2I0YA

Cfms tyrosine kinase (fgf kid) in complex with an arylamide inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
316
structure length
289
Chain Sequence
VRWKIIESYESYTFIEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKRQLSSRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cFMS Tyrosine Kinase
publication title Crystal structure of the tyrosine kinase domain of colony-stimulating factor-1 receptor (cFMS) in complex with two inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 289
sequence length 316
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2i0yA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2i0yA01
3FZSA 4ARKA 4X21A 4U80A 4G31A 4RFYA 4CKJA 5H8GA 5J7HA 1W8CA 2QOBA 4HVHA 5LMKA 4RLKA 4CMOA 1Q8WA 4CFXA 2VO6A 4QTEA 4FGBA 1YHVA 3BI6A 3ACKA 3E8DA 3P23A 4G17A 5FTQA 2OH0E 3TEIA 3VJNA 2GQRA 4ZK5A 3EMGA 3RM6A 3ATSA 2QI8A 3EFLA 2CKQA 3N4TA 3Q3BA 3CKWA 3A7FA 3NVKI 4H36A 3RAKA 3TDVA 2J2IB 4DLJA 3QUPA 5IMEA 4IZ7A 4U9AA 3V8TA 5CAVA 4DFUA 3VJOA 4JBOA 3CPCA 4I6QA 4IE9A 4XG2A 4CEGA 3KB7A 4YJVA 1WVXA 1W7HA 2CGXA 3NSZA 5CT7A 2VU3A 2QO9A 2HWOA 3AXWA 3G6GA 4XV2A 5JQ8A 1JKSA 2C5NA 4P7EA 5KKRC 4ITJA 2Y6OA 3K2LA 4FG8A 3UIMA 4EBVA 4UN0C 5CEPA 4NFMA 4K9YA 4ZSAA 3P78A 4IM2A 4GW8A 5CXHA 4UV0A 4QYEA 3BWJA 5KO1A 4JX7A 4L7FA 3HGKA 2OZOA 3DAJA 5A6OA 3QRKA 1M2QA 5CY3A 5CYIA 3TTIA 5EYKA 3ZZEA 3I6WA 1O6YA 3AD4A 2CGVA 3R30A 3VRYA 3NDMA 3PXYA 4N6YA 4PF4A 4U8ZA 3U4WA 3FI2A 3C1XA 3MVMA 3DY7A 5BUEA 5ANOA 3S2PA 5AUVA 4RT7A 4L52A 4AW1A 5B7VA 2XK9A 3SLSA 2HCKA 1LEWA 3KRJA 5LVOA 3T3UA 2F4JA 4FVPA 3C7QA 5JGAA 2VWXA 2C1AA 2YDKA 4JDHA 4QYFA 4W4WA 1TQPA 5T68A 4AN9A 5C01A 3G51A 3MIYA 2Q83A 3R9RA 2B52A 4FMQA 5JN2A 5L2QA 3LW0A 3LHJA 4YO4A 4ZSLA 1OL7A 2RFEA 3DBDA 5ANKA 2HELA 3HDNA 3NNVA 5JEBA 4FT9A 3ANQA 2CKPA 4GKIA 2OIQA 4JG8A 4YZBA 4AZTA 2ZDUA 3Q6WA 4CTCA 1U59A 3UYSA 2WTIA 4A4XA 3ETAA 5AV0A 1M14A 1H01A 2NPQA 3UIXA 3QQFA 4QP8A 4ASXA 3GCPA 4XMOA 4FKUA 4KA3A 4YTFA 4B99A 4Q2AA 3RHXA 2XYNA 3R7IA 4FYOA 3VBXA 3AMYA 4X6QC 5D12A 4U43A 4YU2A 2IN6A 3R00A 3R1NA 5IA3A 2CHLA 4GK3A 2CGUA 3BQRA 4LQMA 2BALA 4MNEA 5DEYA 3UNZA 3UZTA 5GIPE 3QTZA 4U5JA 5L6WL 4ZJJA 4YNOA 2BILB 2B4SB 3PG3A 4OW8A 3CQWA 5CZIA 4ZSGA 3JY0A 5E1EA 3GU5A 4BCFA 3CLYA 3FPMA 4F9BA 4O0VA 3SV0A 2WU7A 1JNKA 3NYOA 5IKWA 2IJMA 2VX1A 4EOQA 3ATTA 1XH6A 3ZXZA 1SNUA 3BEAA 2WMUA 3VUTA 5IQAA 4RQVA 4E5AX 4E8AA 3OCSA 3LJ2A 4BDIA 2XNOA 4D4VA 4ACGA 3V5WA 4AW5A 4RX9A 2WMSA 2Z8CA 1U4DA 3BE2A 3PPKA 5I3OA 4CLIA 4RJ7A 3Q9ZA 4G5PA 4CT1A 3HAMA 4FEUA 4Q5EA 4YJNA 5A4LA 3BV3A 4OR5A 2W1CA 3DBFA 2VTHA 1OMWA 2JKQA 4MXOA 4EOJA 3O23A 4EH9A 4GYGA 3FZRA 4IANA 3DXPA 3TNWA 4BDBA 5LVMA 2OXDA 3ZLYA 3W2SA 3TUDA 3NVMB 3U6JA 3KQ7A 4FSUA 3ZONA 4M8TA 1XHAA 2A2AA 2JGZA 5CSVA 4QMLA 4RWLA 5DR9A 3DT1A 4NM7A 2ITUA 4XRJA 1H27A 3MB6A 5IA0A 2XRUA 4MD9E 2B9FA 1WBTA 2V5QA 4ENYA 5ETCA 3C0HA 4C57A 1MRYA 3D0EA 4NT4A 4EUUA 1H24A 4MKCA 4U3ZA 5CS6A 3ZO1A 2W17A 5F9EA 4OTPA 3LFNA 2YN8A 3PA4A 3F3VA 3ZOSA 5IDPA 5JFSA 2OJIA 2CLQA 2RIOA 1PXKA 5CSWA 2PY3A 3OWJA 4HGLA 4FTJA 5EDRA 4PMMA 2ETMA 1T45A 2P33A 4M68A 3L8SA 3WOWA 2X39A 5HICA 1PXPA 2AC5A 3KVWA 3TWJA 4J7BA 2RF9A 3R1YA 4FKRA 1XBCA 5E1SA 2WEIA 3FQSA 5FWKK 4QT1A 1Z57A 3F7WA 1UU3A 5KMLA 3FUPA 4Z55A 4EK5A 1K2PA 5JZJA 2O64A 4LV5A 1M17A 5BYZA 5HLNA 2NRUA 3PA3A 2O5KA 4CMTA 3CCNA 4IZ5A 4F1MA 5IUHA 2WO6A 5KBRA 1IAHA 5FDPA 3UOLA 3ZH8A 5I9YA 1MRVA 3MY5A 5ITAA 2NO3A 4MBLA 3GC0A 3ZCLA 3MSSA 4PNKA 1MP8A 4AFJA 3CKXA 3ODYX 4ENXA 5K3YA 2WTKB 2RFDA 3EN7A 5E8YA 2PTKA 1SMHA 4J8MA 4YJPA 2PUNA 5JGDA 2PHKA 5HCYA 4AT3A 1JPAA 2BIYA 4RRVA 5CU3A 5CF6A 1SVEA 2W99B 4FUXA 2B53A 4K77A 3U54A 3FXWA 1IAJA 2CN5A 2X6EA 4KIKB 3NW7A 3TIYA 3QD3A 4P5ZA 3GC7A 5AAFA 4BL1A 3MBLA 4QMYA 2E9NA 4BCNA 2VTIA 3EB0A 4L67A 3LLAA 4ORKA 2XRWA 1NVQA 3L8VA 4K33A 2XIRA 3GC9A 5C27A 1B38A 3MJ2A 5HHWA 3KULA 3MI9A 4KBCA 4M67A 2GHMA 3CQEA 3Q9WA 2VTPA 2Y6MA 4YSMA 4FKQA 4IEBA 5DR6A 2Y9QA 4U40A 3IS5A 1FMKA 1OIUA 4IACA 4ALUA 5AR3A 2X2LA 4PUZA 4WG5A 4DHFA 4F7JA 4AE6A 4XP0A 2QOIA 2WQBA 3D5XA 3PVWA 4RWKA 1F5QA 2IZRA 3V5JA 3W8LA 4QQJA 2HZIA 3G5DA 4NW5A 5L6PA 4QYGA 4ZLOA 4YHTA 4DH8A 4ZY5A 4APPA 2ZV9A 2VWWA 2XNGA 2UVYA 4ZLZA 3EQRA 5TR6A 4RC3A 4RIWB 2OF4A 4MTAA 5HG9A 1MUOA 3UOKA 2XZSA 3OCTA 5HIEA 3QKLA 3H9OA 4GU9A 1OL1A 5DT3A 3AC4A 3MW1A 4I5MA 4O7YA 4MH7A 3F9NA 5JMSA 3BHTA 5LWNA 1P4FA 2Z7SA 4AGWA 5KMMA 2YABA 4C2VA 4JDIA 2XJ0A 2HXQA 3OT8A 2QU5A 4XS2A 4Z7GA 2XA4A 5FXRA 4YZMA 4EOKA 3CGOA 4L45A 3QCXA 4USDA 3U6IA 4JVGA 5HD7A 4O7ZA 2GQSA 2W1FA 2PVNA 2UW4A 1SNXA 4Y8DA 3TIZA 2G2FA 1XH9A 4KIQA 1YWVA 1SYKA 4O7VA 3F3ZA 1W0XC 3LIJA 3VW8A 2C6IA 2QD9A 5EYMA 4ALVA 3OBGA 3LM0A 2C68A 5FM2A 2OSCA 5FXSA 5F1ZA 1BL7A 2B9HA 4C58A 4CSVA 3MFRA 3SRVB 3QRTA 3DBCA 4YLLA 2W5HA 3W8QA 5M4IA 3PP1A 3W2PA 3MPAA 5AADA 1NW1A 3FXXA 2JLDA 4IWDA 2DUVA 5AUWA 4R5YA 4LOQA 2DYLA 4ZXTA 5BUJA 3FXZA 4W4VA 1OBDA 3AT2A 3QWJA 3FSFA 3QHRA 4D2VA 2WTJA 4MXAA 2X1NA 3FI4A 3BBWA 4FE2A 5LJJA 3VQUA 4BC6A 5IPJA 4M84A 4ZTQA 4TPTA 4BKJA 1UV5A 3HMMA 4GCJA 3R9OA 5C8KA 2QG7A 1UU9A 3EQFA 3OFMA 3E7OA 3A2CA 2PMIA 4G9CA 3U8WA 5CAOA 3HRBA 5JK3A 1PMVA 2EUFB 4JI9A 4DFNA 2VO3A 2BIKB 2HIWA 4F7SA 4EH3A 4R7IA 3GU8A 4CFFA 3MFUA 3HRFA 4FVRA 4E1ZA 3K54A 1VYZA 3I81A 1YVJA 4JDKA 5E7RA 2XM9A 3RHKA 3ODZX 1H1QA 1OPLA 4M97A 2C30A 2H9VA 4C4GA 5A14A 1WBVA 4EOLA 3V8SA 4TXCA 4XG7A 5DN3A 5IF1A 3O8PA 4IZAA 1XQZA 3OF0A 3H9FA 1ZOHA 2OJJA 3PZEA 4IB0A 3S3IA 3AGMA 5AP7A 3LXLA 1H1PA 4NZWB 1BUHA 4OTWA 2OFUA 1OIRA 4I3ZA 1RE8A 4DEHA 3EOCA 3IGGA 3LFCA 5FGKA 4D4YA 2GNLA 4MNFA 3FWQA 2BTRA 3RGFA 3QLFA 3JUHA 4DC2A 4UXQA 1DI8A 2RKUA 4RVLA 3V6SA 1OL2A 3G2FA 4BBEA 1OKWA 3RTPA 3ZLWA 4DTKA 2SRCA 3EL7A 4QMPA 2JAMA 3MYGA 1H00A 4F0IA 3RPVA 1APME 2QURA 4U97A 4W8DA 5EH0A 3BLHA 3BV2A 4C4JA 2PE1A 1OPKA 5EQEA 2H96A 4GVJA 4MWIA 3V51A 2A19B 3PVBA 1ERKA 3R0TA 5FQDC 4EOOA 2BRMA 3ZYAA 5HIDA 2ZDTA 1VYWA 2X9FA 5AUZA 5HIBA 5E90A 5G6VA 4CFVA 3D83A 3GOKA 3R63A 3OTUA 5EOLA 3TZ8A 3PLAE 4GJ3A 1H07A 3NRMA 4AZWA 5I9VA 1PHKA 1DM2A 3QHWA 1VJYA 3Q5ZA 4YHFA 2FA2A 3IW7A 2I1MA 2I0EA 3P7BA 3MTFA 5FXQA 4OTQA 2XH5A 4RSSA 4BBMA 1RJBA 3KXHA 4EZ5A 4FKTA 3ZO3A 2JKMA 4ERWA 2JITA 3UOHA 2ETRA 1J1BA 4MF0A 2UZNA 3NLBA 4GEOA 5IH4A 3TKIA 1ZRZA 3AMBA 1ZOEA 3QRUA 4WNKA 4L3JA 1L8TA 3TL8A 3CJGA 4EONA 5HE1A 4F65A 4G6OA 4D58A 4A9SA 4W8EA 3KREA 3S1HA 3RBWA 2FSOX 3E63A 1W83A 5JT2A 3E88A 4EOMA 4BTKA 3B8QA 4FKVA 4BB4A 2YZLA 4L43A 3AGLA 4PRJA 3BGPA 1PXLA 4R1VA 5DIAA 3LQ3A 4ACDA 5KMNA 3EZRA 5ANGA 1OKVA 5TT7A 3ZU7A 5AP4A 3SC1A 5J87A 4GH2A 5GZ8A 3FL5A 3GI3A 3OTVA 3WYXA 4DLIA 3M2WA 4L01A 4EKLA 3D5UA 1H28A 3DBQA 1YXXA 1Z5MA 4RJ4A 5DPVA 5J1WA 3DCVA 3GU7A 4TNDA 2ITTA 2W96B 4MXXA 5JGBA 3PIXA 2F7XE 3VUKA 4M69A 3EFKA 4YC3A 2W1ZA 2JDTA 4OAVB 1T46A 1URWA 1YHWA 4N4SA 5KX8A 2HAKA 5C26A 3COKA 1KE5A 4WSQA 5K5NA 4IAIA 2QCSA 1H26A 4I5HA 3ZFYA 4Z16A 4FC0A 4R7HA 4AT4A 5CANA 3W2CA 3TUBA 4GUBA 4JBPA 4PDOA 2H6DA 3E5AA 2VTSA 4NCTC 4FVQA 5CTPA 4CKIA 5AV4A 3V01A 4DG2E 3DKOA 3KXGA 1R78A 2A4LA 5DYJA 1KV2A 4JG7A 4EJNA 3BYSA 1GY3A 4FIFA 4FL1A 2WIHA 2FVDA 2WB8A 3FLNC 4OLIA 4X2GA 3FI3A 2YZAA 3I60A 4RVKA 3N9XA 3HMNA 5K9IA 3F82A 3CIKA 3ZRLA 3QX2A 4GFGA 4I6HA 2I6LA 3SW4A 3U9CA 3ZBFA 4F64A 4BDGA 3LXNA 2BKZA 3FMLA 3S95A 1NT2A 4YZ9A 4R3CA 4V0GB 5F4NA 3VBVA 4C38A 3SOCA 4QO9A 2VZ6A 1Y6BA 3HYHA 4FIGA 5HBHA 4GMYA 3FQEA 1OPJA 4CFWA 4DGNA 3C9WA 3N4UA 3QRIA 5FUTA 4JNWA 2XK6A 4KD1A 3F2RA 4AQCA 3DPKA 2XNPA 5IUIA 4PPAA 4WIHA 2V7OA 1KV1A 1U46A 2BR1A 4AOIA 4MX9A 4CKRA 4O38A 4A4OA 5JRSA 4QPMA 3ZO4A 4Y83A 3CXWA 4HOKA 2J7TA 2PE0A 2WOTA 2WMTA 3HNGA 5J7BA 1TKIA 2OU7A 4A7CA 3ZO2A 5EQYA 5I9UA 5M07A 1Q8TA 3D5WA 4FICA 5B2KA 4F70A 4J1RA 5L6OA 3FY0A 1I09A 4LM5A 3IK3A 4YZDA 3HAVA 4OTFA 5D11A 4RWJA 5KE0A 1KE6A 4FSYA 4QYHA 3TZ7A 4IFGA 3HA6A 3R04A 4Q5HA 4B8LA 3ZM9A 3RNYA 4DGGA 1XBBA 5BUIA 1JOWB 4E20A 2Z60A 3TG1A 2V62A 4O0XA 1QPEA 3C51A 1Q8YA 1UNLA 2WQNA 4O27B 1OM1A 4CXAA 4AW2A 2UW9A 3QTXA 5L8KA 4DH3A 3OOGA 4E73A 1PXMA 3DKGA 3P08A 5BVEA 4BDCA 1AQ1A 3P86A 2BZIB 2W9ZB 4IVAA 3FHIA 4RIYA 4C62A 4RIXA 1G3NA 1PXJA 4HVSA 2ZB0A 2ITPA 5IQCA 4OUCA 4ZAUA 5DA3A 5CNNA 2PVJA 2P3GX 4LI5A 4PP9A 3AG9A 3DBEA 3OXTA 1R0EA 3L9NA 4BCIA 4NM0A 5DHJA 3BLRA 3DAEA 4UEUA 3R22A 3R9NA 4UMRA 5A4EA 2DWBA 3MB7A 4G3CA 2HXLA 3PFQA 4NU1A 3Q53A 4FSRA 3QQJA 4ZS4A 1PYEA 4ZS0A 3R8VA 1ZYLA 4D5HA 4BZNA 2YERA 3DZQA 4D0WA 3G9NA 2JBPA 5KZ0A 5CVHA 3NWWA 4L8MA 3KMMA 5AR4A 4A06A 3ZRMA 3NEWA 5LOHA 1YI6A 5B2MA 2HY81 3VQHA 3KK9A 4DFXE 5CU4A 4WBBB 4ITIA 2VV9A 3LOKA 4CZTA 5IU2A 1ZYSA 3OBJA 3Q60A 2UZUE 4CRLA 1CKIA 2R3LA 4FG9A 2OWBA 3GCQA 3VBQA 3UZPA 4K18A 4KS7A 3EN4A 2Y4PA 3IDPA 2WHBA 4NFNA 3FV8A 5J8IA 1SZMA 2PSQA 5GJGA 3WI6A 3WZEA 2C4GA 2VNYA 4XG6A 2XK8A 5I9XA 1WBOA 2OIDA 4BHZA 2YIYA 4CTBA 2VTOA 2YIXA 5M55A 4JAJA 2Y4IB 2VX3A 2X4ZA 3VUGA 3RCDA 4QYYA 2HWPA 2XP2A 1XWSA 4O0SA 4M15A 1GOLA 4BZOA 3E64A 3G33A 4RG0A 3A4PA 4R3PA 3LPBA 3S0OA 2FH9A 4WBOA 4O83A 3L9PA 3H3CA 5CSHA 5AJQA 4H3BA 1GIHA 1GZNA 4LGHA 4NUSA 3A99A 3QC4A 4G5JA 4BWXA 2Q0NA 3RWQA 4D28A 3DNDA 2J0IA 2YEXA 5HVYA 4IC8A 4M0ZA 3SXSA 5IA1A 2E2BA 2R3OA 4EKKA 2BAJA 4HVDA 3P7CA 1STCE 3FMNA 2W1GA 5HG7A 5HGIA 4ACHA 2WQMA 1F0QA 2R3GA 3LCOA 5CASA 3Q2JA 5M08A 2XIYA 1J91A 5D1JA 4BYJA 3PPJA 1ZMWA 2C3JA 5ETAA 4E3CA 3HECA 1LR4A 3KN5A 4LGGA 4Y5QA 4E6DA 5KUPA 2E9PA 2C6OA 3UC3A 1BMKA 2VWBA 4EOPA 5M56A 2G01A 5CLPA 4X2NA 2G15A 4LOOA 4U41A 5HOAA 4D2WA 4E4MA 4WHZA 5BVKA 4AN2A 4XUFA 1FGKA 3UPXA 3ENHA 4RZWA 1OECA 2XEYA 2ZOQA 3EKNA 4JLCA 3ROYA 3ZRKA 4DGLC 3NUXA 3VC4A 5M4CA 2CJMA 3KXXA 4YTHA 3GCSA 1FVTA 3IW5A 4BDJA 3RK5A 3HA8A 2IW6A 3EZVA 5DNRA 3NPCA 4K2RA 4BDHA 5AUYA 5ANJA 3SAYA 3FLSA 3ID6C 4FV2A 4F99A 4E93A 1NVRA 4FIIA 2BUJA 5IEYA 3LJ1A 4AX8A 4IB5A 4UYNA 3ORKA 1O6LA 4I5CA 2WTVA 2GPHA 3HKOA 3B8RA 4NIFA 2PVYA 3SQQA 4GT4A 3BQCA 3BGZA 2WNTA 3KXNA 4HJOA 3A61A 4IX5A 4S31A 2P0CA 4U3YA 4XEYA 4BF2A 4D55A 3DJ5A 4L68A 3FC2A 4MYGA 4OTGA 2YJSA 3CJFA 4WUNA 5AV1A 1WVYA 4JOAA 5AWMA 3EQGA 3Q2MA 4FV8A 4HNFA 2BCJA 5HU9A 1Y6AA 2XKEA 4Y95A 5JRQA 1AD5A 1U5QA 3JPVA 5TOZA 3PDTA 2PVMA 4FTRA 2YIQA 4LOPA 5TF9A 4DITA 4D0XA 3UE4A 3QD0A 2WMQA 2C5XA 4Y72A 1PXNA 3UBDA 1U54A 3DGKA 5H3QA 3DKFA 3MH0A 5AEPA 4EYMA 4FEVA 3KRWA 3TNHA 1ZY4A 1OUYA 1YHSA 2C69A 3D2IA 2OXXA 3JY9A 4X3FB 3R2YA 3RWPA 1PXIA 4DFLA 4FKOA 3FKLA 3I6UA 2ETKA 2W4KA 3CC6A 1KOBA 3FKNA 5CT0A 4YTIA 4KKHA 3WZJA 3ZBXA 1M2RA 4M69B 3ZEPA 2XBJA 4Z7HA 4D4SA 4FEQA 3EL8A 4YURA 4FV4A 4QP4A 4IVCA 2O2UA 2XJ1A 4S30A 3F6XA 3QL8A 4X0MA 4IIRA 4CQGA 3I1AA 3LZBA 3PLSA 5KMJA 1PW2A 1PRYA 3HV4A 4QD6A 3JVRA 3FLZA 3QD2B 4KKEA 1LEZA 3F88A 3I0OA 4PMTA 4WNPA 2EXEA 3TN8A 4EH6A 2UZOA 3A7JA 3IW8A 3R9DA 3A62A 3CD3A 4JBVA 3GEQA 3QUDA 5D9HA 3R1QA 1UWHA 2UW5A 4D2TA 3OS3A 1XR1A 2HOGA 3CGFA 4E4LA 1H1WA 4I93A 4NTSA 4QMQA 4M0YA 1ZWSA 4HZRA 4UYAA 2YDIA 3QLGA 3QQKA 4G6NA 1LP4A 5DOSA 1NVSA 2QHMA 4Y5HA 3U4UA 2PMNX 3RP9A 4O1OA 3NUAA 4TYEA 1XKKA 5EW9A 3P7AA 4QMVA 1JKKA 4H3QA 3HRCA 2EXMA 2QOLA 3TNQB 1YXTA 2FO0A 2OJ9A 3KMUA 1IA9A 5M44A 2HYYA 4FT5A 3EHAA 4FK6A 4FX3A 2JBOA 1IG1A 3VAPA 4WD5A 3C4FA 4FZ6A 3VUDA 3TV6A 1XH4A 3LCSA 5C4LA 5GJDA 2ITZA 3NGAA 2VWIA 3FDNA 2ITXA 2GMXA 4YNEA 3TZMA 3VF8A 3K3JA 3LKMA 2BRGA 3OVVA 4FKSA 1PJKA 3ULIA 2IVTA 3UG2A 4J95A 4FTCA 4ANBA 2FUMA 5CAUA 5FTOA 1FPUA 3QWKA 3HV5A 2WTKC 4PQNA 4XG9A 5KHWA 3RINA 3Q9YA 4AGDA 2UZTA 2XK3A 2RL5A 3G0FA 4DEAA 5LCJA 3CR0A 4FKJA 5BNJA 5J1VA 3JVSA 3T9IA 4DBXA 2X2KA 2WOUA 3MH1A 4IM3A 1PXOA 5AR5A 4WRSA 1DAYA 2ZV8A 3OWKA 4O22A 5A4QA 1YXSA 4RX8A 2E9UA 1A9UA 3HEGA 3DQWA 5EM8A 4O0YA 4PMSA 4FSZA 4M7IA 3U6HA 3AD6A 3A7GA 3I79A 4OTHA 2EB2A 5J9LA 2G2IA 3NUUA 3COIA 2J0LA 4D2RA 3RAWA 2OI4X 4PWNA 5GIOE 3GC8A 4O7TA 5CEMA 3BE9A 2PWLA 4G3GA 2OZAB 4QMOA 4CCUA 3BPRA 1DAWA 2PPQA 3RPYA 2PVHA 2XVDA 3GGFA 3LVPA 5D7VA 4DE4A 4BVUA 5KMKA 1ZY5A 4CCBA 2ERKA 2R3HA 3GFEA 4H3PA 2JFMA 4E4XA 2GNGA 3OHTA 4NKAA 3GCVA 3BIZA 3FY2A 3U51A 1KUTA 1H0VA 4F4PA 5LMKC 3RKBA 4TYGA 2R3NA 3I0QA 2XEZA 3PXKA 2W7XA 3KF4A 4J99A 4YBJA 3BHYA 3E7VA 2ZVAA 3FLYA 4JR7A 5DT0A 2B7AA 4OGRA 3TXOA 3NX8A 1IA8A 5AA8A 5BYYA 1Q61A 3OWLA 5BPYA 3ZEWA 5LWMA 4FZ7A 4M3QA 3QGWA 5JFVA 3SOAA 2PMOX 3W16A 2I0YA 4IHPA 3KK8A 1UKHA 5CZHA 4AP7A 3JXWA 5BMSA 4RC2A 3KVXA 5IG1A 2UV2A 4IJ9A 2OG8A 5CSXA 1YDTE 1OI9A 4C4HA 3C0IA 1JVPP 5TO8A 2UZVA 4BDEA 4FTOA 5FEQA 4AZFA 2XUUA 3W2OA 3QFVA 3COHA 3FQHA 2CDZA 1ZMVA 2QR8A 3O50A 5HO7A 4LL0A 4C4EA 4KIOA 1ZZLA 4HCUA 2Z7RA 3WIKA 2BAKA 3D7TB 3OT3A 1J7IA 4G2FA 3K5UA 4JG6A 5EI6A 3RAIA 4XCUA 4CLJA 2QNJA 3DB8A 3ZMMA 3ZC6A 3FZ1A 4BZDA 5AFVA 3OMVA 3JR1A 2G9XA 5AP6A 4O21A 4MEDA 4GSBA 1QPCA 3QX4A 2YM4A 5AR8A 1Y8GA 3FMMA 1IR3A 3LJ0A 1NY3A 2PZYA 4ASEA 3Q04A 4R8QA 3AC8A 5CQWA 4UZHA 5CEQA 5AP2A 4BGGA 4BIDA 2W4OA 2XF0A 3CY3A 3E62A 3PY1A 3R2BA 1YRPA 3DDPA 3NUSA 1I44A 5E8WA 2W9FB 3CQUA 2O3PA 5ETIA 3BWFA 3EQIA 2YWVA 4ZIMA 1ZYDA 2R7IA 3ZZWA 4DTBA 2JD5A 3WF9A 3MA3A 1FMOE 1OZ1A 1XJDA 3EFWA 3UQFA 3QTIA 5E4HA 3I7CA 4FSNA 4QP2A 4TWCA 4E26A 4LMNA 2CKOA 4HVIA 3KRRA 4ZTHA 4JRVA 2WGJA 3BHHA 3ORIA 4YO6A 4WSYA 4GFOA 3PIYA 4HYHA 3NAXA 4TWNA 2OIBA 1H1RA 2VGOA 4E6AA 4O7SA 4FKGA 4A9YA 3Q6UA 3ZC5A 3GQLA 3ORLA 1BX6A 3GU4A 4TYHA 4W4YA 3H0YA 5ACKA 4RJ3A 4AXAA 3VS5A 2PZPA 3QUEA 5FP5A 5M09A 4ZTMA 3KFAA 4FT7A 5AP3A 2V55A 4UMTA 2QOOA 3DTCA 3LAUA 3PP0A 1ZOGA 1UU7A 3LFQA 4O82A 4GUEA 4I22A 4RBLA 2XKDA 4I5PA 4EYJA 1GIIA 3R71A 2ZYBA 3LFAA 2YAKA 3V8WA 4D4RA 4YBKA 2I40A 2RFSA 2JDSA 1W84A 4JT3A 2WELA 2WTWA 2XM8A 3EH9A 4APCA 3ORMA 3FZOA 1OBGA 4XP2A 4YZCA 3VHKA 3SG8A 3ZHPC 1AGWA 2FSTX 2XB7A 3MVHA 3PE2A 4I0TA 4I6FA 4II5A 5AUXA 4QPAA 2IVSA 3PRFA 3EQDA 4PNIA 1P4OA 3M1SA 4P90A 4RPVA 3UPZA 3GFWA 3MPMA 3L8PA 4NCTA 3F7ZA 5LMAA 4IAKA 4USEA 1JSUA 4RJ6A 3L9LA 4MF1A 3S00A 3PVUA 2G2HA 5EG3A 5BVWA 5AP0A 2XCHA 4ZP5A 4XP3A 1FGIA 2UVXA 3FZPA 4EUTA 4PDYA 4QTCA 3V5PA 2HK5A 5A4TA 3MA6A 3WE4A 2ITWA 5IA4A 1XBAA 4EHVA 3R7GA 3DTWA 5IEVA 2EWAA 3OROA 2FGIA 3FL4A 3WZDA 4C8BA 4UMPA 3BYMA 3P9JA 5HTCA 4EL9A 3UIBA 3WILA 3UODA 5HBEA 4JR3A 3KRLA 2XCKA 5FLFA 1Q8UA 3RMFA 4EH5A 5K0XA 3VS2A 2W1HA 2WMWA 5ANDA 3DXQA 4TT7A 4OTDA 3PY3A 2BROA 4XNEA 5CF8A 3ROCA 3NZ0A 2WAJA 4I6BA 4YP8A 4O96A 4ZTRA 2W0JA 3BYVA 2OLCA 4I4FA 2PU8A 4FF8A 3GOPA 5C8NA 2P2HA 2BAQA 3H0ZA 4A07A 2GNJA 3OUNB 5IMXA 2X8IA 3OCBA 1HCLA 2C6TA 4WNOA 2QLQA 4IB1A 2QOQA 4MNEB 4EH8A 4BBFA 3BX5A 4AW0A 3FHRA 4BCJA 3E3BX 4IMYA 2IPXA 4PL3A 3KN6A 4FK3A 4FOBA 4KRCA 3HMOA 4X2JA 3WIGA 5EI2A 2VRXA 2X81A 4BCGA 2H34A 3AOXA 2B54A 3F3TA 4L3PA 4XOZA 4IB3A 5ANEA 5HNBA 4O86A 2OBJA 4FODA 5BQ0A 2GHGA 3DAKA 4V04A 2WKMA 3CSVA 4O81A 3ORZA 4TKSA 2WTCA 4X3JA 2YM3A 4D2SA 3SG9A 2GS2A 2AYPA 4FTIA 3MFTA 4HPUE 2ZMCA 4J96A 3SD0A 2VTJA 3AT4A 3WF6A 1KE8A 2A27A 2XJ2A 4DA5A 2W4JA 3ZS5A 2NP8A 2R64A 4M14A 2WMAA 5L2SA 4IBMA 4JIAA 4FTQA 2GNIA 3PJ3A 3V5QA 2XNBA 3KMWA 3O71A 4C61A 4CZYB 4IX6A 4PTGA 3FI8A 4AF3A 2R3JA 3LQ8A 4L00A 4YJQA 4FYNA 4NW6A 4EHEA 2O65A 3I5NA 4EZ7A 3VBTA 3DNEA 2XIKA 5IQIA 3OG7A 4XG8A 3FBVA 2YHVA 1OB3A 4DG3E 2C6LA 2X4FA 4XRLA 5IDNA 4IAYA 1JWHA 1XH8A 2RSVA 4HCTA 5L3AA 5A4CA 2Z7QA 3KCFA 4QMUA 4I41A 4CRSA 4S34A 2XKFA 4A9RA 3RJCA 5CAQA 3GVUA 4HGTA 3SW7A 5JKGA 4C0TA 2DS1A 4RJ8A 2VD5A 3MV5A 4YHJA 2X9EA 3RAHA 4BIBA 5I5ZA 2XIXA 3SHEA 4DFZE 5A3XA 4I94A 4EQUA 3VUHA 4DFYA 4RZVA 5HTIA 3D7ZA 3EN6A 4CG8A 4BCQA 2IVVA 2QONA 3P5KA 5E8UA 4CQEA 3ZUVA 2OK1A 4YLKA 2BZKB 3ORPA 4D1XA 4P2KA 4IX3A 2C0TA 4IXPA 4CV9A 3LCTA 3ZDIA 5AUUA 4YC6A 4FL3A 3UDBA 1PMEA 4BCOA 1OKZA 3QQHA 4K0YA 1FBNA 2UW0A 3OY1A 3QKKA 3ORTA 5E8TA 1UVRA 3KXZA 1EH4A 4AN3A 3U87A 3NYVA 4C2WA 2YLFA 5F94A 5J95A 3RK7A 5GZ9A 1Q24A 3GBZA 3KEXA 2IZSA 4UZDA 3V5TA 3UOJA 4C37A 4J98A 4O1PA 2IW9A 2JDVA 2QLUA 3Q96A 4F08A 3UIUA 2X0GA 4W9XA 3W2RA 4DYMA 3PXQA 5FM3A 2PE2A 3O96A 3OC1A 1W82A 3QQGA 4BCHA 4KRDA 4QMMA 2PL0A 4IFCA 1R1WA 3TJDA 1NXKA 5J5TA 3MESA 2ZM1A 2BTSA 4FV7A 5FDXA 3C0GA 4BTJA 1H1SA 3F5UA 3SDJA 2V0DA 4BI0A 3NIEA 4L3LA 4QQCA 1GNGA 3P79A 3G9LX 5M4FA 4DCEA 4BKZA 2VWYA 3BCEA 3MTLA 3OZ6A 5DT4A 4DH5A 3KULB 4FBXA 4XLIA 4DCAA 2GFCA 4WG3A 4P4CA 2GNHA 3ZFXA 2IZUA 1SVHA 4KAOA 1PKDA 4AG8A 4IJPA 2WU6A 3RZBA 5AV2A 2CCHA 4LRMA 2IO6A 4PY1A 4V05A 5HBJA 2OW3A 4HGEA 3IONA 3MWUA 2XNEA 3DFAA 1P14A 3UNKA 5L8LA 1KOAA 4BDFA 2XKCA 3FMDA 1G8AA 3D14A 4RA5A 3GNIB 5CU6A 5JFXA 4F63A 4WOVA 5AP5A 2WD1A 1M2PA 2OJGA 3N51A 2PZIA 3L9MA 3TJCA 2WMBA 4EWHA 2X2MA 3W10A 3FE3A 4R77A 3REPA 3EJ1A 4BYIA 4L46A 4Y73A 4D9TA 4MWHA 3NR9A 1GJOA 4RVTA 4IH8A 3PXRA 5JFWA 2YITA 5DBXA 1CM8A 4FKIA 3DK3A 1A06A 2W5AA 5DH3A 5AM7A 3TTJA 4NM3A 2Y4IC 4KBAA 2PMLX 2I7QA 3WZKA 2OICA 1HOWA 1FQ1B 3IO7A 3GENA 2GS6A 3QTRA 3II5A 4X7QA 2W05A 5HTBA 1J7LA 4YLJA 2Q0BA 2QHNA 2J51A 3ANRA 4PTCA 1E9HA 3UTOA 4UMUA 3NYXA 5M53A 2VTAA 2F9GA 3BU6A 4EQCA 1PMUA 5DRBA 3PRIA 4TWPA 4PMPA 3TCPA 5AV3A 3Q4UA 5EW8A 3NAYA 3FKOA 2LGCA 1KWPA 2YA9A 4C3RA 3EN5A 2PVRA 4BIEA 2XBAA 4GT5A 4PDSA 2REIA 3UO5A 2VNWA 3H10A 1B6CB 3JYAA 2BDFA 3QTQA 4R1YA 4O7NA 3DDQA 2OF2A 4NJ3A 3RZFA 5I4NA 3KRXA 1GZKA 1S9IA 3DS6A 2BMCA 1ZZ2A 3CS9A 1P5EA 1FINA 2FYSA 2J5EA 3Q32A 2R5TA 4UX9A 3EQPA 3M11A 3QQUA 2ZB1A 4FNYA 3FEGA 1Y57A 2Z7LA 4O0RA 5IQHA 2WQOA 4WUAA 2Y0AA 3HX4A 4G1WA 4C02A 1B39A 4NM5A 3PUPA 5IH6A 3P4KA 1LPUA 2C6EA 3QCQA 5B2LA 3MY1A 3PXZA 2E9OA 1ZLTA 4FOCA 1RQQA 4OT5A 5FG8A 5FP6A 2BHEA 2QOHA 1YW2A 4U79A 3BU5A 1ZMUA 2R3MA 5CI7A 5L2TA 4JDJA 3HVCA 4B7TA 4FT3A 1R39A 1M52A 3QZGA 5EYCA 2R9SA 1Y91A 5FEDA 4EEVA 1ND4A 4FTNA 4GIHA 4X2FA 4MD8E 5IQFA 4XOYA 4BY9E 4F1TA 2RFNA 3RK9A 4QMSA 5IEXA 2PZRA 3BU3A 4F09A 2WTDA 3O8UA 4H39A 2J5FA 1CKJA 3AMAA 2C1BA 2CNVA 2R3PA 3NUNA 4TW9A 2VO7A 3PY0A 3LMIA 5EDQA 2BFXA 1ZYCA 3QTWA 5DR2A 1IEPA 4ZLYA 1Q8ZA 4JQEA 5CF4A 2R3KA 4NWMA 4U6RA 2O0UA 2FSLX 4EK8A 3ORNA 2UZBA 4GV1A 3DA6A 4N6ZA 4M12A 2YISA 3MS9A 3VS0A 1YWNA 3MVLA 4DGMA 3VO3A 2C6DA 2JDOA 3ZTXA 4GK4A 5HG5A 3C50A 3F2AA 3A8XA 4GS6A 2Z2WA 3MIAA 3EQCA 4EHZA 4D1ZA 3ZSHA 3D5VA 3IG7A 5E92A 2ACXA 2PUUA 3E87A 5E8SA 1H25A 2YAAA 4ID7A 4X3FC 5F95A 2JDRA 4BTMA 4L6QA 4CYJA 4EH4A 4EK6A 4ZEGA 2PULA 4PV0A 3CP9A 3WF5A 4C36A 1R0PA 1U5RA 4D2PA 2W1IA 4EQMA 4WRGA 4IVBA 4ZZOA 5BVFA 4YR8A 2CPKE 4I20A 4U0IA 3I4BA 2UZWE 3E8NA 3AD5A 5LVNA 4KIKA 1GAGA 4JBQA 4E5BA 3AQVA 1CDKA 3WE8A 4BI1A 3C4WA 4B9DA 4GT3A 4CVAA 2JAVA 2O8YA 4GJ2A 4BCPA 1BLXA 3LFBA 3ZM4A 3AC5A 5AIKA 4YJRA 4F6WA 4IDTA 2C0IA 3PIZA 4G3DA 4YMJA 3SA0A 2XS0A 1XH7A 2R7BA 5LVPA 4C33A 1Q41A 1PF8A 1JSVA 4N70A 5CQUA 4WA9A 1H08A 4NYEA 4QTDA 3BZ3A 5EHLA 2OJFE 3VULA 2WPAA 3GCUA 5HKMA 5JQ5A 2PUPA 3ELJA 5KMOA 2VO0A 1ZAOA 4QMTA 3ULZA 3GT8A 4OT6A 1YOMA 4BCKA 5EW3A 3BELA 4RA4A 3G90X 4XJ0A 4FNXA 2ZMDA 2YCRA 2GSFA 3THBA 5KBQA 5LARA 2KULA 5GJFA 3VF9A 5M57A 5CALA 1K3AA 4KINA 1L3RE 2YLEA 3HZTA 5F20A 3QKMA 4FSTA 4PX6A 3R8PA 1W98A 4BN1A 4ANSA 4BI2A 4RFZA 3CBLA 2ERZE 2C6KA 3GXLA 3PJCA 4O0UA 4RIWA 5EOBA 4QP6A 2B0QA 3PVGA 4R6VA 3G0EA 4RC4A 4QRCA 4FIJA 5L8JA 1FOTA 4F9CA 3NCZA 1K9AA 2B55A 2QOFA 3PYYA 4YJTA 3W55A 3RPOA 5KMIA 3UP7A 1VZOA 3AC1A 2R3QA 4OTIA 4A9TA 2YDJA 5C8MA 2UUEA 2XMYA 1TVOA 3FPQA 5B0XA 3EQHA 4AE9A 5HVKA 4JRNA 4PTEA 3GB2A 5DVRA 3E8CA 5M4UA 3I5ZA 3EKKA 4C59A 3ERKA 4ZZNA 2CMWA 2WMRA 3C4CA 4WNMA 3Q5IA 4YJSA 3DK6A 3EQBA 3PJ8A 4G9RA 5I9ZA 2P55A 3EWHA 4J71A 5CNOA 2IVUA 3F69A 3IOKA 1JAMA 3MPTA 3UVPA 4BHNA 4IDVA 3L1SA 4FGRA 4AZVA 2VTMA 3O7LB 4KSQA 5AX9A 1Q62A 4I21A 4LFIA 3T9TA 3H30A 1G8SA 1LUFA 2ITNA 5K4IA 1OUKA 1VEBA 4I24A 2V7AA 3NW6A 4WG4A 1IRKA 3SRVA 4W4XA 4UB7A 5EK7A 3QTSA 4O91A 3EN9A 5E8ZA 4ZMFA 3LFDA 4KBKA 2VWUA 3I7BA 1ZYJA 2VTTA 4FV3A 3VRZA 2ZV7A 4DEDA 4UWYA 1UA2A 4QP9A 4AWIA 4LYNA 3QF9A 3FZTA 4GG5A 4DGOA 4LL5A 2R2PA 4O0WA 4MBJA 4TN6A 3COMA 2PVLA 2UW6A 2V22A 5BMMA 3R1SA 5KHXA 3P0MA 2B1PA 4OAUC 4G34A 4FSQA 2E9VA 2YM5A 4IWOA 3ITZA 4U7ZA 5JSMA 4DFBA 2J90A 5EDPA 3NMUF 3BYOA 3PPZA 5T3QA 4DG0E 3IKAA 5TKDA 5CEKA 5C1QB 4XX9A 1OL5A 1WFCA 3PE1A 4FTUA 3IDBA 2GS7A 2YWPA 5E8VA 4XV9A 2ONLC 4TYIA 3LCKA 3U9NA 2IW8A 4AA4A 5EM6A 2GQGA 4RIOA 2ITQA 3BBTB 3HP2A 4AA0A 2JEDA 4RQKA 4IAZA 2VTLA 4RGJA 3G6HA 2CN8A 2R0UA 2VGPA 2XYUA 3DB6A 3GUBA 4AA5A 1S9JA 4ZJIA 4O6LA 1J7UA 2HW7A 4CYIA 3TV7A 1QPDA 1E1XA 5FBOA 2OFVA 4B8MA 2QO2A 3QYWA 4CFUA 3LQ5A 5HU3A 2OKRA 3WARA 3IW6A 3S4QA 4LRKA 3CE3A 4TRLA 2PK9A 3RI1A 4AAAA 4MHAA 5KKRB 4E6QA 5FBNC 2ZJWA 4LV8A 4EJ7A 1E1VA 2JC6A 3HUBA 2WEVA 4MXYA 3AC2A 3B2WA 3OW4A 3WF7A 4EK3A 5EHYA 4IX4A 4F0GA 1TQMA 2W1EA 2JIUA 4IM0A 2VWZA 1CMKE 1WBPA 4FKWA 5J79A 4D9UA 1Q3DA 5HX6A 1QCFA 5D41A 1PY5A 3F66A 4QP3A 5BVDA 2GTMA 3E8EA 4QP1A 3Q52A 5HESA 3ET7A 3ACJA 4RIYB 3WYYA 4RIXB 4FIHA 5HG8A 4EC9A 2J0MB 4FR4A 1WZYA 4U42A 1WAKA 5HE0A 3QQLA 3DJ6A 4ZTSA 3UQCA 3OWPA 5IQDA 4I0RA 4I1ZA 2FSMX 2W1DA 5H8EA 3D94A 3QCSA 4ERKA 5L2WA 2C6MA 4HVGA 3E3PA 3R28A 4I0SA 4GG7A 2YFXA 2BDJA 1Q97A 2ESMA 3PSBA 4GRBA 3RPRA 2HZ0A 4R78A 5K4JA 1BKXA 1WMKA 2B9JA 2GHLA 3R8UA 4FT0A 2C5VA 3FMHA 5FD2A 3UJGA 2A1AB 2LAVA 5AR7A 1YI4A 2WFYA 3KL8A 5JZNA 4WO5A 1QMZA 4JS8A 3KY2A 1DS5A 3UNJA 4UALA 3UO6A 4MVFA 3POZA 2VTRA 3LFFA 3UC4A 2Y7JA 5AA9A 5DRDA 4Q9SA 3OXIA 3CD8A 3ZFMA 3FLQA 3TZ9A 1ZXEA 3UP2A 3UMWA 4MXZA 5HZNA 3F2NA 4AU8A 4DEBA 5AUTA 4RWIA 4BDKA 4F0FA 3VN9A 4ZY6A 2HZNA 2UW3A 3NIZA 4ANMA 3SX9A 3TV4A 1SVGA 3FMKA 5GZAA 5IA2A 1FVRA 4GYIA 3SGCA 1UWJA 4EHGA 2CNQA 3ALOA 1MQBA 4BDDA 5J9ZA 3EIDA 4AACA 4YSJA 3UG1A 3DV3A 3K3IA 3QD4A 4NSTA 1ZARA 1YDRE 3VVHA 5I0BA 4J53A 1OKYA 3LE6A 1V0OA 3HLLA 5HEZA 3DZOA 3H9RA 4S32A 3VW6A 4QQ5A 3T3VA 4A4LA 1HCKA 3HV3A 4KKGA 4C4FA 4GVAA 5CU0A 3FYJX 4NKSA 4QMNA 3AT3A 3BHVA 3R8LA 2GDOA 3TNPC 4NK9A 5DI1A 3NCGA 5A54A 2XNNA 3ZSIA 4CG9A 3BEGA 3FJQE 5CEOA 5IH5A 3NYNA 3PA5A 4ZJVA 4TNBA 2PYWA 4YZNA 4RX7A 4BKYA 4EOSA 5IZFA 4BFMA 5H2UA 4FV0A 3Q4ZA 3IECA 4O0TA 2IWIA 3FMEA 5K0KA 4AS0A 5EYDA 3F5GA 4FI1A 4FKLA 2F49A 4O6EA 4EBWA 2BKKA 1KSWA 2ITYA 1OL6A 3D15A 3MGYA 3QBNA 2C3KA 2RG6A 2PZ5A 5ICPA 1H0WA 2QODA 4N0SA 4QTAA 5HO8A 2J9MA 5KNJA 2H8HA 3R8MA 4FEWA 3HV6A 4XH6A 2BZJA 5AP1A 2ZM4A 2EVAA 5G1XA 4LUDA 3KKVA 4V0GA 1YDSE 2XK4A 4G3EA 4CZUA 2JIIA 3LM5A 4TYJA 3DOGA 4HGSA 1BL6A 3IQ7A 5BVOA 1YQJA 2HENA 4QNYA 5FTGA 4H1MA 3PSDA 3UVQA 5HQ0A 1REJA 4NIFB 4ZSJA 5E91A 4HYSA 4USFA 1YWRA 4KB8A 4LMUA 4XV3A 5HE3A 3WF8A 1Z9XA 5IISA 3F61A 4UBAA 4B6LA 2PUIA 3ZDUA 4CNHA 2KTYA 4K11A 5J9YA 4EORA 3CTHA 3QZIA 4G16A 2C5YA 3R21A 2F7EE 1MRUA 3OCGA 3AC3A 3TKUA 5ACBC 1QL6A 3T8OA 4DEGA 4ASDA 4E5WA 2QC6A 1G5SA 3PSCA 3NS9A 4MAOA 2P2IA 3LFEA 5IQEA 2W5BA 5J5SA 2BFYA 5LXMA 1U54B 1JLUE 2WMVA 4ANLA 4RJ5A 5BYLA 2XNMA 4BWPA 2YACA 5GHVA 4BR3A 1X8BA 4MD7E 4F6SA 5EHOA 2VTNA 3CY2A 5EKNA 3SKCA 4C35A 4IVDA 5BX0A 1PKGA 2CSNA 4J97A 3C4EA 2VX0A 4OBOA 4O2PA 4OTRA 2BRHA 1F3MC 3MH2A 4EI4A 1VR2A 3UMXA 1OGUA 3PXFA 5CU2A 4DEEA 4FIEA 3A7IA 3QA0A 1WBSA 5DWRA 4ASZA 2HY0A 3ALNA 1UNGA 4R3RA 1URCA 3MVJA 4L42A 4QMZA 4S33A 3IDCA 3D2KA 4XG4A 4FZDB 3OEFX 3HV7A 4FG7A 4FNZA 5ETFA 2R4BA 4MCVA 3RPSA 2A0CX 2VN9A 3Q9XA 4ACCA 2BPMA 2J6MA 3NNXA 4ONAA 2C5OA 3SVVA 5M06A 3NUPA 4EH2A 4GL9A 4QNAA 3UVRA 2GFSA 3G15A 5M51A 3DU8A 4L9IA 4E4NA 4FA2A 4CT2A 3R02A 1CTPE 3IPHA 3PG1A 5HLWA 3R7OA 3SXRA 2YM8A 1BI8A 4GFMA 3RNIA 4AT5A 1OIQA 5HE2A 3OEZA 2WIPA 1V1KA 3R6XA 5LQFA 4ZZMA 3R8ZA 3VS7A 4KS8A 2EXCX 3W18A 3KXMA 4I23A 5CAPA 2ZV2A 2O63A 3FYKX 3KF7A 5FRIA 2CCIA 1M7NA 3OOMA 4D5KA 4JQ8A 4H58A 4YC8A 2ZM3A 3VUIA 4UMQA 4O84A 2J4ZA 3EYGA 4U81A 3V3VA 4BWKA 2UVZA 1H4LA 2G1TA 2JKKA 5AAEA 4V01A 4FV1A 1OIYA 3DLZA 1JKTA 3QGYA 3A7HA 3IW4A 3RM7A 2PVKA 5L2IA 4FEXA 4R7BA 4F9WA 3BHUA 3HL7A 4FUYA 1ATPE 3TNIA 5HD4A 3VS1A 3OW3A 2B9IA 3R7UA 3B2TA 4NH1A 4Z9LA 1YKRA 4QPSA 1V0BA 2AUHA 3PJ2A 4I92A 1V0PA 5LCKA 3VBWA 1BI7A 4ALWA 3KGAA 4TY1A 3VUMA 5CX9A 2WMXA 4E7WA 4XG3A 3QXOA 3LCDA 3VBYA 3ZLSA 2VWVA 4R5SA 4F9AA 2W06A 3R01A 4IZYA 3VS4A 1MQ4A 4J52A 4HYIA 5DEWA 4DN5A 4IAAA 3TUCA 4O7LA 2J0KA 1M7QA 4QMXA 4XBRA 4XBUA 5HORA 2IG7A 4NL0A 4P5QA 1UU8A 4C3FA 3CPBA 2R3RA 5CVFA 4BRXA 2XIZA 4GU6A 1OVEA 5DFPA 4FSWA 2X6DA 3FLWA 3ZLXA 2WQEA 4YPSA 4PDPA 1JBPE 4RMZA 4DINA 5AAGA 3DK7A 2YCSA 2F57A 3JS2A 4AOTA 3MJ1A 3OXZA 2IZTA 5BVNA 4ZTNA 1YI3A 3C4ZA 4KUJA 1WBNA 1WBWA 2C0OA 3FMJA 3ORXA 4QP7A 4S2ZA 4BICA 2JFLA 2WZJA 3NNUA 4MK0A 2OH4A 2VUWA 3TKHA 2PVFA 4IWPA 2BDWA 4PPBA 4QQTA 4N57A 5IQBA 4EZ3A 4RX5A 3V5LA 4K6ZA 4CV8A 3UYTA 4CGAA 3LXKA 5AR2A 3DQXA 2J50A 4OBQA 2ITOA 3QZFA 3TDWA 2YIWA 3IOPA 4FTKA 4QTBA 4M13A 1WCCA 3HUCA 4YGAA 4H05A 2X8EA 3CTQA 5KZIA 1CKPA 4C7TA 2BHHA 5D10A 3CEKA 4AZSA 4JL9A 3WZUA 1Q99A 3VNTA 5CI6A 4L44A 3EYHA 4FV6A 3DLSA 3UGCA 2BZHB 5AM6A 4EOIA 3RVGA 4F9YA 5DLSA 1J1CA 2F2CB 4FNWA 2X7FA 5CF5A 5CXZA 1UNHA 4ACMA 4DEIA 4JAIA 3ZUUA 3MH3A 4IQ6A 4H1JA 5HNGA 3LMGA 4JX3A 3MN3A 2WXVA 4X3FA 3FC1X 5H8BA 4DBNA 1IASA 1JSTA 4IW0A 2QOCA 4EC8A 4Q9ZA 3DXNA 2X7GA 5DG5A 2C47A 4O7RA 4BGHA 4KSPA 4KNBA 4TZRA 2YCQA 2GCDA 4YTCA 4BCMA 5E9EA 3MY0A 3GP0A 3E93A 5DGZA 4BGQA 4DT8A 4FV9A 4NTTA 2QKWB 2RG5A 2QO7A 3O51A 2RGPA 1CSNA 4XV1A 1QPJA 3Q4TA 1YOJA 3LXPA 3R7EA 3U55A 5DE2A 4IC7A 2GNFA 2R3FA 5AIRA 4ZY4A 4DF3A 4FZFB 2Y8OA 3NUYA 2XK7A 3F3UA 3FAAA 4FL2A 4FZAB 3W1FA 4MQ1A 2UW7A 4KABA 4GK2A 4PP7A 3W32A 3SXFA 4EWQA 4LG4A 3KA0A 2QU6A 4U44A 5HLPA 5C4KA 3O0GA 5EM7A 5H9BA 4UWBA 4TWOA 4BTFA 5HX8A 4QMWA 1JQHA 3C5UA 1R3CA 4M66A 2ITVA 4PPCA 4W9WA 3PWDA 4IADA 3ENMA 4F6UA 2VTQA 5C9CA 4AGUA 3UZRA 4DAWA 3QTUA 3A60A 3QA8A 4KIPA 3O17A 4JJRA 3MFSA 2UZLA 3D4QA 3QU0A 4OBPA 4GIIA 4HNIA 3VHEA 1WVWA 4ANOA 2X7OA 3OD6X 3W2QA 5A46A 2X8DA 3VS6A 1A48A 2EU9A 1GIJA 3IGOA 3NNWA 4DT9A 2F2UA 4TYHB 4C3PA 3TM0A 4HCVA 3O2MA 2OXYA 2GU8A 4JQ7A 1RW8A 2UZDA 3ZUTA 4UY9A 4X6RA 4C34A 5E8XA 4JXFA 5I9WA 2YJRA 4TTHB 1FVVA 4PL4A 3O7LD 2OO8X 3BYUA 4RVMA 4DTAA 4F1OA 1DI9A 4ITHA 3ZXTA 4PL5A 1PYXA 4MBIA 3UO4A 5HVJA 3OY3A 3VWAA 3TI1A 1XO2B 3A4OX 1YOLA 3F5XA 3HDMA 1UKIA 4ZOGA 3R7YA 4AUAA 4B4LA 4LGDA 3TT0A 3QALE 4IAFA 4J8NA 3H4JA 3HMPA 3POOA 5DMZA 5I3RA 1KE7A 4I4EA 4Y46A 3PTGA 3R9HA 4L53A 3MDYA 4WKQA 4TL0A 4O7WA 5CWZA 4BDAA 3C4XA 3V04A 4LRJA 3O8TA 2BRNA 2QR7A 4K8AA 4KWPA 5IA5A 4AFEA 4ANNA 2I0VA 2UW8A 5HO6A 1SM2A 3EFJA 4QOXA 3UQGA 4X2KA 5T6KA 4YPDA 5K5XA 1GZOA 4O2ZA 2BRBA 5EFQA 2R3IA 1NA7A 1H8FA 2C3LA 2QKRA 3LLTA 5HI2A 5EI8A 4FTLA 3OP5A 3QC9A 4Y85A 2VAGA 3QXPA 3QCYA 3GQIA 4IWQA 4YJUA 2OZAA 2AC3A 2NRYA 2UZEA 5GINE 2GTNA 4AGCA 4FTMA 3BLQA 5HNIX 4Z3VA 4NJDA 3N4VA 5IUGA 3W33A 1J3HA 2J0JA 3QAME 2ONLA 4G6LA 2CLXA 2JKOA 3PJ1A 3M42A 4JIKA 5EKOA 3OUKA 4L7SA 2BVAA 4CFNA 2QG5A 4ZMEA 2YM6A 4YUQA 2R0IA 2P4IA 2QVSE 1YXUA 1O6KA 2CGWA 3F5PA 1YXVA 4UWCA 5GNKA 3RALA 4DH1A 4D1SA 3QYZA 5AX3A 3D9VA 2NNWB 1PMNA 1KE9A 3CTJA 3PWYA 3R73A 4FSMA 3RCJA 2CNUA 1OITA 4A9UA 4RLLA 4U45A 2HZ4A 4FKPA 4G3FA 2ZAZA 3C5IA 3BRBA 2C3IB 3BKBA 3R83A 3Q4CA 2DQ7X 3HP5A 3KCKA 4MXCA 5CVGA 5IQGA 4B0GA 1O9UA 1JKLA 3VS3A 5HCXA 1REKA 1XH5A 3DKCA 3P1AA 4RFMA 3VIDA 4NEUA 4DH7A 5LVLA 3F3WA 4C4IA 3GU6A 3BGQA 2YIRA 5CEIA 5FEEA 4HW7A 1GZ8A 4HYUA 1BYGA 5CENA 4XLVA 3PZHA 3NW5A 3ZSGA 4HPTE 4EK4A 1Q4LA 4ZTLA 5KCVA 5CSPA 3KC3A 2YM7A 5HCZA 3LFSA 3A8WA 5TE0A 5A9UA 4GKHA 3TACA 4F7LA 5LMBA 4LUEA 5A6NA 4UXLA 2OGVA 3C13A 2CKEA 4XHKB 4F7NA 4HZSA 2Z02A 2QQ7A 3DJ7A 5EQPA 2QOKA 3DFCB 3K5VA 3QZHA 3FSKA 5C03A 3E92A 3R7VA 3D7TA 3WBLA 2I0HA 4AZEA 2YCFA 4EH7A 1P2AA 5ANIA 2F7ZE 4FTAA 4YJOA 5AMNA 5JH6A 2JIVA 4E6CA 1Q5KA 4K1BA 1TQIA 3KU2A 4FTTA 4CMUA 2FB8A 4ZSEA 5D7AA 4CFMA 1Q3WA 3QRJA 2EB3A 4ANQA 3V6RA 4AOJA 3LMHA 4MQ2A 5EM5A 1RDQE 3HMIA 1Y8YA 4XYFA 4WT6A 3L8XA 2HW6A 5L4QA 4FV5A 4CD0A
chains in the Genus database with same CATH superfamily
3FZSA 4ARKA 4X21A 4U80A 4G31A 4RFYA 4CKJA 5H8GA 5J7HA 1W8CA 2QOBA 4HVHA 5LMKA 4RLKA 4CMOA 1Q8WA 4CFXA 4QDEA 2VO6A 4QTEA 4FGBA 1YHVA 3BI6A 3ACKA 3E8DA 3P23A 4G17A 5FTQA 2OH0E 3TEIA 3VJNA 2GQRA 4ZK5A 3EMGA 3RM6A 3ATSA 2QI8A 3EFLA 2CKQA 3N4TA 3Q3BA 3CKWA 3A7FA 3NVKI 4H36A 3RAKA 3TDVA 2J2IB 4DLJA 3QUPA 5IMEA 4IZ7A 4U9AA 3V8TA 5CAVA 4DFUA 3VJOA 4JBOA 3CPCA 4I6QA 4IE9A 4XG2A 4CEGA 3KB7A 4YJVA 1WVXA 1W7HA 2CGXA 3NSZA 5CT7A 2VU3A 2QO9A 2HWOA 3AXWA 3G6GA 4XV2A 5JQ8A 1JKSA 2C5NA 4P7EA 5KKRC 4ITJA 2Y6OA 3K2LA 4FG8A 3UIMA 4EBVA 4UN0C 5AUXA 4NFMA 4K9YA 4ZSAA 3P78A 4IM2A 4GW8A 5CXHA 4UV0A 4QYEA 3BWJA 5KO1A 4JX7A 4L7FA 3HGKA 2OZOA 3DAJA 5A6OA 3QRKA 1M2QA 5CY3A 5CYIA 3TTIA 5EYKA 3ZZEA 3I6WA 1O6YA 3AD4A 2CGVA 3R30A 3VRYA 3NDMA 3PXYA 4N6YA 4PF4A 4U8ZA 3U4WA 3FI2A 3C1XA 3MVMA 3DY7A 5BUEA 5ANOA 3S2PA 5AUVA 4RT7A 4L52A 4AW1A 5B7VA 2XK9A 3SLSA 2HCKA 1LEWA 3KRJA 5LVOA 3T3UA 2F4JA 4FVPA 3C7QA 5JGAA 2VWXA 2C1AA 2YDKA 4JDHA 4QYFA 4W4WA 1TQPA 5T68A 4AN9A 5C01A 3G51A 3MIYA 2Q83A 3R9RA 2B52A 4FMQA 5JN2A 5L2QA 3LW0A 3LHJA 4YO4A 4ZSLA 1OL7A 2RFEA 3DBDA 5ANKA 2HELA 3HDNA 3NNVA 5JEBA 4FT9A 3ANQA 2CKPA 4GKIA 2OIQA 4JG8A 4YZBA 4AZTA 2ZDUA 3Q6WA 4CTCA 1U59A 3UYSA 2WTIA 4A4XA 3ETAA 5AV0A 1M14A 1H01A 2NPQA 3UIXA 3QQFA 4QP8A 4ASXA 3GCPA 4XMOA 4FKUA 4KA3A 4YTFA 4B99A 4Q2AA 3RHXA 2XYNA 3R7IA 4FYOA 3VBXA 3AMYA 4X6QC 5D12A 4U43A 4YU2A 2IN6A 3R00A 3R1NA 5IA3A 2CHLA 4GK3A 2CGUA 3BQRA 4LQMA 2BALA 4MNEA 5DEYA 3UNZA 3UZTA 5GIPE 3QTZA 4U5JA 5L6WL 4ZJJA 4YNOA 2BILB 2B4SB 3PG3A 4OW8A 3CQWA 5CZIA 4ZSGA 3JY0A 5E1EA 3GU5A 4BCFA 3CLYA 3FPMA 4F9BA 4O0VA 3PUFC 3SV0A 2WU7A 1JNKA 3NYOA 5IKWA 2IJMA 2VX1A 4EOQA 3ATTA 1XH6A 3ZXZA 1SNUA 3BEAA 2WMUA 3VUTA 5IQAA 4RQVA 4E5AX 4E8AA 3OCSA 3LJ2A 4BDIA 2XNOA 4D4VA 4ACGA 3V5WA 4AW5A 4RX9A 2WMSA 2Z8CA 1U4DA 3BE2A 3PPKA 5I3OA 4CLIA 4RJ7A 3Q9ZA 4G5PA 4CT1A 3HAMA 4FEUA 4Q5EA 4YJNA 5A4LA 3BV3A 4OR5A 2W1CA 3DBFA 2VTHA 1OMWA 2JKQA 4MXOA 4EOJA 3O23A 4EH9A 4GYGA 3FZRA 4IANA 3DXPA 3TNWA 4BDBA 5LVMA 2OXDA 3ZLYA 3W2SA 3TUDA 3NVMB 3U6JA 3KQ7A 4FSUA 3ZONA 4M8TA 1XHAA 2A2AA 2JGZA 5CSVA 4QMLA 4RWLA 5DR9A 3DT1A 4NM7A 2ITUA 2XANA 4XRJA 1TFFA 1H27A 3MB6A 5IA0A 2XRUA 4MD9E 2B9FA 1WBTA 2V5QA 3BL7A 4ENYA 5ETCA 3C0HA 4C57A 1MRYA 3D0EA 4NT4A 4EUUA 1H24A 4MKCA 4U3ZA 5CS6A 3ZO1A 2W17A 5F9EA 4OTPA 3LFNA 2YN8A 3PA4A 3F3VA 3ZOSA 5IDPA 5JFSA 2OJIA 2CLQA 2RIOA 1PXKA 5CSWA 2PY3A 3OWJA 4HGLA 4FTJA 5EDRA 4PMMA 2ETMA 1T45A 2P33A 4M68A 3L8SA 3WOWA 2X39A 5HICA 1PXPA 2AC5A 3KVWA 3TWJA 4J7BA 2RF9A 3R1YA 4FKRA 1XBCA 5E1SA 2WEIA 3FQSA 5FWKK 4QT1A 1Z57A 3F7WA 1UU3A 5KMLA 3FUPA 4Z55A 4EK5A 1K2PA 5JZJA 2O64A 4LV5A 1M17A 5BYZA 5HLNA 2NRUA 3PA3A 2O5KA 4CMTA 3CCNA 4IZ5A 4F1MA 5IUHA 2WO6A 5KBRA 1IAHA 5FDPA 3UOLA 3ZH8A 5I9YA 1MRVA 3MY5A 5ITAA 4DDIA 2NO3A 4MBLA 3GC0A 3ZCLA 3AKJA 3MSSA 4PNKA 1MP8A 4AFJA 3CKXA 3ODYX 4ENXA 5K3YA 2WTKB 2RFDA 3EN7A 5E8YA 2PTKA 1SMHA 4J8MA 4YJPA 2PUNA 5JGDA 2PHKA 5HCYA 4AT3A 1JPAA 2BIYA 4RRVA 5CU3A 5CF6A 1SVEA 2W99B 4FUXA 2B53A 4K77A 3U54A 3FXWA 1IAJA 2CN5A 2X6EA 4KIKB 3NW7A 3TIYA 3QD3A 4P5ZA 3GC7A 5AAFA 4BL1A 3MBLA 4QMYA 2E9NA 4BCNA 2VTIA 3EB0A 4L67A 3LLAA 4ORKA 2XRWA 1NVQA 3L8VA 4K33A 2XIRA 3GC9A 5C27A 1B38A 3MJ2A 5HHWA 3KULA 3MI9A 4KBCA 4M67A 2GHMA 3CQEA 3Q9WA 2VTPA 2Y6MA 4YSMA 4AXEA 4FKQA 4IEBA 5DR6A 2Y9QA 4U40A 3IS5A 1FMKA 1OIUA 4IACA 4ALUA 2ZFYA 5AR3A 2X2LA 4PUZA 4WG5A 4DHFA 4F7JA 3AKKA 4AE6A 4XP0A 2QOIA 2WQBA 3D5XA 3PVWA 4RWKA 1F5QA 2IZRA 3V5JA 3W8LA 4QQJA 2HZIA 3G5DA 4NW5A 5L6PA 4QYGA 4ZLOA 4YHTA 4DH8A 4ZY5A 4APPA 2ZV9A 2VWWA 2XNGA 2UVYA 4ZLZA 3EQRA 5TR6A 4RC3A 4RIWB 2OF4A 4MTAA 5HG9A 1MUOA 3UOKA 2XZSA 3OCTA 5HIEA 3QKLA 3H9OA 4GU9A 1OL1A 5DT3A 3AC4A 3MW1A 4I5MA 4O7YA 4MH7A 3F9NA 5JMSA 3BHTA 5LWNA 1P4FA 2Z7SA 4AGWA 5KMMA 3W0NA 2YABA 4C2VA 4JDIA 2XJ0A 2HXQA 3OT8A 2QU5A 4XS2A 4Z7GA 2XA4A 5FXRA 4YZMA 4EOKA 3CGOA 4L45A 3QCXA 4USDA 3U6IA 4JVGA 5HD7A 4O7ZA 2GQSA 2W1FA 2PVNA 2UW4A 1SNXA 4Y8DA 3TIZA 2G2FA 1XH9A 4KIQA 1YWVA 1SYKA 4O7VA 3F3ZA 1W0XC 3LIJA 3VW8A 2C6IA 2QD9A 5EYMA 4ALVA 3OBGA 3LM0A 2C68A 5FM2A 4O4FA 2OSCA 5FXSA 3AKLA 5F1ZA 1BL7A 2B9HA 4C58A 4CSVA 3MFRA 3SRVB 3QRTA 3DBCA 4YLLA 2W5HA 3W8QA 5M4IA 3PP1A 3W2PA 3MPAA 5AADA 1NW1A 1ST0A 3FXXA 2JLDA 4IWDA 2DUVA 5AUWA 4R5YA 4LOQA 2DYLA 4ZXTA 5BUJA 3FXZA 4W4VA 1OBDA 3AT2A 3QWJA 3FSFA 3QHRA 4D2VA 2WTJA 4MXAA 2X1NA 3FI4A 3BBWA 4FE2A 5LJJA 3VQUA 4BC6A 5IPJA 4M84A 4ZTQA 4TPTA 4BKJA 1UV5A 3HMMA 4GCJA 3R9OA 5C8KA 2QG7A 1UU9A 3EQFA 3OFMA 3E7OA 3A2CA 2PMIA 4G9CA 3U8WA 5CAOA 3HRBA 5JK3A 1PMVA 2EUFB 4JI9A 4DFNA 2VO3A 2BIKB 2HIWA 4F7SA 4EH3A 4R7IA 3GU8A 4CFFA 3MFUA 3HRFA 4FVRA 4E1ZA 3K54A 1VYZA 3I81A 1YVJA 4JDKA 5E7RA 2XM9A 3RHKA 3ODZX 1H1QA 1OPLA 4M97A 2C30A 2H9VA 4C4GA 5A14A 1WBVA 4EOLA 3V8SA 4TXCA 4XG7A 5DN3A 5IF1A 3O8PA 4IZAA 1XQZA 3OF0A 3H9FA 1ZOHA 2OJJA 3PZEA 4IB0A 3S3IA 3AGMA 5AP7A 3LXLA 1H1PA 4NZWB 1BUHA 4OTWA 2OFUA 1OIRA 4I3ZA 1RE8A 4DEHA 3EOCA 3IGGA 3LFCA 5FGKA 4D4YA 2GNLA 4MNFA 3FWQA 2BTRA 3RGFA 3QLFA 3JUHA 4DC2A 4UXQA 1DI8A 2RKUA 4RVLA 3V6SA 1OL2A 3G2FA 4BBEA 1OKWA 3RTPA 3ZLWA 4DTKA 2SRCA 3EL7A 4QMPA 2JAMA 3MYGA 1H00A 4F0IA 3RPVA 1APME 2QURA 4U97A 4W8DA 5EH0A 3BLHA 3BV2A 4C4JA 2PE1A 1OPKA 5EQEA 2H96A 4GVJA 3BL9A 4MWIA 3V51A 2A19B 3PVBA 1ERKA 3R0TA 5FQDC 4EOOA 2BRMA 3ZYAA 5HIDA 2ZDTA 1VYWA 2X9FA 5AUZA 5HIBA 5E90A 5G6VA 4CFVA 3D83A 3GOKA 3R63A 3OTUA 5EOLA 3TZ8A 3PLAE 1ST4A 4GJ3A 1H07A 3NRMA 4AZWA 5I9VA 1PHKA 1DM2A 3QHWA 1VJYA 3Q5ZA 4YHFA 2FA2A 3IW7A 2I1MA 2I0EA 3P7BA 3MTFA 5FXQA 4OTQA 2XH5A 4RSSA 4BBMA 1RJBA 3KXHA 4EZ5A 4FKTA 3ZO3A 2JKMA 4ERWA 2JITA 3UOHA 2ETRA 1J1BA 4MF0A 2UZNA 3NLBA 4GEOA 5IH4A 3TKIA 1ZRZA 3AMBA 1ZOEA 3QRUA 4WNKA 4L3JA 4LDTA 1L8TA 3TL8A 3CJGA 4EONA 5HE1A 4F65A 4G6OA 4D58A 4A9SA 4W8EA 3KREA 3S1HA 3RBWA 2FSOX 3E63A 1W83A 5JT2A 3E88A 4EOMA 4BTKA 3B8QA 4FKVA 4BB4A 2YZLA 4L43A 3AGLA 4PRJA 3BGPA 1PXLA 4R1VA 5DIAA 3LQ3A 4ACDA 5KMNA 3EZRA 5ANGA 1OKVA 5TT7A 3ZU7A 5AP4A 3SC1A 5J87A 4GH2A 5GZ8A 3FL5A 3GI3A 3OTVA 3WYXA 4DLIA 3M2WA 4L01A 4EKLA 3D5UA 1H28A 3DBQA 1YXXA 1Z5MA 4RJ4A 5DPVA 5J1WA 3DCVA 3GU7A 4TNDA 2ITTA 2W96B 4MXXA 5JGBA 3PIXA 2F7XE 3VUKA 4M69A 3EFKA 4YC3A 2W1ZA 2JDTA 4OAVB 1T46A 1URWA 1YHWA 4N4SA 5KX8A 2HAKA 5C26A 3COKA 1KE5A 4WSQA 5K5NA 4IAIA 2QCSA 1H26A 4I5HA 3ZFYA 4Z16A 4FC0A 4R7HA 4AT4A 5CANA 3W2CA 3TUBA 4GUBA 4JBPA 4PDOA 2H6DA 3E5AA 2VTSA 4NCTC 4FVQA 5CTPA 4CKIA 5AV4A 3V01A 4DG2E 3DKOA 3KXGA 3W0QA 1R78A 2A4LA 5DYJA 1KV2A 4JG7A 4EJNA 3BYSA 1GY3A 4FIFA 4FL1A 2WIHA 2FVDA 2WB8A 3FLNC 4OLIA 4X2GA 3FI3A 2YZAA 3I60A 4RVKA 3N9XA 3HMNA 5K9IA 3F82A 4AXFA 3CIKA 3ZRLA 3QX2A 4FRFA 4GFGA 4I6HA 2I6LA 3SW4A 3U9CA 3ZBFA 4F64A 4BDGA 3LXNA 2BKZA 3FMLA 3S95A 1NT2A 4YZ9A 4R3CA 4V0GB 3VONA 5F4NA 3VBVA 4C38A 3SOCA 4QO9A 2VZ6A 1Y6BA 3HYHA 4FIGA 5HBHA 4GMYA 3FQEA 1OPJA 4CFWA 4DGNA 3C9WA 3N4UA 3QRIA 5FUTA 4JNWA 2XK6A 4KD1A 3F2RA 4AQCA 3DPKA 2XNPA 5IUIA 4PPAA 4WIHA 2V7OA 1KV1A 1U46A 2BR1A 4AOIA 4MX9A 4CKRA 4O38A 4A4OA 5JRSA 4QPMA 3ZO4A 4Y83A 3CXWA 4HOKA 2J7TA 2PE0A 2WOTA 2WMTA 3HNGA 5J7BA 1TKIA 2OU7A 4A7CA 3ZO2A 5EQYA 5I9UA 5M07A 1Q8TA 3D5WA 4FICA 5B2KA 4F70A 4J1RA 5L6OA 3FY0A 1I09A 4LM5A 3IK3A 4YZDA 3HAVA 4OTFA 5D11A 4RWJA 5KE0A 1KE6A 4FSYA 4QYHA 3TZ7A 4IFGA 3HA6A 3R04A 4Q5HA 4B8LA 3ZM9A 3RNYA 4DGGA 1XBBA 5BUIA 1JOWB 4E20A 2Z60A 3TG1A 2V62A 4O0XA 1QPEA 3C51A 1Q8YA 1UNLA 2WQNA 4O27B 1OM1A 4CXAA 4AW2A 2UW9A 3QTXA 5L8KA 4DH3A 3OOGA 4E73A 1PXMA 3DKGA 3P08A 5BVEA 4BDCA 1AQ1A 3P86A 2BZIB 2W9ZB 4IVAA 3FHIA 4RIYA 4C62A 4RIXA 1G3NA 1PXJA 4HVSA 2ZB0A 2ITPA 5IQCA 4OUCA 4ZAUA 1XMMA 5DA3A 5CNNA 2PVJA 2P3GX 4LI5A 4PP9A 3AG9A 3DBEA 3OXTA 1R0EA 3L9NA 4BCIA 4NM0A 5DHJA 3BLRA 3DAEA 4UEUA 3R22A 3R9NA 4UMRA 5A4EA 2DWBA 3MB7A 4G3CA 2HXLA 3PFQA 4NU1A 3Q53A 4FSRA 3QQJA 4ZS4A 1PYEA 4ZS0A 3R8VA 1ZYLA 4D5HA 4BZNA 2YERA 3DZQA 4D0WA 4QDVA 3G9NA 2JBPA 5KZ0A 5CVHA 3NWWA 4L8MA 3KMMA 5AR4A 4A06A 3ZRMA 3NEWA 5LOHA 1YI6A 5B2MA 2HY81 3VQHA 3KK9A 4DFXE 5CU4A 4WBBB 4ITIA 2VV9A 3LOKA 4CZTA 5IU2A 1ZYSA 3OBJA 3Q60A 2UZUE 4CRLA 1CKIA 2R3LA 4FG9A 2OWBA 3GCQA 3VBQA 3UZPA 4K18A 4KS7A 3EN4A 2Y4PA 3IDPA 2WHBA 4NFNA 3FV8A 5J8IA 1SZMA 2PSQA 5GJGA 3WI6A 3WZEA 2C4GA 2VNYA 4XG6A 2XK8A 5I9XA 1WBOA 2OIDA 4BHZA 2YIYA 4CTBA 2VTOA 2YIXA 5M55A 4JAJA 2Y4IB 2VX3A 2X4ZA 3VUGA 3RCDA 4QYYA 2HWPA 2XP2A 1XWSA 4O0SA 4M15A 1GOLA 4BZOA 3E64A 3G33A 4RG0A 3A4PA 4R3PA 3LPBA 3S0OA 2FH9A 4WBOA 4O83A 3L9PA 3H3CA 5CSHA 5AJQA 4H3BA 1GIHA 1GZNA 4LGHA 4NUSA 3A99A 3QC4A 4G5JA 4BWXA 2Q0NA 3RWQA 4D28A 3DNDA 2J0IA 2YEXA 5HVYA 4IC8A 4M0ZA 3SXSA 5IA1A 2E2BA 2R3OA 4EKKA 2BAJA 4HVDA 3P7CA 1STCE 3FMNA 2W1GA 5HG7A 5HGIA 4ACHA 2WQMA 1F0QA 2R3GA 3LCOA 5CASA 3Q2JA 5M08A 2XIYA 1J91A 5D1JA 4BYJA 3PPJA 1ZMWA 2C3JA 5ETAA 4E3CA 3HECA 1LR4A 3KN5A 4LGGA 4Y5QA 4E6DA 5KUPA 2E9PA 2C6OA 3UC3A 1BMKA 2VWBA 4EOPA 5M56A 2G01A 5CLPA 4X2NA 2G15A 4LOOA 4U41A 5HOAA 4D2WA 4E4MA 4WHZA 5BVKA 4AN2A 4XUFA 1FGKA 3UPXA 3ENHA 4RZWA 1OECA 2XEYA 2ZOQA 3EKNA 4JLCA 3ROYA 3ZRKA 4DGLC 3NUXA 3VC4A 5M4CA 4BJJA 2CJMA 3KXXA 4YTHA 3GCSA 1FVTA 3IW5A 4BDJA 3RK5A 3HA8A 2IW6A 3EZVA 5DNRA 3NPCA 4K2RA 4BDHA 5AUYA 5ANJA 3SAYA 3FLSA 3ID6C 4FV2A 4F99A 4E93A 1NVRA 4FIIA 2BUJA 5IEYA 3LJ1A 4AX8A 4IB5A 4UYNA 3ORKA 1O6LA 4I5CA 2WTVA 2GPHA 3HKOA 3B8RA 4NIFA 2PVYA 3SQQA 4AXDA 4GT4A 3BQCA 3BGZA 2WNTA 3KXNA 4HJOA 3A61A 4IX5A 4S31A 2P0CA 4U3YA 4XEYA 4BF2A 4D55A 3DJ5A 4L68A 3FC2A 4MYGA 4OTGA 2YJSA 3CJFA 4WUNA 5AV1A 1WVYA 4JOAA 5AWMA 3EQGA 3Q2MA 4FV8A 4HNFA 2BCJA 5HU9A 1Y6AA 2XKEA 4Y95A 5JRQA 1AD5A 1U5QA 3JPVA 5TOZA 3PDTA 2PVMA 4FTRA 2YIQA 4LOPA 5TF9A 4DITA 4D0XA 3UE4A 3QD0A 2WMQA 2C5XA 4Y72A 1PXNA 3UBDA 1U54A 3DGKA 5H3QA 3DKFA 3MH0A 5AEPA 4EYMA 4FEVA 3KRWA 3TNHA 1ZY4A 1OUYA 1YHSA 2C69A 3D2IA 2OXXA 3JY9A 4X3FB 3R2YA 3RWPA 1PXIA 4DFLA 4FKOA 3W0SA 3FKLA 3I6UA 2ETKA 2W4KA 3CC6A 1KOBA 3FKNA 5CT0A 4YTIA 4KKHA 3WZJA 3ZBXA 1M2RA 4M69B 3ZEPA 2XBJA 4Z7HA 4D4SA 4FEQA 3EL8A 4YURA 4FV4A 4QP4A 4IVCA 2O2UA 2XJ1A 4S30A 3F6XA 3QL8A 4X0MA 4IIRA 4CQGA 3I1AA 3LZBA 3PLSA 5KMJA 1PW2A 1PRYA 3HV4A 4QD6A 3JVRA 3FLZA 3QD2B 4KKEA 1LEZA 3F88A 3I0OA 4PMTA 4WNPA 2EXEA 3TN8A 4EH6A 2UZOA 3A7JA 3IW8A 3R9DA 3A62A 3CD3A 4JBVA 3GEQA 3QUDA 5D9HA 3R1QA 1UWHA 2UW5A 4D2TA 3OS3A 1XR1A 2HOGA 3CGFA 4E4LA 1H1WA 4I93A 4NTSA 4QMQA 4M0YA 2IEWA 1ZWSA 4HZRA 4O4DA 4UYAA 2YDIA 3QLGA 3QQKA 4G6NA 1LP4A 5DOSA 1NVSA 2QHMA 4Y5HA 3U4UA 2PMNX 3RP9A 4O1OA 3NUAA 4TYEA 1XKKA 5EW9A 3P7AA 4QMVA 1JKKA 4H3QA 3HRCA 2EXMA 2QOLA 3TNQB 1YXTA 2FO0A 2OJ9A 3KMUA 1IA9A 5M44A 2HYYA 4FT5A 3EHAA 4FK6A 4FX3A 2JBOA 1IG1A 3VAPA 4WD5A 3C4FA 4FZ6A 3VUDA 3TV6A 1XH4A 3LCSA 5C4LA 5GJDA 2ITZA 3NGAA 2VWIA 3FDNA 2ITXA 2GMXA 4YNEA 3TZMA 3VF8A 3K3JA 3LKMA 2BRGA 3OVVA 4FKSA 1PJKA 3ULIA 2IVTA 3UG2A 4J95A 4FTCA 4ANBA 2FUMA 5CAUA 4O4CA 5FTOA 1FPUA 3QWKA 3HV5A 2WTKC 4PQNA 4XG9A 5KHWA 3RINA 3Q9YA 4AGDA 2UZTA 2XK3A 2RL5A 3G0FA 4DEAA 4F78A 5LCJA 3CR0A 4FKJA 5BNJA 5J1VA 3JVSA 3T9IA 4DBXA 2X2KA 2WOUA 3MH1A 4IM3A 1PXOA 5AR5A 4WRSA 1DAYA 2ZV8A 3OWKA 4O22A 5A4QA 1YXSA 4RX8A 2E9UA 1A9UA 3HEGA 3DQWA 5EM8A 3UDSA 4O0YA 4PMSA 4FSZA 4M7IA 3U6HA 3AD6A 3A7GA 3I79A 4OTHA 2EB2A 5J9LA 2G2IA 5BV3A 3NUUA 3COIA 2J0LA 4D2RA 3RAWA 2OI4X 4PWNA 5GIOE 3GC8A 4O7TA 5CEMA 3BE9A 2PWLA 4G3GA 2OZAB 4QMOA 4CCUA 3BPRA 1DAWA 2PPQA 3RPYA 2PVHA 2XVDA 3GGFA 3LVPA 5D7VA 4DE4A 4BVUA 5KMKA 1ZY5A 4CCBA 2ERKA 2R3HA 3GFEA 4H3PA 2JFMA 4E4XA 2GNGA 3OHTA 4NKAA 3GCVA 3BIZA 3FY2A 3U51A 1KUTA 1H0VA 4F4PA 5LMKC 3RKBA 4TYGA 2R3NA 3I0QA 4QEBA 2XEZA 3PXKA 2W7XA 3KF4A 4J99A 4YBJA 3BHYA 3E7VA 2ZVAA 3FLYA 4JR7A 5DT0A 2B7AA 4OGRA 3TXOA 3NX8A 1IA8A 5AA8A 5BYYA 1Q61A 3OWLA 5BPYA 3ZEWA 5LWMA 4FZ7A 4JMQA 4M3QA 3QGWA 5JFVA 3SOAA 2PMOX 3W16A 2I0YA 4IHPA 3KK8A 1UKHA 5CZHA 4AP7A 3JXWA 5BMSA 4RC2A 2X0QA 3KVXA 5IG1A 2UV2A 4IJ9A 2OG8A 5CSXA 1YDTE 1OI9A 4C4HA 3C0IA 1JVPP 5TO8A 2UZVA 4BDEA 4FTOA 5FEQA 4AZFA 2XUUA 3W2OA 3QFVA 3COHA 3FQHA 2CDZA 1ZMVA 2QR8A 3O50A 5HO7A 1W2CA 4LL0A 4C4EA 4KIOA 1ZZLA 2XAMA 4HCUA 2Z7RA 3WIKA 2BAKA 3D7TB 3OT3A 1J7IA 4G2FA 3K5UA 4JG6A 5EI6A 3RAIA 4XCUA 4CLJA 2QNJA 3DB8A 3ZMMA 3ZC6A 3FZ1A 4BZDA 5AFVA 3OMVA 3JR1A 2G9XA 5AP6A 4O21A 4MEDA 4GSBA 1QPCA 3QX4A 2YM4A 5AR8A 1Y8GA 3FMMA 1IR3A 3LJ0A 1NY3A 2PZYA 4ASEA 3Q04A 4R8QA 3AC8A 5CQWA 4UZHA 5CEQA 5AP2A 4BGGA 4BIDA 2W4OA 2XF0A 3CY3A 3E62A 3PY1A 3R2BA 1YRPA 3DDPA 3NUSA 1I44A 5E8WA 2W9FB 3CQUA 2O3PA 5ETIA 3BWFA 3EQIA 2YWVA 4ZIMA 1ZYDA 2R7IA 3ZZWA 4DTBA 2JD5A 3WF9A 3MA3A 4BJJB 1FMOE 1OZ1A 1XJDA 3EFWA 3UQFA 3QTIA 5E4HA 3I7CA 4FSNA 4QP2A 4TWCA 4E26A 4LMNA 2CKOA 4HVIA 3KRRA 4ZTHA 4JRVA 2WGJA 3BHHA 3ORIA 4YO6A 4WSYA 4GFOA 3PIYA 4HYHA 3NAXA 4TWNA 2OIBA 1H1RA 2VGOA 4E6AA 4O7SA 4FKGA 4A9YA 3Q6UA 3ZC5A 3GQLA 3ORLA 1BX6A 3GU4A 4TYHA 4W4YA 3H0YA 5ACKA 4RJ3A 4AXAA 3VS5A 2PZPA 3QUEA 5FP5A 5M09A 4ZTMA 3KFAA 4FT7A 5AP3A 2V55A 4UMTA 2QOOA 3DTCA 3LAUA 3PP0A 1ZOGA 1UU7A 3LFQA 4O82A 3TMOA 4GUEA 4I22A 3KIOC 4RBLA 2XKDA 4I5PA 4EYJA 1GIIA 3R71A 2ZYBA 3LFAA 2YAKA 3V8WA 4D4RA 4YBKA 2I40A 2RFSA 2JDSA 1W84A 4JT3A 2WELA 2WTWA 2IF8A 2XM8A 3EH9A 4APCA 3ORMA 3FZOA 1OBGA 4XP2A 4YZCA 3VHKA 3SG8A 3ZHPC 1AGWA 2FSTX 2AQXA 2XB7A 3MVHA 3PE2A 4I0TA 4I6FA 4II5A 4QPAA 2IVSA 3PRFA 3EQDA 4PNIA 1P4OA 3M1SA 4P90A 4RPVA 3UPZA 3GFWA 3MPMA 3L8PA 4NCTA 3F7ZA 5LMAA 4IAKA 4USEA 3UDZA 1JSUA 4RJ6A 1W2DA 3L9LA 4MF1A 3S00A 1G8KA 3PVUA 2G2HA 5EG3A 5BVWA 5AP0A 2XCHA 4ZP5A 4XP3A 1FGIA 2UVXA 3FZPA 4EUTA 4PDYA 4QTCA 3V5PA 2HK5A 5A4TA 3MA6A 3WE4A 2ITWA 5IA4A 1XBAA 4EHVA 3R7GA 3DTWA 5IEVA 2EWAA 3OROA 4AXCA 2FGIA 3FL4A 3WZDA 4C8BA 4UMPA 3BYMA 3P9JA 5HTCA 4EL9A 3UIBA 3WILA 3UODA 5HBEA 4JR3A 3KRLA 2XCKA 5FLFA 1Q8UA 3RMFA 4EH5A 5K0XA 3VS2A 2W1HA 2WMWA 5ANDA 3DXQA 4TT7A 4OTDA 3PY3A 2BROA 4XNEA 5CF8A 3ROCA 3NZ0A 2WAJA 4I6BA 4YP8A 4O96A 4ZTRA 2W0JA 3BYVA 2OLCA 4I4FA 2PU8A 4FF8A 3GOPA 5C8NA 2P2HA 2BAQA 3H0ZA 4A07A 2GNJA 3OUNB 5IMXA 3BLAA 2X8IA 3OCBA 1HCLA 2C6TA 4WNOA 2QLQA 4IB1A 2QOQA 4MNEB