGA 3SG9A 3QRKA 4ACHA 4KSPA 5BVDA 2VTPA 1XH6A 3QA0A 5CVHA 4RFMA 5H8BA 4FTTA 2XAOA 3KB7A 4YLLA 5HIBA 3AXWA 2O63A 2YM3A 4QP3A 4IVCA 4PPAA 4BICA 3QTXA 2QODA 4M69A 4ITIA 4Y83A 4DDIA 4F78A 1YHSA 2E9UA 4IWPA 1ZYSA 4O4BB 3DBQA 1UWJA 4F64A 3FZSA 2W7XA 4PWNA 2XUUA 4C4EA 4RWJA 2R3LA 3LXLA 4D4YA 3A2CA 3OXZA 3PVBA 4JOAA 1E1VA 3P7BA 4W9XA 5EK7A 1BKXA 3ZUVA 1Y8YA 4TWNA 3B8RA 5JGBA 4WA9A 5FBNC 4USFA 3BX5A 3ZM9A 4CT2A 3P23A 5IA3A 4ANNA 3HRBA 1ZYDA 3V6SA 4BB4A 5IISA 5HO8A 3UE4A 3DNDA 2YCRA 4LM5A 4U43A 4NEUA 2JDSA 2G2HA 1OKYA 1OKVA 5L2IA 1WBVA 3AKJA 1CSNA 4QQCA 3I7BA 2QNJA 4IZ7A 3RAKA 1WVXA 2R3HA 5IH6A 1BI8A 4AE6A 5HIEA 4KKGA 3EQIA 3REPA 2OKRA 3KRWA 3BU6A 4WT6A 3VUMA 5DHJA 2YM5A 3OZ6A 4QTAA 4MH7A 4YO6A 3VUGA 4HW7A 3LKMA 2DYLA 3F2NA 4D2SA 4ANBA 4WG4A 3FI2A 1YHVA 2JGZA 5M09A 3KF4A 4CLJA 2YM8A 4JG7A 4GK2A 4J8NA 4OAVB 3DXQA 4JDKA 5A4CA 2RFEA 3EL8A 3NAXA 3MH0A 3KMMA 4O7YA 3DBFA 2CLQA 3BELA 4GRBA 3L9MA 4KKEA 1H8FA 3FC2A 2ZFYA 2BFXA 3UO4A 4K33A 4JG8A 3W33A 4AGCA 4FV8A 4IVBA 3JUHA 4LOOA 2VWUA 4WUAA 4A9SA 3R2BA 4CTCA 4E4MA 4D5HA 5D12A 4DG3E 4HVIA 4L6QA 2DUVA 3HDMA 4PPBA 3VUHA 1ZWSA 5HBJA 4AXDA 3CTHA 2JLDA 4V0GA 4RX8A 1MQBA 2XK4A 4BDCA 4YZNA 4FEWA 3FI8A 3NUUA 4GYIA 5M4CA 3TMOA 4BN1A 1QPEA 1XMLA 5FG8A 4C3RA 3TDWA 3GU7A 3TKUA 3U54A 2J6MA 4CFXA 5IMXA 5CI7A 4YJRA 2BRHA 4BCHA 3MVHA 1U4DA 1S9IA 2BALA 3F3VA 4HCTA 4O7NA 5T68A 3BHYA 3R9NA 1IR3A 2UV2A 3KXXA 2VRXA 1U46A 2QOKA 4EQUA 5CVFA 5JN2A 2BTSA 2OIQA 3GCQA 5L6WL 4BCFA 5CU3A 2OH4A 3NW7A 5M4IA 4WSQA 3AQVA 3BWJA 5D9HA 3UBDA 1XHAA 4QTDA 2WMRA 4CZUA 4F9AA 1URCA 3QYZA 3RHKA 3NW5A 3W0QA 1AQ1A 4UALA 4ZP5A 1FMOE 2UW8A 4RIWB 3NEWA 5CAVA 4GK4A 2FVDA 3FKOA 2FO0A 4ITHA 5E1EA 4F63A 3L9PA 1FQ1B 4NK9A 1FOTA 3MPAA 4G3DA 3UVRA 2PZ5A 1R1WA 2UVZA 2QOCA 3CS9A 2XIXA 1MUOA 3DNEA 3EQHA 4R7HA 4K11A 5HO6A 3A8WA 3A4PA 2VX0A 3TUCA 3DTCA 4GKHA 2BPMA 1WCCA 3DQXA 3R22A 4C3PA 4AOJA 4MUQA 4O7WA 4I5CA 4GJ2A 3GXLA 3VW6A 4YURA 3OT8A 5E1SA 3M2WA 4IM2A 2O65A 3TG1A 4CGAA 5EI6A 4FA2A 4FSQA 3PWDA 4QMVA 3NW6A 3BWFA 2HK5A 3D4QA 3F5UA 3OWLA 2PE2A 3I4BA 1GIHA 3PLSA 4AA5A 5JT2A 4QDVA 4GW8A 3JVSA 2CGUA 1RE8A 3OP5A 1ZRZA 4K1BA 4L8MA 4Y5HA 5HEZA 3UDSA 2YEXA 3RZFA 4I22A 1OIUA 2HAKA 2I7QA 4QMMA 1YOMA 4FIGA 4HPTE 3WZEA 3R83A 2IWIA 4X2FA 4FIFA 2QOLA 4QD6A 4RGJA 5EH0A 2PVHA 4TYIA 2WAJA 3SQQA 4FSWA 5EOLA 4BKZA 2NYAA 4M15A 4XJ0A 2R3RA 3A62A 3PSBA 5CX9A 3OOGA 4APPA 4BWPA 4U41A 3D9VA 3IDPA 4WIHA 2XCKA 4FSRA 3LFCA 4FKWA 3ANQA 2ITPA 2R4BA 2GTNA 4JMQA 3HV4A 1J1BA 4FODA 3MB6A 2RF9A 5HNIX 3R9RA 5HO7A 2QVSE 4XOYA 3D0EA 4MAOA 1Y6AA 3ULZA 4FV4A 2J2IB 5CNOA 4EH6A 3HECA 2CKPA 4XLVA 4HCUA 4CYJA 4DCEA 4RJ3A 2WPAA 3P78A 5IEVA 3RPYA 3VS5A 3QQGA 3T9IA 3DOGA 2OF4A 5KMNA 3IKAA 3AGMA 3FC1X 3H4JA 4TTHB 1Q8YA 4DINA 2C3IB 3PZEA 4BDDA 4FRFA 3HGKA 4XG7A 3RAHA 5L3AA 1YW2A 4X7QA 4ZTHA 5IPJA 3NUXA 5M4FA 4O0UA 3RCJA 2WXVA 3R21A 3WZKA 2ZMDA 3G0EA 3QCQA 3TIZA 2VWXA 3DBCA 2CNUA 5AUWA 1MQ4A 3ATSA 4ERKA 4O84A 2R7BA 5HTIA 5E8ZA 2Z60A 4IQ6A 5DT4A 1KOBA 3KK9A 4C37A 1OBDA 4USEA 3T9TA 4G6LA 4A9UA 4I0SA 3V5PA 4GFGA 3PXYA 3K5UA 4YTIA 5DOSA 5E8SA 3R7EA 4KKHA 3QCXA 4DEIA 4U97A 3HX4A 4N70A 1V0OA 5EHYA 2AQXA 3TKIA 5EM5A 1PKGA 3DB6A 2VWZA 4NIFB 3GCPA 2QC6A 5A46A 3E88A 3QZGA 3PVWA 3QD4A 3ACKA 4J8MA 4XV3A 2BHHA 2GU8A 4GFMA 3QWJA 1RDQE 2VO3A 3ORTA 2HZNA 4BHNA 4CXAA 2RIOA 1XH9A 3BU5A 3OWPA 4FTJA 2V62A 4AZFA 3LFNA 3UZTA 3R30A 5M08A 4F6SA 2XIZA 4FSZA 3F6XA 2PUUA 4ZLYA 5KMJA 4R1YA 2ITQA 2ZM4A 3LJ0A 4KIKA 2WQMA 3FZTA 3O2MA 4YP8A 4CMUA 4FKRA 3U8WA 2W4KA 2ZV8A 2R0IA 3VS0A 3TJCA 3ID6C 3MFTA 2BAKA 4FVQA 4PL4A 1CKPA 3V5LA 2YJSA 2GSFA 4I5HA 3W1FA 4F99A 1JBPE 2QD9A 2YZAA 3VQUA 4H39A 1YI3A 5HD7A 2GPHA 4Z16A 1TQIA 1YXVA 3A61A 2F57A 4YNEA 3W2QA 4DFZE 3FY2A 2XNNA 4ZTMA 5F9EA 4ZTSA 4O7TA 2C5XA 3DU8A 3GU4A 2B7AA 3MI9A 4I6QA 4IAFA 4IE9A 5E92A 5LARA 3AC5A 3RNIA 1JKTA 4EL9A 3SW7A 5IA0A 2R3GA 4PV0A 3MYGA 5FQDC 2CGVA 4X2KA 2YDIA 4Z9LA 5E7RA 2PYWA 3PSCA 5FXQA 3NDMA 3ZTXA 5F95A 2G9XA 4Y95A 3OBJA 4U79A 3RWQA 3ERKA 3ZEPA 3Q4ZA 4LG4A 3WYXA 3OCGA 1IEPA 4YJQA 3WI6A 3NUSA 3OY1A 2VO7A 5J79A 2X2MA 4Q5HA 2C6LA 3HAVA 3WILA 3E7OA 5BVNA 3TXOA 1U54B 2HZIA 2C0OA 3FKLA 3FSKA 4G17A 3IW4A 3R7VA 4YJNA 4NM3A 3F5PA 3TNWA 3UG1A 1AD5A 2VTHA 4FYNA 3TKHA 5E8UA 2UUEA 4WOVA 1KE5A 3R8LA 1GOLA 5EDQA 3VF8A 5BPYA 5I3RA 4FV7A 3PZHA 2A1AB 5CEPA 4FT7A 3SG8A 4JLCA 4V01A 4KBCA 1XO2B 4FKSA 5KHXA 2P2HA 3EFLA 5CF8A 5HLWA 3BE9A 4A4OA 3MFRA 4Q9SA 2X6EA 2HWPA 2FGIA 2IW9A 1M2QA 2DS1A 2HY0A 4QMOA 3OOMA 2O3PA 1H1WA 3ORLA 1YXXA 4O0YA 5FP5A 4BC6A 3ML1A 2W1HA 5C8NA 2GNHA 3VBQA 1DAWA 2I1MA 4KINA 5AP6A 5ETAA 2VTIA 1I09A 4FUXA 2W5HA 4RIYA 4RVMA 2V7AA 2WMVA 3PYYA 3FHIA 4MVFA 2J0JA 3Q4TA 2XK3A 3O0GA 3Q6UA 2BRGA 1HCLA 1Q8UA 3QTSA 5BUIA 4GS6A 2C6DA 3OG7A 3RZBA 4LOQA 4EK4A 2C68A 5IDNA 5BUEA 4U8ZA 3TCPA 2Y8OA 3PA4A 5KKRC 2W99B 4C4GA 1J7LA 1EH4A 2HOGA 5HCXA 5AUZA 3OEFX 5HESA 5K4IA 3II5A 5H8EA 5LWNA 1Q3DA 3HA6A 4O0TA 3V5WA 1UU3A 2VAGA 4Y8DA 4CSVA 5GZAA 5FUTA 5LMAA 3A60A 3M11A 2QO2A 3IS5A 5AR2A 1OPJA 4YTCA 4DDGA 4JL9A 3QALE 5IKWA 2OZOA 4LRKA 2J51A 5GJDA 1VEBA 2XKEA 3S00A 4IAKA 2R3QA 2X81A 4PL5A 5I4NA 2UZLA 4OR5A 3KKVA 4LGHA 2WTIA 3FYKX 4I6BA 3W0SA 2PZYA 4MD8E 4O0WA 2PVNA 3GC8A 2WMQA 4KWPA 3P5KA 3R0TA 4YJPA 3GOPA 2YACA 5CF6A 2XA4A 4FX3A 1H4LA 4AXAA 1NA7A 2ITYA 4YNOA 5IU2A 2Z7LA 3KC3A 3HNGA 2C69A 3SRVB 1JOWB 3EQCA 3BRBA 4QT1A 4KA3A 2RFSA 5M55A 5EM7A 2YDJA 5CT0A 1O6YA 2ITTA 4P2KA 4AXFA 4RC3A 4WKQA 3UMWA 3EN9A 4AFJA 5KKRB 2PVKA 4B99A 5HBEA 3WZJA 3ZS5A 2JKMA 3W0MA 4G34A 4RWKA 3U4UA 3KULB 3UTOA 4XG6A 3CY2A 3FKNA 3AKKA 4AQCA 4ZS4A 2YIQA 2OXDA 3H30A 4IMYA 3SX9A 1JKLA 4AOIA 4BCGA 5AUTA 3C0GA 3PTGA 2O5KA 5CSXA 2IF8A 2VTJA 4EC8A 5KCVA 2XP2A 3TNQB 1Z57A 1PYEA 2JD5A 4L9IA 3L9NA 3PPKA 4M0ZA 3SD0A 1YDTE 2WTKB 4FTUA 1Y8GA 5CSVA 4E6QA 5F4NA 1IAHA 1YXTA 4CMOA 3FLWA 4DEDA 5EQPA 2R64A 2YLEA 4IAYA 5AR3A 3SXRA 1H08A 3BU3A 3F3WA 3IOPA 4HGEA 4RFZA 4D1ZA 3ZUTA 3TN8A 2OGVA 5IA4A 4IH8A 2EU9A 5G1XA 1OM1A 3DK3A 1TQMA 2BAJA 3AC4A 4G1WA 4RG0A 4ZK5A 4IHPA 4AUAA 5FM2A 2NRYA 4ZEGA 4UN0C 3CKXA 4GVJA 3ZH8A 3QQKA 4ZMFA 3BEGA 4JX7A 4USDA 2OIBA 1W2CA 3EJ1A 5HU9A 2UZDA 3QWKA 5IZFA 1ZYJA 3FL5A 3ZLXA 4D4RA 3PY1A 1FGKA 3IGOA 2IW6A 3EB0A 2QQ7A 5AV3A 4YJSA 3NUNA 5FRIA 4AW5A 4BCKA 2VTMA 3E8DA 5CEKA 4IAAA 1R0EA 3DTWA 4M67A 2Y4PA 5C9CA 1TVOA 3MB7A 5C8KA 5JFSA 3KF7A 4CT1A 1JPAA 3K3JA 2IVUA 4OW8A 4TN6A 4CFMA 1OECA 2W5AA 2EWAA 3VIDA 2JAMA 2UZUE 3FQSA 4DGLC 1ZY4A 1H1SA 2P2IA 1PW2A 1XQZA 2O2UA 2WFYA 1PXMA 3D5WA 4GKIA 2XYUA 3IQ7A 5GJGA 2UZBA 2X7FA 4GJ3A 4MXAA 4O22A 3NNVA 3QRTA 4GL9A 3COHA 1XWSA 3OW4A 2IZTA 4KIOA 4LQMA 4JIAA 4GH2A 4NKAA 2WTWA 1ZOEA 4L3LA 3UOLA 1FBNA 4OGRA 1SVGA 4LOPA 5AP2A 5K9IA 4I93A 1P2AA 4TWCA 4RVLA 2G2FA 3R1QA 4L42A 3O96A 3HV3A 4TZRA 2VD5A 3L8PA 3ZXZA 4FEUA 3UNKA 5BMSA 4H05A 4PMSA 3QQLA 2BDWA 2Y0AA 4AX8A 4C7TA 4YZDA 3ZZWA 1YDRE 3LJ1A 3O71A 4FKTA 4FL2A 4YMJA 4HPUE 4ZLOA 2ONLC 4KD1A 3C4CA 2BKKA 3KVXA 4NYEA 3KXMA 1UU7A 4NTSA 4O4EA 4DTKA 4RJ4A 5E8VA 4JQ7A 4IVAA 1H0VA 5KE0A 5LMKA 1TKIA 5EQEA 1UWHA 3RK9A 4BR3A 3CLYA 3QA8A 4H3QA 3MJ1A 3PSDA 4K9YA 4YZBA 5EKNA 4BIBA 4O96A 1PXLA 4C2WA 4JIKA 5K0KA 1WBSA 1SYKA 2XNGA 4TYGA 5CU0A 5DMZA 4IX4A 5DPVA 2XF0A 4FOBA 4C38A 3CC6A 3E3BX 4GIIA 5CEIA 2XVDA 1G5SA 3QAME 3LOKA 3QXPA 2YM7A 4BDFA 5D11A 3HMPA 5CWZA 1ZARA 4FR4A 2GFCA 3V04A 4AAAA 1VLRA 3ENHA 5CLPA 1NVRA 1WFCA 4C61A 2RFNA 3GU6A 4GT5A 4XG8A 4CV8A 2XARA 3NYOA 4AGUA 3QCYA 2B1PA 4CQEA 2CNQA 3KGAA 4U7ZA 4UMRA 3DLSA 2FSLX 3OD6X 3UIUA 2H34A 5AV1A 5HVKA 2OU7A 3R8UA 2QR8A 3BBTB 4LI5A 4BDHA 3GOKA 1W2DA 3NYVA 5BUJA 3EWHA 2C3KA 2PVYA 3CE3A 5C27A 2WD1A 3U4WA 3VWAA 3BYSA 2J5EA 4EORA 2QHMA 4CG9A 4MXOA 5GZ9A 3VS1A 3UJGA 3JXWA 4DCAA 4ZTNA 3AMAA 3CQUA 2QOBA 4G3CA 1IASA 4G16A 4JRVA 3OMVA 2QG7A 3F3TA 2QURA 2X4FA 3IW8A 3MFSA 3ZHPC 3ZRMA 4XV9A 1YKRA 4WD5A 4OAUC 4D55A 4FSTA 5A4TA 3PVGA 4FSMA 4LMUA 4RC2A 4YLJA 3OCBA 4CD0A 3DKGA 3QL8A 4FZAB 4KIQA 4TY1A 2YFXA 4FV3A 4GEOA 4PL3A 2HWOA 4Z7HA 5A14A 4NM7A 1ZLTA 5A4QA 4BGGA 3FAAA 1STCE 2ZV9A 2QG5A 3IECA 3OHTA 4FKQA 5FEEA 4EONA 3CTQA 1YI4A 3LLTA 3LXPA 3PXQA 4FGBA 4MD7E 4EWHA 5CEOA 3UGCA 2OJGA 1PXNA 5FEDA 3JS2A 3C0IA 4GIHA 5FTGA 4N6YA 4NH1A 4DE4A 1Y91A 4EH2A 5I3OA 3BYUA 1UKIA 4M68A 4W8EA 4G6NA 2ITXA 2UZTA 4AW2A 1W7HA 1CMKE 4Q9ZA 3QHWA 3ZDIA 2RL5A 1NXKA 2W06A 4QQ5A 4IWOA 3V8SA 4E6AA 4CNHA 5IDPA 4FVRA 4AG8A 3LFSA 3Q9XA 4DAWA 2OZAA 5IQBA 2GS6A 5M07A 1QPCA 2X1NA 3DDQA 3E7VA 4JXFA 5DFPA 5AM6A 1GY3A 4RMZA 3VRYA 2BR1A 5IQIA 2EXCX 3EMGA 4FSNA 2ZV2A 5E8YA 2F7XE 3IDBA 3WIGA 3QUEA 4F7JA 2GHLA 5E91A 1FVRA 5IQEA 1URWA 4MEDA 2AC3A 3SKCA 3V51A 5L8KA 5M57A 2GS7A 3MH1A 5GZ8A 3CTJA 4FK6A 4Z7GA 1JLUE 3DLZA 3ODZX 2UZOA 4DH5A 3HV6A 4FV1A 3POOA 3UP2A 4BWXA 4C35A 4ANSA 4BBEA 1PJKA 4DGOA 1QMZA 5J1VA 2OI4X 1QCFA 5JRSA 2W1FA 3TV6A 4ZS0A 3ZSIA 3E8EA 4PDYA 4MTAA 3KXNA 4HNIA 3ZLSA 4A9YA 1JSVA 3R63A 4QP6A 4C62A 1IA8A 1UNHA 4QMPA 3L8XA 4QQTA 3KMWA 2JEDA 4F7LA 4DFUA 2J7TA 2WQEA 2EXEA 4QMQA 1XH5A 3DKCA 5AP5A 4ASDA 4UZDA 4EH5A 5BNJA 3UIXA 4Y46A 3VVHA 4ANOA 4FTLA 4C4IA 3HUCA 3LFEA 3UDTA 4TXCA 4MNFA 2KTYA 3FBVA 2BDJA 3NS9A 3LAUA 4X3JA 1GIIA 3EYHA 5LOHA 1O9UA 4E7WA 3ET7A 4NM5A 2W05A 2EUFB 2UW6A 3FMHA 3C4WA 1GZKA 2OH0E 4F0GA 3UIBA 4DH7A 3GU8A 4I41A 4I6FA 3FLNC 4UY9A 1H0WA 3VONA 1GAGA 4ASZA 5IF1A 2VWWA 4LDTA 4IFCA 1Q24A 3H10A 3M1SA 3QQFA 4M0YA 3BL7A 3C50A 3PPZA 3EHAA 4DTBA 4MKCA 3MWUA 2R0UA 2IJMA 3QQUA 2W4JA 2Q83A 3Q4CA 2DQ7X 2VTNA 4O2PA 4W8DA 4PMPA 2X0GA 5DH3A 3G6GA 1Q8TA 1YQJA 3FY0A 2B9FA 2JITA 2VTLA 3MY1A 4XP2A 5ANOA 3EN7A 3BI6A 5KMOA 4HGLA 3EN5A 3HV5A 3F69A 4GU6A 3C5UA 3U51A 3W2CA 5A6NA 4ALWA 4BCMA 4FKOA 4CVAA 3TV4A 4QPMA 3TJDA 3V6RA 3LQ8A 2W5BA 1FMKA 2UW9A 1OL5A 3T3VA 3BE2A 3C4XA 3KQ7A 3NNWA 4QOXA 5AA8A 5CQWA 1GZOA 2WTDA 3UP7A 4WBOA 3KU2A 4U9AA 5HG7A 2OIDA 2WQBA 3GFWA 2ERZE 2F49A 2Y4IC 1G8SA 1XH8A 5FXRA 4RX9A 3RMFA 4DH8A 2I0HA 2Z2WA 2IZSA 3F3ZA 4DGNA 4FUYA 3Q4UA 4IXPA 1OIYA 4X2GA 3K3IA 3BHUA 3OXIA 5JFXA 4FYOA 3W2SA 4JAIA 3GQLA 4KIPA 2ESMA 3QRUA 4J1RA 4BCOA 4BTJA 2HZ4A 1SVHA 2C30A 3DAJA 3DZQA 4MHAA 2CLXA 2X4ZA 3HRCA 1KV2A 4N0SA 3HDNA 3QKMA 5HOAA 4ZJVA 2JIUA 2RFDA 2W1CA 2W9ZB 1VYZA 4Y72A 2AC5A 4W9WA 3AOXA 3RPRA 5J9ZA 1OI9A 2H8HA 4L68A 3FJQE 3R2YA 3R6XA 5DT3A 5HLNA 3PFYA 3E93A 4D9UA 3DY7A 4TT7A 1YXSA 3HEGA 2QI8A 4IWDA 4RLLA 3ANRA 3PRIA 4AT3A 3LXNA 4EH4A 4FJVA 3F82A 4QYGA 3EKKA 4FTIA 4MF0A 4FSYA 4D2WA 3QTZA 1W2FA 2R9SA 1XBBA 3UPZA 1H24A 3EKNA 4AP7A 3WF7A 5IUHA 4L44A 4O82A 4YZCA 2R3NA 3N4UA 2G15A 3OF0A 3W10A 2A19B 3E3PA 3VS7A 5CU4A 2WIPA 1V0PA 1GIJA 5I0BA 4FI1A 4YLKA 2CN5A 2KULA 2JDTA 2YIWA 3HP5A 2Y4IB 4DF3A 4H1MA 3ORMA 2YZLA 4N57A 4DBXA 4F0IA 4JDJA 3CR0A 2PZRA 4RA4A 4OBPA 2AEGA 5GINE 5H3QA 2QHNA 4JI9A 3FEGA 3PDTA 5DR9A 1XBCA 4XG9A 4DGMA 3G90X 1E9HA 4HYHA 3NYNA 2JKKA 5CENA 2ITVA 2QLUA 4RIXB 4ZY6A 5KZ0A 4AZVA 1J91A 3ATTA 4NW6A 4KS7A 4NJDA 3IGGA 5ANJA 4ACDA 3LMGA 5K4JA 2R3JA 2XAMA 3LM0A 1PMUA 2V5QA 1R3CA 3FXXA 4TNBA 3ORXA 3ORNA 3AKLA 2W1GA 5JSMA 4KNBA 5HGIA 4Z55A 4EOSA 1KOAA 4PRJA 4J99A 1W83A 3I0OA 2GHGA 3AG9A 3GQIA 4S32A 5J5SA 4I23A 2ZV7A 3C4FA 5AV2A 4L00A 5BX0A 3PXFA 2IVVA 3EN6A 2YDKA 5HG5A 5I9WA 4YTFA 3EZRA 4ORKA 4QP1A 3AC8A 2X0OA 3FI4A 3MY5A 4EUTA 1R78A 1IA9A 2B54A 3LLAA 3QD0A 3OCTA 4M97A 4II5A 3LXKA 5IH4A 3NSZA 1Q99A 5D1JA 3H0YA 4XG2A 3F5GA 4O0XA 5CSPA 3UO6A 1SZMA 4S34A 1M7QA 5HBHA 3RM6A 4BGHA 3GVUA 1K3AA 4DLIA 3QTWA 4ENXA 3ZDUA 1O6LA 2QKWB 3ZLYA 1V0BA 4FIJA 4HVHA 3W0OA 2CDZA 2FSMX 4M13A 3U9CA 3ZONA 3BLAA 1YXUA 4CTBA 5L4QA 3W0RA 5CEQA 1MP8A 2XM8A 3E8CA 5C26A 3O17A 1ST0A 1H1QA 4EH9A 2PMIA 2W17A 4I4FA 2IN6A 4OTPA 4P5QA 4C57A 5CTPA 4R1VA 1W0XC 4O7LA 2VTRA 4IZYA 1OL1A 3AD4A 4NCTA 3FYJX 3VW8A 5CALA 2PUPA 5EW9A 3RINA 5ICPA 3F9NA 4LUEA 4NU1A 4OBQA 4QTBA 1LEZA 3NMUF 3PG3A 3VS3A 4BDJA 5EHOA 1J7IA 2E9NA 4F6WA 2BDFA 3AT2A 4FTAA 2HELA 4LL5A 4ZTRA 4PQNA 4FNYA 3D14A 4C8BA 3JY0A 1MRYA